GenomeNet

Database: RefSeq
Entry: NC_049564
LinkDB: NC_049564
Original site: NC_049564 
LOCUS       NC_049564            5361510 bp    DNA     linear   CON 05-AUG-2020
DEFINITION  Talaromyces rugulosus chromosome IV, complete sequence.
ACCESSION   NC_049564
VERSION     NC_049564.1
DBLINK      BioProject: PRJNA645155
            BioSample: SAMN15229550
            Assembly: GCF_013368755.1
KEYWORDS    RefSeq.
SOURCE      Talaromyces rugulosus
  ORGANISM  Talaromyces rugulosus
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae;
            Talaromyces; Talaromyces sect. Islandici.
REFERENCE   1  (bases 1 to 5361510)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     A chromosome-scale genome assembly of Talaromyces rugulosus W13939
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5361510)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-AUG-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5361510)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JUN-2020) Faculty of Electronic and Information
            Engineering, Xi'an Jiaotong University, Xi'an, Xi'an, Shaanxi
            7120000, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP055901.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: NextDenovo v. 2.0
            Genome Representation  :: Full
            Expected Final Version :: No
            Genome Coverage        :: 526.0x
            Sequencing Technology  :: PacBio RSII
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5361510
                     /organism="Talaromyces rugulosus"
                     /mol_type="genomic DNA"
                     /strain="W13939"
                     /isolation_source="air"
                     /db_xref="taxon:121627"
                     /chromosome="IV"
                     /country="China:Beijing"
                     /collection_date="2015-07-23"
                     /collected_by="Long Wang"
     gene            1971..3769
                     /locus_tag="TRUGW13939_06796"
                     /db_xref="GeneID:55994289"
     rRNA            1971..3769
                     /locus_tag="TRUGW13939_06796"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_004775185.1"
                     /db_xref="GeneID:55994289"
     gene            3950..4107
                     /locus_tag="TRUGW13939_06797"
                     /db_xref="GeneID:55994290"
     rRNA            3950..4107
                     /locus_tag="TRUGW13939_06797"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_004775186.1"
                     /db_xref="GeneID:55994290"
     gene            4282..7624
                     /locus_tag="TRUGW13939_06798"
                     /db_xref="GeneID:55994291"
     rRNA            4282..7624
                     /locus_tag="TRUGW13939_06798"
                     /product="28S ribosomal RNA"
                     /transcript_id="XR_004775187.1"
                     /db_xref="GeneID:55994291"
     gene            complement(<70940..>71676)
                     /locus_tag="TRUGW13939_06799"
                     /db_xref="GeneID:55994292"
     mRNA            complement(join(<70940..71258,71303..>71676))
                     /locus_tag="TRUGW13939_06799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489943.1"
                     /db_xref="GeneID:55994292"
     CDS             complement(join(70940..71258,71303..71676))
                     /locus_tag="TRUGW13939_06799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345836.1"
                     /db_xref="GeneID:55994292"
                     /translation="MQSRQTRQTTQTNEIRNVNTNATSLVLRSFLSHFLRSLQPLHQG
                     LLCRAPAAVLRLDLNLTLATAVPILDPASWRTARALPARSPAAAAASRPCLRRRASPS
                     RLPLPRITGLRFLAPYFPIGLECTCAFVLRVKPRSVPWLVGFGLGLFLLCVASCLRID
                     SLELVQDAYIDYKLRDSDCRAFLTHDFVESGGALDTPNPFEHAVPILSELRAVHDDMT
                     HGLSPEVTWTQR"
     gene            complement(<72647..>73498)
                     /locus_tag="TRUGW13939_06800"
                     /db_xref="GeneID:55994293"
     mRNA            complement(join(<72647..72707,72767..73013,73084..>73498))
                     /locus_tag="TRUGW13939_06800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489944.1"
                     /db_xref="GeneID:55994293"
     CDS             complement(join(72647..72707,72767..73013,73084..73498))
                     /locus_tag="TRUGW13939_06800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345837.1"
                     /db_xref="GeneID:55994293"
                     /translation="MAFEFAEVTSDGDFSELIPLLWRAYSTEPRVTPLPLTFPADDDG
                     AAAREKQVAQCQAAMMHMHRSDPTSHWLKVTNVATGKIIAGCRWHIHEENPYSNAPDK
                     PFCIPFWPEGDRKKYAEKIVGAIVQPRKTRYQKPHLSLQVIFTDPDYRNLGAGRMMME
                     WGTKKADEMGLESFVEASHLGSLLNQKFGFITVTKELVDTHVPDASDEWKDMETRFPP
                     PPVYCMWRPVGGQYEENMSLPW"
     gene            <73949..>75269
                     /locus_tag="TRUGW13939_06801"
                     /db_xref="GeneID:55994294"
     mRNA            join(<73949..74110,74178..74282,74342..74566,
                     74937..>75269)
                     /locus_tag="TRUGW13939_06801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489945.1"
                     /db_xref="GeneID:55994294"
     CDS             join(73949..74110,74178..74282,74342..74566,74937..75269)
                     /locus_tag="TRUGW13939_06801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345838.1"
                     /db_xref="GeneID:55994294"
                     /translation="MSAENTADNPGRIVFVISWFLFCVLWLTVGTRMVTRWTLTRRFE
                     GDDIVTWIALLLGSAQIAAVTVAVYNGLGQNIATLSASQISHFQQSLYASDILSVWTL
                     GLSKIAVLLLLVQVTPIESHLRLAFGVGIFVLLWALSAFLVVAFECHLPHAWQFIGNQ
                     CVNRNLSIVTSCVPYLKPFYLGLESGLMQSNDPLRTNSRKFMSAYTYSDAYAYAYHRH
                     KPDPIARESSGSNGKGPSPERDNTVDSDHDSVIELYDLSDYLDEGHADEDNLMTHS"
     gene            <76688..>78321
                     /locus_tag="TRUGW13939_06802"
                     /db_xref="GeneID:55994295"
     mRNA            join(<76688..76772,76831..76896,76955..77335,77388..77407,
                     77476..>78321)
                     /locus_tag="TRUGW13939_06802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489946.1"
                     /db_xref="GeneID:55994295"
     CDS             join(76688..76772,76831..76896,76955..77335,77388..77407,
                     77476..78321)
                     /locus_tag="TRUGW13939_06802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345839.1"
                     /db_xref="GeneID:55994295"
                     /translation="MQSPTLSPLGAVSFADMRALHYRAPVSAGQYHWCAMLAPREYKN
                     LASYVTGWLTVCGWQAAVTSSSYLSGTMLQNLIMLNHPTYQPKTWQAMLLMWAGLLIA
                     VFLNTIVSNFLPKIEGAILIFHVLGFFAILIPLTYLAPSQSSGSVVFTQFVNNGGWPS
                     QGLSFWVGLNSTVFMFLGADSVIHMSEEIYDAARNVPRAIIWSILINGMLGFGLLLGT
                     LFTLGDLGRVLKTRYDYVFIQIFLDNTGSISGATTMACILLCLTFFSTIGLVASSSRM
                     TWAFARDRGLPGWRYLSKVESKRAIPVITILFTAIFAILLDLIDLGSSTVLNDIMSLS
                     VNSMYGSYFISASLLLWRRCAGDIVDDRRETCITANSIRLSWGPWRIPGILGIINNAF
                     ACVWMVVVLFFTSWPPATPVTASTMNYSIFVTFFVAIVSTIYYIVWARKSYHGPVVET
                     VQSVEMGATESLKSA"
     gene            complement(<80534..>87065)
                     /locus_tag="TRUGW13939_06803"
                     /db_xref="GeneID:55994296"
     mRNA            complement(join(<80534..80679,80743..80982,81041..81409,
                     81465..81838,81898..82172,82220..82298,83212..83285,
                     83339..83364,83423..83473,83525..83642,83703..84331,
                     84424..84678,84757..85063,86581..86896,86977..>87065))
                     /locus_tag="TRUGW13939_06803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489947.1"
                     /db_xref="GeneID:55994296"
     CDS             complement(join(80534..80679,80743..80982,81041..81409,
                     81465..81838,81898..82172,82220..82298,83212..83285,
                     83339..83364,83423..83473,83525..83642,83703..84331,
                     84424..84678,84757..85063,86581..86896,86977..87065))
                     /locus_tag="TRUGW13939_06803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345840.1"
                     /db_xref="GeneID:55994296"
                     /translation="MAPAEAPKFEYLCIILDKPGTNAKRMEYRSIHIQGLRPLMESQT
                     LISGGLFPLPFPTSTIMKIIDARSNHKYCLLTTLWLGTMFNTHPTDSETPPFKGSMVV
                     IQATSAQEAREIVGRDIYAQNGVWDFENAQIFPPAMALGLIQNLLNFSNQDVIPFTWI
                     IGLALIVIFSLAYVRDPFKGIPGPFLARWTAWWNVYYSRKGNMHRNMMAMHKKYGTLV
                     RTGPNEVSTSNPEAFNIIYGAGTGFRKSDWYSVWQGTRKWDLFGERNTEIHRNQRRLV
                     ANTYSLSNMKKLEPYVDSAIGVFITKMAEMSGQQVDISYWTHLFGFDVIGEVTFSKRF
                     GFMESGKDDGAFAIIENSLRSAAWSGYVPWLYWLNARLTPVIGNHLAVTARQGSLLKM
                     AATAIAERKERGSSHADVLAQFFDIQKEKPIFDDISLTSQVSSNIFAGSDSTAISLSA
                     MLLYLLKNPEKKKILLAEIEAMAQKKNVKQCGIFSLEMANDMPYLQAVMWEAMRLHPA
                     IGMNIGRRVPQGGVTIDGRYYPEGTTLSMNAWVINRDKKTFGEDSDAFRPERWMEDSE
                     RVGDMKRIFFSFGAGARFCLGRHIAWLEMSKLIPSLFHSFDIDLATPDLQVTEHTMSK
                     PVEAQEKNHSSRRSPLLLNYQPDHRDTMSSVVEHSQAKSPTQDSAAHSQTSTINPGTE
                     LDEKRAEDSTEPVAADSQPSDEEAAPPPPTDTPEPPPNGGTQAWLTVLGAHFLFCNSW
                     GIANAFGTFQTYYELELLQSSSPSDIAWIGSVQSWLLLFVGALSGPIYDAGYARALII
                     GGSFFSVFGQMMLSLCDNYWQIFLAQGICVGIGGGMLCMIGNLIASQYFTTKLSTATG
                     IAAAGSSLGGVIYPIVFHRLQPTVGFGWATRVIGFITLALQLVAILVLKPRVKPQARR
                     GLLDLAAFKEVPYTVFTFSVFVGFLGLYQPFFYVQSFAIKTGLTNSNLGFYLLSILNA
                     TSAFGRILPGMVSDKIGAMNAMIPCAFLSALLAFCILAVKDAAGIIVLMVLYGFFSGT
                     FVSSPTATIIRLSAHNRAMTGTRLGQAFAIISFGYLIGTPVGGVVLDQHGFNALWIFT
                     GAIIVGSSLILMLARYFYKGLSLTAIG"
     gene            <87917..>89152
                     /locus_tag="TRUGW13939_06804"
                     /db_xref="GeneID:55994297"
     mRNA            join(<87917..88673,88738..88776,88835..88962,
                     89018..>89152)
                     /locus_tag="TRUGW13939_06804"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489948.1"
                     /db_xref="GeneID:55994297"
     CDS             join(87917..88673,88738..88776,88835..88962,89018..89152)
                     /locus_tag="TRUGW13939_06804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345841.1"
                     /db_xref="GeneID:55994297"
                     /translation="MVANKSFLFKEIPAFAPEAGKTVATEVREFDLDQDPPANGAIVK
                     GLYFSLDPSFRFRMHGPEVKSYAPGFKLDEPFAGYAIVQILKSNHDKVAVGDVVFGRF
                     EVAEYSVATADTLGLSITRKIDNSFGVPLSNFLGILGTTGLAAYASLYEIGKPKKGET
                     IFISSAAGAIGQIVGQIAKHEGLKVIGSVGDDTKLDFILKELGFDGGWNYKKEKTHDA
                     LKRLAPEGLDIYYENVGGEQLEAAIDNMKPYGRIIGCGMISQYNLPPDEKYGVKNLMS
                     LVAKRVTFQGFIVGDPGFGPKYYNERNENIGAWLAEGSIKSKEHIVDGMDKAPEALVA
                     MLEGKSLGKTIVKVADPE"
     gene            complement(<90158..>91282)
                     /locus_tag="TRUGW13939_06805"
                     /db_xref="GeneID:55994298"
     mRNA            complement(join(<90158..90947,91017..>91282))
                     /locus_tag="TRUGW13939_06805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489949.1"
                     /db_xref="GeneID:55994298"
     CDS             complement(join(90158..90947,91017..91282))
                     /locus_tag="TRUGW13939_06805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345842.1"
                     /db_xref="GeneID:55994298"
                     /translation="MEVRPNQAAWLVKADTPLQVGNAPLPSAGPGELVVKNAAIAINP
                     LDCHMQDTGIFVQQWPAIFGCDVAGEVHEVGPDVQRFQKGDRVIGHAINLTSGRPEHA
                     AFALYTVVPADKAAILPSSIPFSEGVVVPFALEAAVCALSVQVPGIAMPGVPTPALGL
                     PYPSLQHPEPSSAKTLVIYGGSSSVGSMATQLATAAGIHVISVVGAHNFNFSKRCGAS
                     QVIDHQDPSIVDKVVKAIDRANQDEFVGIFDAISTPETYAHDLAILARSGGGHLACTH
                     PPPNEIPANVKAGMIFAINDIAAPVWREYVTPALRTGKIQCLPPPVIVGKGLQHIQDA
                     LNRCRAGVSTAKLVVEL"
     gene            <91863..>93446
                     /locus_tag="TRUGW13939_06806"
                     /db_xref="GeneID:55994299"
     mRNA            <91863..>93446
                     /locus_tag="TRUGW13939_06806"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489950.1"
                     /db_xref="GeneID:55994299"
     CDS             91863..93446
                     /locus_tag="TRUGW13939_06806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345843.1"
                     /db_xref="GeneID:55994299"
                     /translation="MQPLRLGPHDLLEYDARYGVLICRECQYAIQKSALPSHLLRHKI
                     YRGERQRLLSSIAQLDVLESENVTLPAPTSPPIDLLPIISGYRCMIAGCENLCASSKR
                     MKRHQSEAHELPNSPSYARPAKLQTFFRGTKLRYFEVACSMAVNSPKKPLMATFENDQ
                     THDKRAHRQLPPYVNTAATLSLSPSTGSTPNGLDLEALAYLHHFVTRTSSTLPVAENS
                     ELSGSYWQTNIVIQALEHQWLTCGLLAISAGHSIVLSVEAPTKEVHRKRYIQFLAEFS
                     AGREHMIRIKEANMEKETVEIAMKLGFILQCVQGVLAGPESVLSKKSFCESAATFDME
                     YFMQTVPKFLVSHPGVHPSEARSEHKATQNDPFPQATTIFKTGVSRSPDNISMFSICD
                     DQPSVINHLRTLPSRMAEVFGKPENVQDALATLSAIAVLVECCETSFASNTVETAWRC
                     MARWLIKVPDHFNHMVSQNSPVSLVVVAYWSAFLVKRVEDSGCWFLMGSAKTILLQVV
                     EHLSTHGYATKSLVESLLP"
     gene            complement(<95136..>96271)
                     /locus_tag="TRUGW13939_06807"
                     /db_xref="GeneID:55994300"
     mRNA            complement(join(<95136..95141,95194..95434,95492..95621,
                     95716..95966,96037..96153,96210..>96271))
                     /locus_tag="TRUGW13939_06807"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489951.1"
                     /db_xref="GeneID:55994300"
     CDS             complement(join(95136..95141,95194..95434,95492..95621,
                     95716..95966,96037..96153,96210..96271))
                     /locus_tag="TRUGW13939_06807"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345844.1"
                     /db_xref="GeneID:55994300"
                     /translation="MERLGDGARYDLGRDFLGSARLNLQHYLWKETLGYDLHPSAKVD
                     AASEPLHIADVGTGTGIFILSLARRLPKSCSFVGFDISDDQFPIHESIPENVSFRVAD
                     AMGEPPVELLGKFDIVHLRLFFCVVDKNDPLPAFNFCLKLLKPGGFLQWDEYDQADTI
                     AFKVLPEAPINAMTEMRQGFNNGRQLSGDACTSWITTLKDFCVDHGLQNVECFRTRPP
                     RDLLKPYTQMVFILYLEHAALHDVAGNQDKGDSLRKLIDQCADELKEGGT"
     gene            <97114..>97992
                     /locus_tag="TRUGW13939_06808"
                     /db_xref="GeneID:55994301"
     mRNA            join(<97114..97368,97432..97836,97903..>97992)
                     /locus_tag="TRUGW13939_06808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489952.1"
                     /db_xref="GeneID:55994301"
     CDS             join(97114..97368,97432..97836,97903..97992)
                     /locus_tag="TRUGW13939_06808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345845.1"
                     /db_xref="GeneID:55994301"
                     /translation="MSSCLVAVVAGVGRGTGSAIAHKFASQYLVVCLARNLESYEEVV
                     SNINKSGGNAIGVTTDLSSAKSVKSSFDRLEMELGGDFGISAAVFNASTRPVCKPFLE
                     LTEDEYAGGYDILGRGAFLFAQATLPRLVKLVNVSSHPSSLIFTGATASIKSFAEFVS
                     FSNGKWVLRSLAQSFAKEFGPQGVQVAHTIIDGVIGIPTTVQAMKEAGKDTQDTLISP
                     EAIVDAYWYLHTQPKSAFSWEIDIRPFGEKW"
     gene            <99477..>100608
                     /locus_tag="TRUGW13939_06809"
                     /db_xref="GeneID:55994302"
     mRNA            join(<99477..99768,99832..100267,100326..>100608)
                     /locus_tag="TRUGW13939_06809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489953.1"
                     /db_xref="GeneID:55994302"
     CDS             join(99477..99768,99832..100267,100326..100608)
                     /locus_tag="TRUGW13939_06809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345846.1"
                     /db_xref="GeneID:55994302"
                     /translation="MPSDTSVSFDVFRGIDGKITSDHVTKSLGDNEIFVQTTHSGLCG
                     TDLHYLHSGKVLGHEGVGIVRRLGPGVTSVKVGDRVGFGYTRKVCGKCRHCLSGWDQF
                     CENVVDFENKADADIGSLSNGVVWDADAVVPIPDGYESAEAAPLLCAGSTVWTVLTEY
                     GIKATDRVGVLGIGGLGHLAIKLGAALGCHVVVLSSSESKREEAFEFGAKEYFVLKSG
                     EQPEGLKPLDHLLVCGSATSTDYTFLVSLMEVHGSIYPLTVSSDKVPIRLHDAVLRGV
                     RIQGSLTSSRRSLRSLFQFAAERNIHPVLQTFPMSVDGIETAAGILNSGKMRYRGVLC
                     WE"
     gene            <102190..>103779
                     /locus_tag="TRUGW13939_06810"
                     /db_xref="GeneID:55994303"
     mRNA            <102190..>103779
                     /locus_tag="TRUGW13939_06810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489954.1"
                     /db_xref="GeneID:55994303"
     CDS             102190..103779
                     /locus_tag="TRUGW13939_06810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345847.1"
                     /db_xref="GeneID:55994303"
                     /translation="MAVTYAGLSGRPLSLTISTIATMGFLLFGYDQGVMSGIISDVAF
                     NDVFTATKNNNTMQALVTAIYELGCLFGAMFALVAGDKLGRRKMIIIGASIMIFGVVI
                     QVTAFPGHVPLAQFMVGRTITGIGNGMNTSTIPTYQAECSKTANRGLLICIEGGVIAI
                     GTLIAYWIDFGAHYGPPDLVWRFPIAFQIFFGIIIIVGMFFLPDSPRYLIAQGKMEQG
                     ELVLAALNGCEINDHQTQIQKQLVLDSIRASGALDQTVTYKDLTTGGRTQHLRRMLIG
                     ASSQMFQQLSGCNAVIYYLPVLLKQSLGESNDRALLIGGINMICYAVFATFSWFFVEK
                     IGRRKLFLGGSFGQLAAMTITFACLIPDNPKTADGAVFGLFLYMCFFGATWLPLPWLY
                     PAEISPIKTRAKANAVSTCSNWLFNFTVVMITPVMVQNIKWGTYLFFAAMNACFIPII
                     WLFYPETAGRSLEEIDLIFAKGFVENKSYVNAARELPKLSDDEVDARAAEYGLGRDTD
                     EETEKHVEERHSPGMESHTVT"
     gene            <106530..>107403
                     /locus_tag="TRUGW13939_06811"
                     /db_xref="GeneID:55994304"
     mRNA            join(<106530..106744,106813..107126,107186..>107403)
                     /locus_tag="TRUGW13939_06811"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489955.1"
                     /db_xref="GeneID:55994304"
     CDS             join(106530..106744,106813..107126,107186..107403)
                     /locus_tag="TRUGW13939_06811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345848.1"
                     /db_xref="GeneID:55994304"
                     /translation="MRAVAALSAAALVGAAYATTGETVTVSSLQVTAVNADDGVGAGT
                     DSYSYYTGDGSTGAGWPDQSKWVSFSDMFEANKANMLVGCEWMSVPDDTDDEIQELQD
                     AINQVAQETFVDHRFILAIVMQESNGCVRVHTTGNGVVNPGLMQSHDGTGTCNSDGVV
                     QTPCPESEIVQMIEDGTAGTAEGDGLANCINNAQTTDVSAYYKAARIYNSGSIASDGN
                     LSEGNGATPCYASDVANRLTGWVNAASTCS"
     gene            complement(<110113..>112161)
                     /locus_tag="TRUGW13939_06812"
                     /db_xref="GeneID:55994305"
     mRNA            complement(join(<110113..110584,110637..111672,
                     111744..>112161))
                     /locus_tag="TRUGW13939_06812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489956.1"
                     /db_xref="GeneID:55994305"
     CDS             complement(join(110113..110584,110637..111672,
                     111744..112161))
                     /locus_tag="TRUGW13939_06812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345849.1"
                     /db_xref="GeneID:55994305"
                     /translation="MMDPLVTESALRGTPGHVTLPFSSRVVDHNLIELSTKIIEVIYR
                     YQNKRGGTEGLQSDIGLLSGLTQVYTHVKSNRAIKMALPAFPFKSPNTKIKVLGRLPD
                     KAEEFALAHLNGLCAAIKDVYEPGAELTIISDGIVYNDLLSVPDSDVWAYGEALRELA
                     KTKGFEYIRFSRLGDLVPMSVPQSLDEVSYVANATNFRVGLMNNFSSKDWNVSDRIAE
                     DEDVCLTYRGYLKFLFTDLAETYPVSDSFSKSKFKKGTESIAKQMLVRGQAFARAVRE
                     KFGGHVRLSIHPSTGQNKVSVSTLPTDSSYTTPWHCTLGIRLDGTVTSNLSQTFRDDP
                     KWELVYEDGRPSYFREKSDLYNWSTGAINVTPVYPSGVMIQPAEGHNTLSMQNIDAQK
                     VRALSELNSPVLLRGFSGSRDRERYLAKASEFGTPLPWKFGILLEVKDRGADTRGLNN
                     VLSAEWMPFHFDGLFKTMDMTREDGTTYKLPNPPRFQLFTSVTPSPSDTGFTLFSTST
                     FVFKHLPDHLPVETLKTLTWSVSTSSFDSTKLHGLPLVQDHPVTGKPCLRYHEPWPTS
                     KTNFEATDITIDGLSPEASADVCKVLDNLLHDRRVVYYHSWQKGDILVSDNILTMHTR
                     SDFKGGADRELWRIHFD"
     gene            complement(<115124..>116992)
                     /locus_tag="TRUGW13939_06813"
                     /db_xref="GeneID:55994306"
     mRNA            complement(join(<115124..115536,115601..115939,
                     116048..116602,116656..116775,116823..116888,
                     116956..>116992))
                     /locus_tag="TRUGW13939_06813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489957.1"
                     /db_xref="GeneID:55994306"
     CDS             complement(join(115124..115536,115601..115939,
                     116048..116602,116656..116775,116823..116888,
                     116956..116992))
                     /locus_tag="TRUGW13939_06813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345850.1"
                     /db_xref="GeneID:55994306"
                     /translation="MEETTVDLAVVGGGPTGMLTALLAKRMGASVCVLDGKPRALRLG
                     RADALNARSQQYLQIVGILETLSSQGLKCNTSSIFADGKFTSRQSHWWEKLEHVLHKN
                     FLMIGQPVVEQILAAELGDSIVFSEPVESVRENEKGVDVYAISGHIVHATYCVAADGA
                     RSATRQALDIPFKGTKPEMTWAVLDTFMDSDFPRCPEIITFELNGESRVAWIPRERDM
                     CRFYILLDGEINEERSKESIKKHLAPYRVEFTKKEWFSTFEVKERVAETFISRNGSGR
                     IILAGDAAHCHSVNGGQGLNTGLADAFGLGWRMAYILKHGDRLAPGAAQKILQSFDVE
                     RRKVAENVVAVAARLVRDTKHEASQYVGNVEKNAAYITGMGITYDDLQSPVIRESETG
                     LWKAGCPCPDFEVKVPGSTEDGKWFYQVVEYGKFRVLVSGDHGGNFGKFNDLVAWHKL
                     VPNVDGQQSDLNGESASTYLTDIVKSGEEFAVVVRPDMYLAYAGTVTGATDYLAEIFA
                     N"
     gene            <118366..>119352
                     /locus_tag="TRUGW13939_06814"
                     /db_xref="GeneID:55994307"
     mRNA            join(<118366..118450,118530..119102,119153..>119352)
                     /locus_tag="TRUGW13939_06814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489958.1"
                     /db_xref="GeneID:55994307"
     CDS             join(118366..118450,118530..119102,119153..119352)
                     /locus_tag="TRUGW13939_06814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345851.1"
                     /db_xref="GeneID:55994307"
                     /translation="MAVSTKAIEVSELFSVKGLIAVISGGGSGIGRMITRALAVNGAE
                     KVYILGRRLAVLEEAAQPFSGVVIPVECDVTSKESLQTVTDRITKEAGYINVLWCNSG
                     TSGPESPELNSSSTIDEFIEYNWRHSFEDYAETFRVNTAGFWYTSIAFLKLLSLGNEK
                     IPGLHSQIISTCSTLGFGRFAATGRFAYGQSKASQMHMMKQLSTHLVPYNIRVNMVAP
                     GLFPTDMTSSMTSTGYDVSKLIPEGRAGLETDIAGVVLFLTSKAGAYMNGNVVVCDGG
                     RLSVVPSTY"
     gene            complement(<120347..>121818)
                     /locus_tag="TRUGW13939_06815"
                     /db_xref="GeneID:55994308"
     mRNA            complement(join(<120347..121094,121157..121526,
                     121590..>121818))
                     /locus_tag="TRUGW13939_06815"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489959.1"
                     /db_xref="GeneID:55994308"
     CDS             complement(join(120347..121094,121157..121526,
                     121590..121818))
                     /locus_tag="TRUGW13939_06815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345852.1"
                     /db_xref="GeneID:55994308"
                     /translation="MTATDVLPGIQSHKDRLNGSQQQVVKSQELQGVSEKVPSAINEP
                     PPPSQNADTRPNGGFFAWIQVVCSFCLYFNTYGIISSYGIFQTYYESNLGYDPSKASI
                     IGSIQSFLIFFSTALSGPLYDAGLYRYVVSAGSFMVVFGIIMQSLCKKYWQFILAQSL
                     CVGIGGGFIAFLGPTVLSTHFTTKYPLASGIGASGGGVAGIVLPIAFRQLQPSIGFGW
                     AVRVLGFISLGTLIIPVVALRPRSKPASHRKAVDTTAFRDLPFIVLLIGNFIMLLGVF
                     TPFFYVQSFALDSGIAGEELSFYIIAIMNLTSALGRIIPNFFSTRFGPFNMFLAMNLV
                     TFVIAFGFIGVTNLPGLIVTAAIYGFSTGSVFALQPVVVIRLCPDPKLIGTRVGMAFC
                     FLSFALLPSTPIAGALQTRGGFTAVWVWTGATTAVGFVIMSLSRGIKTNWKLLSKA"
     gene            <124171..>126170
                     /locus_tag="TRUGW13939_06816"
                     /db_xref="GeneID:55994309"
     mRNA            join(<124171..124436,124503..125448,125515..125597,
                     125648..125726,125780..126108,126164..>126170)
                     /locus_tag="TRUGW13939_06816"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489960.1"
                     /db_xref="GeneID:55994309"
     CDS             join(124171..124436,124503..125448,125515..125597,
                     125648..125726,125780..126108,126164..126170)
                     /locus_tag="TRUGW13939_06816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345853.1"
                     /db_xref="GeneID:55994309"
                     /translation="MATGYSVPQEASKVFHERILRSPRVKQHLLDDLEKYANISFEGS
                     PDPILPVNWRFGESISSLKALEATYINAILDKLYGVPVQKASISTNHGILFIMSVLLW
                     SLDPEGRNVSFAEIRSDEKAKDFYFSCFKDYDNHKSLEGPYRCGTSNIYQTRDDRFFH
                     LHGSLNPDVIFRMLKLPLDPPGGEDTWERVLPVFRAALAQWDSDAIDKLSNNVVKTSG
                     SICYDVDGYRKTDQGEANRHVGLWETFRIGNDKQAPSWWTDAAGNKPRDPSKPLAGLK
                     VLDATRIIAGPTVTRGLAELGATVLRITSPNIPDGTIYHPEFNWGKRNAALDFHKAED
                     REIMKNLILECDVFVSSYRPEVMEKWGFGVDQVMELCKDRPKGIIVARLNCFGWHGPL
                     QWRSGWQQISDAHTGVSYGFGRAMGNDEPVTPIFPNSDFCTGVSGICSVLDALVRRAE
                     NGGSYKINLALDYYNNWLTSNVGTYPDNVWKKLHAHYGSPVFRHDDHMLALIGKVTAL
                     LKQHSPNLFDPQFFEIRSCENLGINMRTVKPVIKFDDIVKPGFSLGTRGNGVDEARWP
                     EES"
     gene            complement(<126383..>127591)
                     /locus_tag="TRUGW13939_06817"
                     /db_xref="GeneID:55994310"
     mRNA            complement(join(<126383..126853,126957..127245,
                     127308..>127591))
                     /locus_tag="TRUGW13939_06817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489961.1"
                     /db_xref="GeneID:55994310"
     CDS             complement(join(126383..126853,126957..127245,
                     127308..127591))
                     /locus_tag="TRUGW13939_06817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345854.1"
                     /db_xref="GeneID:55994310"
                     /translation="MSTPDILLFGDQTETNFKVQELFNYAQSSTHLQSFIEGALKSVH
                     QAFDNADIADRQKYAFISFLSLEERILAEKVPDVVLRTVLLCFAQLGHLILRLETDAQ
                     VYELWKSQKFTIVASCAGQIPAALAATTESLDDLVEAAPEIVATAVRAGLDVDQRTND
                     FNDDRSKSWATAVGVPLAQAQQIASTFNENKGLIPSKGLYCGATSAWATTIIGPPRLQ
                     EELFSSKPFGDARVTPLPINATFHALSADRPNVESIIGNAPKLERLKLENARFLSCED
                     GAIFLPQNGRELVSQALLNILNRITDNEKVFEQVRIHTGGKEARIVPVVADKVAARLI
                     KVLGEDKAHVKGN"
     gene            <128963..>130212
                     /locus_tag="TRUGW13939_06818"
                     /db_xref="GeneID:55994311"
     mRNA            join(<128963..129001,129055..>130212)
                     /locus_tag="TRUGW13939_06818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489962.1"
                     /db_xref="GeneID:55994311"
     CDS             join(128963..129001,129055..130212)
                     /locus_tag="TRUGW13939_06818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345855.1"
                     /db_xref="GeneID:55994311"
                     /translation="MGSLSSLVVKSAIAILALALAYAPLADRARVLSLLVQNAPDKLT
                     EVKNLGDYTIKFSDRLRNCEDALLVEEDRVAILSCDPGRDFWNTVMGTFAPDLSIVPT
                     GELVLYRYDSAKYSDTDALVSIELRDFEGIQGFHPLGIEYHRPSSSLFVCNHHYEGSR
                     VEVFTLDLDTPKPVARHQRTIISPLIKAPNAIAALNEHELYITNDHYFLQKNNAFLSH
                     LETYAQLPLGSVAYVNLAIEGHPAEVRSVARSPFTNGVALLNGSALAVSSSSTTKVYL
                     YDILPDRSLLKTGDITLPFMPDNVSVDKKGSLLITGHPHPPTLDKLRKDRFECLMDSS
                     RQNEDCYEGTTPSGMAAWSADDGLKILHLTKGGFSTSCTAVRDTEYNFGFMTGLYEKG
                     ILVWKA"
     gene            <131659..>132480
                     /locus_tag="TRUGW13939_06819"
                     /db_xref="GeneID:55994312"
     mRNA            <131659..>132480
                     /locus_tag="TRUGW13939_06819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489963.1"
                     /db_xref="GeneID:55994312"
     CDS             131659..132480
                     /locus_tag="TRUGW13939_06819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345856.1"
                     /db_xref="GeneID:55994312"
                     /translation="MKYSTPIFVQALLVAGALAAPKGRGVSARVEERSQRSRISHVKL
                     PATGTQEINGAQDGNRTNVDYSSNWSGAVLTAPPSGTTFTAVSAQFTVPTPKAVDGQA
                     GASSAWVGIDGDTYQDAILQTGVDFNVDADGTASFDAWYEWLPDYAHDFSGITIKAGD
                     KISVSVVSSSSTSGTATIENLTNGDKVTKDLTSSSALGGQNAEWIVEDFESGGSLVNL
                     DNFGTVTFTEATAGVSDGSSVGTDGADIIDIKQNDKVLTSVSIPSSSEVVVTYSG"
     gene            complement(<132737..>134039)
                     /locus_tag="TRUGW13939_06820"
                     /db_xref="GeneID:55994313"
     mRNA            complement(join(<132737..133169,133255..133336,
                     133391..133429,133492..133676,133729..>134039))
                     /locus_tag="TRUGW13939_06820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489964.1"
                     /db_xref="GeneID:55994313"
     CDS             complement(join(132737..133169,133255..133336,
                     133391..133429,133492..133676,133729..134039))
                     /locus_tag="TRUGW13939_06820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345857.1"
                     /db_xref="GeneID:55994313"
                     /translation="MGMDNSTTLAIHWVFSVVAIALITLRLAIKSYTRYKYTLGDYFA
                     VGALFCVLVRLPIIHVVLIWGTNNMPVAYRQSHHFSPQEIYHRETGSKLILLDRVVYN
                     SYLWLQKLVLLDTYRRLIHHLPWEKTTLWAYGGVFAATYVTVQTVTFTECHPFDHYWM
                     VVPDPGSCCQAQVQLITLGILNIVTDVMLIVLPIPVLILVKRSLLQKLQLSCLFALGF
                     FIVAITIIRLPQNANNSTAQVNRTTWASTELLAAAIVANAPVIYGFWRGARLASQNNT
                     RESSSNRFFNSRQASRKGAQAGDLDVEDENNDNKHDGRVNLGNLPPGMSSSTALRSTA
                     ATQADNRSLDPRDDT"
     gene            <134953..>136205
                     /locus_tag="TRUGW13939_06821"
                     /db_xref="GeneID:55994314"
     mRNA            join(<134953..135195,135336..>136205)
                     /locus_tag="TRUGW13939_06821"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489965.1"
                     /db_xref="GeneID:55994314"
     CDS             join(134953..135195,135336..136205)
                     /locus_tag="TRUGW13939_06821"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345858.1"
                     /db_xref="GeneID:55994314"
                     /translation="MLWMRRVLGLSCILNGVLAAFSTNEDPYQRSYAYFGGQYVDDGS
                     GQHIFTDQMYVELLTPVGIALKPHPIVFIHGQAQTGTNWLNKPDGSKGWASYFLSQGY
                     ECYLVDQTFRGRSPWLPANGTLSTYSAEVLQQRFTAPQWYNLWPQAKLHTQWPGAGVM
                     GDEVFDTYYSSTVQFISSATGQQSTVQAAGAQLLDTIGKPVILLSHSQGGLMPWLIAD
                     VRNELVHSIVSLEPTGPPFQEAIFSNQSARAWGLTDVPLTYSPPVTDPATDLVRQTIP
                     SNSSTVSPCIIQANDPPPRQLVNLQDIPVLLVTTEASYHVPYDWCTVKYLRQAGVSTE
                     HLQLPDIGIHGNAHMVFMEKNSDEVAAALQKWIEKN"
     gene            complement(<136966..>138252)
                     /locus_tag="TRUGW13939_06822"
                     /db_xref="GeneID:55994315"
     mRNA            complement(join(<136966..137510,137585..137994,
                     138056..>138252))
                     /locus_tag="TRUGW13939_06822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489966.1"
                     /db_xref="GeneID:55994315"
     CDS             complement(join(136966..137510,137585..137994,
                     138056..138252))
                     /locus_tag="TRUGW13939_06822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345859.1"
                     /db_xref="GeneID:55994315"
                     /translation="MPGNVSLLTKALAIAMAMADAASSSQLKPRLVGESPKNGRTSFP
                     AVKIPHKQINSRATSTVDVGSNWYIQAWIGTPGQSFYFLADSGAPNLSIESTLEPSSQ
                     QGDIPLYNPQNSSTAEIMDGYSYSECFGSGYCDNGVVYTDIFTVGQLAYEGMPIMVQT
                     NNTSPSNGVRSGNLGLNVDHGGMSTEPERLPSFFQHILPDLDQPLWTVDFQAANNTGQ
                     FDFGYIDTSKYTGDIAYGNITTTNGLWTVEIQGIGAGYDDSAFKSHQFQVVFDTGTGG
                     GSISRDIADLYWSQVPNSQWNDGWSNYLYPCNQTLPDFVIQLADGSKVGIPSDGLFSK
                     AADDGSGLCATMLAIADGDDTLWGQAWIEKWFVIFDWGNNRLGVANKDQ"
     gene            <141996..>148455
                     /locus_tag="TRUGW13939_06823"
                     /db_xref="GeneID:55994316"
     mRNA            join(<141996..142472,142534..142873,142958..143236,
                     143297..>148455)
                     /locus_tag="TRUGW13939_06823"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489967.1"
                     /db_xref="GeneID:55994316"
     CDS             join(141996..142472,142534..142873,142958..143236,
                     143297..148455)
                     /locus_tag="TRUGW13939_06823"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345860.1"
                     /db_xref="GeneID:55994316"
                     /translation="MAPGLQVGAPSHPLSPTPGTLGLGHWKRVSGGMMDLDSFSNGGP
                     RSVASRRASRKTVAGNESSAISNVVYSLKRRSGDELGATASSKLLNSTHATLLDWIRH
                     QRMSKLPPEGSSYDKVLAWAQLFVERLHSFDLAIEHFAGDSYLAAQLAYGYCAILLEL
                     GEDNASALKISFGFFYSTSMVLVNLLERTELFNVSQEIKEQLILALADLVTLVASVAT
                     HFHKALRSISKASIAVNIHGTFSGQIESFRGRCEKIAEAMWRHQLLRDDLDGDRVSEV
                     KTIKNWLAPEDRVLANVAETTSHLAQDREELTCLWVGPYLTRFLKSPQFKCLSIAGKP
                     GSGKTVLASVIVDHLQHPIGGVSYQTLFVPNNGRVPAESSSRAVVKAILRQLFEKRIG
                     NTHLFQLLSDAYEHSRRTVTDEDYDRILWSVLETAFGSPLRGAKPLVVIVDGMDEVAG
                     GEAPLLQKLQEVTSKATGLKLIVLGSQAAPARPDQANIPVTPDLILDDIAAVVRNIFQ
                     NHKTLITMSEVEQEILVDRITQAANGSFLWAKIAARQARQEETTEALQKSVNTLVAAK
                     LTINDLVTRCLQAPDLTENAKLILVWLATAERPLSQPELSALLSIQADKATTVAQNID
                     ILHLLKPVNSLVCLEDGYIYLRHAQIRSAIVDVFSKGKLVQHVKDRHTDLVRRLLAYI
                     RLSVTEDREPSLTPLDLFEVGDILRKHVLLDFALRYWMVHLRKTAVFINDGEKAAAKE
                     FGKVFPVTTTFFLLQQTFWENKDAPLLLSWYATVVHLCRDIFTPNHIATFQTTITLAL
                     FHRQIAHVSESSQTIYEALTLSRKLLSEHHIITMQVASIFLEVTASSVTSSKTETMIK
                     REEVMLLLIECYKSHYGATSEIIISTLTQLAEHYQFIKEERKAREIYLSLRSTTIQQY
                     GADSQEVREINANLHVHLKSHKTTKDEDTEIDAGLLLLDVSEEDELKETAKYDFITLL
                     QRAEKYVTEGNLALAERTYVEIWQHAASECRIHYSAEWEERKITAVLNYTKFLKSQKR
                     EYEASSLLTTTWQEYEQQSSLSSESTISHLVEVAEVMKTVGLSAVAISVFKRCAQYYE
                     STGRVHTSSYKSIQQSIQSTSKEVMNVVSSSSSSSSSFTSETVLEEMVYEASTSITTI
                     DETSITTVSTLYSRYISQHRWQDATRLLKRVLHGIWGALFAPSLEDVTLPSKHVDHCI
                     ELAERLSQCYHSRRRLAKEEDILVRIYRAVRSDRKVGDKLLDRVTTVLIRFFERTSQT
                     EKVIHLRQEMLSDYIRHYGLHHQIVIQNLWVLAELTRPRPIFVDYYRQIISAINKESD
                     ISKQEAIEPLIIVATELWSQGRYSDAVQYYKIIFNTFLQQPKVSIKFEQQEFVKTFFS
                     RYTHCLRTLQSEFTAIHKITVEYHSKVKATFGATASITIQATLTLAKLCQESKRYEIE
                     AIHLYEDLLKLKSEEIDYQEITATLDSIYEEQTAIVTSTESKSVSTSQVERAVSVLKR
                     RIKSVRQTHGWAHEESLSKMQEMVSFYSKREETESVVQELKEATVQILSTETSSTRLV
                     AAATAIASSYIVSKQTTKATELSQEIYRQIIMKDTTNIKTVQFDLSSKERQSLVFLAQ
                     LEYSLRQNSSVTLNEIFSSLTTEYVYFEEFRNLTKHSKDVTLYSVSATAARLYAFLLS
                     KERHSTANRVFEEFTNYFLATEAKRVKLTEAAQVRIFALTLLDYFSIHESNNFIRSVG
                     IACEKRVQSLITEKKYAEACDLALAAFKYISAHESYRTTTIVKFVFQLGMTISGRQIS
                     NAIDGTGRKKMLGISATIIQDVLSVLKDLKINLAQLNISHLNNLIGLLGEQRDYQTLA
                     WLLTLLWNSREAQRSWQSSITFALGRRFILARYLVGDTAAAVRLAEDTVYNCRRVHGH
                     RHKITLDMSILLSQLYSSVAQRYQSQKGGQDMAHRYYKKSAAVHENILRAFTDPTYAE
                     LDGGDMSLCLDESASSIDLAAAGASAQSNLSEGEHVRQHLELFKLAIERFGEWPKDYS
                     EYERLNADVFREFKEDLQGIEGVEKWNLKNFGSGKAESNADLLDPDFGNWEILETSHV
                     SNGAEEEEEL"
     gene            <149595..>151214
                     /locus_tag="TRUGW13939_06824"
                     /db_xref="GeneID:55994317"
     mRNA            <149595..>151214
                     /locus_tag="TRUGW13939_06824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489968.1"
                     /db_xref="GeneID:55994317"
     CDS             149595..151214
                     /locus_tag="TRUGW13939_06824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345861.1"
                     /db_xref="GeneID:55994317"
                     /translation="MAEKKTTLPYEPEYGDVGDQEDIAEQLGEVHVVRQGLHQRHIQM
                     IALAGTIGTGLFLGSGRAISNGGPLGAFLGYSIVGLLVSNVVFGVGEMGSLVPLTGGV
                     VRYTELFCDPALSFANGWNQVYSILVAIPAEIVAAAVVIEFWVTINNAVWITIFSLLI
                     LATTFTFVRVYGELEFFFSMLKIILIIGINLMSLVVTCGGGPNHTSIGFQYWRNPGPF
                     VQYLDIGGSLGQFLGFWTTFNNALYAYSSIETITVAAAETRNPRQAIPQAAKRIFVRI
                     LLFYVLSIFMVGLVVPSNDPNLLGSTGTASASPFVIAARNAGIKVVPSIINAVVLTSA
                     WSSGNSNMLAGSRMLFGMTNHGHAPAVFKRINRFGIPYVCVIFFGLFMALGYMTLSDS
                     ASTVFTWLQDIVSIATLVNWMTICVVYLRFYYGCKKQGIDRHTELPWAAPFQPYSTWI
                     SLIVFLVLFFTGGYSTFIHGHWDTETFVSSYLNLPAIIILYFGYKFTKKTKIVPLEEI
                     PIRPFIEQYRRNPEPLPPPKRGLQKINILWS"
     gene            complement(<151409..>152241)
                     /locus_tag="TRUGW13939_06825"
                     /db_xref="GeneID:55994318"
     mRNA            complement(join(<151409..151616,151676..151747,
                     151817..>152241))
                     /locus_tag="TRUGW13939_06825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489969.1"
                     /db_xref="GeneID:55994318"
     CDS             complement(join(151409..151616,151676..151747,
                     151817..152241))
                     /locus_tag="TRUGW13939_06825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345862.1"
                     /db_xref="GeneID:55994318"
                     /translation="MQLITALAIAPILATASFLSSGKSIKNSKRADTWGGSVSLGPTQ
                     STIVHAVTTIIPGDAPSSQNGELFLWPGMSNGTGDLIQTTLESWSDNSWCGATTGQWC
                     VRASVFGSFGQLDGTPSPVSGSEKVKIEYILEDDNETWTQLVTNADTGVQLSNYSLAS
                     GPYMTGYGTGTECDDSCTGTIAAQQYVDTTITLADADTTFGGTIATAVGASYTGLSSS
                     QDGKIWTIDTINIPAM"
     gene            <153582..>156102
                     /locus_tag="TRUGW13939_06826"
                     /db_xref="GeneID:55994319"
     mRNA            join(<153582..154741,154822..155137,155197..>156102)
                     /locus_tag="TRUGW13939_06826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489970.1"
                     /db_xref="GeneID:55994319"
     CDS             join(<153582..154741,154822..155137,155197..156102)
                     /locus_tag="TRUGW13939_06826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345863.1"
                     /db_xref="GeneID:55994319"
                     /translation="QSRARNMADSQPAIKKDSNKGSQDVITDFWKKFITKSPSPVTSI
                     FPQHLYTNLLHPTRVQGALSARNAAESYEAAAQECKEQVKRIVRECRRTNEKFADPDF
                     DIEHDYKNGLKNCLRGLARSNNKKYNGSESSEQTGYSSSLSDDDSDSYFVGSVHRIDW
                     IFEKPEFTIDGFSNTDILQGASGDCWWLAAVATICNRQDLMEKICVARDSECGVYGFV
                     FYRDGEWHSTVVDDNLYLANADYSSTSNAYDSTGKRAREYRKRNQTGSEALYFAKCSD
                     PNETWLPLMEKAYAKIHGDYDAISGGWAGEGVEDLTGGVTTTIATNRVLNKNRLWGEL
                     TGSEGSFVFAASAMGTGWDSTQNGLALGHAYSILRAVEEADEKGEKVRLVLIRNPWGQ
                     RDMEGIGEWNGPWSDGSKEWTPYWLQKLQHTFGDDGVFWMAYEDLLSTFMFVHRTRIF
                     DAKWTVVQQWTSVNVPWVTGFLRTKFFVEIKKAGPVVFVLCQLDKRYFSGLEGQYKFA
                     LHFILQEKNSKSEDHIVMVRPVHSWEDRSVSAEIELEPGQYEVVPKVLATRDLDQKVV
                     EDVVKDWAEDNPQKLRQVGMNYDFANKKGSNPNDGPPEQGNTSSDTEIGKTQESSQDK
                     GQQKDEQKDDVKDDVKDSAEDQTKKENTVESEPLPLETLDGFRVNKKGQVLNEDGEQI
                     GELTEGEVEKCASKRINAKGDVHDAENQVLGKVKLLPRASTEPKVDKDDGLENRQKED
                     GLENTQKDDDSESSNTGDGPPPWNAVCVIGLRVHAQDPEVAIKLVKPEVTNEE"
     gene            complement(<156266..>159135)
                     /locus_tag="TRUGW13939_06827"
                     /db_xref="GeneID:55994320"
     mRNA            complement(join(<156266..157241,157311..157508,
                     158270..>159135))
                     /locus_tag="TRUGW13939_06827"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489971.1"
                     /db_xref="GeneID:55994320"
     CDS             complement(join(156266..157241,157311..157508,
                     158270..159135))
                     /locus_tag="TRUGW13939_06827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345864.1"
                     /db_xref="GeneID:55994320"
                     /translation="MTSLRPVAFLHLARRAPRSTPALLSSRTMASYRQAKDWSADQYL
                     KFAEERTRPARDLLAQIRAEAPQRVVDLGCGPGNSTQVLADRWPNAHITGMDSSPDMV
                     DKARKTLPQLDFELGDLATWTPPSGSPVDVYFSNAVFQWMPSDQRLPLISRLIQTQAS
                     GGVFAFQVPDNFLEPSHAMMRETAADGGPWTAVLKDRQPALAKFQSAQDIYNHLSPLC
                     ASLNIWHTHYYHILDSHEAVVEWVKGTGLRPFIDPLSDEDRQAFVASYLARLQSVYPT
                     CVDGKVILKYPRLQKTAEVADAQDLHEKSLQAHSVAEEPERNGSQDPQEEQQQKQDQG
                     RAHGFLQYIRTRDFWLVLLLGQVIALADISSSTFSSLLSYKGTSIPAFQTLWNYVLLN
                     IVYTGITIYKYGFKKWFKMLYTDCWKYFILSFLDVEGNYFMVLAYRYTSLLSAELFSF
                     WTIICVVFISAVFLRRRYHITQYLGIFVACGGLGMLIASDHLRGANYPAEDQLKGDLF
                     ALLASTIYAFSNLFEEFMVSKRPMYEVIGQMGFWGMLINGVQCAIFDRSSFHGATWDS
                     QVGGYIAGYTIVLFIFYTLAPIMLRISSATFFNISLLTMNFWGLIIGIQVFHYTVQFL
                     YPIAFVLIVLGLFIYFVKEGSLGESTKPWLGNNQERGIDGVGTGRRAQATGHAIV"
     gene            complement(<159570..>161074)
                     /locus_tag="TRUGW13939_06828"
                     /db_xref="GeneID:55994321"
     mRNA            complement(join(<159570..160427,160484..160586,
                     160646..160845,160909..160961,161026..>161074))
                     /locus_tag="TRUGW13939_06828"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489972.1"
                     /db_xref="GeneID:55994321"
     CDS             complement(join(159570..160427,160484..160586,
                     160646..160845,160909..160961,161026..161074))
                     /locus_tag="TRUGW13939_06828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345865.1"
                     /db_xref="GeneID:55994321"
                     /translation="MAKPKVCLAYSGGLDTSVILKWLIEQGYDVVAFMADVGQVEDFA
                     AAEKKALAVGAVKFVVEDLKREFVEELCFRAIQCNAIFEDRYLLGTSLARPVIARAQM
                     RVAQQNECIAVSHGCTGKGNDQVRFELAFYAIQFLVQPSIKVIAPWRLPEFFERFAGR
                     NDLLDYSAQVGIPVTSTKAKPWSMDENLAHCSYEAGILEDPDVTPPDDMWKLTDSPLT
                     APNTPEEFNLSFEKGIPSKLTTASGQTLTDSVELFTTLNAIGRKHGIGRVDIVENRFI
                     GIKSRGCYDSPAMTILRAAHVDLEGLVLDREVRALRDQFVTFNWSKLLYNGLYFSPER
                     EFIEKSVLASQDTVNGTVRLCVYKGAVSVLGRFSETEKLYSAEESSMDSLIDFSPVDT
                     TGFIGISKIRVAKYGQAKADAGESLSRA"
     gene            complement(<161234..>161533)
                     /locus_tag="TRUGW13939_06829"
                     /db_xref="GeneID:55994322"
     mRNA            complement(<161234..>161533)
                     /locus_tag="TRUGW13939_06829"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489973.1"
                     /db_xref="GeneID:55994322"
     CDS             complement(161234..161533)
                     /locus_tag="TRUGW13939_06829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345866.1"
                     /db_xref="GeneID:55994322"
                     /translation="MVEVTHSSVAVSMASRTCWVAPHPTSGTRCWLGVLIIPGSLPTG
                     PQNERITATVLLPSPSPSPSPSPSPSCLVVVVVVVFVIVERADTGRGGQSAAHPG"
     gene            <161577..>162668
                     /locus_tag="TRUGW13939_06830"
                     /db_xref="GeneID:55994323"
     mRNA            <161577..>162668
                     /locus_tag="TRUGW13939_06830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489974.1"
                     /db_xref="GeneID:55994323"
     CDS             161577..162668
                     /locus_tag="TRUGW13939_06830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345867.1"
                     /db_xref="GeneID:55994323"
                     /translation="MPPGDTPLTLVVVGVGQMGHSHALAYHHNPGFRIVALVDRRLSE
                     KKIPDVLRQYPALASFDEGLALAPDVVSINTHTATHADYAVAAMEAGAHVFIEKPLAA
                     TVADAERVVSTATRTNRKLVVGYILRHHPSWVEFIHQARQLGPPFVMRMNLNQRSSGD
                     AWAIHRRILEGVRNPVIDCGVHYVDVMLQITDSKPVQVRGMGVRLSDELPADQGQVNY
                     GHLQILFADGSVGWYEAGWGPMMSETAYFVKDIMGPRGSVSIVMDESETKADKDATGS
                     SADVNSHTKTSSLRVSTVVDGRAQDRMLSMQGEPDHYALCAREQQFLLDAIREGRDLS
                     KHMEDAVRSLVIVLAADRSMHENRAIDLG"
     gene            complement(<162909..>163793)
                     /locus_tag="TRUGW13939_06831"
                     /db_xref="GeneID:55994324"
     mRNA            complement(join(<162909..163177,163235..>163793))
                     /locus_tag="TRUGW13939_06831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489975.1"
                     /db_xref="GeneID:55994324"
     CDS             complement(join(162909..163177,163235..163793))
                     /locus_tag="TRUGW13939_06831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345868.1"
                     /db_xref="GeneID:55994324"
                     /translation="MTHSRPTGLFVAGMHCVITRNARLPAHSFSPQTLLQQTRIRAAP
                     QRILILNHYHDSCFQPRPQVRLLSTLSTLPTRRLCPHTQTGIPSKLSSPVQAKVTTRT
                     MASDSDYMAFLNKANSQREAGSGQPHTESSAPSQQIRTQSIEPGAAVPGALKEVDAFY
                     TSETDEPFEPVVLKWDGAAQGTWPTSDQFASLITSTPSPNLSQAIETLSPSSFDPRDQ
                     YPGVIKAVQAAAASDPKNVDVNIYRVEVGHNRVEYWIVALNTAARTIVGMKAKAIES"
     gene            complement(<164078..>167285)
                     /locus_tag="TRUGW13939_06832"
                     /db_xref="GeneID:55994325"
     mRNA            complement(join(<164078..164333,164395..165068,
                     165139..165295,165361..165418,165496..165527,
                     165599..165607,166096..>167285))
                     /locus_tag="TRUGW13939_06832"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489976.1"
                     /db_xref="GeneID:55994325"
     CDS             complement(join(164078..164333,164395..165068,
                     165139..165295,165361..165418,165496..165527,
                     165599..165607,166096..167285))
                     /locus_tag="TRUGW13939_06832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345869.1"
                     /db_xref="GeneID:55994325"
                     /translation="MLECLQIVLNKNQSRRYAAGDRVAGHILVDTGTCIESDTSIAIS
                     FTGLACTQYQAPGGSNHQINTTTLFQRSKILYTFPFRADPGQYKWHFEFCFPSHCDRQ
                     IQKNDNGLPENEVFPQGYACDPLPPSLAESAGYKTGYKADVDYELEASVQYPDWATTN
                     SSRVTANLSLVYVPSHDGPEPYYRYWLQEQKFLGSNNSSSIPGDGSAFQARVTFPTVY
                     VHGQWLLVYLSIVHDARQRHQAQVYLTSMFVTVIAKTEIWVDGQRREFRTETDALRAP
                     NLRLPVSKSDLTHRLIQDPWGTAVRGDGLPPQEGVPIFGRNAGGLKVPSQVCPDVRIP
                     NITVTHKLRIRATLSFGDKRFKFEKTGDLEILAPMDRKENGPPAIAPPPSPDITPSFA
                     MQETEVKMSHRKYEAPRHGSLAYLPRKRAARHRGKVKSFPKDDPKKPVHLTATMGYKA
                     GMTTIVRDLDRPGAKMHKKEVVEAVSVIESPPLVAVGIVGYIETPRGLRSLTTVWAEH
                     LSDELKRRFYKNWYKSKKKAFTRYSKKSTEAGGASVTRELERIKKYCTVVRVLAHTQI
                     RKTPLKQKKAHLMEIQVNGGAVADKVEFAHGLFEKTFGVDSIFEQNEVIDVIGVTRGH
                     GFNGVTSRWGTKKLPRKTHKGLRKVACIGAWHPNHVQWTVARAGQMGYHHRTSVNHKI
                     YRIGKGDDEGNASTEFDVSKKTITPLGGFVRYGEVKNDFVIVKGSVPGTKKRVLTLRK
                     TLYPQVSRKALEKIDLKWIDTSSKFGHGAYQTPAEKRAFLGTLKKDLVTTV"
     gene            <167801..>170097
                     /locus_tag="TRUGW13939_06833"
                     /db_xref="GeneID:55994326"
     mRNA            join(<167801..167990,168041..168926,169326..169546,
                     169610..169932,169990..>170097)
                     /locus_tag="TRUGW13939_06833"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489977.1"
                     /db_xref="GeneID:55994326"
     CDS             join(<167801..167990,168041..168926,169326..169546,
                     169610..169932,169990..170097)
                     /locus_tag="TRUGW13939_06833"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345870.1"
                     /db_xref="GeneID:55994326"
                     /translation="CLPWPIGNPVSSAYKRRDYKCIAFASPLLCSRPDVPSPNNLCLF
                     HQTCPFNADRATRASPGGETCRYVSSQTPEPGAPDANQPPNTAASTDFGPWNLDMDFG
                     IDFVDTRLMEQLTKPSIPNMLGELGELQPVSGNTRSWTWVIEQLKGYPRDFAHSAENV
                     FIHKNLVQRPGSAPLRAAFGVCAACLCVTEANEFMIFDSLNAEMSKLAKSGMGNKSLE
                     ESLSTFQSIVLYQIIRLFHGDAKQRILAERQKSHIAAWGLQLLQRAGDELQDTQPAWE
                     TWLLTESVRRTVMVAFIVHSVYSIFKHGVCPEMPTLSVLPLSSKQAFWSSQTAYLNHF
                     SEDETLKYPEFTSLWIMSPPRTLEPFFSSHQVNMPVTELVFPSYKLDPPSIAELKAKE
                     NQIFQSFSGVTGLEKVYRGIILEEDGASVDAARMRNVLVLEWDKPTSFHDFFPNSAKF
                     EEFVKAIKPFVAAPAIPELYEAEIRSVTCTSSTVTQIIKVKSNQTTAHVWKNLEEFVR
                     KSSTETPNFHSADGIGKDKGVFLGLVGWKGWQEYERLGKGDSFLNHIKALNRDEKAQN
                     IVAELSNLH"
     gene            complement(<170602..>172204)
                     /locus_tag="TRUGW13939_06834"
                     /db_xref="GeneID:55994327"
     mRNA            complement(join(<170602..170843,170912..171202,
                     171268..171559,171632..171864,171962..172031,
                     172087..172124,172180..>172204))
                     /locus_tag="TRUGW13939_06834"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489978.1"
                     /db_xref="GeneID:55994327"
     CDS             complement(join(170602..170843,170912..171202,
                     171268..171559,171632..171864,171962..172031,
                     172087..172124,172180..172204))
                     /locus_tag="TRUGW13939_06834"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345871.1"
                     /db_xref="GeneID:55994327"
                     /translation="MKVLIIGAGSTGLALAHGLHKEDVEYTVFERDSEYTFFNKARDW
                     GMQLHWGKEHLFKVLPESLRLRFDEVLVDPHFKDDLPFPHINGETGEVIAEIRMPGLV
                     RVSRGKLRKLLSGGQQVTIQFEKKLVDIVITQSGVVASFSDGTQYSGDLLVGCDGSHS
                     KVREYLVGADLAKPVDIDLTMINHAVSGYTASQAHLLRKYHPIGKLGYDPQIYGIFLL
                     AVALDCSNLEKPEEWKFQIQHSWWGAPRISELNDPKKRLQFYKGRCSKLCEPFRTAAL
                     ALSDDIVLSIDQSRQWAPIKWDNRGGRVTLAGDAAHSMLPHRGQGLNNAMQDTGELYG
                     AIKAIASGKSSLEPEITSYENAMRPRGVKDVDLSLETGQKMHVSYLQESPFLKMGFHK
                     PKGA"
     gene            <173299..>174153
                     /locus_tag="TRUGW13939_06835"
                     /db_xref="GeneID:55994328"
     mRNA            join(<173299..173341,173399..>174153)
                     /locus_tag="TRUGW13939_06835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489979.1"
                     /db_xref="GeneID:55994328"
     CDS             join(173299..173341,173399..174153)
                     /locus_tag="TRUGW13939_06835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345872.1"
                     /db_xref="GeneID:55994328"
                     /translation="MYPIIWLVLLGISRALIIRHPSQGDVVDVKEYLNITWDLTNQDD
                     MDLNASVRLTIYDTNPHYYLSEEITTVPIAMHHLIWNKSLPFGDHYAITLIDVQGIFS
                     SGNFTVINGPTHTIPPITSYLTSTAAASSSIVDWQSKTSAAAPLTQLSTSVTQAPSAL
                     PSTTSEPANSRLSSGSKAGVGVGVSVSAIVLAGGLAYFFIRRRRQKQEQGQSNQSYDR
                     QIAGGHIDEPKAVPPPNYYSAPPVSPEADSRPLSELHSNTIAHELAA"
     gene            <174580..>175251
                     /locus_tag="TRUGW13939_06836"
                     /db_xref="GeneID:55994329"
     mRNA            join(<174580..174634,174692..>175251)
                     /locus_tag="TRUGW13939_06836"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489980.1"
                     /db_xref="GeneID:55994329"
     CDS             join(174580..174634,174692..175251)
                     /locus_tag="TRUGW13939_06836"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345873.1"
                     /db_xref="GeneID:55994329"
                     /translation="MDYPNLIIALLGGLQMVRAITVSSPAKGQKVDMKQGLTVSWSLD
                     ENDNKSANVTIDLFIGEQFYLLLTPQPGVPANDLNYTYPYTSPNYIDAEDIYIVRLFD
                     GSGRASSSDVFSIFDTDDFVQATSITKISHSKTAAVRNGTPSTSPSLSPSISSLKTTQ
                     TQTPTPTPTASHSASRHGYGENDAGFSMGIAAGLIGLLVLGFAG"
     gene            complement(<175412..>176974)
                     /locus_tag="TRUGW13939_06837"
                     /db_xref="GeneID:55994330"
     mRNA            complement(join(<175412..176395,176469..176656,
                     176705..176809,176860..>176974))
                     /locus_tag="TRUGW13939_06837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489981.1"
                     /db_xref="GeneID:55994330"
     CDS             complement(join(175412..176395,176469..176656,
                     176705..176809,176860..176974))
                     /locus_tag="TRUGW13939_06837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345874.1"
                     /db_xref="GeneID:55994330"
                     /translation="MADLVFLSLHPFVKSTVVDKVRGTIFGSALGDAIGLYTEFLSKD
                     LSTYAYGAYPEARFQLTTPTTEFYPDGHRNKFTLRSWTDDTDHALLIILSFLHSNGTV
                     ISPRDFAARLKVWVEQGLRCLDRLPLGLGATVGRVVCDKNYSKNPELVAYEVWASRGC
                     NIAPNGSLMRAHPLGIICIEKSLEETFQIAIDYSVVTHADPRCVVACCVHTALIRGIL
                     RGEVTSEEDVGRILEASFTSVEQWQQNGRLFNITKNTPRGVPADVLVAEPVLDRVEFD
                     RYVNASSFEELQLDSAREIGYVYKALGSCILCLRLAIRHSKGQLIDEQYMQAGTNIFE
                     ELITALIMQGGDADTNACIAGAVLGAWIGNIGLPPSWRNGLDHNRWLLHKCRAMEQVL
                     GIDESLTGYDGVKDRDTLSDGGRGLLDKPSLEARDAAFVEMYTKKMKRMAERKAHKES
                     KETGRGWIRGLLR"
     gene            <177442..>178688
                     /locus_tag="TRUGW13939_06838"
                     /db_xref="GeneID:55994331"
     mRNA            join(<177442..177513,177576..>178688)
                     /locus_tag="TRUGW13939_06838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489982.1"
                     /db_xref="GeneID:55994331"
     CDS             join(177442..177513,177576..178688)
                     /locus_tag="TRUGW13939_06838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345875.1"
                     /db_xref="GeneID:55994331"
                     /translation="MGGSRTYHTKSRNGCKNCKRRRVKCNLNSPCCSNCSRRGELCSF
                     QLSSCSFLVEGTRDQGEIEEGLGFNDYLSSIAVPTIEKWYPSMFPGQSRLESELICHF
                     TISCAPSLALASDAQFIWECEVPLIRSEHPFLNQAVLALSALHLCHLKTPNTLEYMNT
                     ARKSFAGAINQFQCHVKQITTGNCVALFGFSIIVAMFQLKVSSDTVARATIEDDQQVA
                     AGFDTITVLRATWKLTPFLGPWLLQTRLGTLFARGRDFDEQEYLDAANLELVFSRLEM
                     LNLSDIQVERSKVDCSQALDALRYWYTFMGRRLTIWLHVVWWPAAITDDFLRLLKIKD
                     PMALAIYCFWVLGMTRMSQKWFMEGWAEATFTSVVRSLDPEWKGLVQWVLKPILQRDL
                     SL"
     gene            <180227..>181230
                     /locus_tag="TRUGW13939_06839"
                     /db_xref="GeneID:55994332"
     mRNA            join(<180227..180503,180566..>181230)
                     /locus_tag="TRUGW13939_06839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489983.1"
                     /db_xref="GeneID:55994332"
     CDS             join(180227..180503,180566..181230)
                     /locus_tag="TRUGW13939_06839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345876.1"
                     /db_xref="GeneID:55994332"
                     /translation="MVRVNTLLTATTLLAWSATSLAGNRTCYYPDHSIAHDDVPCGDG
                     ENVACCGSGAICLSTGLCMDIDQQPYALSRLSCTDESWGSDCPNYCLQEASYNSSWIS
                     IVLFTYLDNVAKYCCNNIIDSGGDAACLNDLAPFRMPNAEIVENTNLLAGYVKANSTS
                     SSTNSTDSASNATTSASPTSANSTTTNNRSNHDAAIGAGVGVPLGIIALASIAWALWE
                     RRKLHRISAAHHAAVAASSTQVPQKQDAWNNTNSVQPAPPSNVQHTAPVGSQYSGYSS
                     NDVPVSGYQQPVVRNGQSGFSEMGSFGPVELEGERRS"
     gene            complement(<181679..>184116)
                     /locus_tag="TRUGW13939_06840"
                     /db_xref="GeneID:55994333"
     mRNA            complement(join(<181679..184014,184068..>184116))
                     /locus_tag="TRUGW13939_06840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489984.1"
                     /db_xref="GeneID:55994333"
     CDS             complement(join(181679..184014,184068..184116))
                     /locus_tag="TRUGW13939_06840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345877.1"
                     /db_xref="GeneID:55994333"
                     /translation="MYNVDKIRRKEYSHLNKTSYLDYGGTTPYAKSLVDESARLWKSA
                     LFGNPHSHSASSLLATEYVDRARSHALQFFRADPKHFDIVFVANATAAIKLVGYCFQG
                     KGFWYGYHRDSHTSMVGIREIASSGFHCFNSDDELEKWVDSQKDDIPLLPVDGSGMHH
                     PAKNNGSPKLIGYPAQSNMNGHRTPTHWAARIREVARSGDIEVYTLLDAAAYCSSAQL
                     DLSDPDAAPDFISLSFYKIFGMPDLGALIVRKTSSAILKSRRYFGGGTVDMVLPYDSF
                     HAIKTESIHEVLEEGTLPFHSLIMLDLAITLHKRLFRSMDAVSKHSSQLALSLHKGMS
                     GLRHANGQSVCEIYQDSNSTYGNSITQGPTIAFNIRMANGAIVHHDHVGALASACNIQ
                     IRTGGVCNPGGIAGHLRLASWEMRRNYCEGFRCGEPFKVRTGKPTGIVRASLGGMSSQ
                     KDVDTFLAFLQHFFVDDQEQNMQAQKPFKGHQQPWIAKQIQVFPVRHCSGWKLPANQP
                     WEIEPARLAMDGDWCLVDLRNAKVLDDPSATKRLSVDLDIKLGKLLLQGIVHGISSHI
                     SVDLWGLPKGDWLADSLEQLPSSKYRLARKFTSGDVEELITAVVGYPATLARFFEFPK
                     DLPIDLSLEKRPIRRAAQGIKVQFSEDMRRTDVHIVLSPRGRKRIHCHKYPRSLRFGS
                     QTLIYANSIEENLQDRNLGVVGRYFRRSDDTETIVSQNTSIRSRDFVLASWLDQVNSE
                     EANFEVLHFCPVVGCGEKRDDYTRLVEHLTSHAKSFVPPHRKKWRGTMRQLACF"
     gene            <187396..>188535
                     /locus_tag="TRUGW13939_06841"
                     /db_xref="GeneID:55994334"
     mRNA            join(<187396..187506,187591..187832,187881..188289,
                     188362..>188535)
                     /locus_tag="TRUGW13939_06841"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489985.1"
                     /db_xref="GeneID:55994334"
     CDS             join(187396..187506,187591..187832,187881..188289,
                     188362..188535)
                     /locus_tag="TRUGW13939_06841"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345878.1"
                     /db_xref="GeneID:55994334"
                     /translation="MRTNAVFPLLYSTGVAGLNLAWDIDSSNFLDKFDFFTDADPTNG
                     FVKYVDQSTASSASLFNTSNNQIYLGVDHTTTLSTSDAGRNSVRVTSKDTFSSGILIT
                     DFEHMPTAACGIWPAYWTLNNNGNPYGEIDIIESYNDVGYAYLSLHTSNACTMTGSDF
                     TGTNPRTDCSLSGNTGCGVQGTDAQFGEDFNSAGGGVYVLSLQDSLKVWVFQRSDIPA
                     DITSGSPDPSGWGQPLLDLESTSGCDIASNFIDQSVIFNIDFCGANGAGGQEWTDWTD
                     CSTKTETSTCNAYVAANPSVYEETYFSINSIKLYQ"
     gene            <189652..>190107
                     /locus_tag="TRUGW13939_06842"
                     /db_xref="GeneID:55994335"
     mRNA            <189652..>190107
                     /locus_tag="TRUGW13939_06842"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489986.1"
                     /db_xref="GeneID:55994335"
     CDS             189652..190107
                     /locus_tag="TRUGW13939_06842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345879.1"
                     /db_xref="GeneID:55994335"
                     /translation="MSSTIVEYLTTKRPGSGILDQPYTSLYNVTATDPAWDVWRSIRG
                     PLYQLIASVLDRNCRFIALDMMKHIGQDPHLADTTLVVLFPSAATAEHWLALEIAITN
                     LVQEKAEDYGYHEPIRVLFHYSDKPLETLYRAKRFLDETIGIAYDPAWL"
     gene            <191881..>193865
                     /locus_tag="TRUGW13939_06843"
                     /db_xref="GeneID:55994336"
     mRNA            join(<191881..192421,192487..193000,193067..>193865)
                     /locus_tag="TRUGW13939_06843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489987.1"
                     /db_xref="GeneID:55994336"
     CDS             join(191881..192421,192487..193000,193067..193865)
                     /locus_tag="TRUGW13939_06843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345880.1"
                     /db_xref="GeneID:55994336"
                     /translation="MPATNDKFIFVNAPTIINAGPRDARRQLRSQLMRRVYLRKYQEP
                     PPRIEDVVDTIEREPPKDDSEGDSSSSRGHTTSPPMGTTGSAAPHPVTSIDSKLPTPP
                     SEGDGDDGCNRCGGYCRSPGQCQPVIHTRKKPKLLSPAKEAPLDLGPLLSSIAVSTLN
                     PFAVPDDGVNAPNSHMLIHHYARSLIPALRSGKDWHAGVSSNYLRLLPDPIVFNAICL
                     SASIHLDRSTIWSGIDAEHAVRKWEQHYYRYNALRALRQVLAKCNPKIGTPEFDSVLV
                     SICMLAINDLHGETSQGIIKRDYNPFSNPLPTLGALNVYGYKPVHYFHWNGLVNLLSQ
                     HGGFHNLTLFAARFKISYTAVKYSLHTCTKPAFPICNHKGEILTGYSVLGVLGMTPSQ
                     VPPHTGEGFRNLQTLMIRESIFRPFIELSQLAQAIPLLVPKCSDPTTEDLIADARNLS
                     QYRFQNLPLLTEDPLLVVDIMVEESIEAEDILTQDIIHATFAVYGLCWLVTQLFTSHV
                     TFSVPSSRRFRLNGVFELQSTMNRCESVAYNNLYVMRLQVWAMVIGGIAAEDIDIGLR
                     NWMVSRLQDLCRKLGLRDWAAVSEVLNTFAWMEYACDHAGRKLWAEVENMT"
     gene            <195908..>196891
                     /locus_tag="TRUGW13939_06844"
                     /db_xref="GeneID:55994337"
     mRNA            join(<195908..196028,196107..>196891)
                     /locus_tag="TRUGW13939_06844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489988.1"
                     /db_xref="GeneID:55994337"
     CDS             join(195908..196028,196107..196891)
                     /locus_tag="TRUGW13939_06844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345881.1"
                     /db_xref="GeneID:55994337"
                     /translation="MGVGILGFISSLVYQRGISTTARMAAADVQAPVISLSHGGGPMP
                     ILGDPDHRHLVNSWKTRVRKVLKLNTPEAPKAIILVTAHWSTGQPTISSGSRHELYYD
                     YYGFPQEAYSLKYNASGSPDIAQEIFKRLQKAGFSPKLDDKRGWDHGVFVPLKMIIPD
                     ESIPVIQMSVLDSEDPEDHFKMGQAISDLRKENIAIIGSGYATFHNLRVMFSGSANTP
                     AFKANIREWSEVLNEAVMTEEADKRLAKLKHWRQFPHAYTMHPNGGAEHFLPLIVAAG
                     AAGSGKGGLYGDEYKGNDMFSFYWE"
     gene            <197508..>198593
                     /locus_tag="TRUGW13939_06845"
                     /db_xref="GeneID:55994338"
     mRNA            <197508..>198593
                     /locus_tag="TRUGW13939_06845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489989.1"
                     /db_xref="GeneID:55994338"
     CDS             197508..198593
                     /locus_tag="TRUGW13939_06845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345882.1"
                     /db_xref="GeneID:55994338"
                     /translation="MTINNHYRGSSVVVDKFVEISDYILDRVNHLPETRLEMRSKHIN
                     ILLDEIEDGPLRIIDPYMLHWVLSSSTPCIDNGWWDDWCLTPPFTGFGDYEFEAPYSN
                     HLHDSQGAAVIIAARSNDVALLELLIMEGSEYPIDLVIGDPLNYAAKEGFEDVARLLI
                     HMKGAVPVYEELLIPYDIPDNIPDNISYVSHDELDFGRTWDFDLTGIHFAAQYGSASI
                     LRTMIALGFNLEVTTTMANQTALHIASIYDSQDFARVLLQHIRDVNPKDADGNTPLFY
                     AAKNYQSGVFRVLLADMRVDINLKDYKEVSILSRAIMNQSTKDIELILARKDLIIDFR
                     DSEILDALTYAILNGSEAVVKLLVKLD"
     gene            <199300..>199824
                     /locus_tag="TRUGW13939_06846"
                     /db_xref="GeneID:55994339"
     mRNA            <199300..>199824
                     /locus_tag="TRUGW13939_06846"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489990.1"
                     /db_xref="GeneID:55994339"
     CDS             199300..199824
                     /locus_tag="TRUGW13939_06846"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345883.1"
                     /db_xref="GeneID:55994339"
                     /translation="MKLHASLHSASLLSLALQPATATASPSTGHLARRDDIPNSYYHD
                     KQNAKGMPYNLCDSCSCGGDWWQGGSCALYPDYYSSPNPPPADVYPVVVPTSLMEQFG
                     SVNSNNPLCGHVMHLTGPNNVTVKAAISDTDTLDGIFMCYDLWNVFGYDLNSPSSMNV
                     TWTLISNYTIGQKD"
     gene            complement(<199990..>201638)
                     /locus_tag="TRUGW13939_06847"
                     /db_xref="GeneID:55994340"
     mRNA            complement(join(<199990..200128,200199..200277,
                     200330..200525,200579..200639,200693..201159,
                     201216..>201638))
                     /locus_tag="TRUGW13939_06847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489991.1"
                     /db_xref="GeneID:55994340"
     CDS             complement(join(199990..200128,200199..200277,
                     200330..200525,200579..200639,200693..201159,
                     201216..201638))
                     /locus_tag="TRUGW13939_06847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345884.1"
                     /db_xref="GeneID:55994340"
                     /translation="MSSPHEYNWRRLSVGVIGGGIGGMSVAIALRRAGHEVTIYERND
                     FAGEVGASVSCAANGTRWLHEWNVDVAKGDPVVLRKLINRDWKTGEPVSTYALDDYEE
                     RWGYVYNMFHRQYMHAMLKDSALEEEGEGIRAKLLVHHQCEDIDLVNGMITFTNGKTV
                     HHDLIIGADGIGSAVRKIIGLNPEKRPSESSCLHANVRTEDAVRLGLVDYSKHDALEY
                     WGGQEGKWDKIVLSPCNGGRLLSYYCFFPRAQGDYTNHTWGGEDLSVEELLAPYPELD
                     RHVFGHLSIGKEIQPWRLWVHQPYPYITRSMVCLLGDAGHPMMPHQSQGACMAIEDAA
                     ALGILFSKAYFSGDVHETLSIYQEIRLPRATKVQSAAAKAAYNINERIGFSSNTNNKL
                     YSVENEKGKLTIEEMNGYDMYKHVDEVMARRKGRSYKENFKDGIPLDLKLPNGTPVVE
                     VARL"
     gene            <202402..>204045
                     /locus_tag="TRUGW13939_06848"
                     /db_xref="GeneID:55994341"
     mRNA            join(<202402..203465,203637..>204045)
                     /locus_tag="TRUGW13939_06848"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489992.1"
                     /db_xref="GeneID:55994341"
     CDS             join(202402..203465,203637..204045)
                     /locus_tag="TRUGW13939_06848"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345885.1"
                     /db_xref="GeneID:55994341"
                     /translation="MPRRINRALVQFAVFCGLLSFILFVNRPQRSTDKLFSWNTVRYK
                     TTSRTLPESRGICPHLSGSKKPALVVARVSGDGDPKWVDALSDKYHACVYTADAPIDG
                     TSKFLQVPANRGHEAMTYLTFIIDNYDQIPERGAVFVHGSRWAWHNDEPVYDNAALLA
                     DLDVSAALGPWGYHNLRCDWSVSTCPATAKPQGSLELSLKAKVSPWDARAVSDSLLPG
                     ALESVFGGDKRTLKRDDNPERHFAPGRHDILRSQCCAQFVVAKANILQHSRDEYIALR
                     QWLLDSGDNREAAPRDDRVAGRILSYMWHVLFIAHDDQTNGISLEGLNSAACPRAEDC
                     YCRLYGRCNLEHCSAGSCRGQHSCIMPLSTAEADLIKRATSAVNSIPPSDVHSVASAA
                     IDSNDQVFTGVNVHHFTGGPCAELVVLGMAAAAGASKLTHIVAIANNQGGIPSPCGRC
                     RQVLFDLQPQIKAIVAEDGGGPRAMAITDLLPYTYTYKQA"
     gene            <204067..>205970
                     /locus_tag="TRUGW13939_06849"
                     /db_xref="GeneID:55994342"
     mRNA            join(<204067..204078,204488..204657,205025..>205970)
                     /locus_tag="TRUGW13939_06849"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489993.1"
                     /db_xref="GeneID:55994342"
     CDS             join(204067..204078,204488..204657,205025..205970)
                     /locus_tag="TRUGW13939_06849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345886.1"
                     /db_xref="GeneID:55994342"
                     /translation="MSMRSLTEARIETNNTLSLSVMADTKPFIWYQNDSSHVTMIGCS
                     AYRRDSRVPDRISSYVRRATQASVFPLFSPLLVSLTVIQSWRRLQSQSSSVPATPAPT
                     TSNRNSALSSTATDNNSRSHSHHQLLLSPSAYHLSLPVASFSTPSSQLLPPLFPELPS
                     NPPYHYLEAPSYPSEGHLLADVTAGGDFSHAFSFLSSDDFLQGLEEHSSLPVPQDNVY
                     YTTRRPSRETENPLMTAPELSTQAPPVSNLNQSHPSILRHDNTPVSCSSLPVASLPAP
                     SPSPSTQSSSIASRKPANSDLSSLKRPLADGQSPVEDEAVVEKRQRNTIAARKARRKK
                     DDRIITLETELAAVTRERDEMKLLVARLEGENAALKKVGWG"
     gene            complement(<207359..>208366)
                     /locus_tag="TRUGW13939_06850"
                     /db_xref="GeneID:55994343"
     mRNA            complement(join(<207359..207400,207472..208236,
                     208322..>208366))
                     /locus_tag="TRUGW13939_06850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489994.1"
                     /db_xref="GeneID:55994343"
     CDS             complement(join(207359..207400,207472..208236,
                     208322..208366))
                     /locus_tag="TRUGW13939_06850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345887.1"
                     /db_xref="GeneID:55994343"
                     /translation="MAKIDVPQREDSAQDDTRATDLLHYIFSLPNLEAIRGNPAKVIE
                     AIDDYSDNYKFLMNVGINKGGHVVSLIHQQKPSTMVEVGAFVGYSAIMFGSAVRECGG
                     KQYFSLEINPVFAAVSSLLVELAGLGDFVQFLIAPCNVSLAKLVHDDMLENGQINLLF
                     IDHWQKRYVPDLWVAEQLGLLKPGVSTIVADNVVLPGAPDYVEWVTASTAEKREKLKT
                     AETLSTLKADSLADHIKKTGYGAGKVNLDNVLGNPNLIYETECHRYPLLNAEDALAVT
                     KVVGLEK"
     gene            <209342..>210592
                     /locus_tag="TRUGW13939_06851"
                     /db_xref="GeneID:55994344"
     mRNA            <209342..>210592
                     /locus_tag="TRUGW13939_06851"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489995.1"
                     /db_xref="GeneID:55994344"
     CDS             209342..210592
                     /locus_tag="TRUGW13939_06851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345888.1"
                     /db_xref="GeneID:55994344"
                     /translation="MATPSNIQRISRQTLTLIHKNLLVAWKKPFSTIIRTLVVPIALT
                     LIFCFLKHISPPSVNIGPAGFSNETIPILSLGEAAKTASYTRLAFVTNGIEDPALDHL
                     IQGVISGPGMSVIDTQTVNNTADLFDVCSQTIQGAGKYFAAIIFTSFNETNVDYSIAI
                     SEDIATNYPTNYNNQQSLLSRYMLPVQWAVNSQLGNLSDDAKPSERMWSGFFNEDSSE
                     TTSYLDSAKQVFWLEIVQVFVAPLFICIFVGAAYHISTLVTSERQLAELMAAQRITST
                     PRILSTIISFIVMYSPGLIICSVLTTEILFSHASGGLFFILTVFCGCSVIIFSHFIAS
                     FFQKPSIAGMTCSILVVCLALITLATTLQEYPSPTQIRGLALLFPPPGLLSLGRHPGV
                     KYPSPSLLTSKQMTHIRKPFPNHF"
     gene            <210854..>212146
                     /locus_tag="TRUGW13939_06852"
                     /db_xref="GeneID:55994345"
     mRNA            join(<210854..210892,211045..211284,211349..211438,
                     211511..>212146)
                     /locus_tag="TRUGW13939_06852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489996.1"
                     /db_xref="GeneID:55994345"
     CDS             join(210854..210892,211045..211284,211349..211438,
                     211511..212146)
                     /locus_tag="TRUGW13939_06852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345889.1"
                     /db_xref="GeneID:55994345"
                     /translation="MAEARRLFSNASLIFWDALTVREHVQIWRILRIAASGTQLINDA
                     DVISECDLNDKIGAAAKTLSGGQKRKLQLAMAFAGGSKMVCIDEASSGLDPLSRRNIW
                     DIIQKGRSRRTTLITTHFLDEADVLADHIVVLYRGHLVCQGSSTALKDQHGDGYRVAS
                     INSLQEGNTLGWKFDTSVEATHKVIELESANEVCDVIYPTLEQVFLKVTSDSNSARHI
                     GGDGLIGDEEAQTAINNKSDFLEEEIEGSSELNLDVAKSIGMIRQVWVLFRKRYMLLR
                     SSWFAYLVNLAIPIVVAAILFKYIQDWTTLDTCDMQRDALLSGAPLARIPSYRSLAGD
                     "
     gene            <215356..>216720
                     /locus_tag="TRUGW13939_06853"
                     /db_xref="GeneID:55994346"
     mRNA            <215356..>216720
                     /locus_tag="TRUGW13939_06853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489997.1"
                     /db_xref="GeneID:55994346"
     CDS             215356..216720
                     /locus_tag="TRUGW13939_06853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345890.1"
                     /db_xref="GeneID:55994346"
                     /translation="MKSDDSSFALWHQFLSQHEGVEFVWLQYMGLNGNILGRAIPVPR
                     FTKLLEINKPVSLTRAVFYLLPHDHLAEGGEPVGAFGLKPDLSTIHLWTGATNRAVIT
                     SYGVQSEDGTTPIAECPRSALVRLSKVLTKETDFYPLIGFEIEVVFMQRAKDIKGKVV
                     AYETINENHSFQSMTTDDNSYMELVEDVARSLLAAGIEIEQFHAEAAPGQWEFVLPPN
                     HPVEAVDTLIRARTIISLVAEKHDHRATLHPRPSEMHAGSGAHVHISLNEKAPLKNDR
                     HEFNGSHESFFAGIMIHLPAILAFTLAQPESYRRVMSGIWSGGEYAAWGWENKETALR
                     RVENNRFEIKLMDGLANPYLALSAMFAAGIDGLRNGLPLVGGPCRRAANLLSPQERKE
                     LGIHALPKTLSQSLSALEADTVLCGLISQELIEPYFAVKRGELEQTKQWTETERRNYL
                     ISRY"
     gene            <221501..>221999
                     /locus_tag="TRUGW13939_06854"
                     /db_xref="GeneID:55994347"
     mRNA            join(<221501..221529,221601..221726,221798..>221999)
                     /locus_tag="TRUGW13939_06854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489998.1"
                     /db_xref="GeneID:55994347"
     CDS             join(221501..221529,221601..221726,221798..221999)
                     /locus_tag="TRUGW13939_06854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345891.1"
                     /db_xref="GeneID:55994347"
                     /translation="MVKDTNTVIEEFNSLVNMSASELGDWLQGKQSQSSGWSKPDLSD
                     NETIGHESGRKIVSILQKNPCKDPDRYDGEDIQHMRRVVAYCKRHLAQEGVAKQNTNS
                     KSYKSMKNWGHDPLKT"
     gene            complement(<222400..>223578)
                     /locus_tag="TRUGW13939_06855"
                     /db_xref="GeneID:55994348"
     mRNA            complement(join(<222400..222593,222736..222848,
                     222899..223155,223210..>223578))
                     /locus_tag="TRUGW13939_06855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035489999.1"
                     /db_xref="GeneID:55994348"
     CDS             complement(join(222400..222593,222736..222848,
                     222899..223155,223210..223578))
                     /locus_tag="TRUGW13939_06855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345892.1"
                     /db_xref="GeneID:55994348"
                     /translation="MYVCTVVTLLAMASIYTSNDSIPNNTQPVGSNPVIIANVDYLGE
                     QRTNSCTHRDLGFLGQLTGRWYAVYGDTLWCKASVTEPSQDPEGFHGMVRDSIAECSD
                     SALRVKFTQLNEDSPVAHPKQFIPCNEAWGKTLTTGFGGTSLCPVDDDNSLIFYLVNQ
                     NPDGLVGAGAAQVQLSNDSPTVVKRYGENGWWWNATHEARYGLHLWLGRYEFLHEKPG
                     IRDSMNTGGDVTVLETKHTLNHVQQGDCFAIRTAPAPEGPWSDDVKVYTPTPIDSGFT
                     YAPGVHPYLDSAGKTLTISYTNKNHIQVIKVTLE"
     gene            complement(227784..227884)
                     /locus_tag="TRUGW13939_06856"
                     /db_xref="GeneID:55994349"
     tRNA            complement(227784..227884)
                     /locus_tag="TRUGW13939_06856"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:55994349"
     gene            complement(229177..229277)
                     /locus_tag="TRUGW13939_06857"
                     /db_xref="GeneID:55994350"
     tRNA            complement(229177..229277)
                     /locus_tag="TRUGW13939_06857"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:55994350"
     gene            <229904..>231416
                     /locus_tag="TRUGW13939_06858"
                     /db_xref="GeneID:55994351"
     mRNA            join(<229904..229960,230012..230303,230364..230454,
                     230514..231211,231271..>231416)
                     /locus_tag="TRUGW13939_06858"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490000.1"
                     /db_xref="GeneID:55994351"
     CDS             join(229904..229960,230012..230303,230364..230454,
                     230514..231211,231271..231416)
                     /locus_tag="TRUGW13939_06858"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345893.1"
                     /db_xref="GeneID:55994351"
                     /translation="MEMACSNVGNSNPDIAGLGIILSFVIQAGISFLLSFWSAILDVE
                     LGKPVLRTILPQWAQNLPVLRPYRSRQKLDDSDIEACSTADNCSDFGLLPLKLREWHI
                     DQMLAIISDIQILNGISLLIGAMAQHKTLDLYHYHIIYDVVNFTGISVCASLVNVFGN
                     RRPSIVDRCVLMGLFVILYLAFVIVFGMNLKQWDENTPGRCYYTDAIATPSSSHPYVD
                     KIYVAITCLYFLGSILMCSLVAIFTLHPKIGQVDHVFFEFFGVTQDYEKVALYGSSKL
                     TITMKVINSLKGWIPSKLGENYKAVLIFFQKFDALSVLKTGYKTSVLIIAMMQYPVHV
                     YTVFALRTANEDRLDGDSENYWGFGQVVALALLASSVLQCIRTVIDYRKRLGDIKKKA
                     GITFNEIETRHSEYGSSQGSTHSLLSYGMCQRNSV"
     gene            complement(<231774..>234455)
                     /locus_tag="TRUGW13939_06859"
                     /db_xref="GeneID:55994352"
     mRNA            complement(join(<231774..233749,233809..234211,
                     234276..>234455))
                     /locus_tag="TRUGW13939_06859"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490001.1"
                     /db_xref="GeneID:55994352"
     CDS             complement(join(231774..233749,233809..234211,
                     234276..234455))
                     /locus_tag="TRUGW13939_06859"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345894.1"
                     /db_xref="GeneID:55994352"
                     /translation="MLLSLALLASTAYGSNTLNSFIKRSLLDPIGTDSAESIAGGTVE
                     CSAAPVITFFDGLKPPFPTNSWWAPYAAPPGNATAAGPFPYESALDGNGVIFGVSTQR
                     SFDGTSIKQPTQADWRASFVEHSGEFSNHKAVGFDTQSVTVQYFEESASMTFYGVPGS
                     PYVTFQYNQSTPVLTAMRGGITSFNNQTLSVGANVTVTGTQFSVSSKNSTYLIYALSP
                     ITLTATATSSDEGSISASSPFSGVLRLAMLNETSHKALLDQYSGVYPTSVGLDYSWTN
                     STGTIVFNWDTAGNGSDLLMLTWPHHRITMQKPNFPDITALSYLTIKGYMYPALGKQW
                     QLLYNLTSNLWDPPRDLDDSCSASVLKGLEYEVGQLNVSNAPVPGDFYYWGGALNSVA
                     RLASIADNLGRSDLVDPVIQYLEASFAYWFNTSATTLPAYETAWGGVVDKAGATDANI
                     DFGNGFYNDHHFHYGYFLSVAATIAKYDSSWLKDNKDYINWFARDIINPSLDDPYFPV
                     TRCRDWFAGHSWASGIANGAGSRDQESTGEAVNGYYGAALWASVALSDDYLNYARLLL
                     ASEMHGAQVYWHLYPDQSATDPNNPYPEQGVRELVTIGNVEDWQSGAWLFWGAQKSEI
                     AAIQQLPITPANEALYDTEWVENVWSYAMDEILDPTIGDSWKCVMIAAYSNAHPQVAA
                     EWSANITDWGTGQTYTNELYFIGTRPNLSGGSICGVLPENPYGTFQLQEASSGNYVTA
                     SSENTNLTVSATNSTGAIFNSSFVPNAGTLQLISTGEYVTSDSSGNFTLSASRETVSS
                     WERFVVRQKLGAETGVYSIKAASNGLYVTVNSDGWLINNGVSETDSTGFYFHST"
     gene            complement(<235713..>236891)
                     /locus_tag="TRUGW13939_06860"
                     /db_xref="GeneID:55994353"
     mRNA            complement(join(<235713..235738,235792..235866,
                     235931..236067,236128..236244,236383..>236891))
                     /locus_tag="TRUGW13939_06860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490002.1"
                     /db_xref="GeneID:55994353"
     CDS             complement(join(235713..235738,235792..235866,
                     235931..236067,236128..236244,236383..236891))
                     /locus_tag="TRUGW13939_06860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345895.1"
                     /db_xref="GeneID:55994353"
                     /translation="MLRILTLSILATSKLASAHVVAWHPGMYCLGGNDTSVDDPNTNL
                     AVNPLWDLPKSKWWFQADRGCDKAPPVDGVFLELPAGQNFTTELAHNRAQTTLSFNGQ
                     YAGEWPDGKDHPEDWSGTGTPPGCIQDDGAIHTNNQTMAGGTVFAISYQSDMSQVTME
                     NLVVFSVLEHTPWKRIATYEVPADLPPCPDAGCICAWGWVPQGCGEPNMYMAGYKCKV
                     TGSSSTKQLAQAQVPKYCANDTSECVGGAKQILVMNQADGNNVVAPDNDFVAYNEKWG
                     FQNGAQNDIFM"
     gene            complement(<237904..>239681)
                     /locus_tag="TRUGW13939_06861"
                     /db_xref="GeneID:55994354"
     mRNA            complement(join(<237904..238562,238635..239116,
                     239225..239396,239471..>239681))
                     /locus_tag="TRUGW13939_06861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490003.1"
                     /db_xref="GeneID:55994354"
     CDS             complement(join(237904..238562,238635..239116,
                     239225..239396,239471..239681))
                     /locus_tag="TRUGW13939_06861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345896.1"
                     /db_xref="GeneID:55994354"
                     /translation="MRSILGKGKPLQLGITVCCLIAFILYGYDQGVFSGILENKDWLD
                     QFGHPSDSKTGIIVSCYNLGCFAGCILNYIFGEKLGRRRAIWLAMFIVVVGATLQATA
                     FNVPHLVVGRLVTGCGTGIKTSTVPMYQSELCDRKLRGRLVSAEVLFVGVGITVAYWF
                     DFGMSYVGGPIAWRLPIAAQIVFALIVIVLVLGLPESPRWLFQHGREDEAMAVLCAVY
                     DKEPTDQYIINERDAISSAIELELSENKPRNFFSIFRDDRVKTRKRVLLAWFVQFMNQ
                     AGGVNLVVYYAPSVLVQNVGLSANLAQILGGCINMMFMFGSILPSFTLDRMGRRKTMI
                     TGCAGLSLCMMMVSILLSRADSPNGTSCSSAAVAFFFCYMLIFGMTVNCVPWVYVPEI
                     LPLEARARGTAIGVSSNWLWNFTVVMITPVIINRLQWKAYLIFMITNALFVPAFWLWF
                     PETSNLRLEGVDYIFSSGGDPVKVARQLAIDIKTHGYDVTMGNAENMKSASEMSIAS"
     gene            <240438..>241345
                     /locus_tag="TRUGW13939_06862"
                     /db_xref="GeneID:55994355"
     mRNA            join(<240438..240988,241051..>241345)
                     /locus_tag="TRUGW13939_06862"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490004.1"
                     /db_xref="GeneID:55994355"
     CDS             join(240438..240988,241051..241345)
                     /locus_tag="TRUGW13939_06862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345897.1"
                     /db_xref="GeneID:55994355"
                     /translation="MPRVFFITGASSGLGRAYAQEVINRGDFVVATARKIESLQFSGT
                     SAKNYLPVSLEITDRANIVAALRAAVDTFGRIDVLVNNAGYGLVGIFEELTDDEINRE
                     MAVNFFATLDVTRAAIQLMRDQTPCGGVIQQITSITGQCGFSMMSLYCASKWAVEGFT
                     ESIAQEVNPAWNIKFTCIEPGGFRTNFFNSISLQESKTPAYAHLHPRETTKALEKAQR
                     GDPSKGAKAMYELGIMKDPPLRIVLGSDALEQMLTKTEQYGISLRKYEHISSSTDADE
                     NEKWK"
     gene            <242136..>243173
                     /locus_tag="TRUGW13939_06863"
                     /db_xref="GeneID:55994356"
     mRNA            <242136..>243173
                     /locus_tag="TRUGW13939_06863"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490005.1"
                     /db_xref="GeneID:55994356"
     CDS             242136..243173
                     /locus_tag="TRUGW13939_06863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345898.1"
                     /db_xref="GeneID:55994356"
                     /translation="MSRILVTGGTGFLGAAVVDVLLARGHSVVTTVRNAEKAQQMRAH
                     FPSDKLDFVIVEDIAKLDAFDEAVVHDPPFDAVIHTASPFHYNIQDIRKDMIDPAVNG
                     TVGILQSIKKNAPTVKRAVITSSFAALFQADKPRGSKYSERDWNPVTLDTVSDPVNSG
                     GQAGYRTSKALAEKAAWEFMEKEKPGFTLTALNPSLIFGPVLPWLHSVNAINTSNERF
                     WKFISGAEKLKCSPTGSLFWVDVRDAALAHALAAEKPEVAGKRFFLTAGNFCNRELVE
                     IIGDAFPELRDGLPSGDEALKDGSYPPGGPAHGYDNSASRKELGLEYRSLKESTIDTV
                     KSIQALQNRVQ"
     gene            <243493..>244567
                     /locus_tag="TRUGW13939_06864"
                     /db_xref="GeneID:55994357"
     mRNA            join(<243493..243920,243979..>244567)
                     /locus_tag="TRUGW13939_06864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490006.1"
                     /db_xref="GeneID:55994357"
     CDS             join(243493..243920,243979..244567)
                     /locus_tag="TRUGW13939_06864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345899.1"
                     /db_xref="GeneID:55994357"
                     /translation="MAVIREHLAAKGLGLFNDLQTESSVVGNFPVIEMFSRFGTETQK
                     TEFIWGQLDGRVLMTFGLTEPNHGSDATHIETFAVPGSSSTARPGWLINGRKMWQTGQ
                     HRATHCIVFARTSGKPGSSRGITAFIVPADSEGVRIESYQWTFNMPTDHATTSFVNVW
                     VPEDAILGQVDDGLTVAQCFVHENRIRQAASSLGAATYCVQQSIEHAQTKKPFGRPLM
                     NNQAIQFPLVRLATQIEMLRLLIYKTAWEMDRTERSKIEHVMTDKISMCNYWANELCC
                     NAADRAIQIHGAIGYSRHKPFEHIYRHHRRYRITEGSEEIQMRRVGARLGKWTRDRTS
                     YLKL"
     gene            complement(<245531..>247026)
                     /locus_tag="TRUGW13939_06865"
                     /db_xref="GeneID:55994358"
     mRNA            complement(join(<245531..246919,246976..>247026))
                     /locus_tag="TRUGW13939_06865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490007.1"
                     /db_xref="GeneID:55994358"
     CDS             complement(join(245531..246919,246976..247026))
                     /locus_tag="TRUGW13939_06865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345900.1"
                     /db_xref="GeneID:55994358"
                     /translation="MVHHGPARGCQRCKDRHCGLERPACRQCVKLNFRCPGYRHELDV
                     VLRDQTTSVVRRHGGNRNGRKPAASSAQVASTNRFNKPSLPGEIVSGLETFALSFLVF
                     GSGLVGDGRTSHGHLDSLQSLYQKSAPMPLFTLTTSWMATLVLSMVCKTGKQQCLNEE
                     SRLMAKVIQSIRKAVIDPVSSVSDETLAAVVILGHGEFLRSKLHISPPSEKPVSFMIH
                     QAGAEALIRRRGLLNFQGSSSVALFDAVRHNAVSIATIEPRGSHTLNWDLWDIMDDRF
                     RELCDSYTPATELDACGARIISLKRRVQNTSVYDNSPDLLQKDLIALFDRIQSWRWRI
                     PADWKSNDAATEVSNQTPNVQYLFNEWYLLQLEASHLIKQFKTKFNDQNPCETEFTRE
                     LEWVDIVIASTYPLLGQAPAPHLKISRKATPIARKECDALRGPRLFGQSIEKLEIILL
                     NALKSLQLPAMVESRYKEIVNWVKVKRTH"
     gene            <247473..>248267
                     /locus_tag="TRUGW13939_06866"
                     /db_xref="GeneID:55994359"
     mRNA            <247473..>248267
                     /locus_tag="TRUGW13939_06866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490008.1"
                     /db_xref="GeneID:55994359"
     CDS             247473..248267
                     /locus_tag="TRUGW13939_06866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345901.1"
                     /db_xref="GeneID:55994359"
                     /translation="MTTFKYINKLQGKRVLIFGGTSGIGHAVAEALLEHGAKIVISGS
                     TTESVQRAIARLQKAYPDVNPERIVTAVCDLVQTDTLEDRLRELLKEVVSKDEQKIDH
                     IVFTAGNRFDVAGGITGTDIPLVNSIMAVRVYAPILIARVIATTDYVTKSASTSFTFT
                     SGTAHTRPRKTWPIIAMMSGALQGLATGLAVELAPIRVNVVNPGLFKTELASEWVPEA
                     LEAASNMTLTKRLGQPEDIAEAYLYFMKDASVDGTALVSDNGKVVA"
     gene            complement(<248500..>251487)
                     /locus_tag="TRUGW13939_06867"
                     /db_xref="GeneID:55994360"
     mRNA            complement(join(<248500..250209,250618..250809,
                     250872..251151,251213..>251487))
                     /locus_tag="TRUGW13939_06867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490009.1"
                     /db_xref="GeneID:55994360"
     CDS             complement(join(248500..250209,250618..250809,
                     250872..251151,251213..251487))
                     /locus_tag="TRUGW13939_06867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345902.1"
                     /db_xref="GeneID:55994360"
                     /translation="MIPVHADKALDILQLVLYIPLLLLSQYCLIRHGKQGLLGWLYVS
                     AFCIIRLIAAGLKIHSDTTGTQSSAAVIVDNIGLSPVILGALGLLHEARMARGSVRNT
                     KLEWLIVLQIHMFVTAGLALVAVGVSSLFSSKSSPDSAMTLLKAGFAIMFVGWGIIVG
                     LCLWSFRRPASYGQVESTVFRDGTILLNAVFFSLPFILLRAIYGAINLFGSEDTIGTS
                     SFSSNVAANVIMNVFAQLGAAIIFVIAGIRTISENIKMGTRTGTETDIEYPYNLGPYR
                     RFITTTSAAAQRWFNRGLIWTYAFNHEEAVSCFKKALEHDPECVLAYWGLAYALGPNY
                     NKPWESFDGRELSDSLHEAYAAVKRATDIVKSRRVTHIEAALIKAINLRYPSETPDED
                     FSVWNVEYADAMKAVYEEFPHDFDVLALYADALMNLTPWSLWDLKTGQPAPGARTLEI
                     RNVLEYKTLARGKGLYHPGVLHMYIHLMEMSAVPESALRIADYLRELVPDAGHLNHMP
                     SHLDMLCGEYRQAIISNTRAIHADEKYESNTGSLNFYTLYRAHNYHFRLYAAMFAGQS
                     AVALDTVSRIEKGIPEKLLRIKSPPMADWLEGFLGMRVHALVRFGRWEDILSLTIPHD
                     QELYCVTVAMIHYAKGIASAILHRIKDARTYQRLFMKAVETVVPSRTIFNNKCTNILA
                     VARAMLAGEIEYRTGNIEQAFAHLRESIELDANLPYDEPWGWMQPPRHAYGALLLDQG
                     RVEDALEVYETDLGINNALPRAMQHPNNVWSLHGLYECYVSLGRNGEARLLKRQLDMA
                     VAVADIPIKASCFCRVDKCH"
     gene            <254377..>255281
                     /locus_tag="TRUGW13939_06868"
                     /db_xref="GeneID:55994361"
     mRNA            join(<254377..254416,254473..254563,254614..254776,
                     254990..255052,255109..255195,255258..>255281)
                     /locus_tag="TRUGW13939_06868"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490010.1"
                     /db_xref="GeneID:55994361"
     CDS             join(254377..254416,254473..254563,254614..254776,
                     254990..255052,255109..255195,255258..255281)
                     /locus_tag="TRUGW13939_06868"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345903.1"
                     /db_xref="GeneID:55994361"
                     /translation="MSQRTAARAGDVPALPATPPVPIEKIPPIALDCISDPPTWVKFT
                     SASWRVSCDRANLPASLNDRRPTDRPTSKHLPCAQSGFSATYGTDTVSITLDLMGSLA
                     RAGKVKAATPKVDKQEKPKQPKGRARKRMIYTRRFVNVTLTGGKRKMNPNPGT"
     gene            complement(<255658..>256998)
                     /locus_tag="TRUGW13939_06869"
                     /db_xref="GeneID:55994362"
     mRNA            complement(join(<255658..255893,255956..256265,
                     256333..256646,256953..>256998))
                     /locus_tag="TRUGW13939_06869"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490011.1"
                     /db_xref="GeneID:55994362"
     CDS             complement(join(255658..255893,255956..256265,
                     256333..256646,256953..256998))
                     /locus_tag="TRUGW13939_06869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345904.1"
                     /db_xref="GeneID:55994362"
                     /translation="MNIIFHIQMSTSTGISSYTIGFETAHSNGCQQSNTPCTLGVYEN
                     LTSSTPKWVSNDYGNGVIDHGYGSYINDTLSYTLSGNGTRDPPIVLPNFQVGTLDTFY
                     ASFVLPAPTGWFLRARSTLYERDVIPRCALSIYLGKDEPLVDYALLVINGQDIAKQAS
                     APFTVPMVSPQDMNSAGAVPSLFYVNVTSFTLIFSVANATTASETLRPTVDNNSDIQT
                     RSDRSVSQYFHISTNSSNSDPYTVECDFENVDLKENKINVYFNPGRDLVSIPLASLVS
                     TFGPDKCAVWLDGGGNLHPADLGAV"
     gene            <257401..>260968
                     /locus_tag="TRUGW13939_06870"
                     /db_xref="GeneID:55994363"
     mRNA            join(<257401..257451,257874..258200,258271..258733,
                     258778..259315,259369..259498,259640..259698,
                     259758..260747,260893..>260968)
                     /locus_tag="TRUGW13939_06870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490012.1"
                     /db_xref="GeneID:55994363"
     CDS             join(257401..257451,257874..258200,258271..258733,
                     258778..259315,259369..259498,259640..259698,
                     259758..260747,260893..260968)
                     /locus_tag="TRUGW13939_06870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345905.1"
                     /db_xref="GeneID:55994363"
                     /translation="MLGKEQNKANDLQKDEVATFLLIVGACVAKIFYNLYLHPLRNYP
                     GPFLGRATNAYALCLNALGVQHVKEKEWHDKYGEVVRCMPNYLSYNSSQAWKDIHGYR
                     SDKQGSFDKDPAFFLLHPDAAAHIVGANGAEHRRLRRLMSPAFSDKALQAQEPVLHQY
                     VDMLIEQLRAQCKGDAGGVVDMAKWFNFTTFDLIGDLSFGQPFGLLESGVWHRYVSTL
                     FGSIKVFTYIRVILDVFPSPVRELLLLLLIPKKLMDDQAYQMELAGEKLRQKIETDPE
                     REDFVHHLIKGSQEEVGETGLTFKEMVAQAQLLILAGSETSATALSGMTYYLLTNRES
                     LNKLTDEIRSAFAAESDITLFAVGKLPYLQAVLDESMRMYPPAPNSFLRIVPYPGEVV
                     CGSYVPGGTSVALHHFASYRSSTNFVEADSFIPERWATNGTRHPKFEADNHDAFHPFS
                     VGSRNCLGRNIAWAELRLIVCKLFYHFDLELEPASEMWIDQPTFGLWEKRALNILERG
                     TAVAELPRRDVAELFSARIQGSRTIQCGLRSSSNKTHSNTAPALLNSFTMSANEYFSG
                     GGGAYEQNNEQNRYNTNTTNNNNNNNQSPWSSPPPIHTPSSSTYEGSYPPSEPPYNSP
                     QPAWGQPTFPHQYETQPYPGQSPYPPYQQGQYGPPQPYSPYYPPQEGYPSQHQAYPQH
                     PPPYNAEPATESPDERGLLGAVAGGATGAFAGHQVHHGVLGAVGGAITGSVAEDAIKK
                     HKKDKEKKEKKKWGHGRRDSSSSSSSSSSSSDDDHHHRRHSQEHHDPTLRGNFSRSSN
                     EIRLEGDYELVAYCNPVSGHPQRSSIPLNGVLTNTFGKLNWARGGNFGASARHVRKAD
                     VRFLKCAHFLSTWIVTIHSFA"
     gene            complement(<261048..>262389)
                     /locus_tag="TRUGW13939_06871"
                     /db_xref="GeneID:55994364"
     mRNA            complement(join(<261048..261236,261293..261573,
                     261621..>262389))
                     /locus_tag="TRUGW13939_06871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490013.1"
                     /db_xref="GeneID:55994364"
     CDS             complement(join(261048..261236,261293..261573,
                     261621..262389))
                     /locus_tag="TRUGW13939_06871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345906.1"
                     /db_xref="GeneID:55994364"
                     /translation="MAEVEEPPSTPVSTKTAPEKVLGPSPPPPGTEIHTSQTDESLET
                     PCKNTPLSALKFPRPQPQDDLTPRTKDGFLRENAWLREQVSHLQQDLNHAREENSQLH
                     TRIQKLMDDLVGGHQAHNEQELLLQEAQQKAYSVLEDPMWESDFEKTTRRLDQFAKQI
                     QQWSKQYASQKDLRELMGTSKALRDSLERVLRLDGDGHPHSLVGAKGTSMALLAYLTH
                     LLFEKIVTKPFFFLDSSSPVTAEAKEVGLIKMYRDTLYYDEVEAQQWRAQTLRLLRPR
                     SSTQEAPKAEHVVELNATTQADMKVACNKLVAGFFRSAMRLLINKDEDQKAMKTGLHK
                     IFHEAGELSCYIGTQKEPVYEAHASHRAQLDEDESSLDGHEIRQMLHPAIVVFGNSDG
                     TDYDKLTIWKKAIVWMGVSE"
     gene            <262111..>265342
                     /locus_tag="TRUGW13939_06872"
                     /db_xref="GeneID:55994365"
     mRNA            join(<262111..262183,262240..262285,262771..263811,
                     263865..263970,264021..264127,264178..264379,
                     264430..264823,265206..>265342)
                     /locus_tag="TRUGW13939_06872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490014.1"
                     /db_xref="GeneID:55994365"
     CDS             join(262111..262183,262240..262285,262771..263811,
                     263865..263970,264021..264127,264178..264379,
                     264430..264823,265206..265342)
                     /locus_tag="TRUGW13939_06872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345907.1"
                     /db_xref="GeneID:55994365"
                     /translation="MVEILLQMADLFPQPGILSQKPIFAGYFCKGFQGFRLFGREESS
                     SSVSILAPPLLSLLSPLLGSYLYTIGVSYVMSSTTNVEDVHIIRTWPGHGREADSVWK
                     APSRLAYLSENPDAPTSVWGYQVTPKMKSYSWMKLLLDRKTPTDYDDPDLKHSQGEGL
                     LQLPPSTTATEVCGDFLREIYQYTLEYLRKRLTAAVIDITPFEFWMTVPAIWSDAAKA
                     ATSEAARMAGFGSRAGDTVNFIPEPEAAAVAALSSMASKNTLVPIRKKEAIVICDCGG
                     GTVDIITYLVKNTEPLEFDELVVGTGGKCGSTFIDRNFHRWMSTNFRLAFDCLPPAKK
                     GPGSTFMKEFELYKHDFGHVEDARYVFEVPLVMRNVTDSAHYDSEESTVKFSRDVMKG
                     FFVPAVAKVKQLLKQQFDAVHREHPRTKICKVILVGGFGDSPYLNNQLKSWCLSTENV
                     QIMCPENPQAAIVKGAAFRGLQGIKASKKRSRLHYGIQMLCPFREGIDPEEFAEYDPW
                     DDDEKLCSDRAVWKISKGQLIDEKTKLCHEIEVTTNDDEDPSFSANLFSCKSDVPPDY
                     VSDLGKNMFHFLLLIGADWMHSDVDVVGTLHLEFSEADLQMFKRRVIDGLVHWRLEYE
                     LQIFLAPSDGLLHVRAVTKGNKEVGVTTLLYDSFTTLYCVQDLVHDEFPKLTTVQAYR
                     FDSLFVLENDIEIVYDEVD"
     gene            <269491..>271009
                     /locus_tag="TRUGW13939_06873"
                     /db_xref="GeneID:55994366"
     mRNA            join(<269491..269685,269752..270056,270119..270449,
                     270518..>271009)
                     /locus_tag="TRUGW13939_06873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490015.1"
                     /db_xref="GeneID:55994366"
     CDS             join(269491..269685,269752..270056,270119..270449,
                     270518..271009)
                     /locus_tag="TRUGW13939_06873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345908.1"
                     /db_xref="GeneID:55994366"
                     /translation="MDFLQIVASWPTPNYDHPVSRGDGMVIASAVFGAVGTIATALRL
                     YTRGWITRTLGADDVLIFFAWVWSVAMYICLSIASRSYGFNIHIWDLPFDKMPTANIY
                     SLIFQVTFALASSLTKLSLLWFCRRIIGDGRKISWGFHDTAIVFVMSLIVVFASIYII
                     LLLVQCRPLKALFDILPKYPHTCSINSHELTYAASIANTITDLLTTMIPVTLVGTLHL
                     PYRQRIAIMTIFLLGVFVNVAGALRTYYVHRSMVVTNLDRSWTGWPTCISAIVEIGLG
                     LIVTSVPALRPFLNRFIPSFLESTRRKYFFNNKYLTPNTSERSRSRKSSSGRRSRSIF
                     HLSTIDKSWNKSWHKDTNFTSNITSNDIELLEPEPVYAGSRGINVTKTVRQDSTHRTS
                     WPKSPFSSRSQLGREGVGLKKSSDRLNVVDDEEKLTRFYESDASGNGR"
     gene            <272729..>273433
                     /locus_tag="TRUGW13939_06874"
                     /db_xref="GeneID:55994367"
     mRNA            <272729..>273433
                     /locus_tag="TRUGW13939_06874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490016.1"
                     /db_xref="GeneID:55994367"
     CDS             272729..273433
                     /locus_tag="TRUGW13939_06874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345909.1"
                     /db_xref="GeneID:55994367"
                     /translation="MAPGVLRPLAIFCTQSQSQRYIRSVRNLGDAWRILSEKHDERTD
                     SDTTFIGTAFDFNLEVKNHPDETISTTFEIPSLETTTDKQPISAESQQHYRIFADYGT
                     DFLWRNTNDPDYSEDNTYVEAEEALSDLPPAVFQHYDAWVDTYTSNFKTRCDIPGDYS
                     AHVFVDATDEVSWNIAGYLLAWRIAMAPHIGSVEYSAGNEKYLLRSGEGTEGGALMEK
                     FLNDQATLLAKRESAE"
     gene            <274541..>274888
                     /locus_tag="TRUGW13939_06875"
                     /db_xref="GeneID:55994368"
     mRNA            join(<274541..274785,274849..>274888)
                     /locus_tag="TRUGW13939_06875"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490017.1"
                     /db_xref="GeneID:55994368"
     CDS             join(274541..274785,274849..274888)
                     /locus_tag="TRUGW13939_06875"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345910.1"
                     /db_xref="GeneID:55994368"
                     /translation="MSSTISPSLVVLITVVGAGAAVTIGFSIAKMFGRIEEEKLRPMG
                     RAQEQYMRQVRARNQTAMYWQSVDAARASNTETERTNPYVGLPRTDGGNK"
     gene            complement(<275005..>276296)
                     /locus_tag="TRUGW13939_06876"
                     /db_xref="GeneID:55994369"
     mRNA            complement(join(<275005..276138,276228..>276296))
                     /locus_tag="TRUGW13939_06876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490018.1"
                     /db_xref="GeneID:55994369"
     CDS             complement(join(275005..276138,276228..276296))
                     /locus_tag="TRUGW13939_06876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345911.1"
                     /db_xref="GeneID:55994369"
                     /translation="MPSRRFHAKSRNGCFRCKTRKVKCDIQKPACGHCSRRNEECVFP
                     KEPPRRSSDLLSDDISENDISAAFTESHLNDWAPLMTVHPSNPDQLLLQNFSSRVTRI
                     MSHSHGLQEVWALKITQDAYSHAHLMHGMLAVSALHHAQTSTTSKAEADYYQELAIDH
                     HNYCVSLFRPVVTEINAQNFDPLYASSMLILMFNAVFLGSSENSSYSTLASDIASLSQ
                     LAKGVTAMRARAGNNSRLYQHYRDLNGSPPPPLPEGINRVILAIEKAVDCLPDFGHGS
                     DKKPVYLKTIALLRYTFYGFVLNIEHPALLFVWIAMADARYLDLLMAHDLMALRILAH
                     FGICLLQIPSEWCVNNLGKNIVNGVRRIFEPKMAWDAQHRPRAAPTGLSQKNTIVLPI
                     HRRNDSPS"
     gene            complement(<276808..>277598)
                     /locus_tag="TRUGW13939_06877"
                     /db_xref="GeneID:55994370"
     mRNA            complement(join(<276808..277490,277544..>277598))
                     /locus_tag="TRUGW13939_06877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490019.1"
                     /db_xref="GeneID:55994370"
     CDS             complement(join(276808..277490,277544..277598))
                     /locus_tag="TRUGW13939_06877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345912.1"
                     /db_xref="GeneID:55994370"
                     /translation="MPHPGTRVVRGKKTFVPLENNPEVFRRLASNMGLSPRLDFFDVL
                     DVNDPELLAFIPRPVHAIIFLCPEDVYHATRDETEEQMEEYQGCGSAEPVMWFKQTIG
                     HACGLMAFLHSLMNNGAGRSCIPPGSQLDRILQSSIPLLPEARADLLYESDFLEMAHM
                     NAAGIGDSAAPLPEDPNYFHFMAFVKADDGHLWELNGGLPGPIDHGLLEPDEDALSPR
                     ALDRTVRQFISGHVPDIRHSIVALGPA"
     gene            <279135..>283481
                     /locus_tag="TRUGW13939_06878"
                     /db_xref="GeneID:55994371"
     mRNA            join(<279135..280581,280639..280937,281260..281397,
                     282574..282777,282837..282847,282912..283027,
                     283090..>283481)
                     /locus_tag="TRUGW13939_06878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490020.1"
                     /db_xref="GeneID:55994371"
     CDS             join(279135..280581,280639..280937,281260..281397,
                     282574..282777,282837..282847,282912..283027,
                     283090..283481)
                     /locus_tag="TRUGW13939_06878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345913.1"
                     /db_xref="GeneID:55994371"
                     /translation="MVNSKLTLLVFASSALSAVVPREDPEAGHDHQADPELLPPSAPW
                     GPPGSAPSNAEHHFPGYSIGEHEHGESGFFPPPEFTMSAPLQAAATGAPGAGPFPEQQ
                     QPHYPTPASFNSITQPSSDGPVPPFGSVPTQAPQVVDSSYPADTSGHAPPAPGSSHIR
                     PPPRPSGEPIRPLSTFTQTPRPHPSNGAPPQPSQGVEAGGHPPFDHPESSFGSYGPPP
                     GPPHAIPTEPAKPSEDAHPKEPTGDTEGPGPKHAYGGPPPPFQEGSGEPPHPSGPEGQ
                     PPHPGPDGPPGGPPGEPPHSLQPEWQQPHPEGQSPHSGGAPPPQTDLGETPHPSGSEG
                     QPPHPGPGGPPGKTPHLPQPEEQQPHPEGQPPHSYGGPPPSQPEGHPAELGDHQGGPP
                     CPYAAEHGRPPFGEEPSGSPAGPREQGSGSPPFHVGIPEQHNPHPIGELAEDHGDHPM
                     PPHAMPEGEPPCPEEHPEPPHNPHSSLPVLGLASSGKSAPGPGAPSGGKPGSREFEKP
                     HSSSVAAPSRSPLPSKASMTKQSPPQPAQPTQPTQKTTGAPSPKQSPAQFSSNAVMSK
                     KAISTGLAGVVIGLLLALQDFEKRQDSETTCSVNIFGPPRIAKRLYGACMRNFLFLQA
                     FLFEMFTLLALAGSRAQATPVARASGFSSVCSDISLDSHFWLHATCPDDSGASVNSTV
                     YLPLWIENDQGKLAWKDDGNFEYYCSDYALLNSGSTLEAYCQGTFRNQSGNSTLDLEE
                     HIANYNGHLLSDLDGSPDTPTSSSTVPVPADPSLDITFSSDNTNCENGIAWPTTGPED
                     CWSFTYATGRATPFDSIQITTNPGWSIEGYNASDCSGTPSWTASSNDNQCVAFNNGSL
                     AYFKMTPLWNWD"
     gene            <284819..>286599
                     /locus_tag="TRUGW13939_06879"
                     /db_xref="GeneID:55994372"
     mRNA            join(<284819..284963,285023..285365,285433..285600,
                     285657..285888,285952..>286599)
                     /locus_tag="TRUGW13939_06879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490021.1"
                     /db_xref="GeneID:55994372"
     CDS             join(284819..284963,285023..285365,285433..285600,
                     285657..285888,285952..286599)
                     /locus_tag="TRUGW13939_06879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345914.1"
                     /db_xref="GeneID:55994372"
                     /translation="MKDQDIVGHALAAVLPQYDRPWFRISHLLRLNLILIVPLMSSAV
                     AGYDGSMMNALQATSQWKNYFNNPTGSVLGVVNAAQSIGSFISLPFIGHLSDRIGRKY
                     TLLSGAIVIVVASAIQAASVNYGMFVFSRVLVGVGSMLVVQPSPMLITELAYPTHRGK
                     YTSAFWTIYFVGGILASWAIFGTNKHLTDDWVWRAPSILQAGFPVLQIIFWWFVPESP
                     RWLIANGRSEEAVQTLARFHTGGDSTHPLIQFEVEEIGRTIEMEKLAAKTSWKTLVQT
                     PGNRKRTFIAICVGAFAQYNGIAVVSYYLSLVLDTVGITDPDTQTLINGLLNIFNFVI
                     ALSAAMLVDRLGRRTLFLWSAVGMLISFVIWTACSAVFDSTGNTSLGRTVIAFVFIYS
                     FHYDIAYTPLLLGYPTEIFPYSIRSKGLTLELLAVYGSLIVLAFVNPIALDNVGWHYY
                     IFFCCFDVVVLAVTYFVFPETKGYSLEEIAEVFDGPGVVGEVSWAGLKKTDEELEHAE
                     HVH"
     gene            complement(<286717..>289087)
                     /locus_tag="TRUGW13939_06880"
                     /db_xref="GeneID:55994373"
     mRNA            complement(join(<286717..286901,286985..287077,
                     287139..288076,288149..288665,288730..288935,
                     289008..>289087))
                     /locus_tag="TRUGW13939_06880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490022.1"
                     /db_xref="GeneID:55994373"
     CDS             complement(join(286717..286901,286985..287077,
                     287139..288076,288149..288665,288730..288935,
                     289008..289087))
                     /locus_tag="TRUGW13939_06880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345915.1"
                     /db_xref="GeneID:55994373"
                     /translation="MATPATPDEHMSDASDSSAYAPKSKTVCVLCRRRKVKCDRIKPS
                     CSFCVKNGTASLCQYVASEKKRGLRAGYVSQLENRLDRLEAEIRDLKTLTAQNVHYNQ
                     PPVIPSPPSNSNDATHQINEDLSSALAGPPAMQAPTEHDETRSPSRSAFVELCSAWFD
                     KFHGWFPILHPPTVMQTLQDISISLELSPLYVVLKAIAAVTLPHVGFVTSLSHDQRRV
                     ISADYAQDIALHAMDSLSLPSLQAVLIVSVLEYGNGKLSKFWNLIALCKRMAMQLGLQ
                     DLVVHQCGNFSNPSVLPPRMLPFPNTLIDQEEKTRAYWMTELLDGSSTMGAAWNLSLS
                     RPHMTIATPSATSSSSSASYMAGYQDNPALYPCGEDIWTTAFPEFCISVASFEDLETS
                     SSFTSYVNLVANELYVVHQFLQQPFDRRSVHGRAKWQAECKNVDERLQKCRAGSPLFQ
                     NGFKGGYYNPHYSTTAAPGPAVNATPSAVTEISSLVNGSIVPTPEKASFDPVAILSFA
                     MYDMAIIALYQRLAFPANDIERPHGPFYHAIQRCLDASDEMTTVVRSVSDADLENMSP
                     HLIFPLFVAARFFLVHARITGVETPRNIDLLIYSLRVCGQRWNLARRLEKVLRAACAE
                     RQVTINFSALPPQFFDLQYSHLDIDKVLEVWADSQDVNNIASSHLVGW"
     gene            <290649..>292293
                     /locus_tag="TRUGW13939_06881"
                     /db_xref="GeneID:55994374"
     mRNA            join(<290649..290842,290902..291285,291337..292088,
                     292154..>292293)
                     /locus_tag="TRUGW13939_06881"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490023.1"
                     /db_xref="GeneID:55994374"
     CDS             join(290649..290842,290902..291285,291337..292088,
                     292154..292293)
                     /locus_tag="TRUGW13939_06881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345916.1"
                     /db_xref="GeneID:55994374"
                     /translation="MLQTLDEEGLTPTAASLHYKDELENPGIKPESFPDWENSLENPR
                     NWPAWKKSILMAAMSASAITGSISTSIMTPARAELMQEFHVSSTVAILPVTFYVLALG
                     FGPVLGGPLSETIGRYPVYLGSIIIGSAFVIGSGFTHNFGALVFFRFLTGFAWAPVFA
                     VAPGSLSETFLPKARGPAAATFTLMPFLGPGLGPVIGSFVVSRKGWRWTQWTELFFAA
                     FSLLLTLGTSETFRPVIQRRLAKKRGLEVRQRPLLSTQLHEFAVVALIRPLRMLLMEP
                     TVSFICLHVACEFGTLFSFFAAVPYTFGTVYGFDLDTSGLIFLSIVIGCLLGFLTVIL
                     CDIFVYRKQIPRYPPHQVPPEYRLAPAMFGSIGLPLGLFWFGWTARDGLSWAVPGAAI
                     IPFAWGNLCVFVSTMQYITDTYHGDVVASAAGANSLARYGFAGVFPLFTIQMYEKLGI
                     AWASSLLGFIALALLPIPWVLFRFGPSIRAKSRFKTVQA"
     gene            complement(<292765..>294453)
                     /locus_tag="TRUGW13939_06882"
                     /db_xref="GeneID:55994375"
     mRNA            complement(<292765..>294453)
                     /locus_tag="TRUGW13939_06882"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490024.1"
                     /db_xref="GeneID:55994375"
     CDS             complement(292765..294453)
                     /locus_tag="TRUGW13939_06882"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345917.1"
                     /db_xref="GeneID:55994375"
                     /translation="MTEFPEDEGRLGLEKKLRQIIKDQIQKITRKVKSVEKVEQVESA
                     ENVKEKPQGRGKEKVEEKAEHKMEDDMEDDMEEPDSFAKVRETIKPENLRLLALDLRR
                     QREGVPGRPYVKSKVDCQIKPENLTGSSHILYQIEFSDNVRWLLKVPANGHKDDFDKL
                     SASCLRAEALTMRLIKRKTTIPIPEVYGFDDTCDNRISCAFIMMEHITGQPLQDVWFN
                     QDNAPELLEQRRSRALHDIAKAMLQLNEFTSFRGGTILFDEDETPSRNTGPFRIMDMT
                     AMFDQVEEASGSGNIYSEVQPVSDARGFLTCMLHKRMTPRDQFGSGFELLLHLYIDFA
                     VLENQSLLKEYMAGNKDQNRFVLTHPDFDIQNFIVSEDGSLRGVIDWDGAITTPRGIA
                     GNESYPGWLTRDWDAMCYAYDPESPNNLENSPSELRFYRDMYQRIIRELTGSDLAAMM
                     TARTLVFDNLSIATHNPIPSSHIIDRIFEEIKAKVSKGLEGAQREEERAKEEELSEED
                     EDGEEDDGEEDEEMEEYNGTLDLYRVCMDLAEGLLSDTRRELLAQGFRALFHEQ"
     gene            <296619..>298323
                     /locus_tag="TRUGW13939_06883"
                     /db_xref="GeneID:55994376"
     mRNA            join(<296619..296792,296849..297677,297737..>298323)
                     /locus_tag="TRUGW13939_06883"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490025.1"
                     /db_xref="GeneID:55994376"
     CDS             join(296619..296792,296849..297677,297737..298323)
                     /locus_tag="TRUGW13939_06883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345918.1"
                     /db_xref="GeneID:55994376"
                     /translation="MFKKYLLLLATLHSVWAVSNDPHGHGNRIVQARTGTFVGDYNDT
                     YPDVRQFKYVPYAKPPVGSLRWKPPQHLDNSHELIDSTTFGPACSQYVSAIPTVWALN
                     ITGNLVVNYGESLLAGQVAQNSAEDCLSLAIWTPASATPESKLPVIIFLSGGGDVTGG
                     INIPTQLPSNWVHRSQKHIVVTTNWRVNIFSYPNARGLNGGTNFGLLDQRAAVEWVAE
                     NIAAFGGDPSKITLWGQSAGAGAADMYLFSYYKDPIIRASVSSSGVATGRTTNLDYSG
                     TNFTFVAKSLGCDFEDAHLELECMRRVPMPRIENFVGQYQDNSTLVNTSQASIAFTRQ
                     IDNKTLFSNYTDRYIKGQVAHIPKMIGTTAREASALVAYPIHNYTAGPSEQEIYTNTL
                     STVCAAHNTTILRNDAGLSTYRYEWAGNFTNLGGGVPWLGAYHYSDLYMLFGTYLINP
                     LPSTELEAQTSERMQDYLLDFITNPTSMQSNGWPAYNVSESGGGTLAQFGADGQVVKF
                     VEGKSVEGACYIPGVIYDTTP"
     gene            <298804..>299763
                     /locus_tag="TRUGW13939_06884"
                     /db_xref="GeneID:55994377"
     mRNA            <298804..>299763
                     /locus_tag="TRUGW13939_06884"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490026.1"
                     /db_xref="GeneID:55994377"
     CDS             298804..299763
                     /locus_tag="TRUGW13939_06884"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345919.1"
                     /db_xref="GeneID:55994377"
                     /translation="MDDSVIEHIAVERLSEWKFQSKRLTEPMGNALPISYGGYILGLA
                     TNAAAKTVPAGFHLYSVMGHYLGPTSTKEKVTLTVFPSRSTKTFQTRRVQVTQNTGDG
                     NSRLCFELLADFQRAEPEMLKYSAAPLMKYSNWNEVLPVEDMSEKLVADGKITTAHAK
                     AFGKIFGLLNRVFNTRYCPESIAGQTLLGVAKEAQTTQDDLPITAKTSSVWFQSKYPV
                     SEETDHAAGLAFVLDGALSFLPLIHNHMFLNDASACSSLDFAMRIFVPIVNLNNWHLR
                     ENVTHVGAHGRTYSEAKVWDEKGNMVASMTQQSILRPLPPNKL"
     gene            <300412..>304102
                     /locus_tag="TRUGW13939_06885"
                     /db_xref="GeneID:55994378"
     mRNA            join(<300412..300650,300702..301450,301505..301916,
                     301984..302272,302366..302766,303281..303503,
                     303554..303613,303677..>304102)
                     /locus_tag="TRUGW13939_06885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490027.1"
                     /db_xref="GeneID:55994378"
     CDS             join(300412..300650,300702..301450,301505..301916,
                     301984..302272,302366..302766,303281..303503,
                     303554..303613,303677..304102)
                     /locus_tag="TRUGW13939_06885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345920.1"
                     /db_xref="GeneID:55994378"
                     /translation="MSSASTLSLRRNGKRQSCEQCRKMKIKCDHSLPKCGRCVKRNLD
                     CFYDPAPMTQKFRSHRMEGDLLQLTKTGVKKAPRSSSMTSFSDLDPDNRRISSPHSVV
                     INTPRVKTSGFVGPISYRTVMTDSQNQSDQLGSLGAAEDPTATHIIESRRLEMGLQVV
                     DFLCKHAVPIRVLVERIYFIGRMPILPTTLALPALEHLWDMIEGDDDSVTSPSRLEAV
                     IRIFHNSYQPIPITKSTKVDELSRLISGENVRWETICNILVLASIGLLHFHSREIEFI
                     GYNKTDKQSLLAEFYEINDSLLGLTKESPFLNELVICLKYNQILYALIRFGESSQRAY
                     SSFVDLMSCIYASGIHQDKPIIGDSPSFIDQWRRKIFATAYYMDKNIATALGRPPQMN
                     RYYCVLEPPLDIDDEVTGPDLQQQLRMLDQNGWNMDGKRRPASLIRLRFLLATVREEI
                     LEHHLGVDKIDIGAKSQLALHKLRSIWQSCPNNIKYSPEMWNGQLSTQDILPILWLYL
                     DYMYSTFLIYLTAHDPSKGTSERLLLVAKNIISTILSVNDERERAREVRSDFFGLFLP
                     YGLPSAEILTKELLRRPSLGTDPAETHLPRAEIIRELTVYASCLSWVARPGSWNAEFC
                     KEVKAKLIRILDQIINPSNNPPHLEQDGISRDNQGNANQELGDMMIGWDHLFDWDRGG
                     HWDSGLDFLCEPVFYIVAIHGDGGHYQNSWTHPETKVFWLRDLLPQIVPRSRIMSFGY
                     HASKSSFPATPTQDIALILLTEISELRNGTGSEKRPVIFLAHSFGVMILKGALVDSSS
                     SNFHDIYSFVQGILFFGTPPDISHGLKTLLAISSQEETKESPQTLALRKDAEWLQVIA
                     SEYAKLEAAGGFPIVYFLESPHGEEPRGENLDEEEEKESQSRVIRMGKTHGMMIRFPN
                     AKDGDFRQVEKYLKKITT"
     gene            complement(<305367..>306293)
                     /locus_tag="TRUGW13939_06886"
                     /db_xref="GeneID:55994379"
     mRNA            complement(<305367..>306293)
                     /locus_tag="TRUGW13939_06886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490028.1"
                     /db_xref="GeneID:55994379"
     CDS             complement(305367..306293)
                     /locus_tag="TRUGW13939_06886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345921.1"
                     /db_xref="GeneID:55994379"
                     /translation="MTSVPKPDNVTFLSRQFKLAAHLYHPVPNSPDRSGAAIIIAHPW
                     TSIKEQSPANYARVLSKAGFTCLAYDAAYQGESEGEPRSLEDPAQRVEDIKAAVTYLI
                     SRKDVDSSNIGVLGICASGGYAPYAAQTDLRIKACATVAAVCAGTMARRGYDKDTSNI
                     DILKTQLEAAGRDRNSDVTGESVPIVHMLPEKLEDAPSNFPESFRDLAGYYRTPRAQH
                     PRATNTCLPRSWDLMGNFDAFAFNSMISPRPLLMITGTKAATKWFSEDGIEMAKEPKE
                     LFVIDGLTHADLYDHVDESGPKVVEFFGKAFA"
     gene            <309155..>310406
                     /locus_tag="TRUGW13939_06887"
                     /db_xref="GeneID:55994380"
     mRNA            join(<309155..309228,309296..309582,309640..>310406)
                     /locus_tag="TRUGW13939_06887"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490029.1"
                     /db_xref="GeneID:55994380"
     CDS             join(309155..309228,309296..309582,309640..310406)
                     /locus_tag="TRUGW13939_06887"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345922.1"
                     /db_xref="GeneID:55994380"
                     /translation="MRYAFVTGLLAAQAAALRNVMYVDEWHYTSLPSSDLVSSVTHAI
                     MAFAPSEGFSSGSTFTPFMSVDSFRALFPSSTKIMVALGGWGDNAGFSTGVASNDSIT
                     TYAKNVATMLDTMGFDGVDIDWEYPGGNGEDYKTTPNSQRTGEIDTFPILLKAIRDAI
                     GTDKLLSIATPGLKRDMIAYTADKGPSIFEPVDMVNIMSYDLMNRRDNVTKHHTSIKD
                     SLEAVNNYIDIGMNASQGNLGIAFYSKYFYTDPASDCATEPLGCATVALEDAQGQDTG
                     KSGAVTFETSPEVTDAVALSSWSTAKSNGITDDEAGGQYYWDSTNNIFWTWDTPELIS
                     KKFTEIIGKTGLGGVMAWSLGEDSLDWSELKAINTGVAGSA"
     gene            complement(<310607..>311955)
                     /locus_tag="TRUGW13939_06888"
                     /db_xref="GeneID:55994381"
     mRNA            complement(join(<310607..311176,311237..311410,
                     311467..311594,311661..>311955))
                     /locus_tag="TRUGW13939_06888"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490030.1"
                     /db_xref="GeneID:55994381"
     CDS             complement(join(310607..311176,311237..311410,
                     311467..311594,311661..311955))
                     /locus_tag="TRUGW13939_06888"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345923.1"
                     /db_xref="GeneID:55994381"
                     /translation="MSETTSRHALVIGASGLAGWAVVNEILKEYPTKGTFAKVTAVVN
                     RPLSIARARWPTASNVQIQLVSGVNLTAGSLKDTVTQLRDKIPDLETVTHLYHFAYQQ
                     MDNPAEEVQTNLSMLERVVTALTTYATRLEFVVVPSGSRAYGIYSSDRCFTAPFKESM
                     GRIPEPERSKIHYYLVQDYLARASEQQRWTWCEVRPDAIIGFTPNGSTFSLAAHWFNY
                     LSIYAAVEGKGAKVPYPGIEKAYHSLFNGVSSDMIARFSIWASLHPEKTGNGEIYNIV
                     DQTRPLSMKTHWPAIAGFFGLEGTGPTENQDPILLRPTEYMEKHQDKVPGGGASKLWK
                     ASWLDEYGHWTSFDRQFCADKIRSVGFVEERDANSSWVDTFALLKATQEDAAEN"
     gene            complement(<312451..>313894)
                     /locus_tag="TRUGW13939_06889"
                     /db_xref="GeneID:55994382"
     mRNA            complement(join(<312451..313604,313666..>313894))
                     /locus_tag="TRUGW13939_06889"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490031.1"
                     /db_xref="GeneID:55994382"
     CDS             complement(join(312451..313604,313666..313894))
                     /locus_tag="TRUGW13939_06889"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345924.1"
                     /db_xref="GeneID:55994382"
                     /translation="MQSTIELQDTNVARLRVAPNDHHDDYPQIAEAPILADNNGTNTS
                     VAWTFPDGGRQAWSCVMGSFFLMFPSFGFQVALGTVQDYIATHQLSAYTLSDVGWISA
                     ILVFLTLFLGVQVGPLFDRYGPRYLLILGTSGSFLSYILLAQCTEYWHFILCLSILGG
                     FSSAIVTTVAIAVLSHWFHRRRALASGICMGGSSAGGAIIPLLLRYTFPNYGWEWSMR
                     IIAFISAACYLAGIMLVRGRLPMVRSTAAPKAVVDIRAFASARLSFLALAVFSFEFII
                     FGCAALLPTYIRYSSTGSSGSPLPADMKFYVLTVLNSTSFLGRTIPGFMADMVGCFNV
                     LLLLVLATLVTMAAVWVPVGSHSSASALYAIVALFGFGSGGWISLAPVCAGQMCRTDE
                     YGRFYGTIYMVGAFGVLLTIPIGGELLQYATPQALIGFYAGILVLGLIGVMTSRWAIL
                     EWKWQWKVKV"
     gene            <314346..>315777
                     /locus_tag="TRUGW13939_06890"
                     /db_xref="GeneID:55994383"
     mRNA            join(<314346..314425,314478..>315777)
                     /locus_tag="TRUGW13939_06890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490032.1"
                     /db_xref="GeneID:55994383"
     CDS             join(314346..314425,314478..315777)
                     /locus_tag="TRUGW13939_06890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345925.1"
                     /db_xref="GeneID:55994383"
                     /translation="MDNEIELAEATAAVSETQPTETLWEKLQPSLIVAASTALIFTGC
                     GINFAFGVYQELYDSMATQPNTPFTGASPAQIDLIGTLSISMMTIGAPFSTSWAKIYS
                     PRTVILAGGLIFSVALVLASFSQTLWQFILTQGLLLGIGTCLSYMPSVTVAPTWFTRH
                     RGLAMGIILSGTGIGGVAWPLALRSLIDHVGFRNALRVTGALSFVLTWVSGSFVRWPA
                     SHLARIQAENSANSASGFFQLPVVNWRVARTRKFFAHALGGALQAAAYYTPVFFFASY
                     ARTLGYSQASSANFIALSNAANAIGKIAIGFMADRLGRLNTLLFTTFISALSALAFWL
                     PSCVSATQSDGRVLFIVFTVFYGIFASAYVSLFPASLVELFGVQNFASVNGLLYMLRG
                     MATLIGTPVAGVLIRSNQQNSQPKNYQNTSIMVGILLVSAAVSVFWVRIEAVLTMEET
                     GSRRRKWLV"
     gene            complement(<315989..>317501)
                     /locus_tag="TRUGW13939_06891"
                     /db_xref="GeneID:55994384"
     mRNA            complement(join(<315989..316156,316221..316316,
                     316377..317121,317203..>317501))
                     /locus_tag="TRUGW13939_06891"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490033.1"
                     /db_xref="GeneID:55994384"
     CDS             complement(join(315989..316156,316221..316316,
                     316377..317121,317203..317501))
                     /locus_tag="TRUGW13939_06891"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345926.1"
                     /db_xref="GeneID:55994384"
                     /translation="MKLPSSVPLLSVLILAGHVHGSISAPFQWNFSESPRPFVVNVEK
                     EFIDNTRLKASLTRFVTPIQEPDPLEGPSIYNATTIRDYWVNEYDWDKVEKHLNQNLQ
                     QYTTTVKLSATAQYLEPIPLHFVHHRSPRADAVPLLFIHGWPGSFIEVENIINSLTHP
                     PNDTMPAFHVVAPSIPGFAFSPAPITTGFGDYEAAQAFHALMIQLNYTKYVIQAGDVG
                     GVIMRYQAHLFPENVLAGLNNFWVVSPSQSDRERYEKNATTADETYVINSLDNFFNKH
                     WAYGQIQQTQPLRLAHAMTDSPVGLAMWIYAAVSAVVDNPGVWTPEEIITWTMMHYMQ
                     GPYSTFRLYKEGALNGAFNLTAFDDLPMVEQPMAISEFPLDIWYRTPLEWAQRTGNVQ
                     KRYMHDRGGHFPAWETPHFLLDDIWDFFGQLDISHTWGMNIGE"
     gene            <318416..>320035
                     /locus_tag="TRUGW13939_06892"
                     /db_xref="GeneID:55994385"
     mRNA            join(<318416..318691,318755..>320035)
                     /locus_tag="TRUGW13939_06892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490034.1"
                     /db_xref="GeneID:55994385"
     CDS             join(318416..318691,318755..320035)
                     /locus_tag="TRUGW13939_06892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345927.1"
                     /db_xref="GeneID:55994385"
                     /translation="MPDSGQVNTEKHGNEAIPSKGEEQPQAQNANPQLEKLSVFTKHE
                     KRSMVMVGSLASFFSPLSSSIYFPALDTIATALNQPTSNIDITVTTYLIMQGIAPMLI
                     AGFSDSAGRRPAYIICFTVYLAANLGLGLQNSFAALLVLRCLQSGGSSGTVALANGLV
                     GDLVSSSERGAYIAFSSLGSMLGPSISPIIGGLISQYLEWHWIFWFLLIFSGVFFALL
                     FLFLPETCRKVVADGSIPPPALNWSLTDAIRYRRRKSKGIVPDPEKLAEVRKNYSFRI
                     PSPLPTLKICLDLETALILLPMGLMFAAFYAVMTGATTSFHDIYHFNNIETALMYVPI
                     GAGGIASAFTTGYVVDWRYRVNAKKADFPILKNVRQDLTNFDIEKARMEAAIPVYYIS
                     VAAMIAYGWVVGIKVNLAAPVILLFLVGWGLNAISQVLSALMVDLWPDRAAAATAANN
                     LFRCELGAAASAAISPMGAAMGWGWAYTTLGLIAVAASPSLWFIKTHGMKFRQKRLRK
                     RREKASKSRG"
     gene            complement(<320373..>321293)
                     /locus_tag="TRUGW13939_06893"
                     /db_xref="GeneID:55994386"
     mRNA            complement(<320373..>321293)
                     /locus_tag="TRUGW13939_06893"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490035.1"
                     /db_xref="GeneID:55994386"
     CDS             complement(320373..321293)
                     /locus_tag="TRUGW13939_06893"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345928.1"
                     /db_xref="GeneID:55994386"
                     /translation="MSNQTFFVTAATGPQGGAVTRHLLKKNCTVHAITRNIDSPAAQE
                     LQKLGVKLVTGELDNEESLKAGMQGCTGLFLNLPSNPMTAQPFAKCILAIAKSVGIKH
                     VVYSTALGANSPEKFAAWTPGGMVEIVMHPKRVIEEIVRTYGFEYWTILRPGNFMANF
                     TQPKIPIVYPGLETTGVFTTSFGKETLIPMVDHDDIGKFGAAALLDPTRFDQHGIEIA
                     SEFLTVDQIVAELSKATNKKISAHHLSDEEFQVEAAKNSPASWQRLLQDLAQFVDMEK
                     LKTWGIPLNSFADFLQREKDNVIETYAQTP"
     gene            <321931..>323017
                     /locus_tag="TRUGW13939_06894"
                     /db_xref="GeneID:55994387"
     mRNA            join(<321931..322228,322296..>323017)
                     /locus_tag="TRUGW13939_06894"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490036.1"
                     /db_xref="GeneID:55994387"
     CDS             join(321931..322228,322296..323017)
                     /locus_tag="TRUGW13939_06894"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345929.1"
                     /db_xref="GeneID:55994387"
                     /translation="MQGNAPSSIPTPPDFNSLDSLMTLRATPLQPPDFSHIYGVDDIM
                     LLNAPTFPLLPAAAVSRVQFAFKQLQDAPRMMVLENQTAWCHPLLYRNKMPRSIRGFG
                     RAITKYFNVLDAYSSCALHLARNAANSAMISSIIESRVAEIITSEQPNTPLECLARVH
                     ALILYQTIRLFDNDVSCRLAAEVAMPSLRAAVVALLPHANFEDTLSLSNVATRFLSSS
                     EGSFWETWVFEESARRTMLLSNYLTRIWELMRGDQGLHCDYKLGFSHCWYVSSQLWEA
                     KSPYEFAVAYAEKSRFLISNLDFTDLLVHGKPEDVDMFGKIMLTGRLGLDAAQEWFAS
                     RGAMF"
     gene            <323234..>323845
                     /locus_tag="TRUGW13939_06895"
                     /db_xref="GeneID:55994388"
     mRNA            <323234..>323845
                     /locus_tag="TRUGW13939_06895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490037.1"
                     /db_xref="GeneID:55994388"
     CDS             323234..323845
                     /locus_tag="TRUGW13939_06895"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345930.1"
                     /db_xref="GeneID:55994388"
                     /translation="MGLFWVFVITEVALDKARLYPLAYAVRGWNKAFTPGSKEEIDWI
                     KNYESQEKLCHGYYQEQIYLLETLSALEKSRSLAQDDGSSSYEDLGYDDLKAQLEKIA
                     KCLFSERQKLGGLLSSKPRGAYIREFDAHRRRRDYLLKKHEKECRVRGGCCDRDCGCC
                     SRRIEVPATMVLSKEFGKKSHCSVDCGCCIRSRGFRSREAGKD"
     gene            complement(<324419..>326155)
                     /locus_tag="TRUGW13939_06896"
                     /db_xref="GeneID:55994389"
     mRNA            complement(join(<324419..325578,325639..>326155))
                     /locus_tag="TRUGW13939_06896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490038.1"
                     /db_xref="GeneID:55994389"
     CDS             complement(join(324419..325578,325639..326155))
                     /locus_tag="TRUGW13939_06896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345931.1"
                     /db_xref="GeneID:55994389"
                     /translation="MSSTLSVIDEIKVESSDTAESVMSTDSETREGSTSDSDGTTSEE
                     GSYDASATWPYRFAMDNNCGQFGSRRPLSPPYKYPIDSHAGPMLIEESWKTFCGVCGT
                     CITLEDEQNLMWATGSYGSYGGSVLAQPDDAGNREFQKLQAPEADSDGHYASRRDFGI
                     MPKAGWTGLYRVVICHTRLAAKRDIPRYHVSGVGRYHLWDSDPGARKLSKNLEYKDSR
                     GVLNNEPVFTVPWKKDDLLVDRQHFYNKLIPDDKKDMTKSKPLVKRVNVYPAHFYNSD
                     FQHLYPHGFPIHAHCWSLAERVIGGDRIEKDLELFIRILQQRWEDENIIQNSRQLNEW
                     IIDRYSYLARSEYDCDLQLVAIRDPITVHEVEEIIAESAKRYSLLKDKQGDAPTIVTA
                     NYALFTIPYEVWAGIFDCLHYSELVKFLSVTRIQMPPSYWRSRAPRDIIWELDDIDCG
                     TTPVDWQHLCLRAERLCDESLGLVNRQRICNVLKEVGTKLDFFSDVEVADNQAREAAS
                     PTPETLSEASTVRHDLCHGGSDSEEELGLTEWDDEYAKKDYLVVAEWDGN"
     gene            complement(<326640..>327825)
                     /locus_tag="TRUGW13939_06897"
                     /db_xref="GeneID:55994390"
     mRNA            complement(join(<326640..326910,326969..327483,
                     327571..>327825))
                     /locus_tag="TRUGW13939_06897"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490039.1"
                     /db_xref="GeneID:55994390"
     CDS             complement(join(326640..326910,326969..327483,
                     327571..327825))
                     /locus_tag="TRUGW13939_06897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345932.1"
                     /db_xref="GeneID:55994390"
                     /translation="MLLPRDMPPALPSNVPADIAHAFEVGNVPEGITPEFLMESRDGP
                     TKAAIYFLFFLTMAFMLGRCYSRIFVVRKFGLDDWLACVTFIVYIPVLAFCIISIDNG
                     SGRRSAYVHYVMSLDNDRANRAELDDLILHFLYTIALFTCRLSGLAFYTRLSQAHDHL
                     FRAIKICAGLFLAVFIVQFCLLLFHCLPVTGIWPYSWQPDYHKYRCITWGAVYITNSA
                     LSFLCDVIMFVIPSMLIHLLHVPLKRKLGLAMVMFPGVLVLIISIIRIWLVCLGQWST
                     DNTWLYDPQLAIEMAEIGSTLIALSIPALKPLFGFYVMTKIRSSSSDNRHDRHDRHDR
                     RATFSNPPIRLS"
     gene            complement(<331121..>333044)
                     /locus_tag="TRUGW13939_06898"
                     /db_xref="GeneID:55994391"
     mRNA            complement(join(<331121..331323,331394..331495,
                     331550..331833,331900..332021,332079..>333044))
                     /locus_tag="TRUGW13939_06898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490040.1"
                     /db_xref="GeneID:55994391"
     CDS             complement(join(331121..331323,331394..331495,
                     331550..331833,331900..332021,332079..333044))
                     /locus_tag="TRUGW13939_06898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345933.1"
                     /db_xref="GeneID:55994391"
                     /translation="MSSLIAQFPSLSSIVSGVALHLLVLRHGEWDQSAPVIVAWYLAF
                     VAVGLVLPSVTEFQVGAGPLFQSLICHIAGLFSSIFIYRVFFHRLRKFPGPILAGITA
                     FYATYLSAKKFHKFKEIENLHQQYGDYVRVGPRELSVADPRAVLSIYGPPSKTTKGPF
                     YDGVQPFISLHSDRDKKRHARRRRTWDHAFSTSGNFPPFNRRDYVNLLIIALRDYEHR
                     VSKYSSQLLSAVSDQVGQAIDMGRWFNYYSFDIMGDLTFGKSFEMLVTGQDSYMLSTL
                     HNDLQSLGPFLHVMWFIPFFKMIPGLNNSYTAFWKWLYEQVDTRSKNEPDEPDIFTWL
                     LKEFRTGEQTEKGKLFLHGDADLAVVAGSDTTAATLTNLFYELASSPTWTAKLQSEID
                     VVNHSTYRDLAHMPLLSATIDETLRLHPPLPSGMQRVTPPQGIRLDDVYIPGDCIVQM
                     PLHTLFRDERCFAQPTKFIPERWTTQPELVKDRSAYIPFGSGSFACVGKQLALMEMRR
                     VTVDLLSRYDVTLAKEQTHEDFQEGHQDVFTLVHGRGLQLVFTERKSRNL"
     gene            complement(<333952..>335123)
                     /locus_tag="TRUGW13939_06899"
                     /db_xref="GeneID:55994392"
     mRNA            complement(join(<333952..334775,334850..>335123))
                     /locus_tag="TRUGW13939_06899"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490041.1"
                     /db_xref="GeneID:55994392"
     CDS             complement(join(333952..334775,334850..335123))
                     /locus_tag="TRUGW13939_06899"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345934.1"
                     /db_xref="GeneID:55994392"
                     /translation="MSLLQLPNEIILYIAHHIGSPYSLTLVNRQFYHLLHHTLYRYNI
                     KYRGSTALPWAAKKGDLVVMKRLLAEGAPISKLAFSVNANNLLNIYHSFHSQASPASK
                     GPATEDSPLGLAVRENNEEMVEFLLTELAKNSETSAMLSIQVNETLAAAATHGQNGIL
                     LRMLSRGADIDFKRTRGIKTWTPPLSLAASNGNLETVKLLLEHGADVKAGTRAQSALE
                     GAIRKHQTEIARLLLESGADPNSIYLDGLVPAAERGDAEMVELLLNMGPQFRRSFYCQ
                     RALFKAIEEGHEKVTRLLIEQGGADPKLSEPTSRRSTMRMAVRQMQPNLGIVRLLIEQ
                     GVLPDSQDLRLVKFNGNEGLIGLLEEYCEFP"
     gene            <336646..>338609
                     /locus_tag="TRUGW13939_06900"
                     /db_xref="GeneID:55994393"
     mRNA            join(<336646..336926,337018..337157,337239..338205,
                     338264..>338609)
                     /locus_tag="TRUGW13939_06900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490042.1"
                     /db_xref="GeneID:55994393"
     CDS             join(336646..336926,337018..337157,337239..338205,
                     338264..338609)
                     /locus_tag="TRUGW13939_06900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345935.1"
                     /db_xref="GeneID:55994393"
                     /translation="MSLAALVAIIIVLKEYDQKSMPSWPLGITLNTLLAFLTAISQAG
                     FVNPVFQGLSQMKWNWFVDKDRPLADFQKFDNASRGSWGSILLVFSMKGRLSVLMAAV
                     ILVSSTVTSTITQAVLNQGMRYIPGEGIAHIYNMINDTGIVESPTWITSNIMSAIFTP
                     TNSTILEYTQPICTTGNCKFPIFSSLAVCVDTNDITDKLIIEETAEIYCTQAINETNK
                     WEPLTWPAPVCHNYTRAGLSQDKYVYLTPWEESPLNSSNIFVSDHFYGDDNLDTWDRL
                     YTFSNQSFAYNGILGTQIIYVNQSDAASELSPTKDNITLFMPYTRAVEALFYMCVETY
                     NVTVVNGTTSTNVTGTTKHTTDFLPWGFIDGGKPNIQYNRTFTVDGHNYTYAEASVTI
                     PQVLDNIVTGAFYTNQNLDGLSGMTPYSYALGQSLYTNSTFINVTGVERDQIMRQNIE
                     NLLGNMARGMTNWFRSVYPSPVQGQNYVSDTYVIVRWPFIACLAIQVIFSIIFLGWIM
                     LDTRMRKIGILKESALAALFAIPAEDRATLDNRLSTVNDEKDSIGQVGNTSTANLAKG
                     PYGQWNLTLAR"
     gene            complement(<339343..>340942)
                     /locus_tag="TRUGW13939_06901"
                     /db_xref="GeneID:55994394"
     mRNA            complement(join(<339343..339369,339425..>340942))
                     /locus_tag="TRUGW13939_06901"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490043.1"
                     /db_xref="GeneID:55994394"
     CDS             complement(join(339343..339369,339425..340942))
                     /locus_tag="TRUGW13939_06901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345936.1"
                     /db_xref="GeneID:55994394"
                     /translation="MESSPPRASSLGGPAAGMKRPASLLPAFEPLSSSPSLPRPQKRL
                     ARDAGDYPTPVPTSSTHILSSSPPHLPSTRPTLQRSVFSTSERAPLSTVPTLILPESG
                     EPLLMGRSSASCHHQLSANRLISRVHVTAAYKPAGNPFDRDRVEIVCTGWNGIKLHCQ
                     GKKYDLAKGKTFSSDIKDADVMIDVHDARVLVQWPRNDRKGSSSAESDQAWEESSPQR
                     NPQPRLNGPGSPLKEQHRLVSPVSPSPAVRSRIPPSSPLLSPSRIQSTITIYEDNNSP
                     TFVEGDEKEPVESHPPVLGASSSSQHSALSELCQSYDDFSDHDEENDPIVHSFGPFGE
                     NLLPRMASFRAGDSPTRPRVSRPQLEPLRPVDSPPQSLAATTSTKETREEETKVDEGR
                     KAAIASIQNHAANQLAFSRLSSTPFSTILQNLPTSLWKDEKTSAELFSRGELRTLLED
                     SKCIGEVIREGKDAAGKALESEFYYIPDFDEDQMRRQAVVNDLRKPGLRNCRKQHKQY
                     FWRKPK"
     gene            complement(<342422..>343818)
                     /locus_tag="TRUGW13939_06902"
                     /db_xref="GeneID:55994395"
     mRNA            complement(join(<342422..342852,342912..>343818))
                     /locus_tag="TRUGW13939_06902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490044.1"
                     /db_xref="GeneID:55994395"
     CDS             complement(join(342422..342852,342912..343818))
                     /locus_tag="TRUGW13939_06902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345937.1"
                     /db_xref="GeneID:55994395"
                     /translation="MKLSATLTLAAAGSLAAAQGGHRRVHRHQHKRDVATTVVDEVVT
                     VYQLDGTPVPIADVCKGIKDGDYKWAAGQGPSDACESKTSATVKPHEFLETPTSTAVP
                     TTSTTSTSTAVPTTSSTPPPPPTTTSTSTTSTSTSTSTTTTSTSTSSPAPSPTATSTS
                     SSSGGTGVTASFPDGELSCDTFPSDYGAIALDYFNIGGWSGIQYPTLNTLGTLVESIV
                     TAVSGQSCTEGAMCSYQCPPGYLKSQWPSTQGATGQSVGGVTCKGGKLHRTNTDHETL
                     CVAGVEGVTVENQLGQVVSVCRTDYPGTESETLPLELASGASEQLANPDQSSYFYWEG
                     KPTTAQYYINPAGYQADQACTWGTSAKPIGNFAPMNMGVGYSDGVTYLSIFPNAPTTD
                     AKLKYNVKFEGDVSPSCYYDASSATYYKDGVPNTSEGCTVGVPEGGSAKVIFH"
     gene            <347592..>348790
                     /locus_tag="TRUGW13939_06903"
                     /db_xref="GeneID:55994396"
     mRNA            join(<347592..347663,347723..>348790)
                     /locus_tag="TRUGW13939_06903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490045.1"
                     /db_xref="GeneID:55994396"
     CDS             join(347592..347663,347723..348790)
                     /locus_tag="TRUGW13939_06903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345938.1"
                     /db_xref="GeneID:55994396"
                     /translation="MVTATGPLTTKVASGTPYQLENNQVTRASTALLKFIKSQQKEKE
                     ETSTKKTLIGDNDDASDNEDSPAVNEPVWLVVTTKKHVADKNRLKPGTITIPHSLNSS
                     PSLSICVITADPQRAVKEIVADPTFPSTLSSRITKVIGFTKLRQRYKSFESRRQLLAE
                     HDVFLADDRIITRLVETLGKIFYKSSKRPIPIRIEQIDKVDGKRVKKDAKKKISKDER
                     NATFASPIVVAKEIEKALNSAAVHLAPAATTALRIGSSGMTPQQLTENVGAVVNGLTE
                     KFITKGWRNVKAIHIKGPTTMAMPIWLASELWVDETDVLENVENESKQIEDGKADKKR
                     KTSEEEETTQKVSKKSKKSKGADDNEDSARKEKLRKQKARALEDQ"
     gene            <349189..>350358
                     /locus_tag="TRUGW13939_06904"
                     /db_xref="GeneID:55994397"
     mRNA            join(<349189..349494,349558..349726,349784..>350358)
                     /locus_tag="TRUGW13939_06904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490046.1"
                     /db_xref="GeneID:55994397"
     CDS             join(349189..349494,349558..349726,349784..350358)
                     /locus_tag="TRUGW13939_06904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345939.1"
                     /db_xref="GeneID:55994397"
                     /translation="MISIARPSVLRVARSQLCASRPSFDARLSALTRLLSTLAVLEQR
                     DGKLQPSSLSAIAAAQKLGGSVTGFVAGSGVKGTSAAEAAKIKGVEKILVVENEAYEK
                     SLPENYAPLLVENVKNGGFSHVIAGHSAFGKNVLPRVAALLDVQQVSDITDIESEDTF
                     VRPIYAGNAILTVQSQDPIKVLTVRGTAFQGVETEGGSAEIVDGSDPKAESTTEWVSE
                     DLAKSDRPDLGTASRVVSGGRGLKSKEEFDRVMVPLADALGAAIGASRAAVDSGYADN
                     SLQVGQTGKNVAPQLYLAAGISGAIQHLAGMKDSKVIAAINKDPDAPIFQVADVGLVG
                     DLFEKVPELTEKLKK"
     gene            complement(<350589..>352541)
                     /locus_tag="TRUGW13939_06905"
                     /db_xref="GeneID:55994398"
     mRNA            complement(join(<350589..350901,350953..351892,
                     351968..352107,352159..>352541))
                     /locus_tag="TRUGW13939_06905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490047.1"
                     /db_xref="GeneID:55994398"
     CDS             complement(join(350589..350901,350953..351892,
                     351968..352107,352159..352541))
                     /locus_tag="TRUGW13939_06905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345940.1"
                     /db_xref="GeneID:55994398"
                     /translation="MKRTRWSTLQWRDIQSPSLEVFPRGWSTEVISSVISITAFLIII
                     VILSRYDQQPSPIFPLGSSLAALLAFLTAISQTCFLQPAIQGVTQMQWNWVFGRSRSL
                     TDFDKFNATNKGLWGIIVLLFSVKRRLVVLLAVFFLVTSATISMVTLAVLSHDLRYAP
                     GAGNAAVLQAVNDKNDNSHNVNDALAMMMNAMYTRPDATYEYDAPECTTGNCKYPSFG
                     SLAVCSKSHDITDRLYTMVTPQKWCYQQVEDKWDSRTWGPDICSNYSYAALSPTIYLD
                     YFGSGILTNTSNVWLNSNATWEGVFSFDRNVFAENALNAVHTIYLDSSDSSWSSYLGG
                     LPDTSLYLQHAHAVETLFYLCAQEFTVSTTNGTTSTNVTSTLDYVTDIEFFESSPDGY
                     HYTTEYNRIFTLNGHDYSYVVVDDILGQMMMSSLEGKYNNNTYAGMSYMTPFSFATGN
                     VLYHNPKINGNVAAKRDTQMHQALEAMMSNVAKGMTNWLRSTGSPVQGQAEILTEFVV
                     VRWHFLFPLGLQITLSVCFIVWAMVVSKAQKPRILKDSPLTTSFPMTVSDKAFLEEEL
                     ARKDEENSQKGEDVEKLSIEKFGFE"
     gene            <355019..>358931
                     /locus_tag="TRUGW13939_06906"
                     /db_xref="GeneID:55994399"
     mRNA            join(<355019..355037,355100..355144,355214..357300,
                     357355..357646,357704..357861,357910..358500,
                     358557..358873,358925..>358931)
                     /locus_tag="TRUGW13939_06906"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490048.1"
                     /db_xref="GeneID:55994399"
     CDS             join(355019..355037,355100..355144,355214..357300,
                     357355..357646,357704..357861,357910..358500,
                     358557..358873,358925..358931)
                     /locus_tag="TRUGW13939_06906"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345941.1"
                     /db_xref="GeneID:55994399"
                     /translation="MDQQRKRELRGLNDRAWAGEEGFFAVKSPLDSSLKKNTAFIKRL
                     RTGITASAPSTFITDIRTLSLHKYLSEIISACYEGLSKLKSPGEVAAGVEIVSALHQR
                     FGPNEFTKQIGWLLGRGLSSPDKSQLKALSQEVREREEKERLSRHRVLLRVVTELWLV
                     GFLKTLDDIERPDDIGAKGKDGGSAAAGKTADGPSKTRAAGKGDQDKEADPFPLEVLK
                     DLLGYDREHVNLPLAVLFVKTFSWDILGVRSIEEGRKTVDADGATATAEDNEAAAEET
                     AAKPDSSIGSPLISEKLQLRFKNILTRYLEDVKAHVARDQKALAAQNRRNAEAYVKSG
                     EIFEDRQANFEKQSKTHEKMISNTQIMCEALGVEMPALADKEAADASASGGIGLVKTA
                     EYLRGQGDGAGIWEDEEERRFYENLADLKGKVPAVLLEDGKKKKGEADEQGKGQNTTE
                     KAELPVPETKPSVEADNESMAVVNKTVGAQVDALLVKLPDLQNKDQVDQLALDFCFLN
                     SKASRNRLIKAMQDIPKGRTDLLPLYSRLVATLGQHMPDVPQGLITYLDEEFRSLQRR
                     KQKEFLGQVRMVNIRYLAELTKFGVVPEHVIFHCLKVCLDDFSRTNIEIMGNLLENCG
                     RYLLRNPESSPRMASFLETLGRKKTATHLGQQERMIIENAMYYVDPPERPAIRQKERT
                     PMELYIRKLIYLDMNKRNYTKVLKAIRKLHWEEQEVVSILERVFSRPSKVKYGNVHLL
                     AILASALYRYHQEFIIGIVDNVLESITLGLEQNDFKFNQKRVAEVKYLGELYNYKMID
                     SPVVFDALYRIVVFGHENGTPTPGKINILDMPDDFFRIRLVCTVLDTCGVCFDRGSAK
                     KKLDFFLTFFQFYILTKDPIPMDVDFLIQDTYALVRPQWKIATDLEEAGQLFSEAIAQ
                     NYKAQDGDRPAEADEDEIESVSSDGNGDEGLEEDGMPDAEDMQSSADEADHSPNHEER
                     DFESEEEQIFVSRQEEERDPEVEAEFDRAFEKMMTESIEGRRFERKAMFDVPLPMRPS
                     RREAGGGDEIPVEEPKPSNTMAFSLMTKKGNRQQTRTIELPSDSSFAVAMKSQQQADR
                     EEQQRIKNLVLSYDPGDAEQTDGEDALSSVTQEPFSIQRNPNTKAKAKNSKGFEKRTT
                     QTRMEKPSRAQFRARRLQLSDVDWT"
     gene            complement(<359559..>360561)
                     /locus_tag="TRUGW13939_06907"
                     /db_xref="GeneID:55994400"
     mRNA            complement(join(<359559..359886,359957..>360561))
                     /locus_tag="TRUGW13939_06907"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490049.1"
                     /db_xref="GeneID:55994400"
     CDS             complement(join(359559..359886,359957..360561))
                     /locus_tag="TRUGW13939_06907"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345942.1"
                     /db_xref="GeneID:55994400"
                     /translation="MLRQTTARRTASLLRSANNTTYTASSSSSSSSSRIALQRRFASS
                     GGNPVVPPPPSQKQRSWRNRLVRLGLAGGAIYFYNTSSVFADQPTFSLRSQLEESTDA
                     LALNVRDDKKSAASQPQQQDSVDVQPEQPGDGESGGLSDLESQAGTEGAFNPETGEIN
                     WDCPCLGGMAHGPCGEDFKAAFSCFVYSTEEPKGMDCIEKFKGMQDCFRLHPEIYGSE
                     LDEEEVDEQLTDQIAQRDKQDQATQESEQQQQQQQPVYTNDPASASLNQAEKRAEVEE
                     IHKANEHSQQAAREEENLVPRAWHASEEDKTTEK"
     gene            <362816..>364546
                     /locus_tag="TRUGW13939_06908"
                     /db_xref="GeneID:55994401"
     mRNA            join(<362816..363326,363385..363851,363911..>364546)
                     /locus_tag="TRUGW13939_06908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490050.1"
                     /db_xref="GeneID:55994401"
     CDS             join(362816..363326,363385..363851,363911..364546)
                     /locus_tag="TRUGW13939_06908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345943.1"
                     /db_xref="GeneID:55994401"
                     /translation="MSGSRYRVVDIQFRDSLDRRSLRLSRLDFRNSVSTSSLSQSQTS
                     MPPTLPSPSLLSSGSDMDEFDYTNWDIATATANGSATALPEKATSPVPSNSSKATSPF
                     VERSNPMGGATNPQTVTSKDPKAAAQAASDMRNVVRRKLTGYVGFANLPNQWHRKSVR
                     KGFNFNVMVVGESGLGKSTLINTLFNTSLYPPKERTGPSADIIPKTVSIQSISADIEE
                     NGVRLRLTVVDTPGFGDFVNNDDSWRPIVENIEQRFDAYLEAENKVNRMNIVDNRVHA
                     CVYFIQPTGHSLKPLDIEVMRRLHTKVNLIPVIAKADTLTDEEIAQFKQRILADIQYH
                     SIQIFEGPRYELDDEETIAENQEIMSKVPFAVVGANAEVSSPDGRKVRGRRYPWGVIE
                     VDNEEHCDFVKLRQMLIRTHMEELKEHTNNSLYENYRSDKLTQMGVAQDPSVFKEVNP
                     AVKQEEERALHEQKLAKMETEMKMVFEQKVREKESKLKQSEDELYARHREMKEQLERQ
                     RQELEDKKVRFESGRPIEEKGKRKGFSLR"
     gene            <365641..>366761
                     /locus_tag="TRUGW13939_06909"
                     /db_xref="GeneID:55994402"
     mRNA            join(<365641..365708,365772..365789,365926..366149,
                     366208..>366761)
                     /locus_tag="TRUGW13939_06909"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490051.1"
                     /db_xref="GeneID:55994402"
     CDS             join(365641..365708,365772..365789,365926..366149,
                     366208..366761)
                     /locus_tag="TRUGW13939_06909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345944.1"
                     /db_xref="GeneID:55994402"
                     /translation="MAPPPPATLPLADRIKTLAQTLQFGWFVGHLTLLLTVFRYGLSY
                     ITFNYYSRWAKISYRLAFISAAATYGIVVYKQYIARGKLTGSPLQIAVKLLGDENVQY
                     LGMALVWLYSRQIPLALLPFSVYSIFHVATYTRTYLLPTLQPVPQAAAGAASPGSPRP
                     AAKQSPLAESIGKFVKQYYDASMYLVASLELSLLFRLVFSALTFSKGSWLLLVIYLAF
                     FRARYSQSSFVQSAVARFTARADTLVSHQSTPPQIRQGWDAFKGIVGQAYESTDAKRY
                     LGGGGAAKKPQ"
     gene            <367611..>369076
                     /locus_tag="TRUGW13939_06910"
                     /db_xref="GeneID:55994403"
     mRNA            join(<367611..367853,367916..368213,368274..>369076)
                     /locus_tag="TRUGW13939_06910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490052.1"
                     /db_xref="GeneID:55994403"
     CDS             join(367611..367853,367916..368213,368274..369076)
                     /locus_tag="TRUGW13939_06910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345945.1"
                     /db_xref="GeneID:55994403"
                     /translation="MSLDSSAQASTSTSTSTFYSTSDRSTSASSLRDRHVSQLKHHSE
                     GVLPAGNPAFLGKGEMSTHKMDESLSDEHSSRPRYIHAMLAGGIGGSSGDMLMHSLDT
                     VKTRQQGDPHMPPKYTSTSASYLKIFREEGFRRGLYSGVTPALWGSFPGTVIFFGTYE
                     WSKRNMLDHGINPTISYLSAGFVADLAASIVYVPSEVLKTRLQLQGRYNNPYVKSSYN
                     YRSTTDALRTIVRTEGFGAMFSGYKATIFRDLPFSALQFAFYEQEQTWAKEWVGSRDI
                     GLPLEILTATTAGGMAGVMTCPLDVVKTRIQTQQNPETQKPPSSSPSTTTTTTTTPTA
                     AADHAASSKDTRPHSHHHNPNNTTSTLKAHSRPISTSSPSTSTVQPGAPILNTSSIFT
                     GLRLLYHTEGLAGWFRGVGPRAVWTSVQSGTMLVMYQYLLKQMELWQHAEELDPL"
     gene            <369609..>370799
                     /locus_tag="TRUGW13939_06911"
                     /db_xref="GeneID:55994404"
     mRNA            join(<369609..369685,369759..369983,370055..>370799)
                     /locus_tag="TRUGW13939_06911"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490053.1"
                     /db_xref="GeneID:55994404"
     CDS             join(369609..369685,369759..369983,370055..370799)
                     /locus_tag="TRUGW13939_06911"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345946.1"
                     /db_xref="GeneID:55994404"
                     /translation="MSTAPYLRNLRKAELTELAEVSDLKDYADLKKAELETALDSHLR
                     ANSSIFSGEKRLADYYKRLAQPARVSSPVKKEPKAETSSIASEEKKFTRRRKPSAEVD
                     ETEPEKTTTPSAPVVAARTPARLARSPLSFASSLPPSPAVVTDAIDRQTTIVREKVSD
                     AWTKSGITERSDALRSALSSVKSIETIIVVLELISLSRELVPLRYLTTFPAVDSIATP
                     EFSVKVPDLFVLITGAFWAPFLLWALTSLVLPLTAAYFFNLSLRAQTSHSYSTRRASA
                     VASPATFDPLVYNIAKALVSYLVYANHFTFWETFSHFSLERVNVSIPGQWPGLVTGSA
                     IGILTSLYEAILKK"
     gene            complement(<371408..>372702)
                     /locus_tag="TRUGW13939_06912"
                     /db_xref="GeneID:55994405"
     mRNA            complement(join(<371408..372372,372585..>372702))
                     /locus_tag="TRUGW13939_06912"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490054.1"
                     /db_xref="GeneID:55994405"
     CDS             complement(join(371408..372372,372585..372702))
                     /locus_tag="TRUGW13939_06912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345947.1"
                     /db_xref="GeneID:55994405"
                     /translation="MEWHPASLFRTDTVPANPFAILVLNQPINERAFDAVRRHACYTL
                     LADGGANRYYDLAQSRSAATTDVLLLLLTSLSLMYIHISNFFLKHLQLPSCILGDLDS
                     IQPHVRAHYAAHHVPILHDSDQYSTDFQKCTRFLRAHAHAIMERENPTLSDNHDLYMT
                     THRRRRSSGHKKDSNNNNSPKRLDVVVLGGLGGRVDQGFSQIHHLYVAHAQRHEISST
                     GNSAEEEEEEEQQQQQEDIFGELYLLSEESLSFILSPGKHTIHTPLTHRLDLPEQEQE
                     QGQGQENILAENVGVIPLAGPTFISLTGFEWDVTHWKTEIGGQLSTSNHIRAPQLQID
                     VDTTVGRPVLFTVELAAGFKKGPVSR"
     gene            <373213..>379520
                     /locus_tag="TRUGW13939_06913"
                     /db_xref="GeneID:55994406"
     mRNA            join(<373213..373447,373503..374644,374877..374972,
                     375031..376373,376529..376619,376708..377855,
                     378419..378634,378695..>379520)
                     /locus_tag="TRUGW13939_06913"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490055.1"
                     /db_xref="GeneID:55994406"
     CDS             join(<373213..373447,373503..374644,374877..374972,
                     375031..376373,376529..376619,376708..377855,
                     378419..378634,378695..379520)
                     /locus_tag="TRUGW13939_06913"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345948.1"
                     /db_xref="GeneID:55994406"
                     /translation="HITAVTPQPYLSIPQTLPSRSVICYEPYLHHYLIFQTQDRHTKS
                     LLMAYNNPDAPFFRPPPETFAMFADLAEDEDQDEEEIIPRNRHASNVPPQTPLFFQQG
                     PALPLPRITPRAQHGRRPQTLNGQILHRPRREAPWHQGMYETDYIDDEADLVPKIPTL
                     TSQGRLPPKALRGANPPRRPPGQGGSLPSPTQSSDSHDDNGGAFPLPTRYKPSYAQAR
                     TASRFSEFSVFASQKDKKKANQVQRIAESEEGLRKFLDEFPKDTRFLAKLPQIEKYKQ
                     KLNTPNELLNSGEAKWVYEVARAVERRRVVIESKAFEEQAKAQTGGISTKRKRKDTSS
                     SPSSYGTPIRASTGGKTIPGHVVEESDEDSDDSDEEQGGRPRKKGQKTISGCDGSSIS
                     AFNVREALAETSESEAEDCSTEYDESDESDEESGDVIGDANAVLELGSVAVAEGEVEA
                     EAEAEAEDDLQSLSHLSTYILIQEDLVIMADDDRRIYEPRLDAFELYHKYDYPERPKH
                     EKDWKTAALQGPALPALGHAVAGAAGSAVSNVATYPLRLIVTRLQMQRLAARTQSSKS
                     SSKRESYAGMLDAAQKIYTKDGGIKGFFTGVGDDTWKTIADSFLFFLAYTALRERRLS
                     SNLGAGGKKRSVLPVLDELAIGVIAGAFSKFWTTPLANIVTRKQAAAILSDNASDEIS
                     TKKVAAQISAERGISGFWAGYSASLFLTLNPSITFFLNEFLKYLVLPRQKRRNPPAVV
                     TFLLAAISKAVASTVTYPVSLAKTRLQANPSSGEKTKSSSPAQAFRLEIFQALHSIAV
                     EEGASALYDGIIGEVIKGFLSHGITMLTKDAVHSSIVKSYYAVLILLDKYPTPEELMV
                     MAREQAEAYAEVAREGAKDLAETVKERVPSVTTANMSVDMTSNAPEYPPFEETNELAE
                     IVGDYVEDDATEWRSLYHWFWNRFNAHLNFLHITLTQSITSPHRRSSPDVSPASLQRD
                     PTTLNPRRLTLTMARSKRRKIGFEPTQAYTVDRLKKALRLYQRSKCHIKRRGLPHSYL
                     GSYLRSSYYDLRIRQSNLEPIDIDCDDDSDGNYSPKSRKKRKRNKAKPAELPLPEQVQ
                     PQKLVIIFHFKSITAKMFLHKLAHSAVFSDLIEDSNDIEEEKKVTQVQKKPPASVRSI
                     RTAYCHPLDCELGNNNGEPCEFCRNFTFGMFGLGLKEVTVADYGRGYGLEEVEGGHQS
                     AGHERTRICHNCCLDRQYITNCPGHKLSSLPGLDPFTFDFGKAFRSLEEKKGGYKQVN
                     QWCSLCLNPAFFRCSTELFIDKFARDIEDPSSPEASGCGILLCDSCKVLMERHGNDLA
                     RVVSSIPASEGVRADVDFLLPGSSLHRYFCEYFTVYRGAPDGSISETVTSLTDRPLVN
                     DEVYVRVTHSGVCGSDLHFLPFGIALGHEGVGVVDKLGPNVKRLQIGDRVGWGFITDT
                     CGGCSACLAGKLFLCESSQAYGPMGDANSGSFSTGAIRRESFLFQIPDMISSEDAAPL
                     MCGGATVWAPLFLHDVKPNETVGIVGIGGVGHLAIQFARAMGCTVVAFSQTESKKQQS
                     LELGASRFLATKGKNAEELLNTLQQKGPDNKSGRDFRLHHLIVTTSEMPDWDVFFPLI
                     RNGATIFPMTATDLEKKLDIPHLQFLLRGIKIISALPDRKSYPDMLDFAASHGIRPII
                     EVAPMSVEGVTKSIQRLKGGLVRYRGVLRC"
     gene            complement(<379586..>381655)
                     /locus_tag="TRUGW13939_06914"
                     /db_xref="GeneID:55994407"
     mRNA            complement(join(<379586..379642,379691..380699,
                     380748..>381655))
                     /locus_tag="TRUGW13939_06914"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490056.1"
                     /db_xref="GeneID:55994407"
     CDS             complement(join(379586..379642,379691..380699,
                     380748..381655))
                     /locus_tag="TRUGW13939_06914"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345949.1"
                     /db_xref="GeneID:55994407"
                     /translation="MQKPHRKRTIVSCLECRRRKLRCNRLEPCNQCSRLNKNCVFAPP
                     INDDKEPKKTRQTPPSLDSHIHPLQRSPPQPETTRIAPTPLAIFDASYSTGYNKNEEE
                     YNRADTGFRYGRLGLTDRLGGFFRPLLAQEVKSTLVTLEQKLRENGRLVPVDLEASLK
                     LRQEDFSFQSSKSILPMSLASLGTPTPALPGRLVADRLMLAFAHNVNHIARIAHMPTL
                     YNIYENFWRQTNDGFSPSGPSAALVHASIFAGLVSLDSSDVLRDLGTAKDILYEEFKS
                     RAEHALHHTDYMQTTKLEVLQALVVYLIPLCRSEISRAHSVIIGAAIRLAQCMGLHRD
                     GTHLGLDPLETHVRRLIWYQLCFLDIRTCEAQGPQPSIRQEDFDTLLPLSMNDEAVHP
                     VGPPPTSQDGHWTEMTFSLIRFECHEMQRKLFVARERLQRGIIDLNSIMRDIRSFEEY
                     MARKYDHLIDERVPLQKCAALVKSFMMTRFYVMILHRYNGSVEKPMPERLQKTLLDMA
                     TLNQEIGVALDSDPDIASWEWYTGAYNQYQTTFLLITHLLIFPDDEHADRIWKCADFV
                     FDTDPDTNREQKCWELMTTLQRKSAAYHMLRETKAPPVAMNWPYLGQGHDIQSLKAEA
                     PGIEALGDIWADFDWDEWDRIFNRESADIEAFA"
     gene            <383179..>384388
                     /locus_tag="TRUGW13939_06915"
                     /db_xref="GeneID:55994408"
     mRNA            join(<383179..383420,383488..>384388)
                     /locus_tag="TRUGW13939_06915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490057.1"
                     /db_xref="GeneID:55994408"
     CDS             join(383179..383420,383488..384388)
                     /locus_tag="TRUGW13939_06915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345950.1"
                     /db_xref="GeneID:55994408"
                     /translation="MAAILSTAVSLLLVSESLAAPSGIQKRGIRSAAHRYVPSRAAVD
                     NETGAVYNNFDGGGWIIPVLIGGQQVTLNLDTGSSDLWTASTLMSSDSQATVTTGEIY
                     DPSNSSTYQAMDGSTFDLEYADGSGASGPAALETINIGGATVPNMPFGVCDTLKYGGD
                     GTGTRDTDGPVGLGFGVENSIRPNPQCTFMECLEPYVPEPVFSTSFKTNNSGYIDFGY
                     SDSSAYSGDLTTIPIANTSSGNEGQWAYQGVQFGSGGNVFDAAAFDLDFDSGTSSLSV
                     SADVASAYFGLIQGTSNSSGSWQYPCGSTLPDLDFIFSSATSGPTTVTIPGANLKNGD
                     ASTGDCGTWMNVVTGRGNAGIPFYISKYMIWNQAVPELSFADQADN"
     gene            complement(<386095..>388708)
                     /locus_tag="TRUGW13939_06916"
                     /db_xref="GeneID:55994409"
     mRNA            complement(join(<386095..386627,386680..388123,
                     388181..>388708))
                     /locus_tag="TRUGW13939_06916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490058.1"
                     /db_xref="GeneID:55994409"
     CDS             complement(join(386095..386627,386680..388123,
                     388181..388708))
                     /locus_tag="TRUGW13939_06916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345951.1"
                     /db_xref="GeneID:55994409"
                     /translation="MSQSQLSDFTSSLYSGDIDDLPSLSTQQITPSASHHTIDSGFHR
                     PDDLLVPPSLIRVGPDRRNRFVLYDKMSHNEFIDWWLQTDYGRKRKINWDSHRHTVIW
                     NSYNQVAEGVDGTPKVMCKRCGKILEHPYSLSLNSSGKAQYHGTSTIQKHLKTAGCLR
                     SEKGKKAEITKFLQKEGEISADIPFLQEDWEDDILQFLTLNRLPFHLIEHPSFKRIIY
                     KARSALVAPVIPSADTIRRRLGSLVKDRQQRVLRTLPAGSKISIALDCWTSPFSQAFM
                     AITGYFIDSDWVYREVLLGFKPLHGTHTGSYLSGVLMETLVENNIEDRVFGLTTDNAS
                     NNKALAASLQQALSDGVIITRIPCLAHVIQLSLNQLLVRIKAVPSNESAETKWTESQS
                     RLVQENAKQCQISSTLNKVRYLAIYINASPQRRETFYNLQTTNVKIVPIQDVKTRWNS
                     TFLMLRRAKRLRAIFSLFCAEYDCEEMLLSEHEWRQIDYLLCITEPFFDYTTQLSKTR
                     DVTAHYVFKIYNRLFDHLERSQTQLQRKRVPWKKQMLDALDAGRTKLDEYYAQTDTIR
                     GHIYAVSTMLAPVNKFRFFLSSDWDQKWRDIYRNAFQQALIPYQAQVKSQSQDAYSSH
                     TAAQPSSRLEEMLDGKDIQPRAMTDEISQYLDSDTVSVGPLIFWKEHQYRFPAIAALA
                     RDALSFPATGAGVERLFNTARDVCHYRRGRMKTETIEELMMFLCTSKFDIEAQEAKLL
                     EKFFSQDELEAAKEEREEKLNKDEINPISDTEEQEDELENGPENEMEDIGLDTTSLSA
                     AEPDSPGSPSLPPTCTQTRVSGRKRKSREDDIFEYH"
     gene            <393042..>396542
                     /locus_tag="TRUGW13939_06917"
                     /db_xref="GeneID:55994410"
     mRNA            join(<393042..393244,393299..394796,394855..394907,
                     395428..395531,396187..396324,396379..>396542)
                     /locus_tag="TRUGW13939_06917"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490059.1"
                     /db_xref="GeneID:55994410"
     CDS             join(393042..393244,393299..394796,394855..394907,
                     395428..395531,396187..396324,396379..396542)
                     /locus_tag="TRUGW13939_06917"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345952.1"
                     /db_xref="GeneID:55994410"
                     /translation="MPYTSPLLLLPAPSDAGAMVPDRPHLPRSYSAQAYIRRHRRSPS
                     FSKLAPGSESPAADSPVLSHTQLPRLIVDPHASLRQSPPPRNNAVIPSGAIISPPESA
                     GNSSDEETSPRTVRRPLPVERLDAAIRSLQSEGEPSDKGDKESGPVPPLTPEARAISH
                     SRSSTENDIQFRADSLDSSSSIDSDRDELAPKPSMVRKKSGEVVRPALRTNRRPSSMP
                     GTPTFSKNVHFDAQLEHIRHFLQLDKPLAVSADTSPVETYPGATEYPFYHVPSYEWEV
                     KLPNFPADSTARRTQPVRLDRIYLSADQQSLVGVVVVANLAFRKNVLARFTLDYWKTV
                     SEVSAEYNQDVRRKHVNDGYDRFNFTINLSDVPNLETKTLFLCIRYTVAGQEYWDNNS
                     SMNYQVGFAKKEKTRPAEAPSAPTHEAQSLPRSRSAVSIASRPLSMPSFGEFGSPPTP
                     NFSFPRDSRNADSDFHLSPLDHPDFLEQPKPREKPAKQAWSNRYDFGASLSATKSNGA
                     SEDRTTLTAKARSAGGGHGRSFSSNDAGSPKPQPVAPLVSGKLHQESSSYKELVDKYC
                     FFGTATKSMELPHGPKNTRCLHLRWSRPYESRDNVSYDYELILQYTEYTAHLPSGKGG
                     KGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKTFLESV
                     IRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG"
     gene            complement(<397051..>397314)
                     /locus_tag="TRUGW13939_06918"
                     /db_xref="GeneID:55994411"
     mRNA            complement(<397051..>397314)
                     /locus_tag="TRUGW13939_06918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490060.1"
                     /db_xref="GeneID:55994411"
     CDS             complement(397051..397314)
                     /locus_tag="TRUGW13939_06918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345953.1"
                     /db_xref="GeneID:55994411"
                     /translation="MLLNASPMTRRAFDGSDLQLNHQQQNSVNTSRSNSTVTTSSTST
                     SFDYPRKASAEQTSLEKKRARQAATTKERASFFKAAGTVFALK"
     gene            complement(<398767..>404733)
                     /locus_tag="TRUGW13939_06919"
                     /db_xref="GeneID:55994412"
     mRNA            complement(join(<398767..399009,399077..399188,
                     399245..399303,399360..399525,399573..400929,
                     400982..401831,401884..402517,402886..403578,
                     403639..403760,403815..404119,404175..>404733))
                     /locus_tag="TRUGW13939_06919"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490061.1"
                     /db_xref="GeneID:55994412"
     CDS             complement(join(398767..399009,399077..399188,
                     399245..399303,399360..399525,399573..400929,
                     400982..401831,401884..402517,402886..403578,
                     403639..403760,403815..404119,404175..404733))
                     /locus_tag="TRUGW13939_06919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345954.1"
                     /db_xref="GeneID:55994412"
                     /translation="MQKQTSNMSQSESNPSKQTSQSVSSSSSAVDDGGHSRFTFVTEK
                     NQPGARTHAMRAHWQERRRRNQAGRVHDRTKRPLRSKPDASGSGSASQDEHMQSTTGG
                     TPIQDSIPDLQDPFSYMNLFSVDEQRQYSPKEKDPMSYIAPGLLQGVPAQILTGVNFA
                     LGSSRLDPFDVFPVTLTTEHHKLIHHWITTHATMMFEEMPTSDFNPMRDVWFPLDLSN
                     AACFNVIMAHSAAHLAYFYDGTTPTRGTNSFEALKYKSEALEILNQWFNDPIRALSND
                     TFAAVVRLLTFERYWGTEEGWQVHRDGLQRMIEVKGGVHKLHDDWRLELVVGLVSLMT
                     HPSWFSPTNDISSISSPNFLVTDIKRMRSLWLISFIQDMRNLVSMSLQLYRDGLSMFP
                     ALYDAVLFIRADFDTSVTFSSASSPLKTTYSNSDYDRLAAVFSICLMLQESVSVTFGS
                     PAVMATSNDKNALAVLNMSLFSAPDTWKTSVYALRSFLDAHFLQFYVAGAQKINYVVQ
                     MTDIVGHLSLEAHRGIEKCLLNMLCRTRYGRLVYRADDGATPDSLLSSLHGQRSSGLS
                     DETEVPLGSSRISADTGHGDSIPNAQLETLRSQIAAPAASIDFRPNNSRHNSNNSNNS
                     LSLSTPRSRNSSAIRNSFPPSPSHASSAPPTPTSTTKSDMIPMASRQLSSESLPEDQR
                     SRQFRLRSPWSLSILVLSTALAGVFFFLYIMHSFVQRPLGVNGCQVSMMSPTYLKMLG
                     FDTEHTRFASKYNLYLYREEGVDYYSQDNIGLSGAPVLFLPGNAGSYKQVRSLASEAS
                     RHFRHVILQDGERLNAGARNLDFFMVDFNEDLAAFHGQTILDQAEYVNEALAYILSLY
                     HDPRRLNRDSDLPDPSSVILIGHSMGGVVARTALTMANYQANSVNTIITMSAPHAKPP
                     VSFDSDMVHTYKQVNDYWRGAYSQEWANNNPLWHVTLVSIAGGARDTVVPSDYASLSS
                     LVPETHGFTVFTSTIPDVWVGTDHLSITWCDQFRKAVIKSLYEVVDVHRSSQTRPRAD
                     RMRVFKKWFLTGMEPTAERTLPQQEPNTLLTLDSSTNKILAQGERLVLRRLGNQKEPE
                     AHLMPVPPQGVSGKKFTLLTDRPFDKAEGNLEVLFCTIYPLQVGRAASSFSTNLDFSR
                     GGSGSTRLACKNAAPDRIHLPASTPSSQEAFDLRQPFSYLQYDLEDLAEHQFVAVIDK
                     AQDHTDGWVIAEFSDSSDAVIPTRVGLGRLLSAGLHVKLPANRPMLTEVKIPSLHSSL
                     LAYKLSVRTNKCTDPTPLFSPLLRQSMPEPHESKFFVNLHDVNVNLHGVAPYMPPPLR
                     EQAAYGVSFHLWSDPTCSSSVDLSLAVDIPNSFGELVMRYRTLFTAFPLFVVALVLRK
                     QFKVYDDTGYFITFMESLNACLRSSLPLVLGVLSLLASSLASTRRLPPSDDPFHWRSN
                     STETAVDFTKHDLLLGAQDAFFWFLVPLFGLISIGICVVVNYVSLVLLTLLSSVYGLL
                     RTKTGYIRRDDRGNTPIFSHPSPRRRMINATILLVLVATVIPYQFAYMVACLVQLSTC
                     ARALWYFKETRLAVNSSFFNYAHSILTLMFTLANAVFVAPQCTIDNAIFDTGRDDDEW
                     AHDSTYFFTTNERRVKYVTYIILFCLAGYSAVYGVTFAYLLHHIANIFSAWLVMLYLV
                     SGGFSIRRIFRILEGDDNTSLSANGKHKKKP"
     gene            complement(<405141..>405426)
                     /locus_tag="TRUGW13939_06920"
                     /db_xref="GeneID:55994413"
     mRNA            complement(join(<405141..405364,405417..>405426))
                     /locus_tag="TRUGW13939_06920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490062.1"
                     /db_xref="GeneID:55994413"
     CDS             complement(join(405141..405364,405417..405426))
                     /locus_tag="TRUGW13939_06920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345955.1"
                     /db_xref="GeneID:55994413"
                     /translation="MSSEPHQSSRFGKFFHHKHQNEHGEKSENPEEPSSRKTESETAK
                     VEDNLKKEGKKFEDYIHEDEELEEEGKTYGGLM"
     gene            complement(<406046..>406999)
                     /locus_tag="TRUGW13939_06921"
                     /db_xref="GeneID:55994414"
     mRNA            complement(<406046..>406999)
                     /locus_tag="TRUGW13939_06921"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490063.1"
                     /db_xref="GeneID:55994414"
     CDS             complement(406046..406999)
                     /locus_tag="TRUGW13939_06921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345956.1"
                     /db_xref="GeneID:55994414"
                     /translation="MAGQFSIEPQRVDAPLTQSATFLVLSLVDRPETVRTVRSTLANL
                     ENLTKNVSIRDPSASFTCTTGIGSDAWDRLTGLPRPAELHPFPEIKGAAHTAVSTPGD
                     LFFHIRSERRDLCFEFERQLLDCLGDTIVVVDETVGFRYFDLRDLLGFVDGTANPVGR
                     AVPNSTLVAQEEDAAACGGSYIVVQKYVHDLKAWRSLSVEQQEAIIGRTKVENVELDD
                     APPDHQQAHKSLSTITDENGVEHSILRDNMPFGSPGSSEFGTYFIGYSRRLWVIEQMM
                     QRMFIGSPPGSHDRLLDFSTPLTGTTFFAPSLSFLSSLDPD"
     gene            <408506..>410248
                     /locus_tag="TRUGW13939_06922"
                     /db_xref="GeneID:55994415"
     mRNA            <408506..>410248
                     /locus_tag="TRUGW13939_06922"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490064.1"
                     /db_xref="GeneID:55994415"
     CDS             408506..410248
                     /locus_tag="TRUGW13939_06922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345957.1"
                     /db_xref="GeneID:55994415"
                     /translation="MTVQDGARFDFIVVGGGTAGNIVASRLAENPNARILVVEAGIGS
                     SKDNEEIRTPGLAMEIRGSQYDWAYKTTMVKRDDYERIEKPNTRGKALGGSSSLNYFS
                     WVPGSKGTFDMWEEYGGKEWTWDPLVPYLRKSVTYHDDAGLYPPELKKIGAGGPIPIA
                     HAELMPEMKGFRDLVTKAWKSTGEPVTENIFDGEMHGLVHSVNTIYKGRRSGSFLAVA
                     DKSNITILPEVYSKRLIIDDADRTAKGVTVINGSGQELSFYATREVIVSQGVFESPKL
                     LMLSGIGPEPELKKHNIPVLVDSRHVGQHLLDHPGVPFVLRLKDDFSMDNHVLRKGAL
                     QNQTLAAYSKGHAGPMASPFLELIGFPRIDKYLEKSPEYREAKAANGGLDPFCPYGQP
                     HFELDFIPLFGSAFQWHFPHPNKGSYMTVMVDLVRPVSEGGEVTLNSADPLQQANINL
                     NYFSNDLDIIAIREGIRFTYDVLKNGEGFKDVVVDEYPWDMPLDDDEAMKRTVLDRSQ
                     TSFHPCGTARLSKDIRQGVVDAGLKVHGIKNLRVIDASVIPVIPDCRIQNSVYMVAEK
                     GADAIKRDHGDLYH"
     gene            <410984..>413055
                     /locus_tag="TRUGW13939_06923"
                     /db_xref="GeneID:55994416"
     mRNA            join(<410984..411008,411065..411194,411250..411273,
                     411329..411539,411603..411695,411746..411753,
                     411803..411926,411989..412276,412344..412428,
                     412492..412914,412985..>413055)
                     /locus_tag="TRUGW13939_06923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490065.1"
                     /db_xref="GeneID:55994416"
     CDS             join(410984..411008,411065..411194,411250..411273,
                     411329..411539,411603..411695,411746..411753,
                     411803..411926,411989..412276,412344..412428,
                     412492..412914,412985..413055)
                     /locus_tag="TRUGW13939_06923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345958.1"
                     /db_xref="GeneID:55994416"
                     /translation="MSYYTLAEGCPYARNDTSVQVRNGSGGGLVLLQDTQLIETLAHF
                     SRERIPERVVHAKAAGAYGVFECTHDCTDITSASFLNTVGKKTEVLWRVSTVGPESGS
                     ADTTRDVHGWAMKLYTDQGNLDWVFNNTPVFFVRDPIKFPSLNRSHKRNPRTHRPDAN
                     MFWDFHVGNPEGIHELMHLFSDRGTPASLRHMNAYSGHTYKFTKEDGSFKYIKVHIKS
                     QLGVKNMSADESTRIAGENPDFLLQDVFDAIEQGNYPVWNVYVQVMDPKEAETYKWNI
                     FDMTKVWPHQDFPLRQIGKLTLNRNPQNYFTDIEQASFSPSTMVPGWAPSADPMLQAR
                     MFAYPDAARYRLGTNYQMLPTNKARAPVYCPFQRDGFMNFSTNYGEDPNYVGSSLRPT
                     TFAVSATGKPLGSTITEHEKWVGEISSFTSTVHQDDFEQARGLWKVLGREPGHQDRYI
                     SNVSGNIKNVTSKELREKVYYLYHCVDPQLGQRIKTATEAQIA"
     gene            complement(<413596..>415184)
                     /locus_tag="TRUGW13939_06924"
                     /db_xref="GeneID:55994417"
     mRNA            complement(join(<413596..414237,414299..414973,
                     415035..>415184))
                     /locus_tag="TRUGW13939_06924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490066.1"
                     /db_xref="GeneID:55994417"
     CDS             complement(join(413596..414237,414299..414973,
                     415035..415184))
                     /locus_tag="TRUGW13939_06924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345959.1"
                     /db_xref="GeneID:55994417"
                     /translation="MTNNSRAGEKMSVGRYLATRVTTLVPPMNKAPNPFKALMLLNKQ
                     QWLFFFIAFWGWTWDAFDFFSVSITVTPLAKYFDKENSDITWGITLVLMLRSVGAIIF
                     GILSDRYGRKWPFVANNVLFIVLELGTGFCQTYNQFLACRALFGIAMGGLYGNIAATA
                     LEDCPEDARGIISGMLQQGYAFGYLLVTAFARGLVDTTSHGWRPLYWFGACPPVLFII
                     FRLCLPETQAYRSREEVRKGLGGGVAGNFLSEGKVALKNHWLLLLYLVLLMTGFNFMS
                     HGSQDLYPTLLENQYEFSANAVTVTQVVSNLGAMTGGTLCGWASQIFGRRFSIIVICI
                     VGGALLYPYTFVSSHSIMAAAFFEQFCVQGAWGVIPIHLMELSPGPIRTFAVGTAYQL
                     GNLVSSASSTIESTIGERFPLPPTASGSSRYDYGKVICIFMGCVYAYTIIITFFGPER
                     LGRKFDAEHDEDLNEVAERKLGVDSKADPEKGDSQHKD"
     gene            complement(<416083..>418147)
                     /locus_tag="TRUGW13939_06925"
                     /db_xref="GeneID:55994418"
     mRNA            complement(join(<416083..417813,417875..>418147))
                     /locus_tag="TRUGW13939_06925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490067.1"
                     /db_xref="GeneID:55994418"
     CDS             complement(join(416083..417813,417875..418147))
                     /locus_tag="TRUGW13939_06925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345960.1"
                     /db_xref="GeneID:55994418"
                     /translation="MEPLLRQWTAHIASGLYVRPVRLNSIRTRLPPCLASKRLVSTPA
                     TNPPGANPLGGIQLRDYQEESIQSVLDHLGQGHNRLGLSLATGSGKTIIFTQLIGHIP
                     PRNGTGDQTIIIAHRKELVEQAAHHCRLAYPDKTVEIEMGATKASGAADITVASIKSL
                     VSKERIEKFDPSRFKLVLVDEAHHIVAPQYREALAYFNLQEASDNAPALVGVSATFFR
                     YDGLKLGSAIDHIVYHKGYIEMIGDKWLADAVFTTVKTNVDLSRVSQDSSGDFMTRAL
                     SQAVNVATVNDLTVRSWLTNAGDRKSTLVFCVDTEHVRSLTNNFRKHGIDARYITATT
                     ARQVRNQELEDFKEGKFPVLLNCGLFTEGTDIPNVDCIVLARPTRSKSLLVQMIGRGL
                     RLYPGKENCHIIDMVSTLNTGIISTPTLFGLDPSEVLATESAEDIKERKESQGQGQLH
                     LANGLADRAQPLPGDKVDVTFTTYDSIFDLLRDEKSDRHIRSLSQFAWVRIDTDLYAL
                     AEKSGWITIEKTNDQFGPPFVIKSVHRYGMNSTDRMLLTKPRVVSRVADFEQAVRAAD
                     TFAVQHMSLIAIRTAERWRQAPPSPSQLKILNKRKIRDGDIEAGDLTRGQAADMLTKL
                     HFGTKGRFQSEQKKKKKEEKIRKEFEKQMSQGDVRVGPVIAPE"
     gene            <418435..>420363
                     /locus_tag="TRUGW13939_06926"
                     /db_xref="GeneID:55994419"
     mRNA            <418435..>420363
                     /locus_tag="TRUGW13939_06926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490068.1"
                     /db_xref="GeneID:55994419"
     CDS             418435..420363
                     /locus_tag="TRUGW13939_06926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345961.1"
                     /db_xref="GeneID:55994419"
                     /translation="MSTNENDSGIDQDYDYIFGPFQNAAAHYSSDSWRGSSPDLPQGD
                     KNDEVAPEHAQAAVEEGGKEYQEQEKEDHQVGEEEEEEEESVEGEEWIDESSEDEAGR
                     ERYYQGSRQAILSKSVLRQNQRQCLTKECVKAYQTLLNDMHVDADYEPNTPEEELSLV
                     TTKVGLTQWTKREEDNFFIALARKGKNSVEKITQHVQSKSQLEVQEYISLLQNAVQET
                     GEENQDELIRSFDIPAAVEISEETDEVLDHLAEHVSILDQRTKSIEGREKHGRDTWLI
                     DSKTASRIDDGDEPDKPDALKPGISSVAELFDLTEWVRLSRKIFMNSGTSRFEDNWRN
                     LAFKDESPSLTADAFTDLHDHAMSITRHLVEISLLFAQDRLARVLHVEHERQVKKSDV
                     LKALSALNMKPNAFHHFIGVARRLQLDVADISNKRGRNNRYLSYDEVEKVLSRKRRHG
                     SARSRRGSVSRGRTSGKSERNFDEDDDLYLSPHLSESEMAEGEGSDEEVLSVLDDDDQ
                     FHSSIEDINQSRIHAAEHEASDDDHCRTEAEAETEIERHIDEYTEFIDQEASKDDELA
                     LRQLLQCPEIDDLPPIVKAEQDEAPPMPEVESKKRHNDDVDWKDGLVYQAEWEAFGPN
                     LQQVDEAIAKNHKKRRLE"
     gene            complement(<420773..>422760)
                     /locus_tag="TRUGW13939_06927"
                     /db_xref="GeneID:55994420"
     mRNA            complement(join(<420773..421499,421555..421979,
                     422005..422114,422176..422476,422530..>422760))
                     /locus_tag="TRUGW13939_06927"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490069.1"
                     /db_xref="GeneID:55994420"
     CDS             complement(join(420773..421499,421555..421979,
                     422005..422114,422176..422476,422530..422760))
                     /locus_tag="TRUGW13939_06927"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345962.1"
                     /db_xref="GeneID:55994420"
                     /translation="MGEPTTKEHAHMPLEVSRVESINIGDLEKSTSPPTENLVYDDVD
                     EEPVIHLRTWIALASMFVMNFVQTFALQGPPSVLSYIGTSLNNVQAQTWISNSLTLMQ
                     AVISPLVSSTSDMFQARKLLLVGTSAISFIGAAIAPGSTDIYRLIGATILIGVGFSSV
                     GLAFAVPSEILPRQWRPMSQAGMNIAACLGAVAGPLVIGSFTEADEVNGWKKFYVFKA
                     NRQRWVQMALWGMTAIGIFFGYRPPTRHTRLDHLTFWQKLTHLDLPGFGLLTAGLTLT
                     LVALNLGGGLFSWTNAHVLSLLIIGLVTLIGFGVYQWKGTKTGILHHELFQGGRTFAI
                     CIVLMLIEGIMLFSYVIFFPIMTSELFEQDPFLLTIRGLPFWVVSGLSTALWGYWSMR
                     SRSIRTPLFAGFLIYTAGLVGLATVQPRDNLRSLIFAGLAGLGFGAPLVLIVAGVQLS
                     TPHHLIATATAVTTSTRAVGATVFTAIFSAAYSSDLGVKLPADIGSAVIKAGLAVDHV
                     SAFISALTAQDTAELSAIPGVNSTIIDAATVAMKQAYADSLHVVYYIAIPFGVMACLA
                     CFFLDDLRTTMNYRVDAPVENLTARRHTSEK"
     gene            <423471..>425201
                     /locus_tag="TRUGW13939_06928"
                     /db_xref="GeneID:55994421"
     mRNA            <423471..>425201
                     /locus_tag="TRUGW13939_06928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490070.1"
                     /db_xref="GeneID:55994421"
     CDS             423471..425201
                     /locus_tag="TRUGW13939_06928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345963.1"
                     /db_xref="GeneID:55994421"
                     /translation="MANTSLEAPWVPITRRKQGDRDACIPTQWHIPSLYLPKDPPRFE
                     DGLQSVLDVPSKILSQEEIKITEDYTVATLLEAISRKTFSTEKVIDAFCHRAAVAHQL
                     TNCLTEPLFMQAAERARFLDQYLEEHGSTLGPLHGLPVSVKDTFDIKGVDSSTGLAAL
                     CFKPADKNAPLVDLLLSLGAVILAKTNVPQALSSLDSINNVFGRTMNPANRLCTAGGS
                     SGGEGVMVAMKGSLVGFGTDLGGSVRIPAMANGVYSFKPSNLRLPYGGQAVLVTEGTS
                     RLGVQPVAGPLARSIDDINFVMQELVPRASLWGEDCVFGEYAQGHLQGAGPDGEVVIG
                     VLRCDGNCTLLPPVDQILSEVASSLKQHPNIKVVEVSTPTAWTQSQSTMSKLMGIDGG
                     VLMGKLLDSMQEPLVPWMQSRFRISKPCPLTEVTQLQTRRAELENEMLQIWSEVDKYG
                     RRTRKLDAIICPVAPHPVPEIERYDALGYTSSFVMFDYPAGTIPIRDVVEQDLHLGQP
                     FEGESLSSWDDSCRALWDEKTVNRKVYLGTPLSVQVVVPRLEDEKLGRVMALIDGVVK
                     GRSTSPKLPE"
     gene            <426601..>427698
                     /locus_tag="TRUGW13939_06929"
                     /db_xref="GeneID:55994422"
     mRNA            <426601..>427698
                     /locus_tag="TRUGW13939_06929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490071.1"
                     /db_xref="GeneID:55994422"
     CDS             426601..427698
                     /locus_tag="TRUGW13939_06929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345964.1"
                     /db_xref="GeneID:55994422"
                     /translation="MAETEVTFLTQGIKLETPKSGTYTAGDKVIGLVHFDPLRKDRVT
                     EVDLSLYGSSDPDWDTDGDDSKSETGLLTLNITLYSGAPVVHKNFPFEFTFPALTNHA
                     GPSHEWAPNHRFEHGYGHPLPPTWEGDFDRIRYRLTARIVSERRGTTTFTRKIKYTPS
                     KNASTDSSWIGYTCTLFGFFRSARLNPTEGLEEMAASDTVTSNQVIFRFPKVLVSGED
                     LLGSISVRAPSSEQLKLWYLIVDINLKKGIRTLGNPAGQKPRPAYRPARLLCSFSPTI
                     LPNEQPTDLLTLCKSLCPVPPFYTFKTFNIYVAGYLQIKALFTSSSGKLYRLASSDVP
                     VSIVGPPGFGNSMEGGKPRLTDKPFLIPQKK"
     gene            complement(<428470..>432622)
                     /locus_tag="TRUGW13939_06930"
                     /db_xref="GeneID:55994423"
     mRNA            complement(join(<428470..429117,429169..430135,
                     430203..430771,430823..431452,431548..432343,
                     432399..432493,432557..>432622))
                     /locus_tag="TRUGW13939_06930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490072.1"
                     /db_xref="GeneID:55994423"
     CDS             complement(join(428470..429117,429169..430135,
                     430203..430771,430823..431452,431548..432343,
                     432399..432493,432557..432622))
                     /locus_tag="TRUGW13939_06930"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345965.1"
                     /db_xref="GeneID:55994423"
                     /translation="MTSRQRVQPVLACARCYSLKKKCDKKLPSCSRCIIAGKECVGIN
                     RHSRKEVPRSVLQYLEKRLAETEQDQRSRPEPDYMQIETDSIVLKTAKVSGHAYNQAL
                     QTVSISIRNLYTTSCVGSHPGLLHESKLFYPTERPPVKVPVHGFYYEHLGKRAGYGNE
                     SQFSGIDALRIPFEVARHIFDNYVIAILPRYPCFTSSELWYHFGQVYSKQQANDSSFP
                     DVSRFIVSMVLAVSCLTSRREDFSRVASMSESLYRDAMRHWTFLKHSNIKSLQGLLLL
                     IQLGLLLPYINNVFYLGGETVRMAIGLGLHQEVDPTNGLTSQEVYLIDRTIAISTGSP
                     PCVSDGHITTCLPGGVEEGSHTAEVSTSYSDGRLNAKHFLLQIQLCRLQSEIYEIKFF
                     DRAIPDQFPSHDNWVQHMEERISSMLNLSVSSDGVVPQWIVNSAHHSQNLLHRPYPGN
                     MAPSHASLMAATTSAISLINGYHKSFQNPRLTWTFVVVNNAFQAAIVLLYIFGNYGYI
                     VREASLENELLSALDNLMAILDVGAQRWPVIDITSLYIKDLRDVVFSHQPGSIGSEND
                     LKLLGELELLLSQRRIRSIYQANTEIQHEFLSVEPSSPHEYSQQPFSNDMWQEFIGAQ
                     FDFEDAYSLNFLESSWLAQQQQTLLTSTVEATNEIPTSELPKDIKDVIDSMPSCSFCR
                     DQHIRCDRELPFCGACHRSRRECVYYDLILSQEIPRRNIHNLTQRITAASQFVPTLQN
                     ISLASTFPSKPVSIANSQPTWGINLLIPAAGTSKVGSGKSQDTPMSSIRTTNPDYIFF
                     GVSSHLASINSIMLPLSEYTPAIFGREPGARPIPDSSTPRVQVNRPDISTALRLFAVF
                     YRSVHVWYPVMNDESLQGLLSCCYTEPLGSCLDHDQELFYLILAISSQLTKRAEPWVG
                     FTPAAYFDKATSHVDTGCDHSSGSSTLHMMQRSLLICIYLLLSPGGGDIWRNLGFAIR
                     LYFDMSHGRSENINDLDEGHLTMLARTLYCIEGYVQIPESKHWTDDESRKVTTAFGRP
                     TVLITGDKLRDELTQPICDTTEERVSIQFYRISTIKMQVQSLLLSEASMQCNPGKLKE
                     RCEMFRKELLQWNQSWKTDFMSAIRSELHDWKGAVQCLEAWGSLQYNSTILILSRFSS
                     ETAEYVFNAVREIVSCCSLLVRQQQYSFCAIHDDEICRQIPVFPTDWTISHLLFSAAL
                     HLFSSEKRDVADHNSWERTVRSCLATMALMEADPANLSMGFSEILEGLYCKI"
     gene            <433219..>435038
                     /locus_tag="TRUGW13939_06931"
                     /db_xref="GeneID:55994424"
     mRNA            join(<433219..433473,433524..433713,433765..434597,
                     434657..434813,434869..>435038)
                     /locus_tag="TRUGW13939_06931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490073.1"
                     /db_xref="GeneID:55994424"
     CDS             join(433219..433473,433524..433713,433765..434597,
                     434657..434813,434869..435038)
                     /locus_tag="TRUGW13939_06931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345966.1"
                     /db_xref="GeneID:55994424"
                     /translation="MSIVRLDAEAPRVAVEDVVNIAAKGGIKLSDQMATDFVTLVSGL
                     EAVIANLPDDSCVIPIPDLSKYPRTGIHVPEDNDLGGWATKVTAKCTAPTSDLLKGRT
                     IALKDNIAFAGVPCTNGTSMVEWTPKVDATVATRVMDAGGIIVGKAACENSCFEALSA
                     SSITGNVHNPWAKGYSAGGSSSGSGRLVGTGAVHMSIGCDQAGSVRIPAASCGIVGLK
                     PTWGMVPYTGIINLDATIDHAGPMTRTVRDCALLLEAIAGPDGWDDRQLLLGLDDERL
                     KFVEPVDEVVSKPQGKMLSGIKIGVLQEGFQIDGQDDNIVKCAQAAVDKFEALGAKVA
                     PISIPEHKLASLVWMSSISLCGGQQALLGGMEGRKQLYMTDRLSLVGPHLTQQQFSSL
                     GPGAANLYLNHLWFSEKYGPALQGKCMNLQKFISDAYDKALKEFDVLVMPTLPHPAPK
                     LPENGYEEGILKFAMRTTGMIANTSPFDNSGHPALSIPVGFVPAREDANVKLPAGLQL
                     VGRKYADADCLKVAAAWEKAYDWKTL"
     gene            complement(<436568..>439820)
                     /locus_tag="TRUGW13939_06932"
                     /db_xref="GeneID:55994425"
     mRNA            complement(join(<436568..436732,436791..>439820))
                     /locus_tag="TRUGW13939_06932"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490074.1"
                     /db_xref="GeneID:55994425"
     CDS             complement(join(436568..436732,436791..439820))
                     /locus_tag="TRUGW13939_06932"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345967.1"
                     /db_xref="GeneID:55994425"
                     /translation="MPAVDVASVPAVSGKETASSVALVETLIQNLSISKTPDEANTHA
                     NSLASLLNGPIEEKAVPTKAVESLKKQLANKKDANARERALEAIRAVAEHSSVAPGVE
                     PFLVSLLGPSLTAVGDKMSNVKNAAQLAALALVKAINPNATKAALPFIINSILSAQKW
                     PEKMTGLQCVESLVEAAPAQLAFLVPDLIPVISESMWDTKPEVKKAAYGTMEKICGLI
                     VNKDIERFIPELIKCISKPENVPETIHLLGATTFVTDVHEPTLAIMVPLLERGLAERE
                     TAIKRKSAVIVDNMCKLVEDPQIVASFLPKLMPALNKNHDTLADPEAREKTKQALETL
                     VRVGDVKDGKIPELSNASDVSTVSAILKDILEPKYKAQIAGADASIDYISAIAGQLID
                     EKESQAIIWTENTLPYLTALIGDEAKSIAETLRKRASPTGTEDEEALEDEEEGEDLCN
                     CTFNLAYGAKILLNQTHLRLKRGQRYGLLGPNGSGKSTLMRAINNEQVEGFPKKDEVK
                     TVFVEHDLDSADTEQTVIGWTEKKLESVGITIGREAIEKGLLEFGFLQEQFESPITSL
                     SGGWKMKLALARAVFEEPDILLLDEPTNHLDVKNVIWLEQYLINSPCTSIIVSHDSKF
                     LDNVIQHVIHYERFKLRRYRGSLSEFVKKLPSARSYYELGASEMEFKFPEPGFLEGVK
                     TKAKAIVRVSNMTFQYPGTPKPQISGITFQVSLGSRIAVIGPNGAGKSTLVNVLTGEL
                     IPTSGDVYQHENIRIAYIKQHAFAHIDNHLDLTPSEYIQWRFQTGEDRETMDRANKII
                     TDEDEKAMDKVYTIEGTPRRVIGIHSRRKFKNSYEYECSFALGDNLGMKSEKWTPMST
                     QDNAWIPRTEILASHGKMVAEVDQKEALASGQFRPLVRREIEVHCANFGLDAELVSHS
                     RMRGLSGGQRVKVVLAACSWQRPHLIVLDEPTNYLDRDSLGALSKAIKTFEGGVVIIT
                     HSREFTENLTEEVWAVLDGKMTPSGHNWIQGQGTGTRLTDKTDNDAETFDAMGNVVAK
                     VEKKKKLTSSEERKKKKERMARRKRGEEVFSDEE"
     gene            <442488..>443093
                     /locus_tag="TRUGW13939_06933"
                     /db_xref="GeneID:55994426"
     mRNA            <442488..>443093
                     /locus_tag="TRUGW13939_06933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490075.1"
                     /db_xref="GeneID:55994426"
     CDS             442488..443093
                     /locus_tag="TRUGW13939_06933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345968.1"
                     /db_xref="GeneID:55994426"
                     /translation="MCCCFESNKAFRTSALGFRIILFANLMATMIYGAVTPSEMVKVT
                     AERVTLAITGVSMAAQLYATLARFSCLPYSFWAILGFDGICAAGWCAALAAMSYWDRA
                     VVYKPRAGDPAAWFKWANHRNSDTVLSDDGYGQWIHITWCKVVVNGQDRLVGNGAARL
                     QLHVLIGLSTVSLLFTGFTLWWTVRSAQYLGLIRKRNQTVV"
     gene            complement(<443499..>444596)
                     /locus_tag="TRUGW13939_06934"
                     /db_xref="GeneID:55994427"
     mRNA            complement(<443499..>444596)
                     /locus_tag="TRUGW13939_06934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490076.1"
                     /db_xref="GeneID:55994427"
     CDS             complement(443499..444596)
                     /locus_tag="TRUGW13939_06934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345969.1"
                     /db_xref="GeneID:55994427"
                     /translation="MLQLLVPPEAWRHMLRATLRECTYLPDPIAKTYMRQYVLHRYRA
                     KAAVFDAKYQELAQNLPMPQSTSPVAENTSTSTSTSIERQIRLRRSGRKLLRLLEHAN
                     EGYKKALERVLMLSYGRIGVKQHKLYSALLRDTGDAKQLNTNKDVEEILAKNCGCRFN
                     KDWQPPKVLVEVLKAQRNSPYVQVDRSTRFKFNPKLQIPTLNSWLKPMPEVRLRNLKR
                     QWYNRAKSSVLPPLDPSEWDILVGLLRGTVPWRPPVRRQKVPSPLTPPPTELSPLESF
                     LLQGAQKGVTFDPYVDERPHRITRRFMVRVWEKIYHRSPLRVETPQGIRYKFPTDRRS
                     PPLTLAVRSEEANCLFDGVDQYGRIVESRTQ"
     gene            <445144..>450473
                     /locus_tag="TRUGW13939_06935"
                     /db_xref="GeneID:55994428"
     mRNA            join(<445144..445560,445622..447290,447341..448019,
                     449588..450040,450107..>450473)
                     /locus_tag="TRUGW13939_06935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490077.1"
                     /db_xref="GeneID:55994428"
     CDS             join(<445144..445560,445622..447290,447341..448019,
                     449588..450040,450107..450473)
                     /locus_tag="TRUGW13939_06935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345970.1"
                     /db_xref="GeneID:55994428"
                     /translation="RSTRRSTLLWSAGRRFAGSSCTRLPDLVRLLQGPVGVMATNSTH
                     HRQRPSLAMSYSQNSIGSANGLSHMGSFNASQSVSSTPAPTPPGRNSQQSGMSYNNFT
                     NGMSQSSMQSNFAGYDGSNGYGVMMPYQEDYKPQIYRAVYSNVSVYEMEVNGVAVMKR
                     RSDSWLNATQILKVAGVVKAKRTKTLEKEIAAGEHEKVQGGYGKYQGTWVSYQRGVEL
                     CREYAVEESLRPLLEYDMGDGSARRASLETPTKEQAMAAQRKRLYNAENRGINQPAQA
                     TFFQNMSRTAANAVNAISKARFDSPNKRRPSMMRNSSSQQQMSSQESLGVPVASQGTM
                     YSVASDSGFASQHQNGGRNDLPFDQEDALEPPRKRIRSTPNHGRSFGGNSTLSAYEPT
                     PTEPNESFYQQLDGPMLVDDPQDGKEPLAAATNPDHFHKMKLIMTLFLDKRVKDFATH
                     PAIMQLSGEDLEIPLDEYQNTALHWAAMLARLPLLNALVEKGASIRRQNSTGETALQK
                     AVGTRNNLDYRTFPRLLEMFGPTIDMVDHNGRSILHHIALMAATGGGAHVSAKHYLEA
                     LLEFVLRHGAQAKENSENPSTNSENGVTENGQPQGEIISLGRFVSELVNLRDDQGDTA
                     LNIAGRARSVLVPQLLEVGADPYVANHTGLRPADYGVGVDMVSESSQSQQSGEKKDSF
                     IDQLAKTKKEILDATLAQIGTLVEETLGGIDRNLTSELSKKQAEFDHWHAKIRESARA
                     RQIDQNEVDGLKRKASNQIEVGRRIKNLERDSEELLVVLKTTCGDDYEVLESAPSGHA
                     DKDTGLDAAAFETIFADFDVGSDMSAEQKKFLESLPSATVLEARLKSYQDLNNEVITE
                     VERLKTRNVVLGENYRRVVMACTGWTADQVDEAVEGLTQCVRELNDNPMPEDEVIEIL
                     MKDRGQDCQPANKSRVSPNTRKIDARTDTSTSNMPNFDETAFNKSATVACANAVTNYT
                     SSVNPSGIVACYNIASWNNSTGIFQTDTRLYQKSAAVNEFNGLNMSDFSMSFSIPEAR
                     LSSPKMIPNTFMESSTPMPNQFLMGFQNVGQLSKSIQFSKLTTSDLRDLMIPAITLTA
                     NTGTMVNTSLASDMISYVTGQFVQADGTPTNITAPEANTMATAVAASASVFVLPGTHI
                     MVFPVGLIITCAWSGLFIAAVGAGTAGRYHYRMQYRRAQPGQSFAFGK"
     gene            <450924..>453893
                     /locus_tag="TRUGW13939_06936"
                     /db_xref="GeneID:55994429"
     mRNA            <450924..>453893
                     /locus_tag="TRUGW13939_06936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490078.1"
                     /db_xref="GeneID:55994429"
     CDS             450924..453893
                     /locus_tag="TRUGW13939_06936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345971.1"
                     /db_xref="GeneID:55994429"
                     /translation="MGSSATDTHTRPSQYETIYDNSTAMTAYDPIHVRTTDQLLQSPL
                     AQSILVQDNGSRDPSPELEAVIKGEKCFTDLIAERVRKAVQDQGDQSKKRVLLSQLLH
                     TGIAALFHFLQSNVTGPPLEFDVATVVLGEKISNDKSVLDTIRTKTLRDLSVDGEAVY
                     PLTPNIELFCAAKAILVDSGVLGNAESPLVATTARLRVNFLHQKMLSEVTGTLQKAIY
                     DDLELLSPRVLGGESNSSGAEKAAFLLERAAVHTHHGFDSKARSDLEQAAVANGFEFA
                     LTGKLGKRTKFQNRDITQLVVLAKSATDTTPADSEESRKEESSGDLKPKALDLNDDTL
                     LETISFAKDGGSKPEKITTVQDESSLPASLASVDPSDQPKLNPLDSAILLAIASAITN
                     NSPDHGLTREETLPYAIRVIEGGSSNWQIYTQALLVRSRCEAFKSRTVERGVLQMQAL
                     VDQVIADTATRDSAVARTSTVTNQHQDQPATFLPRPQESESAPAEERLEYIWTLDFQT
                     RWNLEAELAKRWVGLGGLRTALDIYERLELWAEVALCYAATQREEKAKAIVRRQLYRP
                     TSGDIVDDEENERYEGPELSSLPVDAPRLFCILGDIDESPAMYERAWEASGQRYARAQ
                     RSLARLHLKSEPPVLDKAEEAYKKSLKINPLNHGAWFALGCVQLNQERWDDAVQSFTR
                     TVQLEQDDAEAWSNLAAALLNVSADGKPAAKAAEVIPSEPAKTEDDEDDEDDEIAKPE
                     KADPYKHTRDALTALQHAARLKQTDHRIWDNILTVAASLPHPFTPYKDIVFAQRKVIE
                     LVSPKRGEKAIDLLILAMLVDYLVSGPEYETLLIPVEGTDEKILRSGTVAGQILTLID
                     EQIIPLITHSAPLWFVVSKVELYRKQPTKALAAHEKAWRATVSSCTQPAFQMGDEKKW
                     MEIVKATERLVRDGYAKMGGMTKEGQGEDGEELVAGDWRFKSRSAVRGILGNGKEFFE
                     GTDGWMRLKELQGEVTG"
     gene            complement(<454031..>455795)
                     /locus_tag="TRUGW13939_06937"
                     /db_xref="GeneID:55994430"
     mRNA            complement(join(<454031..455416,455478..455541,
                     455599..455632,455696..>455795))
                     /locus_tag="TRUGW13939_06937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490079.1"
                     /db_xref="GeneID:55994430"
     CDS             complement(join(454031..455416,455478..455541,
                     455599..455632,455696..455795))
                     /locus_tag="TRUGW13939_06937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345972.1"
                     /db_xref="GeneID:55994430"
                     /translation="MSPLTVNPLKQDTLSHVKCILICLVVTLGSLQYGLDYALVGGFL
                     SMPGFLKVFGYYDEAKATWAINPTVQQLISSLMTIGTFVGSLLVGPLSWKFGRRVGLW
                     SASLLCYISTAIMLGSSSVGALYFARLLLGVSVGWFMTFAQLYVYETSPAHLRAISLG
                     CYQVTLSIGSIIGSAIDKGTSTMESRRAYQIPLAIFFVVPTVLSICLFFFPESPRWLT
                     VQGRTQDARKALSRLRNSNIDPAQLQAELATIEKSTEEQLNTKGKPAWIEMWRGTNLR
                     RTLLSIAVVCFHSGNGSSWINIYTTYYFTIAGVKDAFSYSILVSCLGFLGVLTSVCFI
                     RYVDRRQVLFWGCLACGLCQLVPAITWSVNPGSINSGKVVVAFIALFTFFYTMYAPYA
                     WLLGGECPNNALRPFTFGVATAANFLFNWLGTFTAPYFINPAELNWSAKYGYIWFGSN
                     MIIAAFVFFFVPETRDRTLEEIHEMFEARVPAREFKNYVCEKTGAFAAEGMGQAGSLH
                     DDDSRSPSDGQEVNIESKA"
     gene            <456853..>458071
                     /locus_tag="TRUGW13939_06938"
                     /db_xref="GeneID:55994431"
     mRNA            join(<456853..456970,457033..457621,457678..>458071)
                     /locus_tag="TRUGW13939_06938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490080.1"
                     /db_xref="GeneID:55994431"
     CDS             join(456853..456970,457033..457621,457678..458071)
                     /locus_tag="TRUGW13939_06938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345973.1"
                     /db_xref="GeneID:55994431"
                     /translation="MVQQLQTAACVLIVLFAIIGTTAVSLRLWARYITKKWGLDDSIV
                     LFAWLLAAGETFCVYQYTLLSYQGYHERDIPKQTIEQKILAQQYNIANQVLYNPILSL
                     IKLSVIVFFQRLEDRRRIVQWNIYALATFEMAFMIASTLVDILQCSPVRYAWEGARMD
                     LAAQQAAGADDNGQVNGITIKGGHCIKQGNFFLATNGIAIFTDIWVLIIPGLILWDLR
                     MPKKAKIAAFCIIGAGGVVAVVSIVRVIIYSWRFSPNNHDMSWGVGYTTSGMVVHVAF
                     VAACAPALKAIFTRFWPKFFASSRNYASSKRGYRGYSHPNNNNNSSGVGGITVTNSIH
                     VSETNGHEMRGGISRQKRATESEEEIMSYGVA"
     gene            <459013..>460264
                     /locus_tag="TRUGW13939_06939"
                     /db_xref="GeneID:55994432"
     mRNA            join(<459013..459484,459546..459642,459751..>460264)
                     /locus_tag="TRUGW13939_06939"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490081.1"
                     /db_xref="GeneID:55994432"
     CDS             join(459013..459484,459546..459642,459751..460264)
                     /locus_tag="TRUGW13939_06939"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345974.1"
                     /db_xref="GeneID:55994432"
                     /translation="MTVSNGNTGLSRPPLQYSGSLSHLDYVEITPIIGREYTTAKIHD
                     ILHAPNSEQQIRDLAIIICERGVVFFRAPQDDLTIDEQKRFTVLLGELTGRPEGHGLH
                     VHPLFRDENNIPMGNGQHDESIYVINAKAAQKLYKSMKQVQRTEPKDPGLEWHSDCMF
                     EECPADFSFLRMEETPPTGGDTIWCSGYELYDRISPSMRTYFESLTTTCAQPVFKTAA
                     TAGGYEVMSPRGSPLNVGDSFSPIHPMVRTHPVTGWKSLYAAIGIHVTKINDVYSYED
                     QMIRDYIMRLITRNHDSVARWKWTKQSCAIWSNACTLHAATPDTHLVVNSDANRTGVR
                     ASGTGEKPYLDPASKSRREALGLPLN"
     gene            <461240..>462088
                     /locus_tag="TRUGW13939_06940"
                     /db_xref="GeneID:55994433"
     mRNA            <461240..>462088
                     /locus_tag="TRUGW13939_06940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490082.1"
                     /db_xref="GeneID:55994433"
     CDS             461240..462088
                     /locus_tag="TRUGW13939_06940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345975.1"
                     /db_xref="GeneID:55994433"
                     /translation="MSTTKTFAFIGATGGCTNSCLAHLLLSDLGYKAIALARTPQKLI
                     DSLLRQPGITESIIADKLTIIQGDATSVSDMKKILLIPRNGQGNTTAYGEKSPGAVVV
                     DGIVSGVGAVPSFEKGKLLSVKFDNLKITEESSTTLITALREVYAERDQQQEGKKPIL
                     AVVSTTGITEKDEKGDVPCLFKPGYHYLLATPHKDKKKMEAIITSAENQALFKAVVIT
                     KPAFLTGDGNLSTAKGLAKIRIGTEEDPAVGYFIARADVGEFLWEEVCKKEEPRWFGK
                     KVTLAN"
     gene            complement(<462374..>465822)
                     /locus_tag="TRUGW13939_06941"
                     /db_xref="GeneID:55994434"
     mRNA            complement(join(<462374..462812,462864..465528,
                     465585..>465822))
                     /locus_tag="TRUGW13939_06941"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490083.1"
                     /db_xref="GeneID:55994434"
     CDS             complement(join(462374..462812,462864..465528,
                     465585..465822))
                     /locus_tag="TRUGW13939_06941"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345976.1"
                     /db_xref="GeneID:55994434"
                     /translation="MADDLLSSEFDPLLYLQSEPPDIVQFDAEPDPESFADDLEALEE
                     RRLEIAEHNRRNRIVIQSRSWKLSDVFRSDDDIRPMTPTRPRNLPRKSILSDIVLPSS
                     PPMDTMPFISSAVYTASSPPMEARKRKSEVPSQTDDSKRHKVVGGFVDDDDDDDDRLL
                     SLQDAHGEYNPDATTTIGGFVDEDEDEDALAELQSNYPSYSIPLSQNLENSSTTEAQK
                     RIIPGPFVEDDDDYDAMDALRGAQTESDISLLQTIAKQPTTEATQVANKLPDSGIMNA
                     RLDLPRGATRKQETVTIKTCGGKVHRVASREGSTAISYERMVAGRSAPAPGKAQRSYY
                     GIEIHKLLDETVQERKDAAQRAEERPQVEQSIEASGVNQSGKNPLWTEKYRARKFTDL
                     IGDERTHRSVLRWLKAWEPIVFPGLAKPKQLQKGNDEAERAHRKILMLTGPPGLGKTT
                     LAHVCARQAGYEVLEINASDERSRDVVKGRIRDAVGTENVKSVGMETDPNKASKAARP
                     VCVVVDEVDGVVGGSGSGGEGGFVKALIDLIMTDQKNTARGKQDSSSTKKKKGDNFRL
                     LRPIILICNDVYHPSLRPLRTANIAELIHVRHVPLENVIQRLKMILGREKISFDNDGV
                     RRLCEASWGISAKKDRTDVHRGIAEGDIRSVLVSAEWVARKLRAMSTTTPRLTRSWLE
                     EFILRSQDGSSKGLGRGGVREIVDRVFLEGAGFPAPPVGVDSFNDPFEKEKTKTPVGV
                     ADLRKRHAISKLREMVETSGDYDRCITDCFVAYPLKSFQDDTLLSKPNSAYDWLHFHD
                     MISSKIFSNQDWELNPYLSQPIVAFHYLFASAKGSAGNSRAVTDNEQEEEEHPFSGPR
                     ADFAAFEALKQNRSTLIGFQSTFCASLLRLFRSLDSVATDLVPNLMRMLSPDVKPVVV
                     RGSEQKSVASVRKASEKALVRAAVRVMAGLGVTFDKVRVENEGTHGGWVYRLEPPIDT
                     LVGFSKLKETTLDAGGSVPVRYAIRQVLEQEYQKETMRKQSLSQLKYGSSSGKSGELN
                     GDDDKENAQKKAKRDAFGVKRDFFGRIINESLPMSNKDGIDQSSHNRKPSGEEQEHKV
                     WVTFHEGFSNAVRKPISLGELLAEL"
     gene            <466652..>468844
                     /locus_tag="TRUGW13939_06942"
                     /db_xref="GeneID:55994435"
     mRNA            join(<466652..466745,466805..467346,467396..>468844)
                     /locus_tag="TRUGW13939_06942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490084.1"
                     /db_xref="GeneID:55994435"
     CDS             join(466652..466745,466805..467346,467396..468844)
                     /locus_tag="TRUGW13939_06942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345977.1"
                     /db_xref="GeneID:55994435"
                     /translation="MDEIQNVSTQPGDENQSGIAAQDVGDASQASASQPPQDSPIKNA
                     DEGSDNPLDAPASPRPQDNDAEPEDEEMGGLESDTKKENGADETADGQGEGVSEEQSA
                     QDKAALEASARDHLVSQTHSIILPSYSSWFDMHQIHPIEKKAMGEFFNGRNRSKTPAV
                     YKDYRDFMINTYRLNPIEYLTVTACRRNLAGDVCAIMRVHSFLEQWGLINYQVDPQTR
                     PSNIGPPFTGHFRAVADTPRGLHPFQPGPNHVVTPGKPLAATDRAASATPAKADLNLE
                     IRRNIYDDKGKEITPVEDKEKQTNGDTPAPNGTSSESATKAMESAAREPRKVFNCWSC
                     GIDCTRLRFHYAKSTPVSTNSNAPGNKYDVCPSCFLQGRLPSSHNAADFVRLEEKEYT
                     NIPDKDAPWSDAELVLLLEGIENFDDDWHQIAEHVGTRTREECVMKFLQLEIEDKYVE
                     DIDGPNDGTIRALQGRDPISQLDNPVLSVVAFLAQMAEPSVAAAAAGRSVEQIRKELR
                     SQLNKEAPEAEKGKDKGVEGLKTEDSMDVDIVRQVESTGEKRESLSTVALAASAARAG
                     ALASHEEREMTRLVSAAVNVTLQKFEIKLEQFNEMEEIIEAERRELEQARQQLFLDRM
                     AFKKRVKEVQDALQATSLQAPGDETNQAINDAASAGIGVRYQFNHPQADMRNGVQPLS
                     AHPGADYKSLDL"
     gene            complement(<469725..>470546)
                     /locus_tag="TRUGW13939_06943"
                     /db_xref="GeneID:55994436"
     mRNA            complement(<469725..>470546)
                     /locus_tag="TRUGW13939_06943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490085.1"
                     /db_xref="GeneID:55994436"
     CDS             complement(469725..470546)
                     /locus_tag="TRUGW13939_06943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345978.1"
                     /db_xref="GeneID:55994436"
                     /translation="MLEAETSHVAVVLGAEPQFPRYSGDKVRQHKIYPNFLEMVLCRF
                     CHMFVEEHNRLREEEEIEQFQRIFELIITRQRQGDVLCENCGAIYGHPTCRGQHRSNA
                     DTGLILFSGCEEYQCHNRKGRDPLLLRRLEKVYEVDQKRARGDPVLCAFCHRTEPATG
                     RNFHVSRTGIGPSCMRRDCRRDAGMTIQQRARREFVALPHIDSLKENAMPAKMSVAFI
                     VAMPKGRERLGNCIPSQETDTVPIAIGNSAEQTLEQRRILLTQYPTRRDNLPKSH"
     gene            complement(<471105..>472139)
                     /locus_tag="TRUGW13939_06944"
                     /db_xref="GeneID:55994437"
     mRNA            complement(join(<471105..471296,471355..471658,
                     471739..471884,471951..472072,472133..>472139))
                     /locus_tag="TRUGW13939_06944"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490086.1"
                     /db_xref="GeneID:55994437"
     CDS             complement(join(471105..471296,471355..471658,
                     471739..471884,471951..472072,472133..472139))
                     /locus_tag="TRUGW13939_06944"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345979.1"
                     /db_xref="GeneID:55994437"
                     /translation="MSDRMEVDHAPAGPTLVACVSMVASGVPPASSDLLPLPCLALLL
                     AKVTTPPPPPPAGAPPAGDTNMPDAEGDDTEPSPAQITGRAAALESGHRTPERPVRVP
                     MELVGAAKALRKELEEIEKETEVENRFKKLLSTQMSEVDKRINDMAKAREGKIEDERR
                     ILAAVNCRKKGPKNDLKWSLCVDAGVSGPAGKKPAKSTPPPPPAGATPQRPAAASTTT
                     PAAGSLILNRKANDISTARELACTPPPTSKAKGGGSRT"
     gene            <477528..>481582
                     /locus_tag="TRUGW13939_06945"
                     /db_xref="GeneID:55994438"
     mRNA            join(<477528..477569,477627..477911,477978..478689,
                     479777..480297,480349..480973,481038..481233,
                     481291..>481582)
                     /locus_tag="TRUGW13939_06945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490087.1"
                     /db_xref="GeneID:55994438"
     CDS             join(477528..477569,477627..477911,477978..478689,
                     479777..480297,480349..480973,481038..481233,
                     481291..481582)
                     /locus_tag="TRUGW13939_06945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345980.1"
                     /db_xref="GeneID:55994438"
                     /translation="MTSLKIAVVGLGRMGKRHVHTLLYRVPRAQIVAVCSSEPSEVEW
                     AKQNEEYRDFKVAVYDKYDDMLNHPGLQAVWVSSSTDAHAPHTLGAIEKGLHVLCEKP
                     LGHNLEEAQSVVDTAKKHPELKVMAGFSRRFDASYRDAASKIFDGQAVGSPFIVRSNT
                     CDLLDDTGFFVRYAARNGGIFVDCAIHDIDLSLWYLGNPVPKACWAAGTLQHHPELEA
                     LSDVDNAVGMVEYWGGKIAYFYCSRTQAHGHDVCTEITGTHGKVMVNVMPKSNNVVFA
                     DKLGMRNEVQPEYWQRFEDAFATEANEFTRSILRNEPVPLPLETGIKVMQIGRALQDA
                     LLSGEVVRFNENAQLRIRETRKYASKTVQAEDPDLQQVFDTSCPPSGVPRSSQTEPDH
                     QPRNAGPAIGDSLAAKKASVAEPILGNDVFQESVPSSGQSISPTPVDLHVPIATPSTG
                     VEHHGILSNASFNESVGRSIDGSNSDVFSCSTPSVTTISQKPTPIFPVQPLKNIQEAC
                     LLRFWIEEISPWFDLCDEERHFQCLVPSRARNSPPLLNAILAVSSRHLSRLLQYKTPR
                     GVEYHGFLLPDLTTSTPVEYMLQCIPALLGFHNIHDKEEQENIMAAAVILRQYEELEE
                     DEIESDSDIHRNTGIHPHRQANFLAVTQAIIETTASTSIPGGLPSAIYWMAIRQEIYY
                     SLTRERCLRIGLEPGVSHGSSAANALIMHAGNVTKWRWGDKSEHEWESLNMQQQHLAD
                     EYLGMFTPLLDRKADKSKGEMFPTVWYSSDAQMTGAQHFELARMIMIAENPNLESRNA
                     PQYRSAHRKAEAQVRSIIFRLCGIALGHSKSRPALINAAISIMLYGEYFTDQSERSAL
                     VGIIDKLNSMHAWPMKKPYQVLKARWELTDNDDY"
     gene            <481880..>483602
                     /locus_tag="TRUGW13939_06946"
                     /db_xref="GeneID:55994439"
     mRNA            join(<481880..481939,482003..482554,482631..>483602)
                     /locus_tag="TRUGW13939_06946"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490088.1"
                     /db_xref="GeneID:55994439"
     CDS             join(481880..481939,482003..482554,482631..483602)
                     /locus_tag="TRUGW13939_06946"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345981.1"
                     /db_xref="GeneID:55994439"
                     /translation="MVNTGRPSSGCETCRRRRVKCDLRRPGCYRCEKLRQPCSGYRSL
                     NSQDSVFRIQTQSSYGPRSWQKPSARHRPKSPRVERLPEKEDLSVSICSPVGSWDSHV
                     IPLILSQFSASIPDGRASRVYRSLGSTFDLLQSVESGSLLYLASRAVGSAYFANKTRS
                     SNFTSIHQHLYGKSLRVLKEALQDSRIRKEDSTFMAVWFLGLYELIVGAPPPDGTDLG
                     PSSWDVHSRALISFIRMRGPEQFNSKRGCQLFQLAYHSIVGPIFKHHFPFSLLTVAQQ
                     VQYLQTGCHPPPEATEWFNSTKDWISTAKIIFVPLFSYCDKAARLCSNTQHLIQQFSP
                     ENVFGVIHNIFESCKELEISMQDRFREVIRYPYMVTVAESIESLMSITVGLHMQNHID
                     ACLLRIDQSMLQLLSHLSEQPGHSTAQLEEIERLRRLTVLQSQGRADRILETVPRLLP
                     LSISNSMGENGNWANSLRLLWPLRLVASSPFLLVRQNASASSTLARIGYEVGIMQAVG
                     GYLPAYQKLITTPCLRSVP"
     gene            complement(<484195..>484449)
                     /locus_tag="TRUGW13939_06947"
                     /db_xref="GeneID:55994440"
     mRNA            complement(<484195..>484449)
                     /locus_tag="TRUGW13939_06947"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490089.1"
                     /db_xref="GeneID:55994440"
     CDS             complement(484195..484449)
                     /locus_tag="TRUGW13939_06947"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345982.1"
                     /db_xref="GeneID:55994440"
                     /translation="MGDMAITEDMLKNIIAPVFVASAEDDSVAPGQTEEIARLLGDQA
                     TYHLFQTKLGAGEHCRLGAEPRLAMITMEWLQGVFEKAKA"
     gene            complement(<484591..>485508)
                     /locus_tag="TRUGW13939_06948"
                     /db_xref="GeneID:55994441"
     mRNA            complement(<484591..>485508)
                     /locus_tag="TRUGW13939_06948"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490090.1"
                     /db_xref="GeneID:55994441"
     CDS             complement(484591..485508)
                     /locus_tag="TRUGW13939_06948"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345983.1"
                     /db_xref="GeneID:55994441"
                     /translation="MHRPRHVSGHAVQNDPITIDSDSSSVVSSRSGSETQQVRSTANR
                     FQSNMPKENAIAYTQRLRMRNHTREIRHTAHFILASRELLMLHALASNESVPRTRRRF
                     LAQIIEPDNPKVALDLAFDSKANRGIGARDQGREQAPIGAIQGGARGGNVIDVIEEGD
                     AQGWELGFRRRDSNKANTSSSPARQSPSASSWKRGKGKGRTPDPERLAGGRSVSGSEA
                     GLAASPSPSSRERRERERERRRRWSGAERDRGVRISSTAGELEPEAIDLDVDMDLDAS
                     GSLNVDTVAPSRRVSGRTTMAASSDDDEL"
     gene            complement(<486329..>488583)
                     /locus_tag="TRUGW13939_06949"
                     /db_xref="GeneID:55994442"
     mRNA            complement(join(<486329..486377,486434..486914,
                     486963..487482,487540..487641,487689..487863,
                     487919..>488583))
                     /locus_tag="TRUGW13939_06949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490091.1"
                     /db_xref="GeneID:55994442"
     CDS             complement(join(486329..486377,486434..486914,
                     486963..487482,487540..487641,487689..487863,
                     487919..488583))
                     /locus_tag="TRUGW13939_06949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345984.1"
                     /db_xref="GeneID:55994442"
                     /translation="MADDTERRLSVRSTPHIRLNSGRQEPYVDLEEGTRELEHQLSNR
                     SQRSLVPPERRSTVITAAPELPSPPIISPPIISPTDSSELLFPPPRKVRSRGSPDRST
                     LISAISYQRNSWDSHSDAGSRDSRGFPFDPFVDSTCPSRADSDDENVNTQTVSEKYNI
                     MPTEGLLLFPEDVEKDDYLHNPDASDRDRVCDMCNTRGVFNIGGLAFLTIGIVALFIV
                     YPVTTFVGQMFEPPYDPCKEDPMCLDNNKSLLKNVRTGLIDPMTPESAMSKISADGTE
                     WKLVFSDEFNVPGRTFYDGDDPFFQGVDLWYGVTQDLEWYDPDAITTKNGVLEIRFDP
                     YDNHNLNFRSGMLQSWNKMCFSGGRLEASISLPGQGDISGFWPGFWAMGNLGRAGYAA
                     TTDGMWPYSYHDECDVGITANQSSPDGMSFLPGMRLPACSCPGADHPSPGKSRSAPEI
                     DVIEASVTVLDEFQDRIGVVSQSLQLAPYDVWYMPNYDFAAVYDSRITTINEYRGGPF
                     QEVASGLTNLNNDWYNGKEYQIYAFEYTPGGEGDVTWFVGGDKTWTLDARAVGPNGNI
                     GQRVIPTEPMYPILNFGISNSFAMINWTGLATTFPATMRVDYLRIYQNPDNISITCDP
                     EDYPTTEYIKKHPEPYNNPNLTTWSDTYDWPENSFVHGC"
     gene            complement(<490827..>492859)
                     /locus_tag="TRUGW13939_06950"
                     /db_xref="GeneID:55994443"
     mRNA            complement(join(<490827..491555,491603..492360,
                     492412..>492859))
                     /locus_tag="TRUGW13939_06950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490092.1"
                     /db_xref="GeneID:55994443"
     CDS             complement(join(490827..491555,491603..492360,
                     492412..492859))
                     /locus_tag="TRUGW13939_06950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345985.1"
                     /db_xref="GeneID:55994443"
                     /translation="MPDGTATATGSSRNHHAAHSSSSPNVEYVSQQDPFFAPRRRSHL
                     TAAERARRNLNAKLANPLAGFTHDELKKQGLRFSITHQMGDEEDIRAFEMGAVLAQAP
                     EKFDQIDGLTEAELRVLRNEFTNRWSQPPLMYVVIIICSICAAVQGMDETVVNGAQVI
                     YKYQFGINGNDARSTWLLGLLNSAPYLCCAIAGCWLTIPFNHWFGRRGTIFITCGIST
                     LACIWQGCVSTWWHMFIARFVLGFGIGPKSATVPIYAAESSPPAIRGALVMQWQMWTA
                     FGIMFGYAADLAFFKVPDPPNIVGLNWRLMMGSAMFPALIVLLLVFFCPESPRWYMSK
                     GRFDKAYHSMCRLRHSKLQAARDVYYIYTLLEAETSMKLGQKKLVELISVPRNRRAMI
                     ASELVMFLQQFCGVNVISYYSSEIFMQANFSPMSAFSASLGFGVVNWLFAIPAVYTID
                     TFGRRNLLLSTFPLMALCMYFTGFSFWIPEKHHTARIGCIALGMFLFGVAYSPGEGPV
                     PFTYSAEAYPLYVRSYGMSLATATTWFFNFILAITWPSLSAAFSTPGGFAWYGSWNVI
                     GWWLILMFMPETKNKTLEELDQVFSVPTRFHAAWGLRQIPYFVKRYLFRRQIKPEVLY
                     EKEETEQPDQVAYRELAMIV"
     gene            complement(<495359..>495730)
                     /locus_tag="TRUGW13939_06951"
                     /db_xref="GeneID:55994444"
     mRNA            complement(<495359..>495730)
                     /locus_tag="TRUGW13939_06951"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490093.1"
                     /db_xref="GeneID:55994444"
     CDS             complement(495359..495730)
                     /locus_tag="TRUGW13939_06951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345986.1"
                     /db_xref="GeneID:55994444"
                     /translation="MWRLGQSQSEPSQVTASNLGHAHSFITGEFSPQMARRAPIESPY
                     GHQLTRRVTWRSSTYKIIAYLYVLGILYIVWLIRDLFWLPFSSSPYSSHADPNGNQAF
                     PKEYVTYISFRFEIEAILDEY"
     gene            <498970..>500514
                     /locus_tag="TRUGW13939_06952"
                     /db_xref="GeneID:55994445"
     mRNA            join(<498970..499081,499164..499312,499367..500394,
                     500451..>500514)
                     /locus_tag="TRUGW13939_06952"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490094.1"
                     /db_xref="GeneID:55994445"
     CDS             join(498970..499081,499164..499312,499367..500394,
                     500451..500514)
                     /locus_tag="TRUGW13939_06952"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345987.1"
                     /db_xref="GeneID:55994445"
                     /translation="MWKASDKLMATIKHYASFPATGVSLRQMVQFGETPSPGTLFRAS
                     QFLSEELPIRLAHRVQELNDLPDGLNDMPSIKKVRDWYAQSFEEIIDVPKPSLSQEVK
                     SLLARPMKSNGHSKTLSKTTWNPSVKEGQYRSSPPSMSINGNRHIEEQVGMTNGGTKA
                     RLAAARRYFVPSEDHVDWPPEIDDFNQRFSQTLQQIKRRHDGVVTTVAQGILEYKRKR
                     QRLQIDSNIQAFLDRFYMSRIGIRMLIGQHIALTEQTHAHHPNYVGIICTKTNIQEVA
                     MEAIENARFVCEDHYGLFEAPKIQLICKPDLDFMYVPGHLSHMLFETLKNSLRAVVER
                     HGAEKEDFPVTKVIVAEGREDITIKISDEGGGIPRSSIPLVWTYMYTTVDQTPNLDPD
                     FDKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGTDVYLHLNRLSSSSEPLH
                     "
     gene            complement(<501106..>501988)
                     /locus_tag="TRUGW13939_06953"
                     /db_xref="GeneID:55994446"
     mRNA            complement(join(<501106..501844,501933..>501988))
                     /locus_tag="TRUGW13939_06953"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490095.1"
                     /db_xref="GeneID:55994446"
     CDS             complement(join(501106..501844,501933..501988))
                     /locus_tag="TRUGW13939_06953"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345988.1"
                     /db_xref="GeneID:55994446"
                     /translation="MKVFLIRHAETIHNVGQAWAGSTDSPLTSHGILQIERLAQYFAS
                     TRTRFSHVFSSDLHRAVATAEGINTTNTTELRLTALLQEQQFGSREGTVFRRSRRNNE
                     EKEEDAVFVPAETELAMRDRANAFLNDYFLPAVFEADSTSQAIAIVAHGIILRVLWEC
                     LTRLFSPGAVQFSPTGGGGGALTPFWSNTGFMEVSIEPDAALLDNPTSSISLLSDFVL
                     SGWSMTVLSIDSKPHLADLRRTRGGIGSMQHDTSQKRIDSFFRPRS"
     gene            <502821..>507416
                     /locus_tag="TRUGW13939_06954"
                     /db_xref="GeneID:55994447"
     mRNA            join(<502821..502878,502944..503214,503278..503679,
                     503745..504003,506002..506074,506133..506719,
                     506775..>507416)
                     /locus_tag="TRUGW13939_06954"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490096.1"
                     /db_xref="GeneID:55994447"
     CDS             join(502821..502878,502944..503214,503278..503679,
                     503745..504003,506002..506074,506133..506719,
                     506775..507416)
                     /locus_tag="TRUGW13939_06954"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345989.1"
                     /db_xref="GeneID:55994447"
                     /translation="MTDIAEQTNGQEQQEQPWSTPTKQPFQSGVRTNGRAFNSPNWRT
                     KTEESPQQTSSTQANNSPRSPFNRSWQAQTVSPAINEGRRLYVGNMPYMAKKEDVETV
                     FAEGGYKIERVDISIDPFTGRNPSYCFVELESKEQADRAMVELDGKDLLGRPVKVKPG
                     VAKASQDRSSPRPSNNNTTVAPRSTEKPGSPSVAFDRWQRNDASSHFKGYSENGRRLY
                     VGGLPKLSNQQTIDSEIQTLFNGYNIEAVSKLISPHPSKRFEAGDHYYLFVDFASADE
                     ATAAQAALDGHDGPWGGKIRVGKARGESWKPDERRKWSSTQTDDAPESAAAEPSSDDT
                     KICVIMVGLPARGKSLIAGKALRYFAWVGITARIFNVGTYRREKSPHPEATFFDPHNS
                     EGEKMRRAAAEAAVSDMLKWFREDNGVVGIFDATNSTKSRRAWIHKTCQEAGIETLFV
                     ESLCDDEDIIMSNILEVKTTSPDYKGQDPEVAAQDFRNRIRHYETVYETISEDEKAYT
                     YVKLINVGSTVIINQIKDYLSSRLVYYIQNLHIKPRSIWLSRHGESEYNLTGKIGGDS
                     DISSRGEAYARALPGLLKQSGVPPDTKLIIWTSTLKRTIQTARHLAAETGYEKLEWKA
                     LDELESGLCDGLTYEEIAEKYPEDFAARDEDKYNYRYRGGESYRDVVIRLEPIIMELE
                     RSENIIIVTHQAVLRCIYSYFHNMSQEQSPWMEVPLHTLIKLTPRAYGTEEKRFKANI
                     PAVSTWRGKGTSAKHQDPGQPSH"
     gene            <510380..>511812
                     /locus_tag="TRUGW13939_06955"
                     /db_xref="GeneID:55994448"
     mRNA            join(<510380..510403,510454..510522,510682..510741,
                     510864..511622,511693..>511812)
                     /locus_tag="TRUGW13939_06955"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490097.1"
                     /db_xref="GeneID:55994448"
     CDS             join(510380..510403,510454..510522,510682..510741,
                     510864..511622,511693..511812)
                     /locus_tag="TRUGW13939_06955"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345990.1"
                     /db_xref="GeneID:55994448"
                     /translation="MAPRAPKPKTPTRRGPSGSTRRGRGARRPALENVFTPPAVTTEE
                     LDALLAVEDSDLSSLEPDADMTDRLESGPAGDATSAPLAENMVEDADETPRHTQAASE
                     TPVPVASGPGIPDVLLSGDQPDFSGYYDPQSGAPLCALGARGLHRLTSQESARLARVP
                     PAYFGAVPVADERLVLWQSHPCLRCAKLVGRHQNFCVRRLPTEKCCRCSCLGVKCDSI
                     PDSQLASFRIVQAMFRLGVSPEAIRAAADWVRVVEGTLRREPSSSPSQSRIRSLGPSE
                     SDRVAALEARLDRIEGTMGQILQILNRQNEYFGIAPAAVPAAPASPAARRHGGVLWSP
                     PAWGGPSGQ"
     gene            complement(<515941..>517083)
                     /locus_tag="TRUGW13939_06956"
                     /db_xref="GeneID:55994449"
     mRNA            complement(<515941..>517083)
                     /locus_tag="TRUGW13939_06956"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490098.1"
                     /db_xref="GeneID:55994449"
     CDS             complement(515941..517083)
                     /locus_tag="TRUGW13939_06956"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345991.1"
                     /db_xref="GeneID:55994449"
                     /translation="MVTTRGMTSPTPDEPGTVPVPNPGFVHEEEEAQDHTSTEPAQDA
                     TSEELPPQAVPQVNMTMEMLQALIQGLRTTGPSHATTSERRDTKVPDPKRFASKSIKE
                     FEEWIEDVENNISSRPRSYPDEASKVQYAAAWLDGDHRIQWREKKNSINLQSFTFDDF
                     RTWLEDQIESPQNRGINSAMALLSLTQSNGQDPEAFYSKFSILYEKAREGSGGPPPAE
                     DLFKYRIFLAKLLPKIRSDITRMGTLPAKLPDLITTAQRLYQIEKQERRLERKAENEN
                     NNRSGGQGPTRNQEGSDSKPTRKRKYRSDHNDREKSQKKQKSFSKNKDKSTVTCYRCN
                     RTGHYATECKATKTAEGNPISPPKLNATHTKKEKETEKQSDKEQTQ"
     gene            complement(<518592..>519061)
                     /locus_tag="TRUGW13939_06957"
                     /db_xref="GeneID:55994450"
     mRNA            complement(join(<518592..518612,518665..518735,
                     518785..>519061))
                     /locus_tag="TRUGW13939_06957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490099.1"
                     /db_xref="GeneID:55994450"
     CDS             complement(join(518592..518612,518665..518735,
                     518785..519061))
                     /locus_tag="TRUGW13939_06957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345992.1"
                     /db_xref="GeneID:55994450"
                     /translation="MLLSVVISLALAVTGHAAVGPSPGGQPGNLSIKEAQDKYPDVDI
                     ACCENKESIQANGILGNVLQKGAALNNLLGTQDAACAKTSLIENLNILGFTKEGPNGV
                     SCSGITAYCPKGEDCHPADD"
     gene            <520600..>521060
                     /locus_tag="TRUGW13939_06958"
                     /db_xref="GeneID:55994451"
     mRNA            join(<520600..520873,520924..520991,521046..>521060)
                     /locus_tag="TRUGW13939_06958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490100.1"
                     /db_xref="GeneID:55994451"
     CDS             join(520600..520873,520924..520991,521046..521060)
                     /locus_tag="TRUGW13939_06958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345993.1"
                     /db_xref="GeneID:55994451"
                     /translation="MQHYLLTIAFAVAVAALPPSGQHAEQGNQVTIQQAQEQCPGEVA
                     CCINKEEVEGNGVLGNLLQKGLLLNNVLGTQDSACAKTSLIENLNLLGFTVEGNNGPS
                     CKSSTACCTGDNCSAV"
     gene            <522137..>525481
                     /locus_tag="TRUGW13939_06959"
                     /db_xref="GeneID:55994452"
     mRNA            join(<522137..523745,523802..524816,524879..525367,
                     525439..>525481)
                     /locus_tag="TRUGW13939_06959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490101.1"
                     /db_xref="GeneID:55994452"
     CDS             join(522137..523745,523802..524816,524879..525367,
                     525439..525481)
                     /locus_tag="TRUGW13939_06959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345994.1"
                     /db_xref="GeneID:55994452"
                     /translation="MLSAFKPRSLVELKPRDKSKIESVLAYGDRLLVGLNNGNLRVYR
                     VNEQAGDERNGHAIESSAGHDHDHDHDGDDGPSTTTTDLLREQEKFARYKIDQLAFIK
                     EANILVSLSGGYVFLHDLQSYDLGEQLMKTKGATAFAVTSNVVNDAETDVPSIVSRLA
                     VAVKRKIILWTWQDMELNPDAAEVTLVSGIKTLTWISGTRLIAGLTSNYVLVDIETME
                     LKDIVGPGSIGGGAGQESSRLGGVGVASMSYIGMGGIVPKPLATRLSEGQVLLAKDVN
                     THFIDIDGTSLRKRQIPWNTAPEALGYSYPYLLALQDPSKGTLEVRNPDTLSLLQSIS
                     LPSASLLHMPHPNISLAHAGKGFLVASDRAIWRMEALSYDNQIDALVESGYLDEAISL
                     ITMLEDALLTDKPGRLREIQLQKAQKLFNDRKYRDALDLFAGVSAPPEIVIQLYPKVI
                     AGDLSSIEEEEEEEETEHVEVNGADASAAATNGLHSHAEDPAPEALRSSTYAPSLTSF
                     LRGKGDEGSDDGSIRAKPMESSQSEKRLEGKDLKTAVRELQGYLADVRRRFQRFLNPN
                     GTLRAGSLHQDGEIDEFEESVRMLLGLSGEFEESEFEERLLENARLVDTTLFRAHMYA
                     TPSLAGSLFRIANFCDPDVVMEKLGESGRYNELIDFYYGKKMHRRALELLRKFGQEKI
                     EEGEKEDDEWAHLRGPKRTIAYLQHLSPEYIDLILEFADWPIREEPDLGMDIFLADTE
                     NAETLPRYQVIDFLEKVDNTALAIRYLEHVIDELNDLSPDLHQRLPNLYLEKLEEHKS
                     GKAKLASEDEFEEWKQKLLAFLKSSDQYSPAKMLDRLPQDDPDFYEAKAIAFSKMGLH
                     RQALEIYVFKLQAHDKAEEYCNHVHVTEEVSAAEIAPSHRLAPTDADDTKPPIYLTLL
                     SLYLSPPNGNKTQYGPALEIMAKHGSRLPAKSTLNLIPEDIAVQELEFYFRSRIRAAS
                     SIMNEARIVSNLQKVQNIKTQARLLVGEGLPDNNKARSRHVTITEERVCGICHKRLGG
                     SVISVFPDDRVVHLGCANRVT"
     gene            complement(<525714..>526007)
                     /locus_tag="TRUGW13939_06960"
                     /db_xref="GeneID:55994453"
     mRNA            complement(<525714..>526007)
                     /locus_tag="TRUGW13939_06960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490102.1"
                     /db_xref="GeneID:55994453"
     CDS             complement(525714..526007)
                     /locus_tag="TRUGW13939_06960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345995.1"
                     /db_xref="GeneID:55994453"
                     /translation="MAPEKPTISASYASPEPSLARTFQHEIAAPLRRDHSVAEKKAYL
                     SELRGLVTLVQAEVNVFLTERMEEDKKAAGAKDAERDAKEEQNYGEENVEEDA"
     gene            <526411..>528951
                     /locus_tag="TRUGW13939_06961"
                     /db_xref="GeneID:55994454"
     mRNA            <526411..>528951
                     /locus_tag="TRUGW13939_06961"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490103.1"
                     /db_xref="GeneID:55994454"
     CDS             526411..528951
                     /locus_tag="TRUGW13939_06961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345996.1"
                     /db_xref="GeneID:55994454"
                     /translation="MHSTRPDRRAAPQQPPPRAQQQQQQQHQRQRIDALRPGSSSSSD
                     GSSASSQVTTLSRPKNNTLYSLNSSSHRLPRNSSGVGNGTNSSNVSLPSVTVQRPSGG
                     APVRAQQNEPFTQKQFPRLPQHQQQQSHHHHRPRQHSQGFFEPSLPTASLAEHASNMT
                     ALSASQIAAQAAMQSTHHVRNRSQTVPVEDGPKGRKGSRDTPSPSQFAPTVTATHTRR
                     DFSAQTYQNGLVGSNAAAATTAANVVFPRSPGAETVDQKHKAERSKKKLFSKPKHIGI
                     SRDKEWKDKALPSPSKLGFGGSGGLSKIVSASTTNLTDMSSNNSSLYNLSNASASTVV
                     PVDRAEKDKDKDKDKSHKHHFLSRQKLKLKDDHFHLPLSSASSNSKPLDPNAPQSLYS
                     FTPSSPLSTGFGKSGLDILHGGRALREKKREEKAMASAAAIDANRDQESEWLAGAGSA
                     NASAALVGAPSLASTAGTYNNDSVKEALQGFGLHNMTAEDVWDFLKAKLLVVFDGGDV
                     RIAVEDLNKLVIIHIQRCVQKHMPTVVEDLRDLLYTGFSTLNHSISGVQDEKLIPHLV
                     QIWISAFGTILPFIQAVFLPLDLEFKGHGSVMNDREAREFWGAFPTNQDSPETAIGDA
                     LDVRTIVLIAFRDAVILQRYEGLKAVFSRLSLDTIDATFGALSGTSNSSNSGGRPATA
                     ASLDPNYSSVNSQSSNALNVAGSYSSDSLSATRSRATSNTSSNPDQLIFQSFTSPQRQ
                     MQSFRFNQATDTSHVITDTVGRLLQCFSVLASVQSNDEAQERVETLMKSLKHNWLGRG
                     RTGRDRRGFVGTKVRPVALTGDSASGKTNGSENGRWNMASSWSMNSML"
     gene            <529409..>530714
                     /locus_tag="TRUGW13939_06962"
                     /db_xref="GeneID:55994455"
     mRNA            join(<529409..529984,530048..530186,530245..530314,
                     530373..530430,530487..>530714)
                     /locus_tag="TRUGW13939_06962"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490104.1"
                     /db_xref="GeneID:55994455"
     CDS             join(529409..529984,530048..530186,530245..530314,
                     530373..530430,530487..530714)
                     /locus_tag="TRUGW13939_06962"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345997.1"
                     /db_xref="GeneID:55994455"
                     /translation="MEVQKSRQWILQNKPQGLPILDRGHNGTFALVTATLPQLGENQV
                     LVKPVYLSNDPAQQVWMSMSTADCHPERAYAPPIEVGDPIAAFAIAEVVESQCARLSP
                     GILVYGRVSWSDLAIIDEKDCFFTLESPTEKGLSITQRMGSLGLSGLTAYYGLYDIVN
                     ATANDSIVISGAAGAVGIMAVQIAKRIIGCKYVIGIAGTDEKCRFVEKLGADVCLNYR
                     SSSFEADLQEATKDCVDVYFDNVGGRILDMMLKRLKAQGRVAACGAIANYSNDDSQLG
                     LANYVDVVTMRLKILGFNVADYIHKSAEVSEILLQAWKEGKIVLGAETETVFESRLEE
                     VPHTWLEIFKGGNKGKMITKVI"
     gene            <531537..>534356
                     /locus_tag="TRUGW13939_06963"
                     /db_xref="GeneID:55994456"
     mRNA            join(<531537..531868,532000..532652,532946..534123,
                     534183..>534356)
                     /locus_tag="TRUGW13939_06963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490105.1"
                     /db_xref="GeneID:55994456"
     CDS             join(531537..531868,532000..532652,532946..534123,
                     534183..534356)
                     /locus_tag="TRUGW13939_06963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345998.1"
                     /db_xref="GeneID:55994456"
                     /translation="MAELSTCLPLTRESTLKAHELIKPFIHRTPVLTSRALNEIASNP
                     RAQENGDRQPAKPVIRLWFKCENLQRIGAFKARGAFYAIERLKQDPSFSESGGMEKGV
                     VGFSAGEKTSQLRGAMEPKSYFAQNSSETTAAKIVAEKGARLVLPFNHPDIILGQATA
                     VLELQEQADNLDAIIAPCSGGGLLAGTALSCDGTSVRVFGAEPEFEGADDCRRGFLTG
                     ERITSVNTSTIADGLMGVVGEIPWSIIYERKLVDGMFAVSEEQILEATRLILERLKVV
                     VEPAAAVPLAVALYNEEFRRLVEEEAGEKGWDLGLILSGGNVSAEGLAKLFGMSFPAI
                     SYGNFIHSSTVTSKSIMDIKSAQNGVPSGLHPTLIETDTKNKNRARLIIGIDFGTTSS
                     KAAFTLLSSDEVHEGIVTEWPGAGTHTKQDIPTTLYYDSYQNVAGWGLEPADALGPLG
                     YPKPGVQKVDWFKLHLTAPETAHPLPPGKSDIDVIADYLLKMRVSVHAQLQKTLCDAF
                     DREQDSIHYYLVVPAIWNDAAKAAIRVAATQAGLLHTGNNKNQLTLITGPRAAAMFYV
                     KTGFWELETRNTSLIVDCGGGFVDLTAYEVKEKPFKLTECTPSSGDLCGSTDLNRNFT
                     KILRAKIKKIGLRPGRIFAKCTIDFENRIKVEFRNNGQKWHIDVGVEADFPEADIKDG
                     YMTFTNEEILQCFTPVVNRISELVLNQISSIQGGGRQLQRILFIGGFGTSEYLFNEIK
                     QHIPSHLQSQVTRLMNSSSATVKGAVMAGIEGHQAGGL"
     gene            complement(<534421..>536409)
                     /locus_tag="TRUGW13939_06964"
                     /db_xref="GeneID:55994457"
     mRNA            complement(<534421..>536409)
                     /locus_tag="TRUGW13939_06964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490106.1"
                     /db_xref="GeneID:55994457"
     CDS             complement(534421..536409)
                     /locus_tag="TRUGW13939_06964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035345999.1"
                     /db_xref="GeneID:55994457"
                     /translation="MATSNEQLIQSLCDLEIPKSIRISPDRKKVLYSSELTWGHRKGK
                     FAVSTLWLASTDVPDSSVQLTPGLFRDYAPAWSPDGTAVAFISDRAGAGTKWALYLLP
                     LQQGGEAYPITPVGNASPITAFAFSPCGSHIAFLSADEDPQSTELRAWGESWRFTQLR
                     VVDVRTKRVRTVKLDRHVTGLCWSPDGTRIGFSSCLTPDIEEPHLTGTAISVIDTDLV
                     SIEELCHFPRVVIDLTWAVDGHLYFCAGVPASKTFAGHGVYRTDSGSRDHRYEWSAFG
                     LEDDSIGLARDSKGTLVVHVQHRLDSRVCLLDGTVLYSKPEELEAFAVESDADGNFVL
                     AVATSNINQPAEVYTTNSSNEETMTKISNHGNRFADRRFGTCSFLTQISSDGEVELDA
                     LYLTPKSYASSDTPCRPLPTAVLIHGGPNTRLTNAFNTYYYMLAPYLLSLGFGILLPN
                     YRGSSGRGERFGSYSIGGLGVYDYADVITLTQCAIDRGYADKERLLVGGWSQGGFLTN
                     LCSVRNGSHDGDWRFRAAIAGSSICDIDSMALTSDLGCVFEPELSRDGVAWNMDFDDT
                     RNRSASALWAFKEASRRADAEGAPVVPPMLILHGEADARCPVTQAWALRRALRSYDIP
                     FELVIYPRQGHFYEDQKYWVDMVLRTGRWCEKYIGDGR"
     gene            <537332..>540411
                     /locus_tag="TRUGW13939_06965"
                     /db_xref="GeneID:55994458"
     mRNA            join(<537332..538232,538287..540206,540281..>540411)
                     /locus_tag="TRUGW13939_06965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490107.1"
                     /db_xref="GeneID:55994458"
     CDS             join(537332..538232,538287..540206,540281..540411)
                     /locus_tag="TRUGW13939_06965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346000.1"
                     /db_xref="GeneID:55994458"
                     /translation="MQHEERISTNPQPPVLIPTSENSPPQFVDDIIVDPPNMSDHETT
                     ERQTSTADPVASTASSTVADNSVTTTPATKDDVTPPAEEAVAKVDTVKGSPTTATTKG
                     DKKKAACKKHKRKLAKKQDQGKKNKKNKKKPSKDESSSSSDTASDSDSSTSSSSEESD
                     SPDETSELSESDSESEKQKRRRRKAKNAKKARRKRRSHRDEESSDSDSDSTSDEDAIA
                     DQKALKRLRRRKAKKMARKLQSDSEEDDSTSESDRIEIRKRVSGLRLKQAASRRRLKM
                     KEKASGKKAKGKRASKVAFKRVDELWDSTIHNYKLRETMDDPDADEFNQYVFTVRRKF
                     DWENKYMETVVDIKSNFLKEALSTVMDGVKSVSLVADTPVVDPNMLFLYLEEARTHMK
                     ELKKLAKTEKKKKPRKLAASKAAHLKVLIKYLDNDYAETKKTLYPLLESNMITFDLLW
                     ALFKPNTIAYTPTYGHADEPRAFKIEYATKESSFMKGTWYVIEGKYLEYDGKTFGMGN
                     MAADVESFKGVRKITNLACYPLKYHREADNLKAKLVERGKKFVSLHGMNYRFHKGMAF
                     FKKKRSVIKVNINGRVMIDPALHRRINPNYPISTVKAKDPDLLDSDSEGDSDDCCCCA
                     SSSDEGHGDADDNDSGPSRPRYKLIRDKKGEAQLVEVEYDENGEEVPPKEDLDKIDNE
                     GKKEDSGPDFTEEELLIASPVVLGFAFSEKLWLEFSVSGVKDIEWNEGAFDSLVLPDN
                     QKSIVKALVESHSFHAAENIDDVIQGKGKGLVAVLHGPPGTGKTLTAEGIAELLKRPL
                     YMVSAGELGTDSRSLEGELNKILDIAHSWGAVLLLDEADVFLEKRTIQDIHRNALVSI
                     FLRLLEYFQGILFLTTNRVETFDDAFQSRIHIALRYGDLTTKAKRSVWKMFLEKVKSI
                     EGVETAEFTDKDLDALARHNLNGRQAPLAVNEKSALSMSHIKRVLEVAETFEQDLKGG
                     TGYMDAMRSYT"
     gene            <541373..>543472
                     /locus_tag="TRUGW13939_06966"
                     /db_xref="GeneID:55994459"
     mRNA            <541373..>543472
                     /locus_tag="TRUGW13939_06966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490108.1"
                     /db_xref="GeneID:55994459"
     CDS             541373..543472
                     /locus_tag="TRUGW13939_06966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346001.1"
                     /db_xref="GeneID:55994459"
                     /translation="MKAQSFDSPLLTISKWSHASKRKTNWPAKFGVLVVCVLVWTFGS
                     RIYPSSNNNNNDNENNIPGEEDANDGNDLFQWRDIVPSTSLEYKPCFSSSFLCARLSV
                     PLNWNSTKDDDSRAAVAVIKLPAKVPVTDPRYGGAIIVNPGGPGESGVYQVLSDGESL
                     QALVDSPVLPTSNSSAAAQGKYFDILSIDPRGVNNTTPHLRCFPDAFHQQVWQLLSPD
                     YGLLWHSESIIGMEWGRAAALGASCEYGKDEDGLQIVPYLNTAQTVQDMAQLIEKEGE
                     WREQEARRILSAGPRTSTEDEDEIMNRVQYRPGQEKIQYWGMSYGTILGATFAAMHPD
                     RVGRLILDGVVDPADHYAGRWLTQLQDSDKIVSQFCAYCFEAGPTKCPFYTGSSPADV
                     EARFTSILFHLKENPIAVVPLDDTTGPEMVTYNDVHLRLLSGLYFPFTMAENFFTLLL
                     ALESRNSSSRDLATMVTGKQALLTPLGCQQEGSESPILDIPYVSGVGAFQSISCMDIG
                     GSLNLTRPEFRAYLDELLGQSRWIGPSWARNKLACEGFTARPAWKPELTFETQEWANT
                     SHGLLIIGNTHDTVTPLRNARRVSTLFPGSVVLHQDSEGHCSHSSPSICTAKRIRQYF
                     HSGELPDEGTVCEPEVRPFLGCVSGAGGEGNKCDYADSWDAQLWKALVELADPFRLQI
                     DAARVTSWLPAGYPTRN"
     gene            complement(<543712..>544958)
                     /locus_tag="TRUGW13939_06967"
                     /db_xref="GeneID:55994460"
     mRNA            complement(join(<543712..544305,544355..544449,
                     544508..544657,544717..544834,544893..>544958))
                     /locus_tag="TRUGW13939_06967"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490109.1"
                     /db_xref="GeneID:55994460"
     CDS             complement(join(543712..544305,544355..544449,
                     544508..544657,544717..544834,544893..544958))
                     /locus_tag="TRUGW13939_06967"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346002.1"
                     /db_xref="GeneID:55994460"
                     /translation="MFAARQSFGLFQKRAFSASASNASKVAVLGAGGGIGQPLSLLMK
                     LNPRVTQLALYDIRGGPGVAADLSHINTNSTVTGYDPTPTGLKDALAGSEIVLIPAGV
                     PRKPGMTRDDLFNTNASIVRDLAKAAAEAAPNANILVIANPVNSTVPIVAEVFKSKGV
                     YNPKRLFGVTTLDVVRASRFISQVKTTDPANEEVPVVGGHSGVTIVPLLSQSNHADIE
                     GEARDALVNRIQFGGDEVVKAKDGAGSATLSMAFAGARFAESLLKASQGVKGVVEPTF
                     VDSPLYKDQGVDFFASRVELGPNGVETINPVGKVSAYEEKLLGAALEDLKKNIKKGVD
                     FVKANP"
     gene            complement(<545397..>548400)
                     /locus_tag="TRUGW13939_06968"
                     /db_xref="GeneID:55994461"
     mRNA            complement(join(<545397..545858,545918..546099,
                     546158..546257,546309..546327,546824..547252,
                     548264..>548400))
                     /locus_tag="TRUGW13939_06968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490110.1"
                     /db_xref="GeneID:55994461"
     CDS             complement(join(545397..545858,545918..546099,
                     546158..546257,546309..546327,546824..547252,
                     548264..548400))
                     /locus_tag="TRUGW13939_06968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346003.1"
                     /db_xref="GeneID:55994461"
                     /translation="MANQCSGHVFAIVQGTNGNILTWRCSDCNSGPFVAIWRCKICGY
                     NRRAPAPPEIEKTESISTASLVDVDAPSVQSVHSDFREQEVKTTTQAERLEREAEEAT
                     ARSKAAASKKATAKAQGISKNADNPVYIGNAVIAAAVGAGLGYGAYRKHTNGKLSWEV
                     AGIWAGAVGLFAGVDYFVSKYVFSSFLYSRSVDSMNSLFNSALKQSSSIRRDLDIFAE
                     SPSTTPPALQGQISASLASFSRTIDDYSGLAKSELIPEKKEKAIEREKNFRTALSDYR
                     QQFERLRKEREEAVSVTNRSELFGRRPHNATTPENPYADSALPRSSAFGAGNASGSSG
                     GGLSFGAGPGNTDRESHALREQSFFTQTNTQLDEFLDRGRAVLNDLGQQRDMLKNTQR
                     RLYSVGNTLGISGDTIRMVERRAKEDKWIFWGGVVVFFLFCWLVLHFLRS"
     gene            <548090..>548787
                     /locus_tag="TRUGW13939_06969"
                     /db_xref="GeneID:55994462"
     mRNA            join(<548090..548112,548178..548433,548491..548535,
                     548647..>548787)
                     /locus_tag="TRUGW13939_06969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490111.1"
                     /db_xref="GeneID:55994462"
     CDS             join(548090..548112,548178..548433,548491..548535,
                     548647..548787)
                     /locus_tag="TRUGW13939_06969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346004.1"
                     /db_xref="GeneID:55994462"
                     /translation="MHAGLIIIQLAESYSKADWHDTPVGHLRLGRMAVVAPVVAADLA
                     APDGHKGTRVAVGAAPGQDVAVGALHNGEHMTGALVGHFVWLIVVLSASVEMVDEGEE
                     ARVVSKTWPTLFCPVCLPQLDSGHRGTGTETETETDTDNDTNDAVRVTGGPN"
     gene            complement(<552561..>554222)
                     /locus_tag="TRUGW13939_06970"
                     /db_xref="GeneID:55994463"
     mRNA            complement(join(<552561..552591,552649..553655,
                     553710..553830,553896..553905,553964..>554222))
                     /locus_tag="TRUGW13939_06970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490112.1"
                     /db_xref="GeneID:55994463"
     CDS             complement(join(552561..552591,552649..553655,
                     553710..553830,553896..553905,553964..554222))
                     /locus_tag="TRUGW13939_06970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346005.1"
                     /db_xref="GeneID:55994463"
                     /translation="MRGVQIFSGTAHPTLAESICERLGAVTAPAELRKFSNGETLVNI
                     GVSVRNKDVYIVQSGSSKINDSLMELLIMISACKGGSAKSITAVMPYFPYSRQSKKKS
                     HRGSITARMIANLLSIAGVDHVITLDLHASQMQGFFGKPVDNLFAEPLIARWIKMNVP
                     EWKTAVVVSKNAGGTKRVTSLADTLKLNFGIVTTDRRRQPKVNISLSESTIFFDTIER
                     GNAAVSRADLAAASHESAIDDFFLSRSADTLRPETPPSARRPSELEAANDTTDERARE
                     VITGRLVQGHLVDDDYSEDTTQEGTPVPPAGSESGDSERVVDPMSSSIFSLHSLQPDH
                     ALGGTYDAEESDEDESHPHITEERTITLVGDVKDKPVFIVDDMIDRSGSWVAAAETVV
                     RKGGAKKVYCIATHGLFGENSLEDMERCTAIDHIIVTNSFPIPAELMRQSKKLIVIDV
                     STLLSESIRRHHYGESISALFQLAD"
     gene            <554563..>555389
                     /locus_tag="TRUGW13939_06971"
                     /db_xref="GeneID:55994464"
     mRNA            join(<554563..554658,554726..555207,555254..>555389)
                     /locus_tag="TRUGW13939_06971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490113.1"
                     /db_xref="GeneID:55994464"
     CDS             join(554563..554658,554726..555207,555254..555389)
                     /locus_tag="TRUGW13939_06971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346006.1"
                     /db_xref="GeneID:55994464"
                     /translation="MSHKFPEVQGGGSLIVAWQTRNKHVVVVGGGEVAAGRILHALNA
                     DARVTVVCPQTGLNEEVAYRVAQNQVSHVDRVFEPQDLDGADMVLCAIDDPEASTQVW
                     KLCKERRIPANIADVPPECDFFFGSVHRDGPLQIMVSTNGNGPKLASIVRKKIANTLP
                     QNTGAAIENVGRLRKKLRTVAPNAEEGPKRMKWMSTVCESWSLEDLVEMTEKDMDALL
                     SFYQPNKVPSLQDVREGSH"
     gene            complement(<555679..>561811)
                     /locus_tag="TRUGW13939_06972"
                     /db_xref="GeneID:55994465"
     mRNA            complement(join(<555679..555970,556028..557095,
                     557152..557518,557575..559877,559934..560118,
                     560171..>561811))
                     /locus_tag="TRUGW13939_06972"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490114.1"
                     /db_xref="GeneID:55994465"
     CDS             complement(join(555679..555970,556028..557095,
                     557152..557518,557575..559877,559934..560118,
                     560171..561811))
                     /locus_tag="TRUGW13939_06972"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346007.1"
                     /db_xref="GeneID:55994465"
                     /translation="MADSEHEAVERTSQADTNADAPEIISPQPLRADKPDLSVEAGWN
                     GVGVTEAADSQESQTVQLNGVAAPAEEEEDEEEEESGEPAPEATKDHKNENEDNETHE
                     EPQATPEPAPESRPRSDSRSTVATQAMHRSTPVSSTVFVVTALETIAASKDARRSKEL
                     EDAVQKALVNIKQSDTRPPDPETIFLPLQLATKTFSIPLQVTALDCIGKLITYSYFAF
                     PSSRDNQDDAAGKELPLIERAIETICDCFENEATPVEIQQQIIKSLLAAVLNDKIVVH
                     GAGLLKAVRQIYNIFIYSKSTQNQQIAQGSLTQMLGTVFDRVRMRLDLKEARTREPSE
                     HQESPADTETGDAVDGSQLSEAADSVQSISDQPVKKEPTEKLTLQSFESSKDDTMVTD
                     NAPTMVTRAKPTHRPTRSISGNTDDREDVDGSEDEVDEIYVKDAFLVFRAMCKLSHKT
                     LTHDQQQDIKSQNMRSKLLSLHLIHYLVNNHITVLTSPLATIRNSNSSSDSTTLLHAI
                     RPHLCLSLSRNGSSSVPKIFEVCCEIFWLMLKFMRVMLKKELEVFLKEIYLAILERKS
                     SPTFQKQYFLEILERLAADPRVLVELYLNYDCDSAALENIFQGLIEQLSRFLIMPTLA
                     ISQQPQHQETRSKSTSSTEWHHRGTLPPNLTTASLGSSPAPGLQSTAPELTIKQQALE
                     CLVGILHSLDNWSSQRLPSSDATIREEIVRKSVENYRESLDTPSIPAALPSPLIESAG
                     TATGRTTPALEDDPNEIERVRQRKMAHAHAIQQFNFKPKRGVKLLLKEGFIPSDSPKD
                     IAKFLLRNDRLDKAMIGEYLGEGEPENVAIMHAFVDSMEFAKRRFVDALREFLQSFRL
                     PGEAQKIDRFMLKFAERYLAGNPNSFANADTAYVLAYSVIMLNTDQHSSKLKGPRMTK
                     EDFIKNNRGINDNQDLPDEYLISIFDEIAKNEIVLDSEREHAANHGMATAAPAGFATR
                     AGQVLATVGRDIQGEKYAQASEEMANKTEQLYRSLIRAQRRTAVRDELSRFILASSVR
                     HVGPMFNVTWMSFLSGLSAPLQETQSIEKVKLCMEGIRLAIRISCSFDLETPRVAFVT
                     ALAKFTNLGNLREMAGKNMEALKVLLEVAVSEGNHLRESWREILTCVSQLDRFQLLSD
                     GVDEGSVPDVSRARIIPPSSSDGSKKSMQATRRPRQRSTASSLSFRPEVALESRSAEI
                     VHAVDRIFSNTANLSHEAIVDFVRALSEVSLQEIQSSGQSESPRTYSLQKVVEISYYN
                     MTRVRIEWSKIWEILGQHFNQVGCQSNTNVVYFALDSLRQLSMRFMEFEELPGFKFQK
                     DFLKPFEHIMANSNTVTVKDMVLRCLIQMIQARGHNIRSGWKTMFGVFTVAAREPYEG
                     IVNMAFEHVSQIYNTRFGVVISQGAFADLIVCLTEFSKNTKFQKKSLQAIETLKSSVP
                     KMLKTPECPLSHKHSADMPAEEIGANLAHQLNRQTKEEQFWYPVLIAFQDVLMTGDDL
                     EVRSRALNYLFDILVRYGGDFPSDFWDVLWRQLLYPIFVVLQSKSEMSKVPNHEELSV
                     WLSTTMIQALRNMITLFTHYFDSLHHMLDRFLGLLTLCICQENDTIARIGSNCLQQLI
                     LQNVTKFSDDHWSRIVGAFVELFDKTTAYELFTAAAPLATPKTLEAKTNGDSTTNDAA
                     SGHSVESATENDRSSTTNGTSDHATENGDAGETLAQAESLQGSTPTAELEDYRPQTAD
                     VQQQPAAVTVARRRFFNRIITNCVLQLLMIETVNELFSNDNVYSQIPSPELLRLMSLL
                     KKSYQFAKKFNEDKDLRMQLWRQGFMKQPPNLLKQESGSAATYINILFRMYHDEREER
                     RSSRAETEAALVPLCADIIRSYGRLDEETQQRNIVAWRPVVVDVMEGYTNFPKDSFSQ
                     HIATFFPLGIDLLGRELNPEVRHALQSLLRRVGEVKLGVTPETQLHTTNNK"
     gene            <562324..>565143
                     /locus_tag="TRUGW13939_06973"
                     /db_xref="GeneID:55994466"
     mRNA            join(<562324..562409,562472..562521,562588..562811,
                     562885..563925,564266..564430,564499..>565143)
                     /locus_tag="TRUGW13939_06973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490115.1"
                     /db_xref="GeneID:55994466"
     CDS             join(562324..562409,562472..562521,562588..562811,
                     562885..563925,564266..564430,564499..565143)
                     /locus_tag="TRUGW13939_06973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346008.1"
                     /db_xref="GeneID:55994466"
                     /translation="MRTPNVMLSKGAAFMRRPQTLYSLKDAARPQIPALSALSRYYAS
                     KSFPPHTIISMPALSPTMTAGNIGAWQKKAGDALNPGDVLVEIETDKAQMDFEFQEEG
                     VLAKVLKDAGEKEVAVGSPIAVLVEEGADVSPFESFTLEDAGGDKGAAAPQAEESKEE
                     APKPSPSESEAQPEAVEPEVTGERLQPALDREPQISPAAKVLALEKGIPIKSLKGTGR
                     GGQITKEDVEKAKPAVSAGAAGATYEDVPLTSMRKTIASRLQQSMRENPHYFVSSTLS
                     VTKLLKLRQALNASADGKYKLSVNDFLVKACAAALLKVPAVNSSWREENGQTFIRQHN
                     TADISVAVATPVGLITPVVKNVQGLGLSNISNQIKDLGKRARDNKLKPEEYQGGTFTI
                     SNMGMNQAVERFTAVINPPQAAILAVGSVRKVAVPVETEDGTSVEWDDQMVVTGSFDH
                     KVVDGAVGAEWMKELKKLKIHMFTPLQHSSSPDGMTTSESSEEAPQNEMECDDVVPYH
                     GHLDPAAKKVVQGEWKTSTQQLKELYGLILHEERDVQTFHLWLHMLDCNLTPNVRGLS
                     IEYQSIDCTHEDYSLVRLTLRANDDSMNRKTQIQILAFDDASKSDPDSDSNKVSWDVF
                     LKELEAHHQIMYQRGELDGDYDCFVAYRQFSRLYTLHGAEQSNLRQCWVRFTEERMRL
                     NHIQPLATDPYDSGPLFEFRVHYTLIKHLLRAFAGNINIPYMYAVPIYNLCVCY"
     gene            complement(<565386..>568250)
                     /locus_tag="TRUGW13939_06974"
                     /db_xref="GeneID:55994467"
     mRNA            complement(join(<565386..565400,565453..566001,
                     566051..566526,566581..566841,566890..567502,
                     567566..567718,567769..568169,568223..>568250))
                     /locus_tag="TRUGW13939_06974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490116.1"
                     /db_xref="GeneID:55994467"
     CDS             complement(join(565386..565400,565453..566001,
                     566051..566526,566581..566841,566890..567502,
                     567566..567718,567769..568169,568223..568250))
                     /locus_tag="TRUGW13939_06974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346009.1"
                     /db_xref="GeneID:55994467"
                     /translation="MDHLKEKFHNTSLHDVKAKASHFKSKVGKIENLFNPNHRHDEAH
                     EQETDRKRTAIAESHRFQSFAPEHDGNRVKWYVDAQDYLWAVSVALDRAQETIYLEDW
                     WISPELFMRRPPFYNQEWRLDQILKRRAEAGVQIYVIVYKEVEQALTCNSAHTKNALR
                     DLCPEGTKGAGNIHILRHPDHNMFENMGDMTFYWAHHEKFAIIDHSVAFIGGIDLCFG
                     RWDNNQHPLSDVHPAGIQHEVFPGQDFNNNRIMDFQSVNDWQNNELNKTDYGRMPWHD
                     VAMGLTGDSVYDIAEHFILRWNCVKRDKYKRDNKVDWLMLEGREEDITAVQRPKYPCG
                     DYIQHPLTPLSSKPRGDQGTVHAQIVRSSGDWSSGILTEHSIQNAYSELIRNAQHYVY
                     IENQFFVTATGDQQSPVENTIGRAIVDAVVRASKEGRKFRVIILIPAIPGFAGDLRDN
                     AAAGTRAIMDYQYKGILRGEHSIFEQVKAQGVDPTEYIFFFNLRSYDRINKTAKLVEQ
                     EELSGVRYQDIQRAEAEEIMSESIHPSVGKDGDRKEKDYSDQSADSSEVEKRVDQLRR
                     FEAQREKAYGEQKEIKSKDSIAENAMLNQKKVSEEVWENEDPETEKENFIQEELYIHG
                     KVCIVDDRTVICGSANINDRSQLGNRDSEIAIVLDDTDMIDSTMNGQPYRASRLAATL
                     RRHLWREHLGLLLPQDLDGTHNPNAQPPTDCLNADNEGPEDVFVSDPLGEELWDTWKK
                     QATTNTEVFRFLFRADPDDNIKTFEDYDQFAPRKAIKQGHLHDPFLPVNIVRSNLDKI
                     KGHLVWMPLDFLKDAEMAEPGLSVNQITVSVYT"
     gene            <568718..>570733
                     /locus_tag="TRUGW13939_06975"
                     /db_xref="GeneID:55994468"
     mRNA            join(<568718..568797,568853..568900,568966..569041,
                     569091..569101,569147..569245,569295..569368,
                     569416..569545,569822..569912,569966..570229,
                     570278..>570733)
                     /locus_tag="TRUGW13939_06975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490117.1"
                     /db_xref="GeneID:55994468"
     CDS             join(568718..568797,568853..568900,568966..569041,
                     569091..569101,569147..569245,569295..569368,
                     569416..569545,569822..569912,569966..570229,
                     570278..570733)
                     /locus_tag="TRUGW13939_06975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346010.1"
                     /db_xref="GeneID:55994468"
                     /translation="MNSSRNIYRREIDFRALALQSPEFSRRLKANDQLDFSDPDAVRQ
                     LTKSLLERDFKIRVDLPGNRLCPPVPNRLNYILWLQDLLDTTSEAGDDEYDPEKEVLG
                     LDIGTGCCSIYPLLGCSMRSRWKFFATDIDEDNIVSSRKTVSENQKSDRITVVKTDPD
                     DLLIPLDKLGIDRLDFTMCNPPFYESEQELLSSAAAKSRPPYSACTGAAVEMITPGGE
                     ITFVSNMITQSLNLQTRVRWFTSMLGKLSSLSAIVQKLLDLDVENWAVTEFVQGKGTK
                     RWAVAWSWMDWRPRSDLSRGLSTLPKHLLPFPSHFNVELPKDTKLEQVCSKLESELSV
                     LRYLVHTWVTKESCVGFAREDVWSRKARRKFSKEQHTKSANENDDPDVMDLEEQWKKA
                     PKDVAALGFRIDLRLEADTSVSMVIRWLKGMDQVLFESFCGMIKRKFGEE"
     gene            <573774..>574274
                     /locus_tag="TRUGW13939_06976"
                     /db_xref="GeneID:55994469"
     mRNA            join(<573774..573780,573837..573991,574053..>574274)
                     /locus_tag="TRUGW13939_06976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490118.1"
                     /db_xref="GeneID:55994469"
     CDS             join(573774..573780,573837..573991,574053..574274)
                     /locus_tag="TRUGW13939_06976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346011.1"
                     /db_xref="GeneID:55994469"
                     /translation="MTYSVDGGFPAPLETTSPAAAANSSTLPMMATTMKRKRKNNAKS
                     DPFRVQKLSSSAPRLSHQNENPMLLRNDTELVSAAKALREDIEKIDDEFNAMNRVKKI
                     LQDQISKLDKRLNQLAPSRRGQNKR"
     gene            complement(<575820..>576734)
                     /locus_tag="TRUGW13939_06977"
                     /db_xref="GeneID:55994470"
     mRNA            complement(<575820..>576734)
                     /locus_tag="TRUGW13939_06977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490119.1"
                     /db_xref="GeneID:55994470"
     CDS             complement(575820..576734)
                     /locus_tag="TRUGW13939_06977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346012.1"
                     /db_xref="GeneID:55994470"
                     /translation="MHHYTAVVSSTMPSCNGAPTKAWKQTIPQLSFSSEIVLNPMLAL
                     AALHLHSHSPNDGDTAIATRRYFGRALTHHRNALSDSGGEGSSEQLWLSAVLLGHMCW
                     LFEHQPQPNTKYELPIQAFKMLEGVGALFMQKNVKGYSWLGQETLPHVLPDEHLSIAA
                     KSQLYGIEEDLAYLLTTFDVLAMAPNARNIYIEAKDYVLYHFRAFYSGADAMILQRFV
                     AYMAVRCQVGYLDMLQRHDPLAMALLARMLVLLNELDYSWWANGKGEYEVVERDVRGI
                     CQLMPENLLWTMDWPCMVLDKKVVLCRD"
     gene            <577355..>578290
                     /locus_tag="TRUGW13939_06978"
                     /db_xref="GeneID:55994471"
     mRNA            <577355..>578290
                     /locus_tag="TRUGW13939_06978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490120.1"
                     /db_xref="GeneID:55994471"
     CDS             577355..578290
                     /locus_tag="TRUGW13939_06978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346013.1"
                     /db_xref="GeneID:55994471"
                     /translation="MSNTLAVFGATGVQGGSLINYVLNDPELSQKYRIRAITRDVDSE
                     KAKQLKEKTEVVQADISDEASLEAALEGVHTVFAVTVPSFGPDGLEIEYNNGKTIADV
                     AVQKGSKYIIFSTLPAVSEISGGKYPHVTMFDAKAKIEHYIRGLPIKSAFVSLGFFMQ
                     NLHTQPFLAPQPAPDGTWVLSRHISPKNQIPYIDAVKDTGTIIGAILAEPDKYEGKTF
                     CAAEKMYSLEEIVALMSKASGKTIVYKQVSLDEFKNSMPFAPDVFADGFSFQEEFGGY
                     WGPGSGDLATWAAENARGRLSTLEEYLEAHPLQLS"
     gene            complement(<580962..>582978)
                     /locus_tag="TRUGW13939_06979"
                     /db_xref="GeneID:55994472"
     mRNA            complement(join(<580962..581452,581522..582014,
                     582072..582398,582453..582610,582660..>582978))
                     /locus_tag="TRUGW13939_06979"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490121.1"
                     /db_xref="GeneID:55994472"
     CDS             complement(join(580962..581452,581522..582014,
                     582072..582398,582453..582610,582660..582978))
                     /locus_tag="TRUGW13939_06979"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346014.1"
                     /db_xref="GeneID:55994472"
                     /translation="MWKLYHGWYILATLLPALAGSTTTQQVLGDVSQCGRPNVVFILT
                     DDQDAHLGSLEYMPFVRKHLLDEGTYFNKHYCTTAVCCPSRATLWTGKASHNTNITDV
                     NPPYGGYPKFVDQGFNENYLPVWLQQAGYNSYYTGKLFNVHTVTNYNSPEPAGFTNYD
                     FLLDPFTYNYLNSTFQRKGENPKSYEGYYSTDVMSQKAQSLLQDAVLAEEPFFLTIAP
                     IAPHGNIVMNGSALDKNPVFEHSAPIPAKRHELLFGDVQVPRSANFNPGKPSGANWVL
                     DLPQQTQENVEYNDHYHRQRIRSLQAVDELVDDIFAKLEEYGILENTYVFYSSDNGFH
                     IGQHRLQPGKSCGYEEDINIPLIVRGPGVAANQTTEIVTTHTDLAPTFFDILGIPTRE
                     DFDGNAIPITPDGINEASQRRREHVAVEYWGYAGGEGIFDRTLHENNTYKAIRISGDG
                     YKFYYSIWCNNEHELYDMDTDPGQMNNLLSVPSSMDTTKSSPSAAIIVAGYPLNKIVS
                     RLDSLLLVLKSCKGAVCREPWKALHPKRDVNTLKEALSSKFDDFYQEQQTRVAFDYCW
                     NGYVPEAEGSMWEKDGLFFRDGLPWHVWT"
     gene            <583416..>585056
                     /locus_tag="TRUGW13939_06980"
                     /db_xref="GeneID:55994473"
     mRNA            <583416..>585056
                     /locus_tag="TRUGW13939_06980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490122.1"
                     /db_xref="GeneID:55994473"
     CDS             583416..585056
                     /locus_tag="TRUGW13939_06980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346015.1"
                     /db_xref="GeneID:55994473"
                     /translation="MAGNNDARSQVDIDNSVLHTLVQSNPKIAVLQSEAKVATEAEHG
                     MTVRDAVKRYPKAVAWSILFSTAIIMEGYDIVLVSAFFAYPSFQKKFGESVDNGATYQ
                     VPAPWQSGLSNGARVGEIIGLFINGILAETFGMKRTMIGTLVLLCGLIFISFFAQNIQ
                     TLLAAEILMGIPWGVFQTLTTSYAAEVCPVALRGYLTTYVNMMWGVGQLLATGVLRAL
                     LSRTDEWSYRIPFALQWIWPVPLIVGIVFAPESPWWLVRKERFEEARKSLRRLTSAAS
                     DNELDNTISMLRHSDAIEKELSAGTSYVDCFKGTNLRRTEIACIAWVIQAASGASLMG
                     YSAYFFEQAGLPTTIAFDFSMALYSIAIVGVFISWWVMTYLGRRTIYIGGLSMLFLVL
                     MGVGFSSLAHNTSANYATGILLLVFTLFYDITIGTVCYSIVAEIPSSRLRTKTIVLAR
                     IAYNIQGTINGVITPDMINPTYWNWKGKAGFFWAGLCFICFVWSYFRLPEPRGRTYAE
                     LDILFEQKVSARKFGSTALDIFDNVPDSFEEKRIEEAI"
     gene            <585704..>586498
                     /locus_tag="TRUGW13939_06981"
                     /db_xref="GeneID:55994474"
     mRNA            <585704..>586498
                     /locus_tag="TRUGW13939_06981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490123.1"
                     /db_xref="GeneID:55994474"
     CDS             585704..586498
                     /locus_tag="TRUGW13939_06981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346016.1"
                     /db_xref="GeneID:55994474"
                     /translation="MSTVAVVAGFSQTNRWLMYASFMLAPAQFVGGLGSNCPSNIGFL
                     AYNWYTQIQWYQAVKAKQLHALSLLPVHFNFLYVLTYLGGITSGNIFMGLILGLGTAG
                     VMILNTISAWTSWATNQQDGFGVYQFFFFGWRTLSPGWHTFILLWQIADSILAFGCVL
                     TALTISVMVTRKDFDEDKLPWYLHTYPMILLGSVAMLLAGWELILWAELIVSRNHIES
                     ETDMVAVWLFVAQVGAMLIPSCGSVLGCFRSGFRGPRSSPEEHGLV"
     gene            complement(<587625..>589057)
                     /locus_tag="TRUGW13939_06982"
                     /db_xref="GeneID:55994475"
     mRNA            complement(join(<587625..588910,588970..>589057))
                     /locus_tag="TRUGW13939_06982"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490124.1"
                     /db_xref="GeneID:55994475"
     CDS             complement(join(587625..588910,588970..589057))
                     /locus_tag="TRUGW13939_06982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346017.1"
                     /db_xref="GeneID:55994475"
                     /translation="MSAATMKGTRDNENAQGFHNPCNCQECQQVRLSQAIAAQQHSYL
                     PPPQLQSTFGFPSMMPESLSNPTSFHVNRPNRPRTTRKKDDFRTKEPDPRVSSTAYET
                     VSPSSFDTHDHGNPSYARSASSSVKYNPKGNFYSHSPVYLNVTQPIDGLETPFYQLPS
                     YPGPHNVDPPLSPTVFGQWWDYNPQNMSTWWLPSWVLRENNYLYPLDTTHSVYSTGWD
                     MRHESTTQQTSAYSPQYSTENNYSMWQAAVPHTWLDTSVFTREYKTPQTMDNTNANLS
                     HPPLHPPIRPQTVASFHSAKDPTHQDFLSRAAKNETLFPIKKEKNRQTKGSSGHPLRE
                     ATLGNHHKRTNTVTPPQNITKNSDTTRDYQPEKTGHRADTYKPSPNNPSYHAPERKQS
                     ATSDYERDSGMPYPLTKDALAKLNKEHGDDIDSKVQGICRANSSWSTTSDEGNFMAGN
                     KGKRGKH"
     gene            <594936..>595396
                     /locus_tag="TRUGW13939_06983"
                     /db_xref="GeneID:55994476"
     mRNA            join(<594936..594951,595017..595160,595227..>595396)
                     /locus_tag="TRUGW13939_06983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490125.1"
                     /db_xref="GeneID:55994476"
     CDS             join(594936..594951,595017..595160,595227..595396)
                     /locus_tag="TRUGW13939_06983"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346018.1"
                     /db_xref="GeneID:55994476"
                     /translation="MGWFDNDSEQSSSHERWNNSEPQEHDSSIVHELIAGAASYEAAK
                     AYEDHVAKNGNPPSHAKAKEIMAGFAGAFVDREVETRGLDFIDKEKAKYHARQQIDNV
                     PEDRFRY"
     gene            complement(<597003..>597553)
                     /locus_tag="TRUGW13939_06984"
                     /db_xref="GeneID:55994477"
     mRNA            complement(join(<597003..597215,597263..>597553))
                     /locus_tag="TRUGW13939_06984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490126.1"
                     /db_xref="GeneID:55994477"
     CDS             complement(join(597003..597215,597263..597553))
                     /locus_tag="TRUGW13939_06984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346019.1"
                     /db_xref="GeneID:55994477"
                     /translation="MTSHSDPQKDPNSRVPLAPVLHRVWATSTPYTASIQANIRSLDP
                     RRPHVGAHHSDHTQRARYIGGPSATLLLHDLLSCSSPACRPAAQPGPRAHRNQPGQGT
                     RSRCKYVRRHNALPNRVCAKLGALVPTGSRVAATIPMFPREHVECVERSEHTKCLEPG
                     ERRNADS"
     gene            <600341..>603137
                     /locus_tag="TRUGW13939_06985"
                     /db_xref="GeneID:55994478"
     mRNA            join(<600341..600518,600586..600789,600854..600936,
                     600994..601266,601326..601482,601543..>603137)
                     /locus_tag="TRUGW13939_06985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490127.1"
                     /db_xref="GeneID:55994478"
     CDS             join(600341..600518,600586..600789,600854..600936,
                     600994..601266,601326..601482,601543..603137)
                     /locus_tag="TRUGW13939_06985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346020.1"
                     /db_xref="GeneID:55994478"
                     /translation="MAHPQPSPPGGVPPQHHGHLAAHAQVNGHIPVQSQGQKGPHLNT
                     AQKIATLNEQVWLQIGSVTELMGELDGAMGAYEQALRHNQWSIAAMTAISQILRTREQ
                     FPKAIEYLQNILKLDPQSGETWGSLGHCHLMMDNLQDAYTSYQQALYHLRDPKEPKLW
                     YGIGILYDRYGSLDHAEEAFSQVMRMAPDFEKANEIYFRLGIIYKQQQKFSQSLECFK
                     YIVNDPPRPLTEEDIYFQIGHVHEQQKDFDAAQAAYRRVLDKDPNHAKVLQQLGWLYH
                     QQSNSYASQEKAIEYLEKSVSADNNDAQSWYLLGRCYMSQQKYPKAYEAYQQAVYRDG
                     RNPTFWCSIGVLYYQINQYRDALDAYSRAIRLNPYISEVWYDLGTLYESCNNQTADAL
                     DAYGRAADLDPTNVHIKARLQLLQGQMQGQTQASAPAPVPQDVHPQAYQAPGVGAPPA
                     PQWGAPAPTGGPPPQPPAPPRQIADWNRGINELQNPPPPPPSGYDQRDALRGPAPGQH
                     PSPRPDLPRSSLPEPRGPQPRSPAPNAYPPTHTLPQLAPPAPGPHDRAPNGAGFRGPP
                     GPNGGPAPGGPPPPSYGRPFTPPTEIRPLRDIADRPSSPGSTYPHQQFHHGPNTVSGI
                     AGGAPPPAAAMTAADAAARDRDDRPPSAMKRAREWGDSGEGAPSKKIANEDNRIRQDD
                     LSRRVTPPRDIHRRSSSEARRDEQRRANDNYHPSEAAHHPPTLPSIQTMPHPSGTSIP
                     PMNEVPQSASNPPSAGPAAASVKEEGNRKEQASLHEPAARKMDVDEDYDDDVEDEKRA
                     GTGPKGSPHGSAAANGNHTNGNTGSAKPESA"
     gene            <604015..>604320
                     /locus_tag="TRUGW13939_06986"
                     /db_xref="GeneID:55994479"
     mRNA            <604015..>604320
                     /locus_tag="TRUGW13939_06986"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490128.1"
                     /db_xref="GeneID:55994479"
     CDS             604015..604320
                     /locus_tag="TRUGW13939_06986"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346021.1"
                     /db_xref="GeneID:55994479"
                     /translation="MKLLASTSALSALMFITITAALSMTEPLDNEPDITVSILSITKT
                     QTETTTATSTDTDTVTALSLPLLPKTVSPSGSVIVPVVGVESPTTLARCDDDELQKT"
     gene            complement(<605134..>606938)
                     /locus_tag="TRUGW13939_06987"
                     /db_xref="GeneID:55994480"
     mRNA            complement(join(<605134..605638,605700..605760,
                     606148..606239,606321..606559,606618..606698,
                     606750..>606938))
                     /locus_tag="TRUGW13939_06987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490129.1"
                     /db_xref="GeneID:55994480"
     CDS             complement(join(605134..605638,605700..605760,
                     606148..606239,606321..606559,606618..606698,
                     606750..606938))
                     /locus_tag="TRUGW13939_06987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346022.1"
                     /db_xref="GeneID:55994480"
                     /translation="MADVVGEDTLLGAEFLGPHVNRTHATYSPTNNYIVGGHGKQLVI
                     VNSKPVSAGHQYFILDFDTVQTILLHTRQLLSNILTAFLSRRSPINRLSSIHTNRFNH
                     RSPKSPSQSPTSPECRRSIIVTAFLDSCEKFIRSFVVNVDICACKSSDVKDLQRGQQD
                     RISFLINYLCRDQRARDEPDDQIPIDAVLKDILQYLWQYHVAVVSVMHETERIGRDNK
                     IKCLNCGCISEAVEGKRIDQLPVESTEVTTESPSWEDADGFSKTEFLRVRYFHDNAIP
                     FIQSERQRLSERLGLSALKPIRRSIPREKSPRISNLAKHFELLSREFEKERQRERRQR
                     NINRSRAFPPVSSKPVGEVYSDLTIVIKKNVKTVRSKRLSTAVEPGANTRYINI"
     gene            <607157..>608380
                     /locus_tag="TRUGW13939_06988"
                     /db_xref="GeneID:55994481"
     mRNA            join(<607157..607385,607434..607902,607964..608141,
                     608246..>608380)
                     /locus_tag="TRUGW13939_06988"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490130.1"
                     /db_xref="GeneID:55994481"
     CDS             join(607157..607385,607434..607902,607964..608141,
                     608246..608380)
                     /locus_tag="TRUGW13939_06988"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346023.1"
                     /db_xref="GeneID:55994481"
                     /translation="MQRPVTGGFPARQIYWEMFTACDMVSQLSWSSTTAKRCDEMLSA
                     QAQPAFGIAIGCTRARKYVAKPGCGVSLLPRISIWPSAWSDGSRSSWTHCQHHHPGGW
                     DISEQQTAVRIHRRLSDRLADTERSPWRELSTVQWLLEALKNKLRRIDYQTLAEGMRI
                     CLQDFKPSMEACSKACYEFRGKVAHITSHSTEDQISWRDKARLQFEEKGITAFKHRIG
                     SHKSTINIALGLLTFLSSDQNRETLQELQNNITTAMSEISGQMEGLDIGIQSLSSAAI
                     SGHYGAVVDTLEAMKLFVVLTTGKSGLVSKMSAHNEGRQALFDKVREGGESELVKEFF
                     RD"
     gene            complement(<609958..>611679)
                     /locus_tag="TRUGW13939_06989"
                     /db_xref="GeneID:55994482"
     mRNA            complement(<609958..>611679)
                     /locus_tag="TRUGW13939_06989"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490131.1"
                     /db_xref="GeneID:55994482"
     CDS             complement(609958..611679)
                     /locus_tag="TRUGW13939_06989"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346024.1"
                     /db_xref="GeneID:55994482"
                     /translation="MESHFGTFAAATALLGNLVQSCLAVSSFWEKIEHADEEANLFIV
                     RLDGRLSALHWWSTRWKIIDDEASSIRIPDARFQVYGNAIANYLELILHTLHHLTSHQ
                     DDVPIFKNTRAAHTSNSSERLAMLLNTRWEAHLGASTTNANEDKSGFGGRLKWALKNG
                     RAIERLKVLESLIQDLQELFPPPGPSYDLSGAVLVNPALMTEQGVWRLRWLSRQGDID
                     PFAASLAWLKHTSISHIYDLKVSSGSDSQRQLANLERYSCPGDATHYTTEYNGSSMLI
                     ERKIVPREADNNVLKLRIEKVIHLLKASQSIQELRTLPCIGYLHRQPGEDGLSPDDEY
                     CVYEILYTIPTGSTLSLNAMIKDSNKYQPELSLDKRFEIARILSRAVLYLHVAEWLHK
                     GIRSHNVMFCSSEESATRSADRFGHPYIVGFEYSRVSSKNEGTENSASSDEDNLYRHP
                     MVQGPPVADTDSYIGNTGRFTKDHDIYSLGVTLTEIGLLMTASQILDKLRKTKNYTHT
                     PKNFRDKLIEKFVPTVVAFKMGQIYADVTIRCLRADFYSLPKEDSRESSVEFYKHVVS
                     QLDLCRA"
     gene            <612027..>616640
                     /locus_tag="TRUGW13939_06990"
                     /db_xref="GeneID:55994483"
     mRNA            join(<612027..613672,613729..613800,613850..613907,
                     613991..614243,614315..614371,614430..616175,
                     616477..>616640)
                     /locus_tag="TRUGW13939_06990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490132.1"
                     /db_xref="GeneID:55994483"
     CDS             join(612027..613672,613729..613800,613850..613907,
                     613991..614243,614315..614371,614430..616175,
                     616477..616640)
                     /locus_tag="TRUGW13939_06990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346025.1"
                     /db_xref="GeneID:55994483"
                     /translation="MSDIEYTEETYLGLSLEDETITENKDFPQSEHDDVLYDFLSFLA
                     LVSSSTAETEWSAMAMNMIHITTSNVTLWLKRRQGSSFSVSLVDRKELDTNLPQGMAH
                     LELPRVLAVKTPILDSDLGTRRNRHIFDSMTREYQILNHKSLKNHENIVSLIGCCWRT
                     VDIQAELTVPNLVLEGADFGDLEEFYQQHGQKVTMRRRLGLCIDVALGLEALNLAGIL
                     HGDIKPSNILVFKNKDRGFIAKLADFGSSIPLHNSKFPRRACPGTPLFAAPETVESSS
                     EFSKDELLKAEIYTLGLVFVFLVRGPHILDKLRSASWGDVMRLKFCGGLLDWIQQDEE
                     QLLFDTMSRPTFGKNAKERQRQRNIQNWLSTQEYNKFLAFSERHEFPIYDSSVDDKDW
                     LTLRNDCLKDEKSEILFSNLVRQIMSENPSQRPTDVHCVLHTLREILTLELHVLYDSN
                     QKKQRLQEEKFASIRRKLNPEGLHEGLAISTLNSQERDSITLNYFFKSCSNYRRNKYR
                     RVSLFREFAFIWKFGGIAKFLQKHRSSRTRRLGVRVSLEKRSSNQMVKQAKKVKKEME
                     LVLQKWWEKHQSLETLSFSDNSLVFQATMDERFTSLLPNNLRRGIMKQLKLTADLPKE
                     NETRRLLASFEYTFMVLCYDDTWRTDTELLFSTLLYLYRAADSGYHRAQSIVVYFKRK
                     PGCNESVANVRSQGEVWDDSKLWIFAINAGFVNSPPAFIHNLAAHGQLHSLRQLSNIP
                     REYLNEQNGLGETPLVVACRCGHANIVTLLLEYGADPSIGSFSNAHPLHFLSAFPETD
                     IPHISKLLVQYGAELEPHSQNARLYRQGLDGRFGLEEGTPLLWAVLIGNFAAIQALLN
                     LGADIFSYKRLHPWDFSNDVVIHSSPLEGAIYMYRYNILELLLSSYADVEKLRFQLNE
                     LRLVGSNERASPLLMALERQVLGRFKSTLLHGPFRENAQLRTAQVLLRYGANPLRLSR
                     EVSGESVDAIDLVCQGGNCLLLEFLWDYQEGKLRPSNPMQFFLLMNHAIAMSNREVFD
                     FLLAHQNDVSQINRASKQGMRTLSKACSISHDMHYISSLVDLFCQRAKSVSLSEAIIK
                     PDFTEQVLLALVAGNIEAANLMCHHGDCNFTRQNDGFSMLATMIFLDSTAPIIRDRVH
                     DLLSLSSALLPSVSQGKLCWDCARSNGTSRHFRLTALHFAFCPHEYDHNREIIPAAAN
                     PRILTTLLQWFHEPQFLNAQVDSRSSQYAGYTALHMAAHRGSIREINDLLNGRYRDAF
                     DLNILNARKESLVDLCHSIGNHVLSGDDHEDITCLLQLKDGGLIPFVDSPSKYGKVFS
                     KDMNEIIQSMV"
     gene            complement(<616765..>618591)
                     /locus_tag="TRUGW13939_06991"
                     /db_xref="GeneID:55994484"
     mRNA            complement(<616765..>618591)
                     /locus_tag="TRUGW13939_06991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490133.1"
                     /db_xref="GeneID:55994484"
     CDS             complement(616765..618591)
                     /locus_tag="TRUGW13939_06991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346026.1"
                     /db_xref="GeneID:55994484"
                     /translation="MVKVRSTHEKESLAYKPFESWLFPVRGHATIRKNGREREIGDAF
                     GLVVRRDRIAWQFLENMEYPSSGTMQLALDIFDRHGCLKEEYIHHPIRKGLGVWGSEL
                     NEGNFLIIETVTVMSKFRRQGIGRKLVLDMIKKSIYLVNNVRFVLAYPTCLHRGEDLR
                     DRAGKTKKERFDMADAQHSVAVRFFRDLGFRRIGTSHWFALSNMDVHHPSRSVPVIED
                     LDPLEAERLFDDYDSDDSQPEVPKSKTVHVSAPIGADGNFDYRENISSNHQVAADYFG
                     EKTRSGFARLYPIHNALQSLSDSQCLTLLKEYATEHDSSLADLEKMEDNERNNLLHTA
                     ACHFKPMCVSWILHSLTTDHPHLKSDRNIQGYTPIEALQAKLEETRLGHYHVNQRFTV
                     RADKFAGFDENAALCMCAMRGWSPKDDTDRWNRTRFGCTCGFCLGGYLSPYMSKSLQQ
                     SAEEILDRFASTETMPNRLLSRINVLQYTPKNIHSAFKKSKVVRKGFRLFFSTIVECL
                     QSKRCPTADNLMDIYRAKRAWPQMHLFYFSRGGSIESAFKVVLDLAEQNFKDLFGCVE
                     DRSLSDLRRCRNDYEFAMVRRLCTTDTSDAQETPGSMDQLLS"
     gene            complement(<620205..>622426)
                     /locus_tag="TRUGW13939_06992"
                     /db_xref="GeneID:55994485"
     mRNA            complement(join(<620205..620390,620446..620472,
                     620532..620615,620670..620984,621051..621509,
                     621974..>622426))
                     /locus_tag="TRUGW13939_06992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490134.1"
                     /db_xref="GeneID:55994485"
     CDS             complement(join(620205..620390,620446..620472,
                     620532..620615,620670..620984,621051..621509,
                     621974..622426))
                     /locus_tag="TRUGW13939_06992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346027.1"
                     /db_xref="GeneID:55994485"
                     /translation="MTTTLTTPRYNFSITTPHLRWDPKFMKRNLKLYQSENHKPFKPD
                     SSGSAKSKIEKFLDQQSHGLIPRAYNYQGLRDFLSHADLYMFDNGVRSLNPADLVKTV
                     LFDERIDNQASNMFMSRNWQGYEDYPPRGSAEYTGLLDCKECYEKLVQVDYPIRPATP
                     YALEFHISYFALRRSSKALDGFDIVVGRRSGVFADSLTRGCEPTQQEYFHETQVSVLL
                     VGVDEWVWTLYCLVETHFEQKVEGKDTLKNCLATLQDAPSGQDASYISPYWNPREYFL
                     LVLCRRMSQATLEWRNLVETLELRLRDLEKDIFQKPPPQLTVGKTVDLPRINDYTWAI
                     QVLQLFANQLVKTIDSWQEFSRMHLPIFHSADESLNYSSKVPRYLQILDRDVSEMQYF
                     HTILTQRITAFESRRSMIFNASALMETRISNRQAVDIGLLTKMTVFYLPLSLVTAIFS
                     MNFMQVAGTWTLYMAVLLPFSLVSVIVSFNLQRIDTTVKSMMQKIGTVMNSGTSILS"
     gene            complement(<625667..>626719)
                     /locus_tag="TRUGW13939_06993"
                     /db_xref="GeneID:55994486"
     mRNA            complement(<625667..>626719)
                     /locus_tag="TRUGW13939_06993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490135.1"
                     /db_xref="GeneID:55994486"
     CDS             complement(625667..626719)
                     /locus_tag="TRUGW13939_06993"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346028.1"
                     /db_xref="GeneID:55994486"
                     /translation="MASPEQLNRYSLLDDQSGGAHPALLKALVAANTTQETSYGKDRY
                     SESARQRIRRHLGRDDVGIFFVPTGTAANAISIAACLRPHEAVISATSGHIIARETGA
                     IELSGHKIIHVAPQNGKVTPKAIQQAIDDHWHFPHMAKPRLVYISNATEIGTVYTKEE
                     LTAIKQICQDKGLLLFMDGARIGKALMSKASDLTLQDILELTDIFWIGGTKNGALLGE
                     AVVVKDPSIASEFEFYIKQHGSLIANGRVIGSQFAELFRENLYFDLSLKANLFAETLS
                     AGISEAGFTVLATTETNSVFTVLPWDVIKRLQEHFVFYIWENRGETEAVVRFLTTWAT
                     DATQLDRLVRLLNSSS"
     gene            <627688..>629681
                     /locus_tag="TRUGW13939_06994"
                     /db_xref="GeneID:55994487"
     mRNA            join(<627688..628921,628969..>629681)
                     /locus_tag="TRUGW13939_06994"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490136.1"
                     /db_xref="GeneID:55994487"
     CDS             join(627688..628921,628969..629681)
                     /locus_tag="TRUGW13939_06994"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346029.1"
                     /db_xref="GeneID:55994487"
                     /translation="MAYKVVAKPVDGSEASWTVSWKIVGHESKQSFQSADITFEQSSA
                     PVDFALHDAGVRVFLESAKGDRSELQPADLGHPQAFEFLLETLEATGEKGPRAIKLVT
                     PHDKGNIIRSDIVPQRMQDLEYIEKTTAFAQPLQLFSGEEWTASTEFATLFKSSAGVI
                     RLRDIPTTQITDAALQVLESELHNRLPTPLVVAGLKRRTIVFLEGSEVLPNRGGCAAR
                     FYGAAESLGIDLVVLAVEGHWLQGSEYAHWRKAFIPIEFGFDADFPSRIVAAVRQYDG
                     PVDGILTIFDSYQIALSIAATELGLPTEPTSAYEVATDKYKMSAFEGRKSFVAASAEE
                     AMKIAQTEDLPWPIIVKPCRGFGSELVFRVDNIEQLAAVAGRMNSARHGTEFVIEHYC
                     DGPEVDINFVVYDGKILFHEIGDEDPKSAEDGSDSFHERDCCSPTELPKPEQAVLHDS
                     IAKTLNRLGFRNGIYHCEARVDDSTVEWRRTESNAPELVPRSTHSSRPPSSWLIEINP
                     RPPGCNSSDVIETTWGVDYWAVLLSIRLHDSDRVRAFSQPYRNGPQYFADMIFISAAF
                     DKSKNGVWESGEVTEELVQRRPDLGRHISKHLTFMRKGDSMPHPSTGVNTFVAYLNVF
                     SRRSRAHVLDIAAAVRKELRIEYS"
     gene            complement(<630454..>633457)
                     /locus_tag="TRUGW13939_06995"
                     /db_xref="GeneID:55994488"
     mRNA            complement(join(<630454..630709,630764..631313,
                     632008..632760,632822..632945,633032..>633457))
                     /locus_tag="TRUGW13939_06995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490137.1"
                     /db_xref="GeneID:55994488"
     CDS             complement(join(630454..630709,630764..631313,
                     632008..632760,632822..632945,633032..633457))
                     /locus_tag="TRUGW13939_06995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346030.1"
                     /db_xref="GeneID:55994488"
                     /translation="MQITWRDTADEATYEEARIGRVFNHRRPSRFPLAIVKAKSEDDI
                     VAAVKLAAECNCRVAVRSGGHSWAAWSVRDNSVLIDLGDYKSLEYDPEGKIAKATPSM
                     TGRDINSVLNKHELMFAGGHCPDVGIGGFLLQGGMGWNCRGWGWACEQVKAVDVVTVQ
                     GEKLHCNAQQNQDLYWAARGAGPGFPGIISRFHLKVREYPRRGFRSSGYLYPISMYRQ
                     VFDWVLSIAPGYDHDTEIAAVSQYPEQKDELCFFVLFVTMKGTENEAEHALRPAQETR
                     PLGAFEEWFCQEDSLDKQYISQAKANPDRHRYCVDNAYIDNDSDVVAVLENGFTTLPH
                     RKAFSLWYAMNPCSRRQLPDMALSVQSDHYFAAYAVWEDQTDDLRCQTWVQKTMKTIE
                     KHSVGAYLGDSDFQVRQTRYWADENSARLKNIRQKWDPEGRVFLVPSFLHAWLIDCNM
                     TEQSLLNKVAIISGSSSGIGAAIIRELASRGAKTVINYPFPSLEAEAEALRCSLPCES
                     VAVEANMATTTGPQSLVDAAVARWGKIDIVINCAGLAVNKPLEEQTLDEWDLLVNVNG
                     RSTFLLTQSSLPHLNRGSRIINIASISARGPPPNQTIYAGTKGMVDSFTKCWAKELPP
                     KFGCTVNAVSPGPTKTEGFAAAGGEQMKILQPIIDQTPVAPRMGEPEEIAFAVAFLCE
                     EKARWVNGVHIIASGGLFID"
     gene            <633886..>635690
                     /locus_tag="TRUGW13939_06996"
                     /db_xref="GeneID:55994489"
     mRNA            join(<633886..634028,634095..635365,635473..>635690)
                     /locus_tag="TRUGW13939_06996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490138.1"
                     /db_xref="GeneID:55994489"
     CDS             join(633886..634028,634095..635365,635473..635690)
                     /locus_tag="TRUGW13939_06996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346031.1"
                     /db_xref="GeneID:55994489"
                     /translation="MDLQKTASLRPNETRTDVLGSLRLRHQETNEIILIPIPTDDPND
                     PLNWSRPFRYYIAFVVCLAVFFCNFLAAGPTVAIVETTVDFFGPEGPNFSAQISKVAF
                     FYTTTALTQGVGMLFWMPLIVKYGRRPIYVISFILYFATGVWSGFAKTYSVELAGRII
                     MGFAAGAGECLGPLTIADLFFLHERGTVMATYTAALSMGVSGGIIIDGLITISLHWRY
                     IYYVACALIGGVTVLVIFTFPETTFQRNIELSHECSVTKSVQGKDGSNSLAASDHNEN
                     GTIHLVPKKVGYIESLKLFNKTNFTSEPLLRVFVRPIVLIILPSVLWTSLVFAVTIGF
                     LVAISSNFATAFSTTYGFSSWETGLCFISGLLGSFIGVLFGGNVSDWCADWFTKRNGG
                     IREPEMRLPSIVIGGVCAPVALILYGVGINNELHWMVPTLGLGILSFAIVQATNVAMV
                     YVIDCYRPAVGEVTVSILSFKAAFGFLLSFYTNPWIDLEGYSRAFGEMACISGVMVAF
                     SAVFYYWGKPIRHSTWKWSVMQKYGRWAADREVGE"
     gene            complement(<636224..>642530)
                     /locus_tag="TRUGW13939_06997"
                     /db_xref="GeneID:55994490"
     mRNA            complement(join(<636224..636356,636415..637310,
                     639561..639852,639922..640498,640560..640892,
                     641355..641781,641845..641930,641986..642071,
                     642146..642372,642423..>642530))
                     /locus_tag="TRUGW13939_06997"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490139.1"
                     /db_xref="GeneID:55994490"
     CDS             complement(join(636224..636356,636415..637310,
                     639561..639852,639922..640498,640560..640892,
                     641355..641781,641845..641930,641986..642071,
                     642146..642372,642423..642530))
                     /locus_tag="TRUGW13939_06997"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346032.1"
                     /db_xref="GeneID:55994490"
                     /translation="MKSSLITFALTCGSALAVPTANRNARSLVKRASLDDAATGFASL
                     NGGTTGGSGGTTTTVSSFAALETAVSGDDSKVVIVSGTITETADQIKIGNNTSVIGED
                     SSAQLVNFGLLVKEASNVIIRNIGVSKVLADNGDAIGVQYSNNVWIDHVDVSSDTDHD
                     KDYYDGLIDLTHAADFVTVSNSYIHDHWKASLVGHSDNNGDEDTGHLRVTQNNNYWSN
                     INSRAPSIRFGTGHIYNSYFESVNDGINTRDGAQVLVESNVFVDSDKPLYSTDDGYAV
                     ANDNDFGDGSNEALAGTLTSVDYSYDLLGSSSVKDESLKTELIEIMSLSNAKQFKLTS
                     NLTIQAPLSRQGHGPGLLIIRSAAKHDQLNIKETLDPEPLRKWAEESYVIAQLEVSEG
                     HTTIKEELRQALDALENHERCSKKASYGIIVYSPSLVPDLTQGIDENEEITAVVSYGA
                     LPQVSKKPHVYHLAEGGTKSTGEAEIIYRYPEAKSTSFILPSHKDFLPSSAAIAHTRC
                     LEFLKKQLDGPWFDLEEIWDEHTKFEFETRSVEKTMGTMVQEPYVNHIPTITGGIGRE
                     KLSHFYAHHFIFNNPSDTSLELISRTVGIDRVVDEFIFSFSHEKMIDWLIPGIPPTGK
                     KLRIPFTAIVNIRGDRLYHEHISWDQLTVLFQLGLMPEYLPIPYSLPNGPTPQAGHKL
                     EYRVPGAGKETADKIVDESSVPSNEMIGFAMGDVADAGFLRSFIKSQFCTKPRKAPAG
                     TNLSGQVAIITGGSSGLGLHCARHFLSLKLSHLILAVRSLEKGEAVAKKLRSDYPASK
                     IEVWHLEMSSYPSIQKFCSRAEKDLSRLDITILNAGLIQPSFDTCSTGHEEVIQVNYL
                     STFLLAILILPISKRKSSSGVPGRLTIVSSGTALWAKLPTQDRRPFLASFDNPIAHPY
                     KPTERYFDSKALGHLFFSKMFSYINSNDVTVNLVEPGMCKGSDLHRFATGAVALFLET
                     YKSITGRKSEDGAWMYVDAAVVKGKESHGCFCMDWEIHPFMNLVYLPKGQPIIEALWE
                     ETMAEFHFAGAREILETFKQKETA"
     gene            <637778..>639362
                     /locus_tag="TRUGW13939_06998"
                     /db_xref="GeneID:55994491"
     mRNA            join(<637778..638156,638221..638629,638687..>639362)
                     /locus_tag="TRUGW13939_06998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490140.1"
                     /db_xref="GeneID:55994491"
     CDS             join(637778..638156,638221..638629,638687..639362)
                     /locus_tag="TRUGW13939_06998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346033.1"
                     /db_xref="GeneID:55994491"
                     /translation="MDTEARQSTVKSQKLGRKRKAVQSLASPFIVATNQDTIKPDATS
                     RMLIRHHVMKGKNRKDVSSQRATLRSWVNQGREFPLPQQTATKWLRGGCLANPLRLQI
                     NDPGLPITGLKFNIEPCIVQVIHDFISVMTRAMYPAQCCVNSVNEENDWFEDLSNDAT
                     YFQVVSHTAQIYFDTVKSRIYGLNAMRYMNRAMFLLRNKLVYGNEAIANSTIFTILTI
                     AMASEIFGDLEAAKKHLNGLYQVLHARGGIGTLANSRSLQFKCFRLDLRISLKSGSIP
                     LFLTRDNISWNTYLAGPDKLSTTPIQTTCKMPDIRLVNVWIDLREFVKAINLAHQTGR
                     NLSTELFQEALISLQYRLQCLAYSIQDLQENFRLSMLALSTSMFLEKDGLELRCTALA
                     KELRTALQLMECDVNNYGLKLTLWLLVVGRVSVLDSPEDSCWLKAKLSTTIQALGLAS
                     WKEARLVLKTFIWMDAMHDEPGKIIFDDAMCSKNNQI"
     gene            <644361..>646390
                     /locus_tag="TRUGW13939_06999"
                     /db_xref="GeneID:55994492"
     mRNA            join(<644361..644751,644808..645412,645472..645637,
                     645809..645915,645980..>646390)
                     /locus_tag="TRUGW13939_06999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490141.1"
                     /db_xref="GeneID:55994492"
     CDS             join(<644361..644751,644808..645412,645472..645637,
                     645809..645915,645980..646390)
                     /locus_tag="TRUGW13939_06999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346034.1"
                     /db_xref="GeneID:55994492"
                     /translation="NTNKKSRRKDMFYTGATWLRGTPLISAITSVCASSFLLFGYDNG
                     VMSGVVISSYWLDAMGNPSTIIVSTITALYDVGAVFGAVAAAFTTEQLGRKRSLLLGS
                     FIVVIGSILMGTCVERIQMMVGRIVTGVGIGYLMSTAPVYQSEICQPSQRGWQICIQV
                     SMMLFGLMISYFMNYGLYFHPGDIQWRFPLLFQILFAIYIIVVTTFLPESPRWLMWHR
                     PSNNEGPEVLSRLRNRPMDDSMVVEEKTGILEAIRIESQEEGTWMDLFRDGGTKADKR
                     FYLALGIQFMQQLSGINIVTYYAPTLFTESLGMTQERSLLMGSFLQVWYLLASFLTWY
                     IIDIVGRRRLFITMALGMCIVLILEGACVAINNWASNIAAVVFVFAFESCFTWGWMAT
                     VWLYSPEVLPLKIRAKGAALAAAADFVGNFLVVEITPPALQNIGYKTYIIFAIFNLVN
                     ALIVFLFYPETMGLPLESVDLIFIHPDEDTDLSSSKNKSFYQQLQWWVVPKSWEMVRS
                     QKITGNSRLIREDFVDDNGNERISANNSGDAEGKISNTQRDDDVARFDHIA"
     gene            complement(<646696..>647160)
                     /locus_tag="TRUGW13939_07000"
                     /db_xref="GeneID:55994493"
     mRNA            complement(<646696..>647160)
                     /locus_tag="TRUGW13939_07000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490142.1"
                     /db_xref="GeneID:55994493"
     CDS             complement(646696..647160)
                     /locus_tag="TRUGW13939_07000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346035.1"
                     /db_xref="GeneID:55994493"
                     /translation="MSISLSSLTPREAISDTLYRCLLGLDTNDLPMFKSAWLAEDPDV
                     SIAVGDTVTLGFDNITEAVFKRIGALDTTHFTTNIRIDLKDGSDKASLTSYTLAQHYR
                     PGEGHNPEGQQLLTGGLYYVDLEKDKGDGLWKVKKWTIKFIWSEGDMSIVGR"
     gene            complement(<648351..>650436)
                     /locus_tag="TRUGW13939_07001"
                     /db_xref="GeneID:55994494"
     mRNA            complement(join(<648351..649693,649756..650240,
                     650301..650327,650384..>650436))
                     /locus_tag="TRUGW13939_07001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490143.1"
                     /db_xref="GeneID:55994494"
     CDS             complement(join(648351..649693,649756..650240,
                     650301..650327,650384..650436))
                     /locus_tag="TRUGW13939_07001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346036.1"
                     /db_xref="GeneID:55994494"
                     /translation="MASSATVEPISMVASTSWYGDDGQWGTVYIAVGDSPQVFAVLPN
                     TAGVDILAVNYEGGCVNVSSTICSSSRGGVFMPSNSTTWVSDITREATYNGVGVDGLN
                     ATYGTDYITFNLDPENDPDNSRAASSNVPSAVGTFNSTDNWIGYIGLSVYRSDTNVWD
                     LPTFMESIWDNRSAAPSCSYGYTAGAYYRLKGAPASLTIGGVDELRYEPNNVSFNLSY
                     QGLPVALLSSIEVLSVDADDDSTTLIETLIDSYFTLDSSTSYIWLPEYTCDMFSQALN
                     LTYNETLELYTYPTGGYEDLSSSNISFTFTLSGTSDYSTSVSITLPFSAFDHNISYPY
                     PNFNPNETTSATLPYFPIKRAPNSNEYRIGRVFFQEAYLVVDYERQNFSVYQASFNSS
                     IMTNTNIVSIDPPLNSVYPGWNSQKFSRGTIAGIVIGSVAGFAFIIFIIWWFFFHQGY
                     QLSVSRRGPKPKDSKEEISVNQDRSLAPRRWKNWRYKGRAELGGDHVQPSELPAMAMI
                     HELPGSMPGTTDQPMTPGLKQNVRRSAISAAGSSIVSFSSAARTSVSSDGSFDEEELV
                     SPQANSRPPSIAKNHFLTADEAAENTHASETEANQRTRTWPGEIVVGPSASTDTSTDS
                     SDCTSESSFSS"
     gene            <655350..>656409
                     /locus_tag="TRUGW13939_07002"
                     /db_xref="GeneID:55994495"
     mRNA            join(<655350..655856,655915..>656409)
                     /locus_tag="TRUGW13939_07002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490144.1"
                     /db_xref="GeneID:55994495"
     CDS             join(655350..655856,655915..656409)
                     /locus_tag="TRUGW13939_07002"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346037.1"
                     /db_xref="GeneID:55994495"
                     /translation="MPQHDDPAIDSNGDEQFVTAVVPDVCYSQPPSLKHPPNVYSSPA
                     NYYYPVVAPAASSPAISSPEARMSVSGSSTGSYSLPRANLDASIQYPEQAATNVRPQL
                     SPSPRDTSVMTDSCTKEERTQSPWSARMSSSDGHHPRSTHEPRNSVNVYTSDKEQVSG
                     REPNAVLVLLLLSAPIPLFSLATALYTFFALFLVIFTTPLRLCPPTRFFRSTTFSTQF
                     CQLLAPALLYHERLAQSSRTYHHHNHHNGRANDPYSPAETTAKQFAPLWLSLVLTLAP
                     ILSLGLLLAVWTAAFFWIFAMIMGNPDGTEKKDDGRVAVLGVNAWWQTWLRKSRRRQ"
     gene            complement(<657022..>661009)
                     /locus_tag="TRUGW13939_07003"
                     /db_xref="GeneID:55994496"
     mRNA            complement(join(<657022..658896,658948..660873,
                     660947..>661009))
                     /locus_tag="TRUGW13939_07003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490145.1"
                     /db_xref="GeneID:55994496"
     CDS             complement(join(657022..658896,658948..660873,
                     660947..661009))
                     /locus_tag="TRUGW13939_07003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346038.1"
                     /db_xref="GeneID:55994496"
                     /translation="MATLAEKFEKIKSPKLQNQHHTAVVLNAVEDTLRDQKADFSATA
                     YFAALLALLSQALTTTHGIVNKDLATSVVYLLDITAEYVPAPLLRSKFAQILSNLVPA
                     LTLADVEAPLLRPSIGVLETLLVAQDANSWTLPHTQIGPRRATAGLLTLAVDHRPKVR
                     KRAQDALVKVLKNPPPSPSLDHPAADMCAETALQTLHDSVAVAGKIKKTKHQQHKQQD
                     SHQEPAIIHSLHLVKTVATASGGWPSKKIEPLCELLLNVSRSSNEFITMGAFEVFEVI
                     FEGMADEISSSKLPRLLEAIQELRPAQNDAQLLPPWIAVLSRGYDVSSQIEPEETFEK
                     LPGLFEMIATFLASPSHNIRVSASECLVSFLANCIPNNVILEPSVYDEKTLEKLAKFA
                     SDLLSVKYQAAWMEVFNVCSAMFEAFKWRSSPYLDNIVKTVGELRGNDSFSGKKEADE
                     VLGRAAYAIGPAEILRLLPLNITEQKAGQPGRVWLLPIFRDNVSNTSLAHFRSEMVPL
                     SEALYQRVLEFGQAEKTVEVKIFETIINQIWSILPGYCELPLDLESAFDQSFAELLSN
                     VLYKQTELRVDVCRALQNLVESNQAIVEVDTGAKGEENLVLQRRISKAAAAKNLAHLG
                     GFTSNLLSVLFNVYSQTLPHYRGYILQCINAYLSITPEKELEELFTRITTMLESELPS
                     EEEAAKQGSLPKGTDNKMPPTSHTLIDLVIAMSIYLPRSSFSNLFRLAALVLNRHASD
                     PQLIKKAYKLIPRLTSTETGQDSLAERSSELQALMLSTADNTPSPARRDRLLAIHELV
                     TYLPTNDLHFVPSILPEVILGCKESNDKARTAAFDLLIHLAKRISDDERNPAGTMIRN
                     SLVPHLPDNSADAPASLEEFFTMVSAGLAGSSPHMVAACVTALSRLFFEYRTELSTQT
                     LSDLVQTVELFLTSNNREIVRSVLGFAKVAVVCLPEDMLRPRLNTMVPNLMVWSKEHK
                     GRMRTKVKGILDRLVRRFGAPLIESLVGEGDRKLVVNIRKERERQKRKKKEGAADAEG
                     DEDDNDNNNANNTGSSKQFSNEFDKTVYMSSDDEDGSDLDDASEIDVDEAGQTSVKKQ
                     GNKKGGKKGGRQNEQYIRELSPESNPLDLLAPDALASISTTKPSVRFLDAGVGKRNKK
                     RGAKVNADGKLIIGGGGDDDDELDVNKNNNNNQSDQGAGGVNAYLAAVSGPDAVRRGQ
                     KGRLKFNKKDSGADGMDIDDDDDNETAGFEKKGAQNAGRRGLGMPKTHGPSGGGGRGR
                     GGKGRVEKRRSGSGFVAKTRGRGRR"
     gene            complement(<661677..>662472)
                     /locus_tag="TRUGW13939_07004"
                     /db_xref="GeneID:55994497"
     mRNA            complement(join(<661677..661850,661907..662022,
                     662130..662198,662316..>662472))
                     /locus_tag="TRUGW13939_07004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490146.1"
                     /db_xref="GeneID:55994497"
     CDS             complement(join(661677..661850,661907..662022,
                     662130..662198,662316..662472))
                     /locus_tag="TRUGW13939_07004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346039.1"
                     /db_xref="GeneID:55994497"
                     /translation="MEKLSIQDRTESPRQGHSQPQHQHSHSQSTGGPPQLPPQMFTTA
                     AQLLDLTDKKLVLVLRDGRKLIGVLRSWDQFANLVLQDTVERIYSGTYYAEDPVGLFL
                     VRGENVLLLGEIDLDTEDDVPDFLTRVTVKEIKDMKEKDEEQRKRKDKKSYGKLSGLG
                     FEPEHSGEVLF"
     gene            complement(<663257..>664443)
                     /locus_tag="TRUGW13939_07005"
                     /db_xref="GeneID:55994498"
     mRNA            complement(join(<663257..664094,664349..>664443))
                     /locus_tag="TRUGW13939_07005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490147.1"
                     /db_xref="GeneID:55994498"
     CDS             complement(join(663257..664094,664349..664443))
                     /locus_tag="TRUGW13939_07005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346040.1"
                     /db_xref="GeneID:55994498"
                     /translation="MSLLAIVSDKQKGISEFRDDAIDHPLIDRGSLQYSLSAWTQETP
                     DTFSDRLASRYYLPAINTNLHPGRRTQAASNDSLVAEDGVSAYPYSESMTPSSMVVPS
                     LSNGSQSVSEMSMGSRMAAKVQIVNMLETDSTGNLVTPPATAATHDEQSKPIYYCLFH
                     TLPCDHKSDRVDAWKTHVLSHFRGCPLPPNATCQWCAVEFVHDAENKNPASRAWDAML
                     EHAAHEHFEKGHSLAATRPSFELMKYMYQSKIITEDQLKAIQLCPSPDSPAYHPSQDP
                     VRARIGSSDEPYCSTYSPRREKRMREQRRGISVV"
     gene            complement(<665420..>666472)
                     /locus_tag="TRUGW13939_07006"
                     /db_xref="GeneID:55994499"
     mRNA            complement(<665420..>666472)
                     /locus_tag="TRUGW13939_07006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490148.1"
                     /db_xref="GeneID:55994499"
     CDS             complement(665420..666472)
                     /locus_tag="TRUGW13939_07006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346041.1"
                     /db_xref="GeneID:55994499"
                     /translation="MVDADDGAGPKGPLDGISGSLGSQYTLLSMVVILFLSFALYNSV
                     ELIIMVLLSFKRFRGLYFWSLLLSVVLGVVPYSVGFLLKFFTDTNRWVSVTILSLGWW
                     VMVTGQAFVLYSRLHLVLRDQHRLRHVVYMIFTSVLIFHLPTTILTYGSNIRSGTSSR
                     FVTGYNIMEKIQLTGFSVQEAILSGLYLYETARLLRLANNPRSHRRIQYQLIGINVLI
                     IFMDLVLLGFEYASEYAVQITLKAAVYSLKLKLEFAVLGKLVDFIRTNRDHSSAMPMG
                     SSAQRYAGQGAGLPSTRANDRHFYGESTATVMRPERTNSSQEQLNLPSGIIVAKTEFS
                     TTIDKRETSLRMDDSD"
     gene            complement(<668996..>673419)
                     /locus_tag="TRUGW13939_07007"
                     /db_xref="GeneID:55994500"
     mRNA            complement(join(<668996..671603,671659..672741,
                     672794..672920,672974..673226,673286..673334,
                     673391..>673419))
                     /locus_tag="TRUGW13939_07007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490149.1"
                     /db_xref="GeneID:55994500"
     CDS             complement(join(668996..671603,671659..672741,
                     672794..672920,672974..673226,673286..673334,
                     673391..673419))
                     /locus_tag="TRUGW13939_07007"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346042.1"
                     /db_xref="GeneID:55994500"
                     /translation="MGTGSGKTQIAVLRVQEELSRCAPDKLVWFLTPTVVLAEQQYSV
                     LSKQLPLYQSRLLLGSDNIDHWSTQRIWDKILLNIRIVVSTPQVLLNAMSSGFVKLSK
                     LALLVFDEAHRCVKASPFNGIMRLYHRARLAGDNVELPGILGLSASPDDVKALEKNLH
                     AICRTPVTQREELLKHTHKPEISCITYSRRLEDHSQLLQFLDKLLGITFADIENDPYM
                     KSLRMKKDPKSQEQYETISGSGKTFTRTNLISLAQRAQVIHSEVGPWAADVFVTTCTE
                     KFIEGILKKSTNSIFKLWEDAEKIYMMQHLSKLQPFIGERRWGSLPDAMSQKAELLVD
                     KIVESFHPGHRIIVFAEQRTTVIMIAHLLSVHPRMKEIVAASFLGSSNYASRKSNITE
                     LFSPRDQEEAVNNLRSGKINVLVATSVLEEGIDVPACNMVICFDPPKELKSFIQRRGR
                     ARDRESKFILFVDGNDVESVAKWTFMEENLKKIYADSMRKLEEIQALEDIEEDSPENF
                     RVPSTEAVLNYQNAREYLAYFCATISCAYINNQPDFVMHRDPVTDLITAKVVLPSYLS
                     PSLRTAWAKSKWLTEKLAKRDASFQAYMALYNAGLVNDNLMPIHRRKYNDEEKTMQEK
                     QAKLVQVSESWNPWLDMAHLHRSDVALIATRVCFEPNSLGIPDMVLLLPKRLPCDWEF
                     DLFWNAETTLKARLCYGGHAISVGDTQQAARFTHEMLYSVYNGRMLWDDNDYLTLFWP
                     AQMVQSPIEQWLLSIKGTDPAQDAISPFDKGKLNELGIARSTEAYVRAFTIEQTINKV
                     ALNKNGDENGDEDHATREPELHIQGTNFPKRADFLHALSQDALAPMAHTSQQCVPIRL
                     CNIHRIPVKFSKFALFVPSIAHKIEILYVAERLARTVLSRVKFENLGHVLVAISASEA
                     REPTDYQRYEFLGDSLLKFIVSIHLTATNPLWHEGLLSPEKDKIVSNDRLAQAARREG
                     LDQYILTKPFTGRKWRPYRVSDFGETGQAPNKRRELSTKVLADVVEALMGASFLDGGI
                     EKMTTCARVLLPGVEWTSVQEEIHVLYRDAAVSDVAATHPKLAQIEEMVGYNFTKPSL
                     VFEALTHPSCQDESVSYQRLEFLGDSVLDHIVVQELFHLPKELSHQDMHLMRTTVANA
                     DFLAFLCLGLYTTEEREEAISPGLAHVSTIQTEHKTYLWQMMRHGASWDIVNAQQEAF
                     QRYQAWGGAVEDALKHSSTYPWAGLFRISAGKIFSDMVESLLGAIFVDSHGSLDACRG
                     FLERIGLLMYLRRIAHEAIELLHPRNQLLIAAKSALVTTETKAEKICDGEENTDDSND
                     IDNKLVYICKIYVDGEEIVEVNDGINKLEVETRAAALAAEILRRRSSDRMDESVDGEA
                     SVAA"
     gene            complement(<674279..>675340)
                     /locus_tag="TRUGW13939_07008"
                     /db_xref="GeneID:55994501"
     mRNA            complement(join(<674279..674397,674460..675056,
                     675122..675172,675224..675243,675297..>675340))
                     /locus_tag="TRUGW13939_07008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490150.1"
                     /db_xref="GeneID:55994501"
     CDS             complement(join(674279..674397,674460..675056,
                     675122..675172,675224..675243,675297..675340))
                     /locus_tag="TRUGW13939_07008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346043.1"
                     /db_xref="GeneID:55994501"
                     /translation="MADRYSFSLTTFSPSGKLVQIEYALNAVNTGVTALGIKATNGVV
                     LATEKKSSSPLVDPPSLSKVSLITPDIGMVYAGMSPDYRVLVDKARKVSHTGYKRIYN
                     EYPPTRILVQDVARVVQEATQSGGVRPYGVSLLIAGWDEGVEPEAEEKTEEGSEKKAS
                     GKTGGILKGGPSLYQVDPSGSYFPWKATAIGKSATSAKTFLEKRYTEGLELEDAIHIA
                     LLTLKETIEGEMNSETVEIGIVGPPADHLLGYQGVDGARGPRFRKLTKEEIEDYLTNL
                     "
     gene            <675785..>676822
                     /locus_tag="TRUGW13939_07009"
                     /db_xref="GeneID:55994502"
     mRNA            join(<675785..676618,676676..>676822)
                     /locus_tag="TRUGW13939_07009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490151.1"
                     /db_xref="GeneID:55994502"
     CDS             join(675785..676618,676676..676822)
                     /locus_tag="TRUGW13939_07009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346044.1"
                     /db_xref="GeneID:55994502"
                     /translation="MASAGRDTQAWRWRDILPQSLAGAFPEDPQPHTEPDDATGSATN
                     SSHDHHYPPRTCRICLETVYPTSEPPSEHLPKFLQSKPRVRYVSPDPEFGRLLRPCKC
                     KGSSLYVHEGCLQSWRHADARYGARNYYQCPTCSFKYRFERVVWSRWITSTMTQLLLT
                     SSILLFTIFLLGFVADPIINLYLDPLDTIIGAEYWDSTQIVDLPDLHDRDSWADHFFK
                     GLASLGVLSFAKAILAVSPFRWWRLGGPGFGSSRGRRTGRDRVASVGWLVILVGVGTF
                     LLAVYRGVRHWARNTLEKASERVLDVQGDDDEAEHADPSPETSDQDKKEE"
     gene            complement(<677594..>679585)
                     /locus_tag="TRUGW13939_07010"
                     /db_xref="GeneID:55994503"
     mRNA            complement(join(<677594..678978,679036..679253,
                     679302..>679585))
                     /locus_tag="TRUGW13939_07010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490152.1"
                     /db_xref="GeneID:55994503"
     CDS             complement(join(677594..678978,679036..679253,
                     679302..679585))
                     /locus_tag="TRUGW13939_07010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346045.1"
                     /db_xref="GeneID:55994503"
                     /translation="MAGTKNTAYAEESAEVEVLYANLDKLKVLTKKIQGSMDRLETSG
                     KVVKEAIGPIYSNTQSLQITNSNIDRVIEAIDKLRKPLDAKGREEGIIRAGPQSAGLA
                     QYLAALKRIDYALQNLNATNLRSNQQAMTEFSSLLSTGSQRLQDLYRSMLRQNIDKIE
                     PLHYLTKQLPFPSIPEETIEELAPIAAAITSAATHLPSQRGGSEEPSISIYAEIRGPY
                     ITSSLQNLAIASISTAKRRPADGPYKQGTNGIGVYSSALEGFIVVEHDTVVKIYTGDQ
                     QGRALQATCRSSMAEFAKTLRELNQYIKANILTDCFLAFEVIEIVTAMSYRIDSKTGE
                     LKSLFIEALRPIRETAKSSLSELLEETKKRASGITVLPPDGGTVPLISEVMSSLSTLT
                     GYSGPLTSILTSLGDGNWRSKSTSTNTTPLDVGPDSQTLLSHFILDMIEAMISSLESR
                     GRSFYRSKAVLGVFISNIFCVVDRSIRASPELSRYLSSPDSISRIDAFRKRGTSAYID
                     AWRETSQHLLDVQYTSRGPRPTSSGPVDSAQVVKALSSKDKDAIKEKFKSFNAGFESL
                     VTQHKQLYMEREVRGALGREVQAVLEPLYTRFWDRYHEVDKGRGKYVKWDKAAFSTQL
                     AGLS"
     gene            <680010..>682517
                     /locus_tag="TRUGW13939_07011"
                     /db_xref="GeneID:55994504"
     mRNA            <680010..>682517
                     /locus_tag="TRUGW13939_07011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490153.1"
                     /db_xref="GeneID:55994504"
     CDS             680010..682517
                     /locus_tag="TRUGW13939_07011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346046.1"
                     /db_xref="GeneID:55994504"
                     /translation="MYSATLSRLRWTVPPAFLAAWGGWGSTHDRLRADGPARQWDQKS
                     SFSTSELLHERKKSSGDSQLPQPNAPKEQTDPGNAWASFTKRFGVARESVSSVEWTNI
                     GDSIKNYIVPDWARFLPATVQKLQRELSMAPGSLADDIWRDARDPDENPEIAFEARVR
                     VSDELCPEELAFRKKRQTHATKALAKYLDLNEDEIHPDDVPIIAMCGSGGGLRALVAG
                     SGSYLATQEAGLWDCITYTAGVSGSCWLQTLYNSSISGRNFHKLVDHLKSRLGVHIAF
                     PPQALYLLTTAPTNKYLLGGVVEKLKADPDSDFGLVDVYGLLLAARLLVPRGELDLSE
                     RNLKLSNQRDYLQDGNSPLPIYTAVRHEIPIIDQNDFKGHRAAENMKAAAKQESWFQW
                     FEFTPYEFFCEEFGAGIPMWAVGRHFTDGKSAPTDEYPAPELRVPGLMGMWGSAFCAT
                     LAHYYKEIRPVVKGLAGFGGIDSMIEEKNDELSKVHPFDPASIPNYLLGMKDKLPPSC
                     PESALISTNLQLMDAGMSNNLPIYPLLRPGRDIDIIVAFDASADIKQENWLSVVDGYA
                     KQRGVKGWPLGAGWPKASTEPEETVEKLREASHMDESSSTEKLEKAQKSDPHYPNREE
                     PPVDTLMTSHSQSNNKEKPSTRSLEDLTFCNVWLGTKQEMTARKEPPPSKRLFHPSHG
                     DHEEEEFHLMRPDAGIAVVYFPLLPNPSAPDYSTPTRGKPQSKDGKPSVSLPEREDAD
                     PEKPLAPKPSSIDPEVDDFLSTWNFVYTPEQIDSVVGLAKANFSQGEAQLKRVVRGVY
                     ERRKRDRLQRERATIESAVDRRISEIKKQHEGYAPIY"
     gene            complement(<683938..>688993)
                     /locus_tag="TRUGW13939_07012"
                     /db_xref="GeneID:55994505"
     mRNA            complement(join(<683938..685703,685784..685868,
                     686444..687508,687571..688148,688517..688673,
                     688730..688921,688991..>688993))
                     /locus_tag="TRUGW13939_07012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490154.1"
                     /db_xref="GeneID:55994505"
     CDS             complement(join(683938..685703,685784..685868,
                     686444..687508,687571..688148,688517..688673,
                     688730..688921,688991..688993))
                     /locus_tag="TRUGW13939_07012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346047.1"
                     /db_xref="GeneID:55994505"
                     /translation="MLPLGLLTAAQGHPMLVELKNGETLNGHLVNCDNWMNLTLKEVV
                     QTSPEGDRFYRLPEVYVRGNNIKYLRVPEEIIDIVKEQQQQNQGSHRGGRGGRGDGRD
                     RGRGGRGGRGRGRGRDLNLILPKTMRRPPLTIDGLWYCLCPSFQPSSLHRVVAPLRGQ
                     QKVARRCLTSESASPGETFRRLELTHTTTNQTTNENSNTTTNLPGKSDGRDRWSAPRS
                     NRHRWQTPEPTLEERLEEQSSQRLTEIPRIASILQEIFRSRHVSPNSQHYKALILANI
                     DRKRGSSKHVRELLSEMEAKEITADSATLHAALETLAVHPDYLLRQEIIAALRTRWLS
                     LSPAGWHHLTTGLIRDGQLELALNRIDLMEIQGIRLEQWLHSLLIYNLCAVGEYDEVI
                     RLMQRRGMKLNNISKKLWVYLLDEAIRASHLKLASYIWKNTVDMSYADLNAPRCSRIL
                     DLASHHGDIQLAESAFRQIIVLEQPLLQEDYEQLAHGYAKAGDFKLAFEILCRMQGEG
                     FPIRPESIRAVLLSLQETISHPAQVWKSMVDLKQQNLDIPVGLANIAIEYCDAALASD
                     SFFKSEAMEVALDIYKDIFDMCPGGADTHTFNLLFAICRRQNRPDAFTFLAREMAALE
                     VEPDQTTLEHFILVCLEVKNYHSAYMYAMDLTNRGWVPSVKASILRQIVAGPRLQHPE
                     TGLDLCYATDFLIVTSGPSSTYPRRAYRNPTDALVRFLDKKHGENWAIWEFRAEGTGY
                     PDSEVHGRIHHFPFPDHHPPPFALIPAMMASMRNWLKEGTSDVNKQHQHHGSTLSTSS
                     SKEKRKVAVVHCKAGKGRSGTVSCSYLISQEGWTMEDALKRFTERRMRSGFGEGVSIP
                     SQLRWIRYVNTWTNSMNKTYVERPVEILEVHVWGLRDGVKIAVEGYVDEGRKIKCFHL
                     FKRRERIIVHEGNNKSDSNSRVGSDKETLRKKVTSASSLSSSSIYQPALATETVTSPE
                     SSGDLREDTAQLSAAILRPDKPVILPTSDVNIDFERRTKAAYTGWAMVTSIAHVWFNA
                     FFEGGDEHDSGIFECEWDKLDGIKGTSRKGARALERVKVVWRYPSKAQLEGESPVEQP
                     EPQDIHEIPGQVMTLPKPGEPVHESHAADWRGDNVVRESRDEQEYIENYSVDNPTTSP
                     LSSGDITRQDDSTRQIIGHQNIVSDESTGTKGSRHTLATEASVAAASAITSAVNKVSH
                     LGRELGLRRQTDTSKDVSLASSVEDLSQSQKATNQEAESSPLQKQDLKEGEDSDSEME
                     GVKPFYENGNVNRKGKSDS"
     gene            <689631..>691137
                     /locus_tag="TRUGW13939_07013"
                     /db_xref="GeneID:55994506"
     mRNA            join(<689631..689757,689808..689869,689932..>691137)
                     /locus_tag="TRUGW13939_07013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490155.1"
                     /db_xref="GeneID:55994506"
     CDS             join(689631..689757,689808..689869,689932..691137)
                     /locus_tag="TRUGW13939_07013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346048.1"
                     /db_xref="GeneID:55994506"
                     /translation="MHGVDKAAILLLAPAIAHGLPATAISDLPSTESGEHAVVFRIDT
                     GAVIVRFQVPCAGCDHDPWPIDLVTQSASGICEDVAISVNGRDLEHRWHGNTSWGSGA
                     IPASPSQYRGSEMSAKWQSKCMKLPLEAPSGGSIHALTMFLNNGTSSSQDHVGFTISF
                     TLSDQIEMRRLSNWPLRLSDELEWETWVYSYNAEGGSELQTFQHDVQESQHLMTLQDE
                     SRRSTSHTNSYQHQKRENGILGVEIPADYPTRKFARNCAIAFLIILTSCLLFRIIRRS
                     TAFRRRRRDIASRHEERRARRAYNNAARRLRWRQWWEGSSRSNSDTRSVRSSHSLAEL
                     QHPTTDHLQHNPSDHHSHHGDHRYSDVDDDGDDYDSFLEDEDNNNMGGGMMRDEILGL
                     RRVLEYVGELVGNESSSVSRRNNRSRSRSRPPPRYDELHQSPRASTMFSLDTRSLATL
                     DTTDSETAPPSYHA"
     gene            complement(<691581..>695354)
                     /locus_tag="TRUGW13939_07014"
                     /db_xref="GeneID:55994507"
     mRNA            complement(join(<691581..692541,692606..692870,
                     692932..693207,693286..693375,693708..694288,
                     694471..694540,694598..695110,695186..>695354))
                     /locus_tag="TRUGW13939_07014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490156.1"
                     /db_xref="GeneID:55994507"
     CDS             complement(join(691581..692541,692606..692870,
                     692932..693207,693286..693375,693708..694288,
                     694471..694540,694598..695110,695186..695354))
                     /locus_tag="TRUGW13939_07014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346049.1"
                     /db_xref="GeneID:55994507"
                     /translation="MHIPLITSIVAATAALLADTIWAMPSSSSFHGEMAAKRAPHASD
                     TKDFRFLTNKTSKYRVESLPEVNFDIGEMYSGLIPVDKSKNESRELFFVFQPTIGAPV
                     DEITIFLNGGPGCSSLQAFLQENGRFLWTPGTFAPVENPYSWVNLTNMLWVDQPIGTG
                     YSIGTPTAVSQEETAQDFVKFFKNFEVLFGIKKFKIYLAGESYAGRYVPYISAAFIEQ
                     QDNEYFDLQGVLLYDPTIGAALTTQLMVRLTRRTLPNNPCFSMYDISSTCPILWDVLG
                     APTILSYVPNGAEIYFDRPDVQKALHAPSVSWLECTTSKVYLGGNGTGGPEAKGDMSP
                     DPIQDVLPQVIEHTNRVLVSNGDYDMIVQTNGTLLSIQNMTWNGKLGFGERPSKPINI
                     QTPDLMYQKVFQESTYAGLDGPQGEMGVQHYERGLMWAETYQAGHMQPQYQPPPRLHL
                     FCAPIQTRLRASAWHHTIMADQGDWSCDANDAVQISIVQPGDQKLVTADLFHPQFTYS
                     IFGDEEQIFGYKGLIVRLRFAAHDLRTQVHISYDEKFKAVGDAAATDLNKTLRDWIPE
                     FAFTRLPDYEKAVQNDESAKDFVPPGKLVHSYESKNRNYEIWAGSLADPAVCNLLARA
                     QVFVPFFIEAGTPLVLDDPEWTLERWTVYFVYERITPPTPKASKYLFVGYSTTYRWWF
                     YPKQKGEKGAVKDDIFPYPEEIRFSTLPSRLRIAQFLILPSHQGAGHGSLLYNTIHKA
                     TIADDTVTEITVEDPNEAFDVLRDSADYHTLYPELMKQDININPNPYPADAGKRRPRN
                     VPTSTLIPTEKLSKIRSQYKIAPTQFAHILEMFLLKRIPHPKRAAGGANMARLLTKKH
                     KADDENERRYYWWRMLLKQRLYKRSRDILIQLDLPERIQKLDETATNVEEGYEALLTV
                     FDAREKGKATAAPALAAGEIEVSVPALRFKRKYAVEDDEDEEEEEDDQPQIAEAAKRP
                     KV"
     gene            <696001..>697115
                     /locus_tag="TRUGW13939_07015"
                     /db_xref="GeneID:55994508"
     mRNA            join(<696001..696351,696534..>697115)
                     /locus_tag="TRUGW13939_07015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490157.1"
                     /db_xref="GeneID:55994508"
     CDS             join(696001..696351,696534..697115)
                     /locus_tag="TRUGW13939_07015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346050.1"
                     /db_xref="GeneID:55994508"
                     /translation="MTTTDPEYSVDQEIAHFFGATSATRSACDSYAKEHLGGDVIPVA
                     VQGVCSYTVYAGPNGQSIVQFRLKSLELRMDTAELARTIYGQFASQVTFRGQIGEDVE
                     GKEPLYIYIMSRIEGSPLDVDQAYRGSLKCRYEEELGLLLTSLPDRFHPLIQKTLKSL
                     PAIISLPMVLLHKDFGVCNIMVDESSCNLVGVIDWAEAEIAPFGLNLHSHQRLISKIH
                     IKNGWSRYDDYNALEEVFWNAFSRETRGLDSETARTIRSARILGTLLSCGFTSRLANM
                     PKTIPIGNDESGTYKMRDLDGLLINPATRFTDLA"
     gene            complement(<697230..>698230)
                     /locus_tag="TRUGW13939_07016"
                     /db_xref="GeneID:55994509"
     mRNA            complement(join(<697230..697790,697844..>698230))
                     /locus_tag="TRUGW13939_07016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490158.1"
                     /db_xref="GeneID:55994509"
     CDS             complement(join(697230..697790,697844..698230))
                     /locus_tag="TRUGW13939_07016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346051.1"
                     /db_xref="GeneID:55994509"
                     /translation="MLFRFAAPIVTVLSLCQSAFGLPFIAPRGTRDNSTPLRNVAYVQ
                     TFTDSSGNFLDLTQLVTQNTGVTHVILSSLHLDSPTEIHLNDNDIGSSYWDPLWPMVQ
                     TLQSSGVKVMLMMGGAARGSYVNLANNFDTYYPILLQILQDHNLDGFDFDVEENVALS
                     VLLRLAQQFDADLGTDFILTAAPVASALRNGGNLNNVSWPDLDAAAASSVRPNGKLFN
                     WYNAQFYEGWGTPNESSYESIINYGWDPSRIVMGTIVSAKAGSGWTPLSTLATDISAI
                     RAKYPNFGGVFGWEYGVAGLSDGVSPVGWEAAIGEDLAS"
     gene            <699918..>701276
                     /locus_tag="TRUGW13939_07017"
                     /db_xref="GeneID:55994510"
     mRNA            join(<699918..700055,700113..>701276)
                     /locus_tag="TRUGW13939_07017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490159.1"
                     /db_xref="GeneID:55994510"
     CDS             join(699918..700055,700113..701276)
                     /locus_tag="TRUGW13939_07017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346052.1"
                     /db_xref="GeneID:55994510"
                     /translation="MPFLTYPRALQLKKELCETNAQVITPDDENYEEGITRFNESSER
                     VAGAIVLVTSTSEVSKVVSFATKRYIPVVVQGGGYSTSGASSTHGGIVINLSKMSKVA
                     VDPASRTLAAQAGATWAAVDNVAASSGLAVVGCTVNHTSVAGTALGGGYGWLTGRHSL
                     IIDNLLSIKMVLADGRVVDASTTENTDLFWAARGAGQSFGVATELVFKAHRQPNRVFG
                     GCLYYTIDKLPQIVEFANRFEQLSTGKECLFFGFTAPILMETTMIIVIAFYNGPSPEA
                     EKFFEPILSLGPIVNETRMMPYPQINTLMNGAAEYGGRKRFGATNITLPLQVEFLEEL
                     YRDFDKIIKTYPRVNETVVVFQLIPYTEIIKVPSDATAFANRGKYYNVGSIFCWNFPE
                     LDKKMGSLQNDMMKKIRERAGALQGGKLDDGVGVYANYAGT"
     gene            complement(<703486..>704754)
                     /locus_tag="TRUGW13939_07018"
                     /db_xref="GeneID:55994511"
     mRNA            complement(join(<703486..704580,704653..>704754))
                     /locus_tag="TRUGW13939_07018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490160.1"
                     /db_xref="GeneID:55994511"
     CDS             complement(join(703486..704580,704653..704754))
                     /locus_tag="TRUGW13939_07018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346053.1"
                     /db_xref="GeneID:55994511"
                     /translation="MKGLTVCIALSLASYVYGHGYLTIPKSRTCLGNEASLDSCPECA
                     ILEPVASWPNLTAAAVGRSGPCGYNARSSIDYNQPGSAWGSSTVATYTAGQIVTVQWC
                     VDANGDHGGMFSYRVCQNQDIVDKFIDPSYLPTNDEKQEAEDCFVAGTLNCNDVDGQT
                     CDYSADCTEDEPCWRNDWFTCHGFEASTLPKCQGVDNAALNSCYTSIAGGYTVTKQIK
                     IPDYSSNHTLLSWKWNSFQTGQDYLGCADIAITGGGSGTTTTSASTATTLITSTATTS
                     KLTTTTLTTTATQACSTPVASVAVTFNELVATTPGQTIKVAGSISELGNWDPNSAPAL
                     SASQYTSATPLWSYTVSLAAGTSFEYKFINVDQSGSVTWEDDPNRSYEVPTGCADSVI
                     ASSNWQ"
     gene            <708804..>709895
                     /locus_tag="TRUGW13939_07019"
                     /db_xref="GeneID:55994512"
     mRNA            <708804..>709895
                     /locus_tag="TRUGW13939_07019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490161.1"
                     /db_xref="GeneID:55994512"
     CDS             708804..709895
                     /locus_tag="TRUGW13939_07019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346054.1"
                     /db_xref="GeneID:55994512"
                     /translation="MYNFAYYGSLSMFRLLLDHSPEYAYLPDEERVAPVCIAARQGHA
                     ELVRLLVDECKVSVNVTCKHFNNTTPLHHATAGGNIGIVRILLQNGANPDARGGDLNA
                     SPLCIAAHIRSYPIVKLLIENGADVNVADNGGLFPLHHAAHNGHMEMVSLLLKHGAKV
                     DPHENNRKSPLWLAAQFEKTEIVRVLLENGANPETTDIKFARRPLHQAALGGHLEIAS
                     MLLKEKVEVDAVDGGGCTPLLLAAHKGHLELVKMLLEAEANVNLAENYGTNALWIAAQ
                     LGFTKIVKVLLSYNSFVSSAGPSKRYPIHQAAQNGHLEVVKLLVEYDPGCVNCQDEQG
                     STPLDISTMGNNPDNRAIMDYLCGFWCLT"
     gene            <711008..>712342
                     /locus_tag="TRUGW13939_07020"
                     /db_xref="GeneID:55994513"
     mRNA            join(<711008..711057,711134..712087,712165..>712342)
                     /locus_tag="TRUGW13939_07020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490162.1"
                     /db_xref="GeneID:55994513"
     CDS             join(711008..711057,711134..712087,712165..712342)
                     /locus_tag="TRUGW13939_07020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346055.1"
                     /db_xref="GeneID:55994513"
                     /translation="MEGLFTLLILSVVMAITSFLVGALPLTFTLSPSQLRFISSLGMG
                     VLVGTALVIIIPEGVETLYSSQQKSHSSLQSRAVDVRWSHQNLPGLLPRDVPEILNLP
                     GPVIPDVASTAEFTPTSPEKSERGPADEGTSAQNDQDDHHDEDEAGALHAWIGISLVS
                     GFILMYLIDRLPAYVTPPKPKRLPYHISLDNLGASGLRRSSSPSRGEGLLENDGRANS
                     SSNHSFAMTTGLVIHAAADGIALGASGSNSSLSFIIFLALLVHKAPAAFGLTSVLLKH
                     GLSSRAARGHLLVFSLAAPVGAILTFLAIQTLGSGVGGDESSHRWRTGVLLLFSAGTF
                     LYVAMHTMQENAPQPSRDSHSNGYVDSRDSPKHKESVKDLAVSVAGMILPLFLQIGHA
                     H"
     gene            <713958..>718984
                     /locus_tag="TRUGW13939_07021"
                     /db_xref="GeneID:55994514"
     mRNA            join(<713958..714467,714524..715161,715217..715928,
                     715983..716040,717327..718099,718157..>718984)
                     /locus_tag="TRUGW13939_07021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490163.1"
                     /db_xref="GeneID:55994514"
     CDS             join(713958..714467,714524..715161,715217..715928,
                     715983..716040,717327..718099,718157..718984)
                     /locus_tag="TRUGW13939_07021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346056.1"
                     /db_xref="GeneID:55994514"
                     /translation="MAARYTPPRSLGQHRASLRDSNGNNESPIPRSVPVPLDNMPPRG
                     SGGAADLDSTSHPKPLPTPSKSGSPLPSNLFPSAPASPPTPAPSPTPHHNLSGWRPAE
                     DDDGDVGNNLLLKAQIHFSSLGSAQRQKFLVDILNLCDNQQLSFISSVIGPRLRKDPF
                     QAFPNEICLRVLSFIDDPRTLARASQVSKRWHELLNDDITWKHLCDRHAYAYQRMSDD
                     EREFVDPFHNRRLSSFSSESQPFSSWRRRSTSSGSDTIDVMSTADDHMESSWPMSPVY
                     RHRVQPSSYRIHFKQKYMVESAWNKGGRCSLRHITPDQGVVTSLHLTPKYIVVALDNA
                     KIHVYDTHGGRQRTLHGHVMGVWAMVPWDDLLVSGGCDREVRVWNMVTGACTHLLRGH
                     TSTVRCLKMSDKNTAISGSRDTTLRIWDLVTGNCRAVLVGHQASVRCLGIHGDLVVSG
                     SYDTMARVWSISEGRCLRTLTGHFSQIYAIAFDGRRIATGSLDTSVRIWDPNTGQCQA
                     VLQGHTSLVGQLQMRGDTLVTGGSDGSVRVWSLNRMAPIHRLAAHDNSVTSLQFDSTR
                     IVSGGSDGRVKVWSLKTGQLLRELSTPAEAVWRVAFEEEKAVIMASRAGRTVMEVWSF
                     APPAEDLFDDNVLVEMNNPQCDEARPGCRNCGIYGKECPGYRPAIVFPDESSNNSNSN
                     SNSSSNSSNNNSSNNDTANPKKWKSLARDRRFTDAAYSANADTDDYALVPRPRWLAES
                     SMEDRALCYFFDQYTIPETPTGAPGVLESIPPLYVLCRENEVAGHPSSCLRWAVDAAA
                     LSSFAHEANDPDLALKARKKYGMALQSLQGTLSSPVEKVQDGTLAAILLLVLFEDING
                     ERTTLQSSHTAGLELFARLHKHRRLDGKYSRCLFNFAYTQLQIQILGLGGRPRFDLQS
                     LIELFDSSDPLQSLMSTVTKLSQLIVDAPALLTTPPPDAPMPGTEALFNYLTYARSLD
                     TELSHWCRNVPEQWLPRIVYSTTGESIITYASISTGSLWNFYRSARIILQGVIDNIVN
                     KLEAFGETPSPVDDFMIIDENNTPDNSTSEKSTPYEIVQNMIVDVCRSIPFTLGDVDS
                     SGNPLNNSNFNNTDPENMSASNTPNHSSRLRAIEGYELLWPFWHILTCHFSTPKQRRQ
                     AKDALTRLNAELGIKLASKLVAFADF"
     gene            <719619..>720788
                     /locus_tag="TRUGW13939_07022"
                     /db_xref="GeneID:55994515"
     mRNA            join(<719619..719712,719777..719782,719849..720499,
                     720558..720681,720737..>720788)
                     /locus_tag="TRUGW13939_07022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490164.1"
                     /db_xref="GeneID:55994515"
     CDS             join(719619..719712,719777..719782,719849..720499,
                     720558..720681,720737..720788)
                     /locus_tag="TRUGW13939_07022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346057.1"
                     /db_xref="GeneID:55994515"
                     /translation="MATTQDKKLPFGKIDLYSSRYFYACTLGGIIACGPTHTAVTPLD
                     LVKCRRQVDPSIYKSNVSAWRSIFAKEGLRGVFFGWAPTLAGYSLQGAGKYGFYEVFK
                     YWYGEQLFPNTNRTLVYLGASASAEFFADLALCPFEAIKVRMQTTLPPYAHNLRDGWK
                     KVVAQDGIGGLYKGLYPLWARQIPYTMTKFATFEEAVNLIYRTLGGPKDSYSRLTQTG
                     VSFAGGYLAGILCAIVSHPADVMVSKLNAERKAGEGAMTAVSRIYSKIGFVGLWNGLP
                     VRIAMLGTLTGFQWLIYDSFKVFCGLPTTGGH"
     gene            <721379..>722276
                     /locus_tag="TRUGW13939_07023"
                     /db_xref="GeneID:55994516"
     mRNA            join(<721379..721795,721863..>722276)
                     /locus_tag="TRUGW13939_07023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490165.1"
                     /db_xref="GeneID:55994516"
     CDS             join(721379..721795,721863..722276)
                     /locus_tag="TRUGW13939_07023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346058.1"
                     /db_xref="GeneID:55994516"
                     /translation="MDTTSSTAIGNGGSNSSSLNNNANPPSIELAYKKKCIQLKKRLN
                     EIETENDSMRNRNKRAKSYIQKMRLETCIMLERLATLTGMLDEQQGSSAAQSGGPLVN
                     AELKAKAAAIMGDARAAIEHDVLDDETEGSSEERPPTPQERPLRVKRSRRSNMPIDEL
                     EAEAAMQFEAASPEKSHTNSISNNNNNNNGSNNAAAESELAATSSLPALAPAPSGQSP
                     QDQPTSTSGFRAVNNGDAGGSSNKINNSSSAAGNENGESPADEPVPMDVDERVTKSES
                     "
     gene            complement(<722775..>724420)
                     /locus_tag="TRUGW13939_07024"
                     /db_xref="GeneID:55994517"
     mRNA            complement(join(<722775..722851,722908..>724420))
                     /locus_tag="TRUGW13939_07024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490166.1"
                     /db_xref="GeneID:55994517"
     CDS             complement(join(722775..722851,722908..724420))
                     /locus_tag="TRUGW13939_07024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346059.1"
                     /db_xref="GeneID:55994517"
                     /translation="MATTETSPLLPQFQQRSSANTSLRAERDRRTVTFNPLTTISTYN
                     GASQADSIVQPLQPGSPPVRPASGPSGQPMLSALNSKLRRRNSAGSPVTAPIITAAPK
                     IGPQRTSKNTQKLKLLPDPVTGDEEEIVDDGFPRDVYTQISRIKEPTARRDAARLGKA
                     DRDRLPRVTAYCTANSYRLEGVMRFLKSRDKTRGTNPKLFDECVYSPFNYGHEKRQAE
                     QQQQAQAQARNGWNSEPSVPRVPKERRYSDSVVEVEEHGKNVREDLISLREEEETAHS
                     HDTGMGSSSSAADEQQLDLDTTVHTPEVFLFDYGTVVIWGMTPAEESKFLADVAKFAT
                     AILSSEDRQVENFNFYYARDYQARIYNDFICLRDPRNHMIKLAISHALAQSVKTSLFE
                     DLVSETIATTAPLPAQIAKTGSVNMTRKQINMQIGELFILRINIHLQGSVLDSPELMW
                     AEPQLEPVYQAVRTYLEMDQRVGLLTERLDVIADLLAVLKDQLSHRHGEYLEWIVIVL
                     IAAEILVAAINIIVDLYAGVE"
     gene            complement(<724998..>726243)
                     /locus_tag="TRUGW13939_07025"
                     /db_xref="GeneID:55994518"
     mRNA            complement(join(<724998..725514,725567..>726243))
                     /locus_tag="TRUGW13939_07025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490167.1"
                     /db_xref="GeneID:55994518"
     CDS             complement(join(724998..725514,725567..726243))
                     /locus_tag="TRUGW13939_07025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346060.1"
                     /db_xref="GeneID:55994518"
                     /translation="MFSQIFNKARGLFPGTAADDSSFTAHASTSEATTDSTIDSTPTA
                     TDMVTATRRGQVGSPQINGSDVAANGKRKTRTTRSDSQSNKRRRTRPEDGNDNIERHQ
                     TSVVVEIPLRRKLVEDGVADEVPETQQTNETSNSIEEEATDESQNTTLTNSPKNAKNH
                     IRFGSEEPAPVLNGAEEIPETQPVPPEEEASSDDDDDDEAPEVVDNSAQLLSLKVQAQ
                     KQEEARKRDEILRREKRKLQDERNKSQAKASKKTKLEKPSESRPAEPTLMQDDDLVSE
                     STATLQGSVVRDTGRLVLPALLPDEILNAEPVYTAPSPAPEQSRQNTKKHKFFDDVKK
                     PAKDIRHGDVTIRVLENQKNMLPPKSSTAGQNLKAAWMAGRRNKNAPSGLKRVSGGQK
                     GFVRR"
     gene            <727834..>729413
                     /locus_tag="TRUGW13939_07026"
                     /db_xref="GeneID:55994519"
     mRNA            join(<727834..728007,728061..728358,728428..>729413)
                     /locus_tag="TRUGW13939_07026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490168.1"
                     /db_xref="GeneID:55994519"
     CDS             join(727834..728007,728061..728358,728428..729413)
                     /locus_tag="TRUGW13939_07026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346061.1"
                     /db_xref="GeneID:55994519"
                     /translation="MRGLSYTPLLALLAPEINALSLHKRDDPAVLGLPVQRHRTSAES
                     LRKRDSTLDVTITNADAVLYVVNVTLGTPPQEFSLQLDTGSSDLWVNSAGNSTVKAPA
                     FDSSASSTYTKLDVVLNDTYADGSSAIGPYGTDTLKLGGVTLKDFEFGINETPFEEPV
                     PGVSGIAGIAYKVVEAAAIAKNPYNNLPYALAEKGVINSAAYSLWLNDITSESGTILF
                     GGVNKAKYIGDLQTLPIISVNGVHQELAVALSDVSGQSSSGSISYADGLPLPVILDSG
                     TTLTMLPTAIANKIFDDVKAIYNTTLSASFIDCEAGKQDYNLTYSFSGASISVGINEL
                     VAPDPQHRLPEGVCIFGIVPTDNNAEILLGDTFLRSAYVVYDLENNEISIANTNFNPG
                     EDDIHEIGSATGVPVPGATPVTSAISTFAVQTPSSSAVVSRTSPVGTATATGSATVTQ
                     TGTASATPSTGMAAISSINAGYLLWGLAGAGLFMV"
     gene            complement(<729659..>730421)
                     /locus_tag="TRUGW13939_07027"
                     /db_xref="GeneID:55994520"
     mRNA            complement(join(<729659..730201,730266..>730421))
                     /locus_tag="TRUGW13939_07027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490169.1"
                     /db_xref="GeneID:55994520"
     CDS             complement(join(729659..730201,730266..730421))
                     /locus_tag="TRUGW13939_07027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346062.1"
                     /db_xref="GeneID:55994520"
                     /translation="MTDPFEVRMRFTTQLQHLSAAVSSSQKVAQYALKYRDMDEDLHS
                     CILEQLERNNMNTRANIMYFVEHFCEMATKEDHLNYVRMIQRDILTIVDGVAPADGSG
                     AANVKHVRRVLQGLQDKNMLSSETVAEISGALKDRETNQSNVLDNEPSEASGTPASSR
                     ASGAMRVDKRQIEQRIEEDRERNKRLRESMWAVSGDNKNEYNKLWDETSDIGEDDLLD
                     AEEELGERKMAVAA"
     gene            <730691..>731700
                     /locus_tag="TRUGW13939_07028"
                     /db_xref="GeneID:55994521"
     mRNA            join(<730691..730751,730817..>731700)
                     /locus_tag="TRUGW13939_07028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490170.1"
                     /db_xref="GeneID:55994521"
     CDS             join(730691..730751,730817..731700)
                     /locus_tag="TRUGW13939_07028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346063.1"
                     /db_xref="GeneID:55994521"
                     /translation="MSANTSTPGSGEKTLAMLGCGNLGLAILTGILSSISDASKKEDT
                     SFQTPTKFIACVRSERSSKRIQTAVEPYSGFPVTILQNENLKAVQQADIIILGCKPYM
                     VKDLLAVPGMRDALKGKLLISVLAGVEVEAITHTIYEGQEVPESDSCTVVRAMPNTAA
                     MVGESMTTIGISNPPLPQEWDDLISWIFTRIGKIVRLPLSQMDVCTALAGSGPAFAAL
                     VLEGLADGAVAMGLPRAEAQLMACQVLRGTVSMAEKGEHPSIIKDKISSPGGCTIGGL
                     LVLEEAAVRGTLARSVREATCIASELGKGVQRVNGTRR"
     gene            complement(<731906..>734849)
                     /locus_tag="TRUGW13939_07029"
                     /db_xref="GeneID:55994522"
     mRNA            complement(join(<731906..733372,733423..733514,
                     733567..733681,733734..733886,733940..734043,
                     734093..734628,734692..>734849))
                     /locus_tag="TRUGW13939_07029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490171.1"
                     /db_xref="GeneID:55994522"
     CDS             complement(join(731906..733372,733423..733514,
                     733567..733681,733734..733886,733940..734043,
                     734093..734628,734692..734849))
                     /locus_tag="TRUGW13939_07029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346064.1"
                     /db_xref="GeneID:55994522"
                     /translation="MSLITPSSSDDGHQDTILRDTFTPNDSEEGESQRHQDEAIFAED
                     PFAQGEAEPITFKRKQKKPARFSLSNIFPSGNSSTPPRLIGHPQTGAHSLRDWTNFAH
                     DPEPTDSGTNINGFKEDGPLDWYVEGPGRRVGYDDLTAIDWVFEYMKERQRKRLLYSK
                     GQGLLGHLQQILDGSHVWVVLVTTGITVGLIAACIDIATNWLGDLKLGYCKGDQGANQ
                     FYLNRQFCCWGHEEFSECVGWVPWRAALGISSGGGGYVIEYIFFVMFSVVFASCACIL
                     VRSYAPYAKHSGIPEIKTVLGGFVMKHLMGGWTLAIKSIGLCLAVSSGMWIGKEGPLV
                     HVACCCANIIMKPFDSLNRNEAIKREVLSAAAAAGISVAFGAPIGGVLFSLEQLAYYF
                     PDRTMWQSFVCATIASVTLQALDPFHTGKIVLYQVTYTREWHRFEIFPFMLLGILGGL
                     YGGLFIKFNMKIAGWRKTRGWAFPILEVAFIAIVTALINFPNKFMRAQSSELVYQLFA
                     ECATTTDDQLDLCKTGAASFGVIALLLVAALCGFFLASISFGLEIPAGIILPSLAIGA
                     LFGRALGIGVEMWQSAYPDFFLFQSCDPDIPCITPATYAIIGAAAALGGATRMTVSIV
                     VIMFELTGALTYVIPIMIAVMLSKWCGDIFGKRGIYESWIHLNEYPFLDHKDDKPPPD
                     VPASKIMTHVDDLTVIPAVGHTIESLKSLLSQTRYRGFPVVLDTSNPILLGYISRNEL
                     SYALNSYTKSRKLSPETQAFFVHQPFADPNETFDLRPWMDQTPMALNSRISFSIVLGM
                     FQRLGLRYVLFVHKGNLKGLLTKKDVWFILNGVESRREKGFGDGALREAENPDEVGLL
                     SHEDDFSVVEGRQSMQSL"
     gene            <735191..>749887
                     /locus_tag="TRUGW13939_07030"
                     /db_xref="GeneID:55994523"
     mRNA            <735191..>749887
                     /locus_tag="TRUGW13939_07030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490172.1"
                     /db_xref="GeneID:55994523"
     CDS             735191..749887
                     /locus_tag="TRUGW13939_07030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346065.1"
                     /db_xref="GeneID:55994523"
                     /translation="MDRIPVFELELSDTEIVRQLPSELAQRIRNASGAQYLDALALAA
                     LQPGTTERIFASHEPLLVDLTSRWLDLDRPSYFFQVISAFSRILPFAPYLRSFASNYV
                     TAQASLLAISKEPNLLSLDDAPLRDALLAVFRLLSFDLEAFSGILIPTHFQPLFQHSD
                     KCVRYLAVRSFCSYMRAADAATQKMIEIHIGSQPCHGQWEGTVIDYRLLGLWEERRWQ
                     TLDTRFREGRNARPLDMGLDLVEKFETNIAPRTANIGGVLVPKVRWDRPVAESALVKT
                     PTVLTNLRNIATSLLDNKPLLLLGLPNAGKTSLVNDIARVMGQGSSMVTLHLNEQTDA
                     KSLLGMYATSSMTGAFAWQPGVLTKAAKEGRWVLIEDLDRAPSEVIGLMLPIIERGEL
                     IIPSRKERIKCSDGFRLIATMKTSLNNKGEEVAPSHGLLGVRLWQRIQVQSLPLTEIR
                     QVIANKFPLLSSRVGTLMNIYDNLCSAFHSNLAVRSSQGRTPGLRDLIKLCRRLSRRL
                     DNMGVKTGNEGTPESFQDEMFLDAMDVFIRFLPDRDLGYRLADHIAQCLQLSPQRAHF
                     CLQDRSPPYADRDANFSVGRETCTKMKVTKATKSKYLKSSSRFAPTRAALKTMEQIAG
                     SIQLAEPVLLVGETGIGKTAVIQQLANLMCQKLTVVNLSQQSESTDLLGGFRPVNLRS
                     MAVPILDEFNDLFEQTFSAKKNQKFLASVTKSLTARNWPRLVNLWHEAVRMAESVFRS
                     PKDSGQPEEQPSKKRKLDSPKYVALKEKWDIFNVQLADFEAQATRGDSKFAFAFVQGK
                     IVRALRNGEWVLLDEINLATPDILENIASLLHHGNEGLPSVLLSEAGDVERVYGHPNF
                     RIFGAMNPATDAGKRDLAPGLRSRFTEIYVHSPDVDLDDLLGLIQTYLGDLTQSDLRL
                     ASDVANLYLDTKRLSLDNKLTDGAGQKPHFSIRTLVRTLVYIVDHVQIYGIRRAAYEG
                     FCMSFLTLLSQESEKLVIPLIEKHIFGSPKHAKSLLGQTPRPPSDGNEYVQFKHYWMR
                     KGPFTAEKQPHYIITPFIEKNLKNLLRASSTRRFPILLQGPTSSGKTSMVEYLAKVSG
                     NKFVRINNHEHTDLQEYLGSYVSTDDGSLRYQEGVLVEALRNGYWIVLDELNLAPSDV
                     LEALNRLLDDNRELFLPETQEVIHPHPNFMLFATQNPAGLYGGRKVLSRAFRNRFLEL
                     HFDDIPEDELEFILKERTQIAPSFCARIVTVYKKLSVLRQSSRLFEQKNSFATLRDLF
                     RWALRQADDRETLAINGFMLLAERVRNSQERAAVKKVIEEVMKVKIDEDSIYSSSELI
                     RLSQGQEKLSKGVVWTKAMRRVFVLVSQALQNNEPVLLVGETGCGKTQICQAISDIHA
                     KDLLIVNAHVNLETGDLIGAQRPLRNRSSLEQQLHDDLQRVFSMNENSVSSQELNGLE
                     GLKAQFAKLTPQQLEAIDTELLQRIKTNFTRSQALFEWSDGSLVTAMKSGQYFLLDEV
                     SLADDSVLERLNSVLEPHRSLLLAEKGPIDSLVVAQNGYQFLSTMNPGGDYGKRELSA
                     ALRNRMTEIWVPQLSEEEDILPILKSKLQFVEEVQTKAMLGFAKWFKQVFQGATSSSV
                     SIRDLLAWVEFINKCSPSNPNFAIIQGAAMVYIDTLGANPSALLSISLDSLAENRKLC
                     LEKLSSLFAVDAAEIYGEAATVSVQNGHLCVGAFELPMSADSSPDPQFVMDAPTTIAN
                     SVRIARGLQSSKPILLEGSPGVGKTTLIESLARALGKPFTRINLSDQTDLTDLFGSDV
                     PVEGGDVGQFAWRDAPFLRAMQRGHWVLLDEMNLASQSVLEGLNSCLDHRQQVYVAEL
                     DQTFKRHPEFVLFAAQNPHHQGGGRKGLPASFVNRFTVVYADSFTDTDLKRICSRLFP
                     QTSPEEIEQIVDFMSRLNTAIIRDRRIGNIGGPWELNLRDITRWLQLAANEDIQIPSG
                     YFLENIICQRFRTEEDRQIISEVFKQSFGNSLPVKSYYHNMALDHLQVGLGVMKRDTV
                     KQSIVDSSIKVLPRDLQVLESLIFCVQRAWPSILVGLSGCGKTATLRKLAAIQGAELV
                     ELALSPDTDTMDLIGGFEQIDYRRQIQALAKDFATFLHHEVISALASGFGLEPALPLL
                     EMFSICGQSDVTLDKLFAGINALQPHFDSPQFENFVRRCNVLIQTSKNANKVGFEWTE
                     GALTEAIQYGYWVVLDNANLCNASVLDRLNSLMEPNGCLVLNEQRTEDGSARVVKPHA
                     NFRLFLTMDPRNGELSRAMRNRSVEISFLQHSDAIELENVPSYTLESALYRLRNLWGN
                     KKQISSTPIDDRYLGVRLDHIRTAELAAFQDSIRQFLSLPSVYAESNAFVDVIDQYAA
                     VAQEGLQSKLLGNSSFQFGEPSFELIHPLVDEPHLTWHPTFISQMVLVAKLQDIERDL
                     HSLQKHLITANEKSQHLKPSQMTRLERSFASSRISSLMKDSTQPVSPFLVDCVRSLHE
                     FIQNLTSDVELSTSGVSALVDMTRFCWDIYTATQARELDEGEFQIYLQTGQRILSLFS
                     DQVPALYTLSTSFDQFFARFKSKWTLTTGLSMRRIWDTWRPVTCSNPEQLSWLLDVEA
                     SIKEFSTVALQTSLSLSQLGMMRKSLIDAQNSMLLHNTDGKPLVQGLKQEVQKLTSAT
                     ELYSSFQAPHFSNVFETICEYHDLPTIWNKTQISSHTHLNEILPLLAGRSTQGARIST
                     GDLTIPTILHKLALYNGREGTSNAVSPWSKNFSTDLLKHLKQVGNVSLGRLEFLQHEQ
                     RALIEAVSLSSSEIALAQETIISKTFARVLLELLWLHQDLLEGSALQIVVNVLVAIEQ
                     TGNSEEPVPSLEPAHNLPSNHYFRQFIGEISNCIQALHSAGKDSGNGLYTLGFLSTQL
                     AVICLRLFVPDKPYDPSLGLVIERRRHAEQVSQLESQDQALMVFETQFSGRHTNLRRR
                     LIEEELQKLGSAPPASPVTRPSKSQLLELQGEFSNLFNSVLSRNPEKYGLAEFQQYGR
                     LLTDNIRQICTRLHSNFRPYDDITVLVTRFLQLLDLGASLCSSGSNLVKSVDTPIKRI
                     TEVTPLLGENGALLKDSQIEHQDALKAPLDIRLQQLSSLVLRHNVDRSTLTSSYRLYE
                     LQDILQSIHTVWKTQLTEEQKETAEKNQMYRYKGSFEDSEEVDESELRELFPTFEDNT
                     EEESKRSRLDPQAIAIELTQLHAAIFQGGDTQTRMRKLIIHSTCLLGSLDPEKSPSSN
                     PKSHLPGILLALTDDMKIYGQVSSRHYNFYTDANIIEAKRLVSLVLSIRTRFLQLQAS
                     WPEHAAIHDVLTCCQEILLFKHKEPLAKYITKLEKLHGFVHEWQLVASKEFSAASLYD
                     DITALTISWRRLELSTWAKLLDIEYEKCEQAVSSWWFVAYEVLIAVPLQMAEDREDLK
                     GYTKETLATLEGFFKTTTIGQYSARLRLVEIFRSLLVLFMQQYPVLKCVIAGLENFME
                     HYRVFQPAISKSLEEGRSTLEKNVKEQIQLASWKDTNITALRESARRSHYKLFKYVRK
                     YRELLSRTTDSLLQQGMPELQDQTQNSTPVKQEFEVFSGTSLSEALAICQTQNSMWIE
                     RAPRFKDPSATASNMLRVYNTSLPELDVSTQLSSFVTDVVDSIKAFKAETPGTLTEDN
                     KDNVQHLKAQKRRFYAETLRQLHFMGVRRNVSTVFIEEQLTTVQVLATTPSLGYNNGP
                     NSSIAKSADSYFQRLLDLLPRVRLSSREHNEDLNPAEVTRSAGSTEGFLVMIRKQRDS
                     LGPAIARLPNLQSTCDKMRTLWDHGHQQLQQDDSSRNTARDGVFKRVSWLIPLLGIGA
                     EIVEIHANCSGSSSVANVLQGWKDTLGRFKTEIEQIPDFPLNISSQVTHATEQQVLDS
                     LLQFNSELLELINQRPDLTFVLEQIVSWLKFSFPNTNTENSRNIALEDLNEHYLSVVD
                     KILVGLQGLKSSLSSLPPNIDEKDWLSQTDSALSKALRELHIEDIYASLNSVLDQLQY
                     LQPSGSSLPLAAAIIAGLLPIANQYVNICEDLVHRYLSIHREVCKMAYIFSKSFTQIA
                     KEGFCSPHEASTDQSGAGKVESGTGLGDGEGAEDISKDIQDDEDLSDLAQEQNAEKPS
                     KEDMEQSEDAVNMDQEDLEGDYDDNKDKEDADESGSDEDEPDHDEIDEEVGSVSDLDP
                     NAVDEKMWDGDHDEQQKETENEEGKGVSEADDQAASNEKKKNEEQKEGDEQGSEGEEE
                     EEEEAPENEGEAVGKEELDVTDPHAKEEQALDLPEEMQLDGDENEGASDKDDDDGMDE
                     FSDFEPDTTEDKQEQAAEEMIEDEATPKPEDIDMDENDGEPEEGEDNMEADKAGEEET
                     IEEPEQEDAMHSQLDDTTAADEDVAESEAVSGGVGLDNDNKDEKGTSGNAQQEGGSEE
                     AGSEELPNGAAEGEDRKKAEDSSGGTGDDTQDDPQAQAFKKLGDVLEQWHRRQKEIMN
                     SSEDKESEALPPDTDMTDADFEHLADDDDVADTQALGQASEEQAKALDDKKGVETEPP
                     TSTDDILPDATDNNKDIKDDEENLDEAAMDLNAADQSTAAGSSTARNTTFVGEPSNDQ
                     DGEPPMAEELDEVDNHLAAIHLSSVLDPKTSSDEARQMWSHYEAITNDLSLSLTEQLR
                     LILAPTLATKLRGDFRTGKRLNIKKIIPYIASQYKRDKIWMRRSIPSKRNYQIMLAVD
                     DSKSMLESGSGQLAFETLTLVARSLNMLEVGDLCIVGFGDEEHVRVAHEFGKPFSSEA
                     GMQVFQQFSYQQTGTNVRKLVADSIALFRDARTKRSGGGSGNSADLWQLELIISDGIC
                     EDHETIRRLVRQAQEERIMIVFIILDAAKGSSILDLTQASFEPDDSATGTGEMKLKMK
                     KYLEGFPFAYYLVVRDVRELPAVLAMALKQWFAEVVDTSS"
     gene            complement(<750174..>751433)
                     /locus_tag="TRUGW13939_07031"
                     /db_xref="GeneID:55994524"
     mRNA            complement(<750174..>751433)
                     /locus_tag="TRUGW13939_07031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490173.1"
                     /db_xref="GeneID:55994524"
     CDS             complement(750174..751433)
                     /locus_tag="TRUGW13939_07031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346066.1"
                     /db_xref="GeneID:55994524"
                     /translation="MALVQYSDSEGSDAEDEQPQIPPAPVSKEPAATETKPSQKFSSL
                     VDRANPRKIRVALPEIKPETQGDTGDDEDGPARKKPKTGAGGGGLFSGFNSILPAPKR
                     ANQPATTTGTSRKAFSLKTGAAPGFDRLADAELRQEQALNEVADNGNDIPKPGSLSGD
                     SKGEGSLLKEANYKKQGNAMAFKPLSVARNGPKKKSAAFVAAKAAAKNAGVPKPTDTT
                     TLKDSASEKNVSEPAVSGTPTPVQPPKPKVSLFSFSSEDKDTSSEPTTGYESILYNPP
                     GHDDASTLQEDSASLAYHDQQASSYPAPSTQQNSSLDAIADDLNLSRAQRRQLMGRNP
                     GVSMANSRIVNFNTDTEYAANQEILSKTTEEELAAQQHNPVRAIAPGKHSLRQLVQAA
                     SSQKDALEDSFASGRRNKKEAGSRYGW"
     gene            <751755..>752792
                     /locus_tag="TRUGW13939_07032"
                     /db_xref="GeneID:55994525"
     mRNA            <751755..>752792
                     /locus_tag="TRUGW13939_07032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490174.1"
                     /db_xref="GeneID:55994525"
     CDS             751755..752792
                     /locus_tag="TRUGW13939_07032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346067.1"
                     /db_xref="GeneID:55994525"
                     /translation="MEEATPEIPSEENPRGEDDVPSEGTNTHSRSSKFRFKSSKRRDH
                     SPDHRSSPRRENGESSSRHERSHRRHHRHHHSSKRRRTTTTRDSAPPPSPGSKEQERS
                     LSPETAFRESLFDAMADDEGAAFWESVYGQPIHTYAVPNNGPEGELERMTEDEYAAYV
                     RARMWERSHEGIMAERERQRQEKAKAKRNAESSRHRDQERVQFDQAIEESLRRGEARR
                     RAKSWKAAWEKYTSSWEELNAAAIDEPSSRSPNFQIRNNIHWPVASGKRRDISRDEIK
                     QFLWNAPGTAESKQGDLMSTLKAERVRWHPDKMLHRYGNLGLSQDKSLIQSVTEVFQI
                     LDQLWTETKTS"
     gene            complement(<753142..>754435)
                     /locus_tag="TRUGW13939_07033"
                     /db_xref="GeneID:55994526"
     mRNA            complement(join(<753142..753576,753635..753895,
                     753955..754036,754102..754172,754256..754279,
                     754337..>754435))
                     /locus_tag="TRUGW13939_07033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490175.1"
                     /db_xref="GeneID:55994526"
     CDS             complement(join(753142..753576,753635..753895,
                     753955..754036,754102..754172,754256..754279,
                     754337..754435))
                     /locus_tag="TRUGW13939_07033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346068.1"
                     /db_xref="GeneID:55994526"
                     /translation="MWFSQLASTVLGLALTASAASSTWQDTDIKMLPLRTHSLTSPYL
                     DSDMHSRWWDFGGDTVIRTDQYVRLTADRQSQQGWIFSRVPLTATNWEIEVEFKLHGE
                     GHLHGDGFALWLTKQRATPGPVFGSTDNFEGLGIFFDTYKNNRPGTSFPYVMAMLGDG
                     QTSYDKAHDGKANELAGCSARGIRDASVPTKARLTYFQDKSLNLDLQYKSDNAWINCF
                     SLTSPESNFNIPSVAYLGFSGETGEVTDSHEIISVNTHNLYDHTGNGPVRRGSKGSGR
                     GGRSASKKKKSGSWTWFFFKSFLFVGAIVGSYVGYTVYRSQKRQSRF"
     gene            <755009..>755395
                     /locus_tag="TRUGW13939_07034"
                     /db_xref="GeneID:55994527"
     mRNA            join(<755009..755137,755204..>755395)
                     /locus_tag="TRUGW13939_07034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490176.1"
                     /db_xref="GeneID:55994527"
     CDS             join(755009..755137,755204..755395)
                     /locus_tag="TRUGW13939_07034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346069.1"
                     /db_xref="GeneID:55994527"
                     /translation="MSFFGSSSSTPAGAEPGSTELKNALMKQVQAEAAMTNARALVSK
                     INENCFDRCITSPGSSLSSGETSCLSSCMEKYISVWNTTSRTYINRVQLETKNMGGSE
                     PLLQ"
     gene            complement(<756180..>757747)
                     /locus_tag="TRUGW13939_07035"
                     /db_xref="GeneID:55994528"
     mRNA            complement(join(<756180..756207,756264..756638,
                     756696..756949,757007..>757747))
                     /locus_tag="TRUGW13939_07035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490177.1"
                     /db_xref="GeneID:55994528"
     CDS             complement(join(756180..756207,756264..756638,
                     756696..756949,757007..757747))
                     /locus_tag="TRUGW13939_07035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346070.1"
                     /db_xref="GeneID:55994528"
                     /translation="MPTFGGLLKKKKTHSISSREAPSSPTGAEASATTTASSDQKKKK
                     ASSSDAEKHRRQSGKKDSSDKTESSLSTNRGTPSDTPMTSTAPSAHSSAPAASTQQQQ
                     QYTQGIGSINSIINPPQQQQHGQDAAAAQAQQFQAARAQPRQTKGKYSLEDFALQRTL
                     GTGSFGRVHLVQSKHNHRFYAIKVLKKAQVVKMKQVEHTNDERRMLQRVKHPFLITLW
                     GTFQDSKNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHAQHIIYR
                     DLKPENLLLDRHGHLKITDFGFAKEVPDITWTLCGTPDYLAPEVVSSKGYNKSVDWWS
                     LGILIFEMLCGFTPFWDSGSPVKIYENILRGKIKFPPYMHPDAVDLLSQLITPDLTKR
                     LGNLHGGPEDVKNHPWFAEVTWDRLLRKDIDAPYVPPVRAGQGDASQFDKYPEENEAY
                     GVHGEDPYNNLFADF"
     gene            complement(<759196..>761877)
                     /locus_tag="TRUGW13939_07036"
                     /db_xref="GeneID:55994529"
     mRNA            complement(join(<759196..761245,761309..761791,
                     761855..>761877))
                     /locus_tag="TRUGW13939_07036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490178.1"
                     /db_xref="GeneID:55994529"
     CDS             complement(join(759196..761245,761309..761791,
                     761855..761877))
                     /locus_tag="TRUGW13939_07036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346071.1"
                     /db_xref="GeneID:55994529"
                     /translation="MSLLQNEDFTIWQLRTSYLSAIKDGIGDRLINVNDSVLNAPGFR
                     AAGWLAATTSPTTQEQGSLVKRTYSPPIPTTATVASEYYHFARHNHGDPNEEDRLSVG
                     DDGDEDEGGMVTGGGGGSTYVFGAKHHGRGARKNRRRDRPMQRQGEGDDEDSSDLSDD
                     SDEEGDVGRAAQQIKFSKMPVRDRSGSLPIHDHREGPESAAPSARHPSANNGYRRSSV
                     GVVETATKGRPRGDTVTSSDLSEGDNPALFKKRQIQFSSRHQLIEEPEDDDDDDENDE
                     NSGLHPGGLNDQDDDSVAGSVDSALSSDFGATAGSASLLGNVELNNTLGSSLAIMHKL
                     PNTSSQGASPKKSKTTLPDLQELPPPRPISTLQPISLLSKELNARKVVPSNPVERFAA
                     LWGGDSSNSSNALSIKIYAPFSEDPEEPFNMPILRESRDQDQTRPVTVTEAIGLALWR
                     YLKEDLEPSIEPKNLSVNRWTLRMVEDGEVDYDFPALNRNLPLADFTSNNNRAAGTRG
                     RMRGKQYDEFALVEASDAEFAENCRLYPKFNPEPVAESNNEGSSTLQPPNSIPPQMRA
                     GAAAPRPNPILGKPFSSALDHNTLTPADMPVPTYHATPRLGVQKTLKVRFINIEASSQ
                     TTTVNTATDSYIAEILDSVCKRWGLDKANYLLKVKGTNTVAPLDRTVEVLGNVTELDV
                     VRRRFGAGATFAGSPGSSSPNAPLQIDNSTLAAAKKGKRGHQTLQPLLQPQKQDLVGG
                     YYRRYYVYRKQSMSFTASNQKVLILDNDYLHIMPSDAAKGMVDNTGKTRSINFNDIVG
                     SKVSRRHPKSFRVVVLRGTDAHEQKRYDFEARNESEAAEIVGEIKKNMEHFRV"
     gene            complement(<762387..>765768)
                     /locus_tag="TRUGW13939_07037"
                     /db_xref="GeneID:55994530"
     mRNA            complement(join(<762387..763012,763071..765352,
                     765407..765485,765541..765565,765688..>765768))
                     /locus_tag="TRUGW13939_07037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490179.1"
                     /db_xref="GeneID:55994530"
     CDS             complement(join(762387..763012,763071..765352,
                     765407..765485,765541..765565,765688..765768))
                     /locus_tag="TRUGW13939_07037"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346072.1"
                     /db_xref="GeneID:55994530"
                     /translation="MPDIRNFFGAKPGQGANTSAKPAAAKEDPAAARKKRSRKVVDDS
                     DDEVVEPKSPKPKPTKKQPKKEEDLGEPTTTSEYFASSKKRGKPSNATDAKEPADSSV
                     NGKSTPKKQQTPTKKSETGRRAKPAAKVLEDDEGLGGDDIFATEYGKPRRGGDDDYVE
                     QHDGSDSDDLIVKPATAKKGKLEVEEEDDDVEMLTTPPAKARAGRKRKSEAVLDPDEV
                     DEKPKKKAAAPKKAKATPKKDQPENKEIQDIFDNIPMVRPPTPPPTAPGEKPKFYLNA
                     GRSRDPAGAGSVELPEGAENCLAGLAFVFTGVLDTLGRDEGQNLVKKYGGKVTGAPSS
                     KTSYVVLGNDAGPSKLKKIRDMNIKTINEEGLFELIRRLPANGGSGKAAEQAQAKREA
                     EEKKIKAMAEEMEQQERKKAQAQQPAAVSSQTPSSSASSKPQSDNRLWTTKYAPTQMS
                     MICGNKLQVERLQTWLRNWRTSAKRQFKMPGKDGSGLYRAVMIHGPPGIGKTTAAHLI
                     ANLEGYDVVETNASDTRSKKLVEGGLLGVLDTTSLQGYFSGDGKNVESQKRNLVLIMD
                     EVDGMSAGDRGGVGALAAAAKKTNIPLILICNERSLPKMKPFDHVTFELPFRRPTADM
                     IRARLSTICFREGMKIPPHVLDSLIAGTGSDIRQVINMLSTVKLDQKTLDYDQGKELS
                     KSWEKNVILKPWDIVSKILNAQMFSPSSKSTLNEKIELYFNDHEFSYLMLQENYLRTN
                     PMLAGNYSGKERQLKLLELADNAASSISDGDLVDKMIHGSQQQWSLMPTHAAFSFVRP
                     ASYMFGNLGGRPNFTSWLGNNSKQGKLNRFVKDIQGHMRLRSTGDREEIRQQYMPVLW
                     NKLVRPLMEVGKDSVEEVIDLMDSYFLTREDWDSLVELGLGPMGDENVKIETQTKSAF
                     TRIYNQRSHPLPYMKTSNALALKKDPKEKPDIEDTIEKSDEEDTAEGAKEVDESEELD
                     LKKDKYVKVPKAKAKAKAGASKGKKANGKGKKKEDDFLDDDEEDEQPKKGRKGKAKAK
                     "
     gene            <766073..>766906
                     /locus_tag="TRUGW13939_07038"
                     /db_xref="GeneID:55994531"
     mRNA            join(<766073..766670,766734..>766906)
                     /locus_tag="TRUGW13939_07038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490180.1"
                     /db_xref="GeneID:55994531"
     CDS             join(766073..766670,766734..766906)
                     /locus_tag="TRUGW13939_07038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346073.1"
                     /db_xref="GeneID:55994531"
                     /translation="MFGKPQLGLLRPCKYPLIPVASINNSQYLFFLPTCVSGSHATAA
                     DTTSGLTNFGLTRCFSTTPITMNWLQPKFAEKSKSPKGRPKMRTGGSVRGTTVVHGDY
                     GLRMKDHDRRVSAASFKLGEDTIRRRLRGMNYTLYKRVSANIGVYTSGNEMRMGKGKG
                     KFDYWAARVPVSRIVFEIKGDIHEKIAREAFRLAAHKLPGLWEFVKKGEPPVVGITKL
                     GNGVTLESLKRARRAVPLGMENSPNPPKTTSSSTSPSQ"
     gene            complement(<767876..>770771)
                     /locus_tag="TRUGW13939_07039"
                     /db_xref="GeneID:55994532"
     mRNA            complement(join(<767876..767900,767953..768008,
                     768060..768158,768217..768385,768439..769061,
                     769122..769195,769601..770131,770181..770253,
                     770316..>770771))
                     /locus_tag="TRUGW13939_07039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490181.1"
                     /db_xref="GeneID:55994532"
     CDS             complement(join(767876..767900,767953..768008,
                     768060..768158,768217..768385,768439..769061,
                     769122..769195,769601..770131,770181..770253,
                     770316..770771))
                     /locus_tag="TRUGW13939_07039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346074.1"
                     /db_xref="GeneID:55994532"
                     /translation="MASITPFKISISDEKIKRLQQKLALTDLPSEVPELTNPWARGVP
                     LSEIKRLTLHWQHNFNWRAVETKLNELPQYTANIEVEDFGKYDVHFVHQRSQVTTDAI
                     PLLVLHGWPSSFLQVRDMLPILVDGGTDGPAFHVVAPSLIDFGFSSASNKKGFNVEHH
                     AEAYHKVMLALGYNEYVVQAGDLGYLVTRFIALKYGSKHCKAYHLNNAAPAEPKQPSP
                     LDDADLAGLARTKEFSTRGNAYFLLQSTKPQTLAYSLTDSPVGLLAWIYEKLVDWSDG
                     YTWSDDDILTWVSIYYFSRAGPAASLNIYYENEQQAPTAFEKAKEWSDVPLGVARFEK
                     DLVLLPKAWNATLGPVVLEMDRLRPRSLESLTYHSDLSARLKSLAQSGDFPHLLVYGP
                     SGAGKKTRIIATLKELYGPGVEKIKVDARVFQTTSNRKLEFNIVASVYHLEITPSDVG
                     TYDRVVVQELLKEVAQTQQVDQSAKQRFKVVVINEADHLTRDAQAALRRTMEKYSPNL
                     RLILLANSTSNIIAPIRSRTLLVRVAAPSELDICNVLRSAAEKENWTVSEHLNQRIAK
                     ESARNLRRALLMFEAIYAQNEKVSDATPIPPPDWEALISVIADEILAERSPARILQVR
                     ERLYDLLTHCIPPTTILKTLTFKLITKVDDALKPEVIKWSAFYEHRIKLGSKVIFHLE
                     AFVAKFMRIYEGYLMGMDF"
     gene            complement(<772346..>773244)
                     /locus_tag="TRUGW13939_07040"
                     /db_xref="GeneID:55994533"
     mRNA            complement(join(<772346..772389,772446..772887,
                     772947..773016,773072..>773244))
                     /locus_tag="TRUGW13939_07040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490182.1"
                     /db_xref="GeneID:55994533"
     CDS             complement(join(772346..772389,772446..772887,
                     772947..773016,773072..773244))
                     /locus_tag="TRUGW13939_07040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346075.1"
                     /db_xref="GeneID:55994533"
                     /translation="MTRPHAWRLDTCYSCFARQLLKKPAFNGSRFFSQHPILRQQPSP
                     YSHATSRKKNTSTLLYTASILMGTLALAYGSVPLYKMICQQTGWNGQPVQVHSTGDGD
                     TASRLTPVTESRRLRITFNGSVSDVLPWKFTPQQREVRVLPGETALAFYTATNKGPAD
                     IIGVATYSVTPGQVAPYFSKIQCFCFEEQKLNAGESVDMPVFFFIDPDFAKDPAMKNI
                     DTITLSYTFFKARYDDNGVLRATP"
     gene            complement(<773684..>775441)
                     /locus_tag="TRUGW13939_07041"
                     /db_xref="GeneID:55994534"
     mRNA            complement(join(<773684..773806,773952..775151,
                     775216..775327,775395..>775441))
                     /locus_tag="TRUGW13939_07041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490183.1"
                     /db_xref="GeneID:55994534"
     CDS             complement(join(773684..773806,773952..775151,
                     775216..775327,775395..775441))
                     /locus_tag="TRUGW13939_07041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346076.1"
                     /db_xref="GeneID:55994534"
                     /translation="MAPLQGRVMGVQSIKPVLRAYGLAYLALTTPKLLTLATTLFKKD
                     IDHRQKLRQLVRILLSSWGLAKFPTSCAILVGGATWLPLLCFQLSSICSKVITGKAIR
                     SSQTVVRLLRFLSAFISAWVAFHLLNKKRNSHTTMNGHTTMNGNSSASELHNGNHLNG
                     SAGRAEQKRPDLAGRTLDLTLFSFVRAASIVTYSVWNRWTHRRKAQRGGISRLESFLP
                     RIADSGVFAGSAAVVMWAWFYCPERLPRSYAKWIGEAASVDERLIEALRRVRRGEFVY
                     GKDTGQAPLLESMCKDYGWPTVWGDPAKTTPIPCEMVHMGCGTSCEWHAISRFARAFK
                     FAALTYLPLQLLLRMRSKPHAEAITRAVKDAMRSSSFLALFISLFYYSVCLARTRLGP
                     KIFDHKTVTPMMWDSGLCVGAGCFTCGWSILLENTSKRQEIAFFVAPRAVATLLPRRY
                     DRKYLSREQVTFAISTAVILTCAQEQPELIRGVFGRVLSSVIG"
     gene            <776818..>778209
                     /locus_tag="TRUGW13939_07042"
                     /db_xref="GeneID:55994535"
     mRNA            join(<776818..776893,776948..>778209)
                     /locus_tag="TRUGW13939_07042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490184.1"
                     /db_xref="GeneID:55994535"
     CDS             join(776818..776893,776948..778209)
                     /locus_tag="TRUGW13939_07042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346077.1"
                     /db_xref="GeneID:55994535"
                     /translation="MNVTGAQPQAREEPSGSPPLPGPFGYSFGANQDTPYDPGPAPPP
                     GPSLLDVSESNMLDNFFTTLNTGQLDMGDTWFNALSQEKGTNPFGLDWADELPPTFEG
                     SATSLSQAPALPYNSNNGPKRTNSLMGGMGPDSDILAAASMLYGNGIHTASNFGTHNF
                     FPDSAMHGIPPTSQHQHQHALKQEEEDRPHQRLLRPQHTTSFNLEQPTPADPRTTTNV
                     RTLRWGSDAGFVDQGYLRPPEMPNVEEQTNSLLDHVTVLLPDDSTSATNTRATSPARN
                     PPENANDSGWGVTDDKNASHLRQGSRDKTESNLPPRKRLKAKSRPDENSDDTGTPPRM
                     KRPKSSSGGKQRRGSNDLLSRKLSSKAARENLTEEQKRTNHILSEQKRRNLIKTGFED
                     LCSLVPELRGGGFSKSAMLLQAADYLDEVLQGNDVLRQQLNQLKAMNGFLIPR"
     gene            <778837..>779873
                     /locus_tag="TRUGW13939_07043"
                     /db_xref="GeneID:55994536"
     mRNA            join(<778837..779111,779184..779268,779317..779481,
                     779554..779664,779721..>779873)
                     /locus_tag="TRUGW13939_07043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490185.1"
                     /db_xref="GeneID:55994536"
     CDS             join(778837..779111,779184..779268,779317..779481,
                     779554..779664,779721..779873)
                     /locus_tag="TRUGW13939_07043"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346078.1"
                     /db_xref="GeneID:55994536"
                     /translation="MAKRSRVEENEDDTTTTTTSSKRSTKRFASLKPRTQNVSKRTIK
                     AKWSNLPDAAQEKVRAMFRTLERPVIVLQRDERKRVEAQTALGSVVKTLERRLPRMPF
                     PPMTKDATFDYEATLNEHRLLDAQLSTATNTTDILKMEIEKEEALLAQETKYVDEMEK
                     NAKKAEAERRRQMKNEHPVLRHIDHQPQHSNEALTAPFIVVDGAQDQSALCEIEPDSE
                     LRSLITQLNGHLSSMRNNLGPLVELREAITEAQSSLDVLFIPAD"
     gene            <780506..>785433
                     /locus_tag="TRUGW13939_07044"
                     /db_xref="GeneID:55994537"
     mRNA            join(<780506..780689,780772..780794,780876..780893,
                     780943..781222,781276..782036,782107..782303,
                     782577..782797,782855..783221,783350..783494,
                     783548..783803,783850..783923,783972..784111,
                     784341..784464,784517..784644,784693..784835,
                     784886..785066,785121..785206,785261..>785433)
                     /locus_tag="TRUGW13939_07044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490186.1"
                     /db_xref="GeneID:55994537"
     CDS             join(780506..780689,780772..780794,780876..780893,
                     780943..781222,781276..782036,782107..782303,
                     782577..782797,782855..783221,783350..783494,
                     783548..783803,783850..783923,783972..784111,
                     784341..784464,784517..784644,784693..784835,
                     784886..785066,785121..785206,785261..785433)
                     /locus_tag="TRUGW13939_07044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346079.1"
                     /db_xref="GeneID:55994537"
                     /translation="MPGNESSASTDNSINIKAAPDSSLHLRDASSNSSDQTPSVAKAD
                     TNGQAHASPKKRRKVNHACVYCRRSHMTCDSERPCTRCIKRNIGHLCHDEPREPTKKG
                     RNEHEEEGAATSDFGASHGMSNIGRQPMLSDSPLSIRPSTIDPSQTVQPSSISNPAGP
                     TLDATPQQMFSYGEWPVNGQSQFQDMHTFHPSYMFNAPEVTDEYNLLGDFLSNSLLDD
                     NAMYGNDELQGLYSDSSLINMSTNLAGNNQAFNQQQKLAQLAPTQNMNAQSSVQGPSS
                     TIQNDKAREKYYMTAADPSGMDPPEERMNKLLKAKYEAGMLRPFNYVKGYARLNQYME
                     QHMQPALRHKILRQLDKFRPKFRERMQSLTDIELVLSEMWFERSLMEYDRVFASMAIP
                     ACCWRRTGEIFRGNKEMAELINVPIENLRDGKLALHQIITEDQLVSYWEKFGAIAFDG
                     TQKAMLTSCTLKSPDDDDSTKGIPCCFSFTIRRDPNAIWSMSISQPACWQRQSSFLPI
                     SASALQLLSSPTLRSPSLLHTVILPLHATFNHCIVAMEASNVRDPNKIAVSICGFVAD
                     LLSHTEDLPSLASWIQNAETTASLDQFLSALSLKSSTLSVASRNLLDSSATVLWNAFN
                     RLLQITEEFEFTPLLIQGHLNFTSTHIEADFSIVPLLAYHMLVSCVAQDDDAFSRTHP
                     ANCPAGDLTERASNMLQQTASSISALQANGPVDKEIEISIAKYHILRANLAMKDGNIE
                     LTETALSQVSNNSMKTDPGIGKQYVILCHAALRQALGRGEAADKWLLRISNAFHIFHE
                     YSSLYSDCVKVHLEVIYTLATSDMSEVSEAFETLAMKLFQTVELDHPKYSLVLVLQLE
                     FMSKQKNPDLRTFHEALINYINLMEPSMQNFKRLLTSASWRSLGCLKALENMANILCE
                     ILPQSLSNEASDASLIIIWKEAEYFSLQGNFLEALAWYRFSQHILFRRASEVNKTKIL
                     RKLIFCGFQIGDNGEVERAWMSLPEQERDPQTTYLVYQVLLKDSDFSSAADLLRYLTD
                     LGKEGHIYSAAAIAAASLSQEKRQALESIQYFLEKTPDGNENVQPNFSLYRIAVQLIV
                     RGIRENDESILHEQLCQLLSRAVDLFQYCQKFELNDLDWFSRCSYLASIELFDKIDGY
                     QVLSLLEISLKVKAFLIHSG"
     gene            complement(<786455..>789792)
                     /locus_tag="TRUGW13939_07045"
                     /db_xref="GeneID:55994538"
     mRNA            complement(join(<786455..788003,788053..788883,
                     788933..789204,789256..>789792))
                     /locus_tag="TRUGW13939_07045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490187.1"
                     /db_xref="GeneID:55994538"
     CDS             complement(join(786455..788003,788053..788883,
                     788933..789204,789256..789792))
                     /locus_tag="TRUGW13939_07045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346080.1"
                     /db_xref="GeneID:55994538"
                     /translation="MASNSWSAKGKIPGSATSLKITPANSPVLRPGTRSPSKPSPHQS
                     ALTLQTVIGTTTATPNGFSSHESSKSFALCVGSAAILAQIETDGTVNQRFFRARPTAL
                     PVNPIVSFYNHQPTSSPVTPDNRYRSVTNRPAASGGLTPNADWTDGSTSRTWSSRERI
                     KAVTSVAISPNGRFLAIGETGYNPRVSIFSTAADAPRDIPLTMLTEHSFGIRSLAFSS
                     DSQYLATLGDMNDGFLFVWAINLRTGAAKIHSTNKCTSFIRDMCWMGQTLITAGIRHV
                     KVWRLDTQPSSPSKLRPGAEPFANTPSTSPKALSGRNCVLGPLSDHTFTCIASISDCE
                     AILCTDGGAVCVLDDSQNSQRLTVVKYVSFGLTSVTLDSESGYIWLGGRGRKSLKLHM
                     DSIRESLKSRSPSPNTSTEVYNPKTKAPTFISMAYLSTHIITVDSARAIHVCPVDTFG
                     SDDEDSLKEKLMPAHRDPILGVKPLKSPNLHEADFFTWSCEGTVHFWNVDGKCRASRK
                     VEIEQLSAGEDEAANELKVLRVTEDMNTFVSGDRYGVLRILSANPWKCINEARAHGSE
                     VTDVVIQSVSGFCLIASSGRDRMVQLFKKTDEAFELIQTMDEHVGAVGGLLFMNDGER
                     LLSCSADRTVIVREKACREFDGSTTVAYLMSKVITLKVSPISMALAPDDPDTLLLSTI
                     DRHVQRFDVSSGRHIHSFKTTDSDTVDAVVMGSLIVASEIPGQSPRLLVGVSTTDKSI
                     RVYDLERDTLLTKEFGHSEGVSDVIMLETKKRDSTNEVSRTLVSTGLDGVVMIWSLSV
                     QQQQVQELSQGNIRGEEETPVKELTATKPPLRRILSRSELAGFRQDNPLGTPTPIREP
                     SPPRIRRKTSRYTLAPPIPKSGSFARGDSPPLLSSVRRSVAPVFDPRRSPSPPSPKSK
                     VMNGVNHRSSMSNLRRPSIDFRSSRTKSTGPSEFGSLNMSTEQVCRTLRAYRKKLHGT
                     SENPRCGKELERELQLTVNALDERAKRHSLTPDTENDSSGKENHERRLATGPTPSKPT
                     RAARRVPSTPLLSKAGPSKTPRSRSWDADGEG"
     gene            <791691..>793145
                     /locus_tag="TRUGW13939_07046"
                     /db_xref="GeneID:55994539"
     mRNA            join(<791691..791777,791837..792401,792460..>793145)
                     /locus_tag="TRUGW13939_07046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490188.1"
                     /db_xref="GeneID:55994539"
     CDS             join(791691..791777,791837..792401,792460..793145)
                     /locus_tag="TRUGW13939_07046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346081.1"
                     /db_xref="GeneID:55994539"
                     /translation="MKPSATLALGLSCLCKQAVAGGSVFAHYMVGGITQDHANTDIQE
                     AIAAGFDAFALNLMSTDDWSTSAVSALFSASAGTDFKLFFSFDMTHFSDPSDFIPVLK
                     DYVGNDNYYTYSGKPFVSTFDGGTMTFGSSDPNSGWTNSFKTVLSDAGIDVFFVPDFD
                     DASNYPNDFFSTFSVVDGAFSWETAWPTVNSGKVNVSDSVDSTLIGDAHSSSKVYMMP
                     LSTFQFKHLDSSQNWYRRGESNIVDRMAQVLSLQPDLVEVITWNDGGEGHYIGNVWEE
                     AISSSTIGNYTNGFSHAGWQTLIPPFVSAYKSGATDLSQISTSDGKPVGVMWYRELLI
                     TASCSGDSLGQPAGMDSGEDAISYAVILPSSGSYTINVYSNNNKIGSASGTAGLNGGT
                     VTGLVAGSADSQRVEVVDDSNGQSVVISATGTKDVSGEASGLCNFNYVVVAMS"
     gene            complement(<793662..>795274)
                     /locus_tag="TRUGW13939_07047"
                     /db_xref="GeneID:55994540"
     mRNA            complement(join(<793662..794067,794119..794320,
                     794372..794971,795019..>795274))
                     /locus_tag="TRUGW13939_07047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490189.1"
                     /db_xref="GeneID:55994540"
     CDS             complement(join(793662..794067,794119..794320,
                     794372..794971,795019..795274))
                     /locus_tag="TRUGW13939_07047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346082.1"
                     /db_xref="GeneID:55994540"
                     /translation="MLLQTLKLASLVAVGLPVSSHGRTISKRSVSSAQAWVSSNDGSY
                     QLGNYTAPTQGSSGTLSSTSTWNLTVDDTSSGHKQTIDGFGAAVTDATVTVFSELSSD
                     QQSAVLNDLFTDTTNDGASFNLMRHTIASSDLSSSVYTYDDASSADTDLSSWSLTDAG
                     NNMVSWISKFASASGSMKLLGSSWSPPGWMKLNGVTSGSTDDNNLDPQYADAFADYFV
                     KYIQAFADGGVTVDAITIQNEPLNSQSGYPTMYVSADDSTNFIQNNVGPALKSANLDT
                     EIWAYDHNTDVPSYPQAVLDGASSYVSTVAWHCYAQNNNWSVLTDFHNTNPDVQQYMT
                     ECWTSEINDWSSTIDFTMGPLQNWASGVIAWTLGTDTSDSPHLDGGCTTCRGVVTVDT
                     DAGTYSKTADYYYLAQFSRFLPRGSIALDTTGSYDYGSGNKVEAQAFVQPDGTRVVVI
                     QNGFDNEVDLTVTFNSGETWTGPLYSQSLTTWLLPSA"
     gene            <796383..>797237
                     /locus_tag="TRUGW13939_07048"
                     /db_xref="GeneID:55994541"
     mRNA            <796383..>797237
                     /locus_tag="TRUGW13939_07048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490190.1"
                     /db_xref="GeneID:55994541"
     CDS             796383..797237
                     /locus_tag="TRUGW13939_07048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346083.1"
                     /db_xref="GeneID:55994541"
                     /translation="MPATCTLSVSIITNAMRSIYLSNVTTQSPKLCLSSKSQPCLARP
                     RFNTHPLRASSRRSFATTSRNGQYVPMTSSEEGIGKIKTKTKTKTNVDDDFVLDIFPK
                     EPPQKAKSTDKSQKKVAEGARIKTFKGKKPEGTEESAPKKKPKPEPWQLQKAALQKKF
                     KEGWNPPKKISPDNMDMIRHLHSTKPEEWTTPALSDAFKVSPEAIRRILRSKWQPTEN
                     GRKERQERWERRHERIWAQMAELGLRKPMPSVNQYSDLTALGMPAPKPDGLRRRRRRS
                     QPQPQPLK"
     gene            <797588..>801772
                     /locus_tag="TRUGW13939_07049"
                     /db_xref="GeneID:55994542"
     mRNA            join(<797588..798203,798257..799270,799319..800166,
                     800552..800725,800860..801127,801186..801279,
                     801333..801466,801531..>801772)
                     /locus_tag="TRUGW13939_07049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490191.1"
                     /db_xref="GeneID:55994542"
     CDS             join(<797588..798203,798257..799270,799319..800166,
                     800552..800725,800860..801127,801186..801279,
                     801333..801466,801531..801772)
                     /locus_tag="TRUGW13939_07049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346084.1"
                     /db_xref="GeneID:55994542"
                     /translation="SSLLSHFVIRPCGKTTPAMVAMPSDLQVFVKWKEQTIFAGEDVE
                     CTITFKNVAETAKEEPKTPALNHQRRASRPFTAGSNNDTGYFGTKSPQSFFFSGGGRR
                     STPSSPRRPALGSHRVSASLSSPLTGSHSFPPLHTPSHLNSGSNHKHKRSVSILSIES
                     DGSTVSEKTPVQSQVARSRPWGHGRSASMQVLPKRPSGTEEIFSPGGRLPVRGLPSAE
                     SALSPRIEAERFRKPSRAGSGTASPMRSPRAGPAPLLTDFKFPMAPAPNESDGSLPGS
                     DQLTGANDDPIPHRQQPRQPPSLTQQAHLAPATRILSNSSVNGSTRSSGEFYAASNNS
                     SDTLESEYTNYGGARSKASAPKHRRHLSSLEPSIKSRDALTLLMGYAQISATFTVDGS
                     LVNQAAFEDVKRKGVVGGQPNGGRTQEKTRRGGGLLGAFGWNAIEESINGLLSNGDLE
                     GLRDMRGVTSSKSVPLLSTPQSLLFVNLRLGPGEEKSYSFSFTLPKGLPASHKGKAIK
                     VLYNLVIGTQRAGGPKDTQQVNRISVPFRVFSGVNGHGDVLSHDLMQPYVLLRDEARV
                     QTLNGSPRPPPKDKSISGPVWTTAPEFLSYVDELLDHHEQQSLRTPGAPPITPLERRP
                     STNFHGPDMSCKDAIDFAILRGNQITSSNRSANRFDIARNGRRIVVVVLNRPSHRLGE
                     TVFATIEFSDAALPCFSLRATLESSEKVDSSLAVRSSASIHRATRRIHASYFENTLFS
                     TRVVFSPAIPVSATPTLLTSGIKLDWELRFEFVTTHSNNDADATLSGMRLLESVGEDD
                     RGTVFAALENLPSESFEIVIPLTVYGETNPTDQQFVALEAKPHTAVEFLKPRGFQIGN
                     WAYPVVLAALFINTPHGEKNHGVLDEYNTINARHNFLSLEPPSYLSPAVRALKGSLHV
                     LTPPSNARTKGPFKPRSATRGTSSYQLRRFAEETLGSGSLRKAVRLPEGEDVNEWLAV
                     NVVDFYNQINLLYGSITEFCSPQSCPEMKATDEFEYLWQDSEAYKRPTKMSAPEYIEH
                     LMAWVQGNIDNEQLFPSRTGVAFPKSFPSLIRQMFKRLYRVYAHIYCHHYHVVLNLGL
                     EPHLNTSFKHYVLFIDEHNLSSGKDFWGPLGDLVESMLRSD"
     gene            complement(<803829..>804749)
                     /locus_tag="TRUGW13939_07050"
                     /db_xref="GeneID:55994543"
     mRNA            complement(join(<803829..803942,804001..804090,
                     804147..804461,804564..>804749))
                     /locus_tag="TRUGW13939_07050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490192.1"
                     /db_xref="GeneID:55994543"
     CDS             complement(join(803829..803942,804001..804090,
                     804147..804461,804564..804749))
                     /locus_tag="TRUGW13939_07050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346085.1"
                     /db_xref="GeneID:55994543"
                     /translation="MFSSRAVIRAAGLRASSNVQISRSATQGSLRTYAAAAAAPSAQN
                     SRPPVALYGVDGTYANALYTASAKTSSLDQVSKALSTLGEVFKKDPKLTTVLNAPTLT
                     VSDKRQIVQELQRVAGVDKGDILKNFLTTLAENNRLGLLAGVVEKFGTLISAHKGEIE
                     LNITSAQELDNKTIQRIEKAVAKSEFSQGKKLKIVTKVNPDVLGGLIVELGDRTIDLS
                     VSSKINRLNKALTDAL"
     gene            complement(<805203..>808747)
                     /locus_tag="TRUGW13939_07051"
                     /db_xref="GeneID:55994544"
     mRNA            complement(join(<805203..805563,805616..806401,
                     806457..806553,806607..808053,808118..808217,
                     808265..808382,808446..808468,808525..808540,
                     808624..>808747))
                     /locus_tag="TRUGW13939_07051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490193.1"
                     /db_xref="GeneID:55994544"
     CDS             complement(join(805203..805563,805616..806401,
                     806457..806553,806607..808053,808118..808217,
                     808265..808382,808446..808468,808525..808540,
                     808624..808747))
                     /locus_tag="TRUGW13939_07051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346086.1"
                     /db_xref="GeneID:55994544"
                     /translation="MVIIDDHEYLSAEEKRLKEDRDRVRYWKKWGPYVAERQWATVRE
                     DYSENGDAWSHFSHEHARSRAYRWGEDGIAGVSDTHGRLNIAFSFWNEKDDFLKERLF
                     GLSNPQGNHGESVKECHFHLDNTPSHSYMKFLYKYPQKKFPYQELVDENARRGKDEHE
                     YQILDTGVFAENRYWDIFIETAKEEDDEEELSFRVIAYNRGPEPAPLHIVPHVWYRNT
                     WAWGWEDKEKKPKIKQTGPLTAKSSHHSLGDRYVRLSPSPPFNGGEEDIQPQMLFTEN
                     DSNNKALWGSENDQPYVKDAFHRHIVDEEKGVINPDNEGTKFAAWYAFDEGDGVPPGE
                     CVVVRFRFSRKDEEYLNEEELDDVIEQRKGEADDFFYRINPLPIADDLRNIQRQALSG
                     MMWTKQFYHFIWDQWANGDPNTVPPPPGRKNVRNQNWRHMYLDDILSMPDSWEYPFFA
                     AWDSAFHCIPLAMIDPDFAKKQLDLLTREWYMHPNGQLPAYEWNFSDVNPPVHAWAVF
                     RTFKIERKMYGRQDLDFLERVFQKLLLNFTWWVNRKDTDGKNVFEGGFLGLDNIGLFN
                     RSEPLPTGGVLEQADSTGWMAFYCLNMLNIALELAKHRRTYEDIASKFFEHFVLISDA
                     MTFKNQGTETSLWNEEDNFYYDAISYGGPWTQQLPVRSLVGLIPLYAVLTLEPEIINK
                     FPSFKRRLDWFIENKNDVAERNIASMRRRGKDDRLLLALVSKDRLVKILQRMLDETEF
                     LSDHGIRSLSKFHKENPVSMDVNGQEFKVSYVPGDSDSGLFGGNSNWRGPIWICVNFL
                     LIESLLRFYMFYGDTLKVECPTGSGDYMHLGHVAEELQHRLQHLYSRDYDGRRAINNK
                     NDLLDFDKHWKDYLWFYEFFDADTGRGLGASHQCGWTGLLAKVIHDTGLNCRLPQTPR
                     TPTTAAAHYFDDIFSRSAKPSKTPNSRLRRSSTSRSIGNRSDFEAALDGDAESEDGAH
                     SYEANNRNNESDAHFNNYVSDQLNRVRSRTSLAAYEDEFEAQLDANGANGH"
     gene            complement(<809856..>810294)
                     /locus_tag="TRUGW13939_07052"
                     /db_xref="GeneID:55994545"
     mRNA            complement(join(<809856..810150,810209..>810294))
                     /locus_tag="TRUGW13939_07052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490194.1"
                     /db_xref="GeneID:55994545"
     CDS             complement(join(809856..810150,810209..810294))
                     /locus_tag="TRUGW13939_07052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346087.1"
                     /db_xref="GeneID:55994545"
                     /translation="MAQAFSLALDNAFMLDSEVDNLSQSIEQKKQMVTIQARELEALQ
                     AKIREAEARLGNGDNKASSSQNNDQRGGSADQEGRGEIELAGPQYPMSSALSDGHSSD
                     QGSTDSATSAATSNDLDSNGQRKA"
     gene            <812865..>815624
                     /locus_tag="TRUGW13939_07053"
                     /db_xref="GeneID:55994546"
     mRNA            <812865..>815624
                     /locus_tag="TRUGW13939_07053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490195.1"
                     /db_xref="GeneID:55994546"
     CDS             812865..815624
                     /locus_tag="TRUGW13939_07053"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346088.1"
                     /db_xref="GeneID:55994546"
                     /translation="MPPLSAYTPFESLLFFQCLASLASRPASFADISDTLRKNRFVKE
                     NDAFDGDRLSPEALEELYTTLLQEGVDSSITATTTTDSANANLKKRKINNNNNNAAQS
                     HTVVVPALVSQLYARYKDRVTKEIRDEEQKYREIRDEIDRLQKDQLDKPVEPAVQNVV
                     TTDLLPDSAKALPVPSTSDRMDIDTNDLAEEEKTNVIPPNVNNVQGVKEIRRQQEAAP
                     ITSHQTPKPALPLVPPSKPQEEGPLPKLDTVKQQGPPPAPAPPVIAPARALQPQPPTP
                     IPGKQPVSVPAATPKPAPKATPPIAREQPLAPQPAQISPAPPKIEVKVPAPNQLSRPP
                     SHTPSRTGPSPSRNQPALPPGSTIVFQAQQAPSLPATPPVQRHIPQVSENVARQGVPI
                     PTGTPIAPHIPPGQHAFQQWSPHPPPPHSAASVRTPGILPAAQRPIMPQQAHHAQLEF
                     SNTVPASVHGPLPVTPGAQAPFAPMSAPQTPLPGTPTFRPGMKPRMSRASIDTAGSLT
                     PWKRTPSLSISIPDTPGSPPRPQPGDVSPISDREPSPIEFPEPAVKEGVVQRKPSQSE
                     SEKPRRGRKRSVQPPSLEKAEPKSDRATPARRGKRGDSITSTRGRAISAASREDEESL
                     DSAAAQRKIKDEAPATPAGISEDTEAEMRPVTRRKSTVTVGPSEDMQVKGRPKRKRGA
                     SEVLDIERDQPTPGRPSTSQLIYCTRNFPRTGAPLMNDVSAHKHASIFGKPLTEREAP
                     GYKDLIYRPQDLKTIRSALNQGNRAVAAATESFSTPVDGESPNPAATGTPSKNAAWLP
                     KTAELIPPKAIVNSSQLEKELIRMFANAVMFNPAPERERGFGPSFPLGTANESRSSSQ
                     PWQLDEGGIFRDTREMCDDVEKAVTKWRAAERTTADDLSNKNLFTLRGNSGENAENTD
                     SDMKG"
     gene            complement(<815739..>817094)
                     /locus_tag="TRUGW13939_07054"
                     /db_xref="GeneID:55994547"
     mRNA            complement(join(<815739..816895,816959..>817094))
                     /locus_tag="TRUGW13939_07054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490196.1"
                     /db_xref="GeneID:55994547"
     CDS             complement(join(815739..816895,816959..817094))
                     /locus_tag="TRUGW13939_07054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346089.1"
                     /db_xref="GeneID:55994547"
                     /translation="MEDTDPAAASRTQTRQPKKRFVGRRTADAQSQNEASTNSDTTVQ
                     KATPRRAPRTLNHVPPEISENPDILAAVELLPKNYSFEIPKTIHRIRTLDAKRVALQF
                     PEGLLLFATTISDILTEFCPGIETLIMGDVTYGACCVDDYTARALGCDLLVHYAHSCL
                     VPVDVTTIKTLYIFVDISIDTSHLIATLERNFQPGKTIATVGTIQFNATLHGLKPVLE
                     RAGFKVVIPQIMPLSKGEILGCTSPQLSDKEVDALLYLGDGRFHLESAMIHNPSIPAY
                     RYDPYSRVLSRETYEHEEMHDLRRDAIKSAKSAKKWGIILGALGRQGNPHTMTLIERH
                     LQDQGIPFVNLLLSEIFPGKLASMADVECWVQVACPRLSIDWGYAFSRPLLTPYEALV
                     ALGGREGWDQVNNGVYPMDYYGKEGLGRTRPAPRTSVA"
     gene            <817405..>818549
                     /locus_tag="TRUGW13939_07055"
                     /db_xref="GeneID:55994548"
     mRNA            join(<817405..817665,817728..>818549)
                     /locus_tag="TRUGW13939_07055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490197.1"
                     /db_xref="GeneID:55994548"
     CDS             join(817405..817665,817728..818549)
                     /locus_tag="TRUGW13939_07055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346090.1"
                     /db_xref="GeneID:55994548"
                     /translation="MHQLRLPLQLLRSARAARPRPARRFATEARLTTDHVRIVEVGPR
                     DGLQNEKKSISLETKLELIERLSKTGVTTIEAGSFVPAKWVPQMASTSEILQHLIKTP
                     PQSHNQIAYNYLVPNIRGLENLIKVLEAEGATAGSRGDSKSTTTTEVSLFAAATESFS
                     KANTNCSISESIERARPIVTLAKEKDIRVRGYVSVALGCPYEGTDVSPSKVAEITATL
                     LEMGADEVSVADTTGMGTAPRTLELLRALAAAGIANSDLALHFHDTYGQALVNTVVGL
                     EHGIRIFDSSVGGLGGCPYSKGATGNVATEDLVHTLHGLGMHTGIDLEEMSRIGAWIS
                     GELGRANDSRAGKATVARLAGEKPCS"
     gene            complement(<818698..>819138)
                     /locus_tag="TRUGW13939_07056"
                     /db_xref="GeneID:55994549"
     mRNA            complement(<818698..>819138)
                     /locus_tag="TRUGW13939_07056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490198.1"
                     /db_xref="GeneID:55994549"
     CDS             complement(818698..819138)
                     /locus_tag="TRUGW13939_07056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346091.1"
                     /db_xref="GeneID:55994549"
                     /translation="MALLSRRIPSITLLAGPRRSFASSNSRHTADQNNNPFATGPAPP
                     RLPKEEQEIFEELQKQSTGAFSTPRTPPKINQSPDSQPEHAAQKASSSSSDQELHPHV
                     REGVKPEFEGEKNPKTGEVGGPKNEPLRWGHQGDWSYNGRVTDF"
     gene            complement(<819484..>820101)
                     /locus_tag="TRUGW13939_07057"
                     /db_xref="GeneID:55994550"
     mRNA            complement(<819484..>820101)
                     /locus_tag="TRUGW13939_07057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490199.1"
                     /db_xref="GeneID:55994550"
     CDS             complement(819484..820101)
                     /locus_tag="TRUGW13939_07057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346092.1"
                     /db_xref="GeneID:55994550"
                     /translation="MDIDEGRSIPTANDYKDHQVRQEQEADTEIGGCYKMVEPLPAYP
                     EGPTRLKEKNTWHGSPVASLRRAFHALGSPRIKTALTTTEIANLRTLMDLYFEPTTVD
                     DQSSETTGESGPTATSEKRKHDDEDDEDESTDRKGKGVSSKKVKYEQDTPTPKYNICA
                     RYQEVPGKTWCPDFHYWVNASWQFGPEDIIEKASMFQVATQKHRG"
     gene            <820938..>822426
                     /locus_tag="TRUGW13939_07058"
                     /db_xref="GeneID:55994551"
     mRNA            join(<820938..821060,821116..>822426)
                     /locus_tag="TRUGW13939_07058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490200.1"
                     /db_xref="GeneID:55994551"
     CDS             join(820938..821060,821116..822426)
                     /locus_tag="TRUGW13939_07058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346093.1"
                     /db_xref="GeneID:55994551"
                     /translation="MAMRAAARRLHSVNRPLFTARSFSTTARVSSLPQSEKSRIKNEA
                     SLPSADPGPDSSTASFLKERTPYMVPTYIRPMPMFVKGQGCYLWDMENRRFLDFTGGI
                     AVNSLGHCDPEIAQLIAEQAETLIHCSNLYHNPWTGALSKILVESTVKSGGMRDASQV
                     FIANSGTEANEAAIKFARKVGSTTDPSGAKHELVSFHNSFHGRTMGALSATPNPKYQA
                     PFAPMLPGFKYGTFNDIEQLETLITEKTCGVIVEPIQGEGGVNMATPEFLAALRKRCD
                     QVGAVLIYDEIQCGLSRTGTLWAHGNPALAPKDKKSPAAHPDILTIAKALGNGIPIGA
                     TIITDKVSSAIKTGDHGTTFGGNPLVCRVAHHIVERLSASELQNGVELKSSQFVAGFK
                     SLQEKYPEVISEIRGLGLILGVQLGEKYASRASEILTAARERGLLIITAGEGCLRFVP
                     PLTVTEEQIKTGLGILEDSFQAVLGKQ"
     gene            complement(<822675..>827309)
                     /locus_tag="TRUGW13939_07059"
                     /db_xref="GeneID:55994552"
     mRNA            complement(join(<822675..824811,824865..824949,
                     825652..826112,826168..826867,826949..>827309))
                     /locus_tag="TRUGW13939_07059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490201.1"
                     /db_xref="GeneID:55994552"
     CDS             complement(join(822675..824811,824865..824949,
                     825652..826112,826168..826867,826949..827309))
                     /locus_tag="TRUGW13939_07059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346094.1"
                     /db_xref="GeneID:55994552"
                     /translation="MWPVRSSNDHEIGSGRQIQPPPSPSVRILSPGRCLDSRQALRVD
                     ALVPLLANHRNAFVTSPVLASAKQSLSSGMPAETPPLPMPLPLPGSPGTSWAGFRDRL
                     KAIFNGVDPRVCTAFWFFGLINNVLYVVILSAALDLVGSGFPKGVVLLADVVPSFACK
                     LTAPYFIHLVPYPVRVIIFVALSVLGMLIIALTPATTDGGAISTKLAGIVLASLSSGG
                     GELSFLGLTHYYGPFSLAAWSSGTGAAGLVGAGAYALATTSFGLSVKSTLLASACLPA
                     VMLVNFFMVLPLEPIRYISRMQSEYQPIAGTDDVEDADLVAEPRDGIASKATGNSAGS
                     NGWALLMAKLERSKGLFMPFMLPLLLVYVAEYTINQGVAPTLLFPLDETPFKQFRAFY
                     PAYNAIYQIGVFISRSSTPFFRVHNLYLPSFLQVINLTLLTLHALFNFIPNVYFIFLV
                     VFWEGLLGGLVYVNTFAEIGDRVPAEDREFSLAATTVSDSGGICIAGFLGMAMEVWLY
                     HVLGRPSTQFRKIQVFSVVLFWSVYLFKGNHHGPPGIRAISSKLSARLTPWQTMVVTL
                     LWLYISRNFAKIMGFESPEPLANLYSRSYFRATWVTTALDAGFWTAMKIRPAWLKDIA
                     SMAFSVYYLIAAERADEKVRRVRATLTVEHMRTSWNKPTTPYLSLLSTLVRPRFMRYP
                     PREIRIPRPRGSSYREPVNAWLYFDGTLAELREQNQLVLDVPGGGFVAMSPRTADDKL
                     LAWAGKTRVPVLSLDYQKAPEYPYPYALNECYDVYQSIVHSRGRCAGLSGKSRPRIIV
                     SGDSAGGNLATGMMIMILQSGRTETRRWQGETPLPPPDGLVLVYPSLDMNIGSWMTEE
                     QMSLIQERGMRKTNENILRRKSEDFNRLTPSSSHTEDTFFPDQSKSKADLLSSSPIAP
                     VADDKNNNHPTQIKTRIAVSSMISYFGDRILTPEMMRAMIILYVGPHNRPDFKTDFLL
                     SPILAPDAILANFPKTYFLTGERDPLVDDTVIFAGRLRQAKLLRFRERQELGLEKSTL
                     SFNEKDHVEVNLVPAISHGFLNFPGLFPEGWRHINKCAKWIVELLDQAAERELKASTS
                     SLAESLSQDLPKPRESGQYTLVSSHERSRRSSTGESSADEDHPLEMGGGKLMPMTKAQ
                     QDKTPSSNLKQSSKQNKYSSNKKPSDPSSDAYNTFAFPLTLPKLKGAASSQPASVEQV
                     LTSSIMENGSTITRLPSEEDLIGRRMNGLAGGLMGLGEGVRTP"
     gene            <828420..>832314
                     /locus_tag="TRUGW13939_07060"
                     /db_xref="GeneID:55994553"
     mRNA            join(<828420..828771,829490..831233,831291..>832314)
                     /locus_tag="TRUGW13939_07060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490202.1"
                     /db_xref="GeneID:55994553"
     CDS             join(828420..828771,829490..831233,831291..832314)
                     /locus_tag="TRUGW13939_07060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346095.1"
                     /db_xref="GeneID:55994553"
                     /translation="MDHQRPPPPFSRSSLFNTAPQSTRQYGSEQQQQQQQQQSRQDGR
                     THPSYNALHHPETESSRTTSSFGYGPPSFASDMRPRSRPLSPMRFGAMRSAASSPEKQ
                     NGAAAKESSSALYHDGPTEPSTSGLGFNRRQMPPPSPPQPYPSRSLPGTSSQPAHPLP
                     RDSASAPLHRPGSSMSISSMLGGSDPDRLAREAPPSIFSRPSMSSSSPFGTTRTPGGA
                     MSPPTAPARPASSVEHSLLRRSRTPDKQYSKDRPSSKSSSNSISSDAFKFVFGRAPLS
                     QYSEKASRPQGSPPSSEPPLTHSRQHSLGGQRASSQPIHEEQRGPGYSPRSRILGEGL
                     LGSTQRPASYADHDNRPIQRYGGIYSDRAREEQTAREREREREREKEREKERERNRER
                     ERERERERSSFNELDNKGTVGSLHGRYGVPFSEREPDRLQSHAPWEINRSQPGSPENR
                     RFGGSESGSGFGFGAIQSYTKSLGSQLGTSRVSQPPPQHSGVSLQSRQDQPTPPPHDN
                     PFHHKPTPGRPISVTSIPSGNQQPTSAPGSSTNDEQRRKGSDDLMQHRSFLGINADGR
                     RAGRASPLPQAVQGAQAQIIGPAGESGIKGELGRVFAGIGSGVGTGISGSVGSGHSTP
                     MTASPFKRESLPGHPESVDDSKFGRGASSTNGRKRSAKDEDVQFEAGEQSLDGRTTSS
                     SRGSSRRGRHVHHHHHHHHHHRHKNEEEGATQRTPSGPASILGRYAPAETAAAPTSAP
                     PSAHHHHHHHHHHHGSRPAVSAANTAPVPPPREVHTVVNIKPLLKSIAHLPRHHLGST
                     LYAPRIGVPSSNSGESRKFGYTSTPVPIPRFEGKENCTFTVRVPRYRIDTGHREEICA
                     RRALWGTGVYTDDSDPVAAAIHSGYIRGEWGDNVDISMLDLEVKDGYNHVPPADGDES
                     STGNKRVPPVFEDNKDLHITLLILPRLEKYEPSLMFGLKSRLWDGSHDGMSFKVERIE
                     WVDEGSTRGEERSGAARRKRLQNMMQSGRICTGPSLLRMRGGATGGVRPEKDIGASTA
                     AASATVQPV"
     gene            <832876..>836095
                     /locus_tag="TRUGW13939_07061"
                     /db_xref="GeneID:55994554"
     mRNA            join(<832876..833268,833327..>836095)
                     /locus_tag="TRUGW13939_07061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490203.1"
                     /db_xref="GeneID:55994554"
     CDS             join(832876..833268,833327..836095)
                     /locus_tag="TRUGW13939_07061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346096.1"
                     /db_xref="GeneID:55994554"
                     /translation="MASTNAPDKPMSEKQRLKHEKFIKKQAQQQQQQQAISTVSKQSK
                     AKTQDASYSTTSTVKTSKDWIDETPSGQKKILKPLDDDLHKAYIPKVVESAWYSFWEE
                     QGLFKPRTNEEDGSFKAKGKYVIAIPPPNVTGKLHIGHALALSLEDTLIRWHRMRQFT
                     TLYIPGCDHAGIATQAVVEKQLAKNPKDGKSKRQDFSRAEFVQLCQDWKEDYHRAINN
                     TTRKLGVSVDWSREAFTMSPQLSKAVTETFVQLHSEGLIYRANRLVHWSCRLTTALST
                     LEVDQKEIEGTTKLSVPGYDRKVEFGTLTYFKYPIEGCPGQTIEIATTRPETMLGDTG
                     IAVHPQDERYKDLVGKIAQHPIIPDRKLRIVADEYVERDFGTGAVKLTPAHDYNDFNL
                     GKKHNLPFINILNEDGTLNSNAGHYAGEKRFNARYKVIEELKTLGLYTKQESNKMVIP
                     ICSRSGDVVEPLLKPQWWMKMEPLTKPAIDVVESGELVIRPELQRRQYLQWMQNLQDW
                     CLSRQLWWGHQIPAYFITIDGEGDGDDSNDDYWVCGRTEEEAQQKAEEKFPGKKLKLR
                     RDEDVLDTWFSSGLWPFSILGWPDKTSDFENYFPTTTMETGWDILPFWVSRMIIFSLK
                     LTGKVPFKEVFCHGLIRDSDGRKMSKSLGNVVDPLDILDGISLDDLHKKLLQGNLAES
                     EVKNAQKYQKKAFPQGIPEIGADALRFSLVNYTQASGGDISFDVKTMQGYRRFCNKIY
                     QATKYVLGKLGNDFVPRETSALTGKEGLAEKWILTKMNTAAKQVNQALEEREFARSTQ
                     IIYGYLYDQLFDIYIENSKSIISDGTPDEARSAMDTLYTTLESGLRLMSPFMPFLTEE
                     LWQRLPRRPSNSTSSITIAEYPEYETAFDDPRSETAYELVLGCSKGIRSLIADYAVKD
                     KAQVYIAPLNKKSYETASAQLSSIKSLSGKIPVDISILNPEEPSPDGCAVFPVSADAN
                     VYIEVKDRIQDARKEAEKFKAKLDEARNDQDEVDSLVAELNKVQDKGVTEAMQSAESR
                     KRDVGARLRALEDTVAMFEKMSI"
     gene            <836887..>838985
                     /locus_tag="TRUGW13939_07062"
                     /db_xref="GeneID:55994555"
     mRNA            join(<836887..836973,837030..837078,837134..838799,
                     838853..>838985)
                     /locus_tag="TRUGW13939_07062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490204.1"
                     /db_xref="GeneID:55994555"
     CDS             join(836887..836973,837030..837078,837134..838799,
                     838853..838985)
                     /locus_tag="TRUGW13939_07062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346097.1"
                     /db_xref="GeneID:55994555"
                     /translation="MFLASARSRVLSPSLGRAPALRLSNRTSPTLAMAPQRRKQSSVP
                     EGYVEDLSKGKLLRFEDSLPKLPVPSLEETSSRYLKSVHPLLSASEFERTTKAVQDFV
                     KPGGVGETLQKRLVARRDDPKNKNWLTEWWNNAAYLGYRDPVVPYVSYFYSYRDDRKR
                     RNPAVRAAAITTSVLDFKRQVDDGSLEPEYLRRLPMAMSSYQYMFNCTRIPAEGADYP
                     QKYSAQENQHITVVRKNQFFKLPVVVDGQQLTNAELQQQFERIYERAEHPVTPVGVLT
                     AANRDHWTAARAKLLSVSPANAKALKDIESSGFLVCLDDAAPVTLEERAHQYWHGDGS
                     NRWFDKPLQFIVNDNGTAGFMGEHSMMDGTPTHRLNDYVNKLIFGNKLDYDNTSVRST
                     LSTPAPINFELSAEVEQAVNEALQEHRSQIASHELRVQAFQAYGKGLVKKFKCSPDAY
                     VQMLIQLAYFKMYGISRPTYESATTRKFQEGRTEATRTVSDESVAFVRAHQDPQVPRE
                     EVVKLFRAALKQHTKYTLEASDGLGVDRHLFGLKKLLKEGESLPEIYQDPAFSYSSSW
                     YLSTSQLSSEYFNGYGWSQVIDDGFGIAYMINEDSLQFNIVCKRLGAERMSFYLNEAA
                     LEVRDLLMPDLLAEKEKAKL"
     gene            complement(<839257..>840583)
                     /locus_tag="TRUGW13939_07063"
                     /db_xref="GeneID:55994556"
     mRNA            complement(join(<839257..840232,840288..>840583))
                     /locus_tag="TRUGW13939_07063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490205.1"
                     /db_xref="GeneID:55994556"
     CDS             complement(join(839257..840232,840288..840583))
                     /locus_tag="TRUGW13939_07063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346098.1"
                     /db_xref="GeneID:55994556"
                     /translation="MISKLVTLALLSRFILCSSLPNVPGATFGSSPSPFEVEVDPGFI
                     DSVYDRVLHARSPAPLDGLNPANADGPGLDDFHKIRDFWLHEYDWNKTQQSINEKFKQ
                     FTTTVESPQSNYSHPVPLHFVHHQSPRTDASPLLFIHGWPGSFLEVEHIIDLLTNPPN
                     SSLPAFHVVAPSIPGFGFSPAPQYPGYGPLEAAHSFNSLMIQLNYTKYLINGGDFGSV
                     ILRFQANAYPENVVSVLSNFWVIRPNATDNARLAANTTTPDETQYMTALNNYVTKNSG
                     YRFIQQTQPLTVAYSLTDSPLGFAVWIWSLIKHTLDPAIKKFTPQELITWSMMYTIQG
                     PYAGLRFYKESQQEGNFEGFSFGTLPYVSQPAAISEFPYDAWFGLPLDWAQREGNVQV
                     RYVHTRGGHFAAYEVPELLARDLWTWFGGLV"
     gene            complement(<841265..>842834)
                     /locus_tag="TRUGW13939_07064"
                     /db_xref="GeneID:55994557"
     mRNA            complement(join(<841265..842193,842247..842474,
                     842534..842629,842681..>842834))
                     /locus_tag="TRUGW13939_07064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490206.1"
                     /db_xref="GeneID:55994557"
     CDS             complement(join(841265..842193,842247..842474,
                     842534..842629,842681..842834))
                     /locus_tag="TRUGW13939_07064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346099.1"
                     /db_xref="GeneID:55994557"
                     /translation="MATSQAANLVEKRMSHEQKPITEDVPHYSSHGESSQTMKALTWQ
                     GKNNVKVVDTARPKIIDDTDVIIKVTGSTICGSDLHLYHGVIPEMKKGDILGHEFCGI
                     VESVGPSAKRYKPGDRVVASFQIACGNCFYCKRKLSSVCEQTNSSELEKKLYGRRTAG
                     IFGYSHLTGGFAGGQAEWVRVPYGDVNLLALPDDVPDEKGLFLSDVLATSWHAVVDTG
                     VVQDDIVAIWGAGPIGQMVAEFSFLHGASRVILIDGGPAAWRLDFVKKHAPKLETIDF
                     SNLSKGESVSSQLKKMCSNRGPDVAIECAAGEYAQSWQHYFETLLGMETDTSELLNEM
                     ITSVRAFGRCGITGVYAGYVRAYLFFLSLVEIEVILTIGAYQVNHLNIGSLMQTGIRL
                     IGNGQAPVHKYWDHLLELIQQKKIEPLDMVTHRFDIGDMEKVYTLFNKREFGVQKVFV
                     QTRHSAPATKGAPTITKL"
     gene            complement(<845122..>853023)
                     /locus_tag="TRUGW13939_07065"
                     /db_xref="GeneID:55994558"
     mRNA            complement(join(<845122..845952,846013..846333,
                     846390..850990,851045..852105,852167..852500,
                     852565..852622,852685..852771,852829..>853023))
                     /locus_tag="TRUGW13939_07065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490207.1"
                     /db_xref="GeneID:55994558"
     CDS             complement(join(845122..845952,846013..846333,
                     846390..850990,851045..852105,852167..852500,
                     852565..852622,852685..852771,852829..853023))
                     /locus_tag="TRUGW13939_07065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346100.1"
                     /db_xref="GeneID:55994558"
                     /translation="MESTNNSSLEPIAIVGMACRLPPDISTLAEFWSFCAHGKSAWTE
                     NPEGRFENAAFWNKNADRKGKINNKGGHYLNHNLAHFDAPFFRITANEAKAMDPQQRF
                     LLEVTYEALENGGLPMEEMAGKDVAVFTANSFSDYLHGITRDPETAATFAMTGCDPCM
                     IANRLSHFFDFRGPSITVDTACSSAMTAIHLACQSLRSGDAPYAIVAAAHLNIYPQST
                     ILYSLSHLLSPEGKCHAFDDRATGGFGRGEGAACLVLKPLSVALEAGDRIYSVIKNTG
                     VNQDGRASAGITVPNGEAQERLIRSVYAACGLDPSQTRYVEAHGTGTAIGDPIEVEAI
                     AKIFGKQGTGLEPTFVGSAKSNFGHLEGVSGLVSIIKTSMMLEKGMLLPNANFINPNP
                     KLNLQGNNLQVLTGIKPWPRSGIRRASVNNFGIGGSNSHGIFEQAPPKPSPKPSNCSY
                     IFALSASSEYSSRMQLSQLSAYVRKHPLFFNQTIMEDLAFTLSARRSLLPWRTTVTAK
                     SPNQLIEKLRAESTTAIRSTRQPLVGLVFTGQGAHWPQMGQELACYPVFAKSLEQSQS
                     MLLELGATWKLQDEMFKSPEDSQLGVPQISQAACCAIQIALVDLLRSWGLDTTAVVGH
                     SSGEIAAGYAAGILSAATCIRVAYHRGMATMEIKEQFPNLKGSMIAVGCREALLQSLL
                     ALLASGSANIACKNSPSSFTVSGDRSAIEELHVLCESRKIFNRILNVDIAYHSSHMGF
                     VADSYLAALGDIDCGVSSVKFFSSTEGSLLQQPNLNSCYWTSNLTGKVLFYDSLSAMS
                     RYFEPVRDEKRGIEILVEVGPHAALKGPVLQVLKDIAKTKDIEYFPTLVRGKNGIDTM
                     HELAASLSSKGLPINLEEVNFGNSANLSKQFAVLGDLPSYPWRHQEEYWQEPRINKFY
                     RENKIPYNDLLGSFATDFNTLEPRWRNIVRLDDLPWLRDHRVQSEVVFPMAGYISMAI
                     EAISQYRLLQGISHGVTYVLREMLVRYPLMLSELAEYDMTLSLRPYIIGPQTQSTKWY
                     EFAIFSCSEDSEFEERCRGKICALHRPPVGVKSGYIDPDGFIGAALDNTDFYTAVKRS
                     GIEYGAAFQGLHDIKAASCEAIAKLRIPDTAKTMPSMCESSYVLHPATVDILMQTILL
                     LAHSKFGGLDRLYMPRYIEEIEVQPLSALGEGEEFPISGIISDPSPDSPVFSLSAQHG
                     GESLISIKGLQCRGQQLPQVSSEITDFCYKVEWRPWVDILSSDELRRIFQSSNDGFAE
                     EQLRVNLFKDVSLYYIREALKQLEDYDAPRHVNMHRWMKEQVEEQRHNAIDNQHAQEL
                     IKTAGQAGSVGKFLCRMGENIARIVREEVEPLSLMLEDDLLTSYYENLDPLKNRLYPA
                     AASIVAALAHQNPNLRILEIGAGTGGTTLPILQALGEPVVTGQTLFECYVFTDVSAGF
                     FEKSKIKLQSWKDMMEFRVLDIEASPVDQGFMEGSYDLVIAANVLHATVNMSKTMTNV
                     RSLLKPGGKLLLLEITSPSIASFPFATLPGWWLGEEEFRQNGPTLSSMTWETVLKSAG
                     FSGIQAELYDYPGTPEQECSLMLSSAMAPDQWSPTGDLTIVACGSSEGLAEALKASLA
                     TSLQITASVKSLEAIATEPNTSKSYIVLEDFDAPLLCSVNELQYQGLQCICKAERNLW
                     VVAGANQGSVNPKASMTLGLSRSIREENHNQKLVVLDLDLDSRLPSAEAAAMIIHVFA
                     HSFVKPDTTMAEIELSERNGIIRIPRYKKDTEMNQVIVDTRDQFAPKSQIGWDSGHSL
                     KMNTETPGTSKELSFVENGPLQSTIEDMDIEIEVKACGVSFQDVLIRNGKVVGDMGYE
                     CSGLITATGLGVNDLASGDRVCALTRGSYASIVRCPSVQVVKIPNEMTYTTAAAIPMA
                     FATAYYSVITIGHLERGETILIHQAAGGVGQMALEIAQCIGAEVYATTGSADKKQAIS
                     DNFHIPLDHIFCEDQMSSYDDLMNATTGRGYDVVLNTRSNEALDVSWKSVGPHGRFVN
                     LALADILDDNHLSMRPFSRGASFFSIDLEALMKDKPQLLHDILIRGVDRYATGVMKSA
                     ISPKCYPIGAIEDAFNDLSQGNTIGKLVIDFASPVPVSVTVKESSVPLFTPNESYLVV
                     GGGGGIGRSIVQWMSRRGAKNIIIMTRSGLQSQRVRELESEMQLKGIRLVVLQGDVAD
                     ASSLEAVIQESAKILPPIKGVIHSAMVLKTRLFENMPFQDYRAVVSPKVQGAWNLHKR
                     FSDPQSLRFFIIISSITGTVGPPSHAAYGAATTYLGSLARMRKAQGLPGVSIDLGPVI
                     KVGYIAEQTSRQQIIDKNWGDSGLTDMDINAIMDTVISGRYSPSWDAECYTCLLPPSS
                     YVPFWFADSRFAHCRHPRLTDEQGTDCIDDKRVIPLGQLLSNSQSLEDDGSIIYDAVV
                     GKFVSVLSLHPDDILPSTPPGTCGVDSLVASEIRNWILRELKASLSLPELLNSASFVD
                     LSNTITQRYRKSKEV"
     gene            <853698..>854999
                     /locus_tag="TRUGW13939_07066"
                     /db_xref="GeneID:55994559"
     mRNA            join(<853698..853745,853794..854726,854784..>854999)
                     /locus_tag="TRUGW13939_07066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490208.1"
                     /db_xref="GeneID:55994559"
     CDS             join(853698..853745,853794..854726,854784..854999)
                     /locus_tag="TRUGW13939_07066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346101.1"
                     /db_xref="GeneID:55994559"
                     /translation="MNPVYIAGAARTPTARINTQLDSFPGTTLGAIAIREALRRSKVP
                     LDLFSDVYMGQVLQAGTGQAPAKQAAMQAGLGSDIEATTINKVCASGLKAVTLAAQNI
                     QLGYAVAQVAGGMESMSNVPGYLKKGEDSESKDNPVIDGLLFDGLTNASDGRSMGACA
                     ESIAEQMGISREDQDDYALGAYQRATQAQQRNVHQGEITPVSIDTNMAEVFDMDSLPH
                     ESLVNRLRSLNPVFSPNGTVTAGNACPLSDGASAVVLVDSQTAGQFCRENRVLSKIVA
                     YADASVAPHEFALAPTKAIQLVLERAEMCAEQISFWEINEAFAIVVIASQQLLGLDPD
                     TVNVNGGAIAFGHPLGSSGCRLLVSLLHQLAEDQYGIAAICNGGGGATAVLIQRVRGE
                     SLDVPS"
     gene            complement(<855436..>856335)
                     /locus_tag="TRUGW13939_07067"
                     /db_xref="GeneID:55994560"
     mRNA            complement(join(<855436..856139,856194..856212,
                     856294..>856335))
                     /locus_tag="TRUGW13939_07067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490209.1"
                     /db_xref="GeneID:55994560"
     CDS             complement(join(855436..856139,856194..856212,
                     856294..856335))
                     /locus_tag="TRUGW13939_07067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346102.1"
                     /db_xref="GeneID:55994560"
                     /translation="MKFLCLYGGGMGEQLFKEQLDPLGTALPAKYQAQFQYAPPLHKI
                     PNVSDDLAQYAGVGPHLRYVEYPLQATVPGLLEMVNGTPGEGSAEQIWRHAFEWLYPK
                     GLDEQRQFKESIGRSVGYLNDIIDQDGPFDGLIGYCEGASIGAALILSRLDRHLPNPF
                     KCALFYGGYAPYTADGSKFVLADEVGTVFHFPTCHVIGSDDPMIDGCTALLNLCDSAQ
                     ATVVEGGAGHLMPQDSLAIDAVNIAFCKMVETAVVT"
     gene            complement(<862141..>862976)
                     /locus_tag="TRUGW13939_07068"
                     /db_xref="GeneID:55994561"
     mRNA            complement(join(<862141..862246,862294..>862976))
                     /locus_tag="TRUGW13939_07068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490210.1"
                     /db_xref="GeneID:55994561"
     CDS             complement(join(862141..862246,862294..862976))
                     /locus_tag="TRUGW13939_07068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346103.1"
                     /db_xref="GeneID:55994561"
                     /translation="MILLLRQLLRVASRIESELEVVNQRLDYITSLLEKHPGPVQEPH
                     EDVAALSSHEDSPFRLLATSSIMVVLELEPDFSQNLIRLERINFLTGSTSGTDARLFF
                     VPHQQAVTVLAAFSERIHIYYPILASDFSEEYFRVLSEPLTPSCQSCLVLLVAAIGCV
                     AHDPTSDRENPFFTAALSSLPLVVAECSLVSVQCLVFLSIHYACLLKPCQAHDYCLVA
                     SFKIQNLFKSGLQGTDPDVLELTHRAYWAILLLERQVACTNRHS"
     gene            <863515..>864888
                     /locus_tag="TRUGW13939_07069"
                     /db_xref="GeneID:55994562"
     mRNA            <863515..>864888
                     /locus_tag="TRUGW13939_07069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490211.1"
                     /db_xref="GeneID:55994562"
     CDS             863515..864888
                     /locus_tag="TRUGW13939_07069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346104.1"
                     /db_xref="GeneID:55994562"
                     /translation="MNPLLGNHLLADITRHRVSRSARVSSWDQKGLNEDAFVVLPGET
                     MLLADLEGPGAITHLWFVQTCRKILGPGLIPYSKSGVAMMEIHNALGLNYEVNDPDYY
                     RKVLIKMYWDDSETPNVLAPVGDFFCLGHSMAANFQSLPFTVSVKPSEEKKFGGAAAF
                     NCYLTMPFNKRARIEIENQNDEAYIQYFYIDYELYPEPLPGNTLYFHAHWRRENPTNG
                     WAPSGIQTNGLETQVKNLDGKDNYVILETEGAGHYVGCNHSVLHFQGTWWGEGDDMIF
                     IDDDTWPPSMHGTGGEDYFSQGWGMQKNAYPFCGTIIHEEDVPNYQVSYRWHLADPVR
                     FSKKIKVTLESGHANHLRDDWSTTAYWYQTLPGPKLEILPVASRLPRKPEILPPVLDL
                     SDQEISTLSLEKREKLTQHQERYDLFVKDRNEWLERRAKDSRERAMNNVQICKDIRLR
                     FLKSLEG"
     gene            <865650..>867775
                     /locus_tag="TRUGW13939_07070"
                     /db_xref="GeneID:55994563"
     mRNA            join(<865650..865758,865816..866139,866202..866331,
                     866385..866426,866483..867326,867409..867513,
                     867575..>867775)
                     /locus_tag="TRUGW13939_07070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490212.1"
                     /db_xref="GeneID:55994563"
     CDS             join(865650..865758,865816..866139,866202..866331,
                     866385..866426,866483..867326,867409..867513,
                     867575..867775)
                     /locus_tag="TRUGW13939_07070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346105.1"
                     /db_xref="GeneID:55994563"
                     /translation="MSLRIESLTCRRIDYSVVDPSRRWQMLISQRRFCLWCLWISSGV
                     VMQGFDLVAGGQLAALPEFQRRFGYPQPDDSYLIPAHYLSAWSSIAPACEIVSTFIFV
                     PLLERFGRKTGILAASLISTAGVILQQLATDWRVHLAGRGVNDPGIAIGIMFTISPLW
                     IGETCRPELRGFFLCFFNTSIVFGQFAIAVVTRGSSHLAGKWQWWLPIVAMYIFPGKE
                     HISLLFCLTISLSYLIFPFARSSAILISGWFFFPESPYWLVRQGKNREARISLRRVYG
                     FKNEAFYTAEVLRMEAENKREISTHGSLSEGSYRFLGIDVSTEAECFNRTNLKRTLTA
                     VFVASGQQMIGATFVIGYATYFLELIGVKDYFDASIVLYVVMLLSSMLTFPLSEILGR
                     RTMIVNPQFFLCFVLFLIGILGCIPDPEKASWGIVVLIYIWAIVYQLSIGAVGFVLAS
                     EIATAHLRSTTQGLVTITNALWGLIMQFTVPYMINTDAGHLGGKVGFIFLGTGSIAAI
                     GGWYLYPETKGISFEKIDELYASMTAPRHFSRAVTVQGEITPQTGKIEGSDHVDGTNP
                     SSRWRETLKSVARQVFMI"
     gene            complement(<868373..>870269)
                     /locus_tag="TRUGW13939_07071"
                     /db_xref="GeneID:55994564"
     mRNA            complement(join(<868373..868775,868876..869659,
                     869783..870108,870172..>870269))
                     /locus_tag="TRUGW13939_07071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490213.1"
                     /db_xref="GeneID:55994564"
     CDS             complement(join(868373..868775,868876..869659,
                     869783..870108,870172..870269))
                     /locus_tag="TRUGW13939_07071"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346106.1"
                     /db_xref="GeneID:55994564"
                     /translation="MGFRLEKPKESAGKTWPAILISGFVAFGGILYGYDTGTISGIIA
                     MPYWSQTFSTGYRDSTGKLTITSSQTSAIVSILSAGTFFGALGAAPMGDSIGRRWGLI
                     VSNGVFVFGVILQTAATSIPLFLAGRFFAGLGVGLISALVPLYQSETAPKWIRGFIVG
                     SYQFAITIGLLLASVVNNATHNRNDSGSYRIPIAVQFAWAIILVIGVLLLPETPRYLI
                     KKDNYNGAVKSLARLRRLPEDDPALRDELGEIQANHQYEISLGNSGYRECVRGNLAKR
                     LLTGCLLQALQQLSGINFIIYYGTQFFKNSGVKNEFAINLIINCVNSVSTLPGLYAID
                     KWGRRPVLLLGAFGMTISQLLVAVLGTTTTSQDSVGNIIVNNAAAQKAAIAFICIYIF
                     FFAASWGPIAWVVTGEIFPLKTRAKSLSITTATNWLFNWALGFATPYLVNYGPGNANL
                     QSKIFFVWFGCCFLCIAFVYFMIYETKGLTLEEVDELYGEVKDARKSLGWKPSITFTE
                     MRGKAEAFEDKEATEEQREFDKGHETSA"
     gene            complement(<870925..>872827)
                     /locus_tag="TRUGW13939_07072"
                     /db_xref="GeneID:55994565"
     mRNA            complement(join(<870925..871123,871186..871776,
                     871856..871933,872002..872373,872449..872743,
                     872803..>872827))
                     /locus_tag="TRUGW13939_07072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490214.1"
                     /db_xref="GeneID:55994565"
     CDS             complement(join(870925..871123,871186..871776,
                     871856..871933,872002..872373,872449..872743,
                     872803..872827))
                     /locus_tag="TRUGW13939_07072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346107.1"
                     /db_xref="GeneID:55994565"
                     /translation="METQTLPLLELSRIWKQLDHITRVIDTKASERAYSVKEQLPWDP
                     FGDQDPLAGFPIMTIKNQSFMALLKLDRSFSVLLEQMESRGQSFCSRPSSVPVVMVDF
                     AQALEFLNAFAEHVHIWYPILHVDYMDEFLQVISAPFQPSVYSCLALLVLAIGSLARY
                     ESIVHAQKNRPENIYIQAAEDMLPCVLADSSTRSTQCLLLFSMFYLCYAQPCRAHDFV
                     AIASHKIQDRLINHPDDENDLSRPSIIGNCYWTAVLIESEITVQLDLVDSSIWSMDSV
                     TTVPVSYETWIWYPSLLPVEASGDEAEGIMHEQALRHHDLSYFVAEIAMRKMLQRCTS
                     SVRRLSQVEFSYAPVIAAELEQQLQEWYDLLPDELALRGDNDDSVPSRGLAQAEFLHT
                     QCYAFRASIYWPAVYQASVTGEADDDLLLHCRGFFDSYIEFIACAAISVSTCKPNIWT
                     LYASVFTISMAALTASTAPCLLSAVSPGVLQSLGKAVHLFESVAEVSPSLAKMEAILK
                     ERIFHQASPSS"
     gene            complement(<874397..>875307)
                     /locus_tag="TRUGW13939_07073"
                     /db_xref="GeneID:55994566"
     mRNA            complement(join(<874397..874664,874738..875027,
                     875092..>875307))
                     /locus_tag="TRUGW13939_07073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490215.1"
                     /db_xref="GeneID:55994566"
     CDS             complement(join(874397..874664,874738..875027,
                     875092..875307))
                     /locus_tag="TRUGW13939_07073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346108.1"
                     /db_xref="GeneID:55994566"
                     /translation="MNNSSIYSKPNVLDHAPFLVKRDVSRPVDDPAALILEAWSQGLM
                     TGSLVIMAAITYVNMRSGVFLHKMILLELILAMPHGTFIFAPEPAYGWYLASTAIGLI
                     ISWSLHNVIAWMKNKAFMARWLSLAYIGTIVLVQPYWAVEIFANFAYFNNIDAAFYEK
                     MRPLEALFRDPWWIFTTCNIFWVIKTHYNFGIIELVRESPRFGLMLASMGLSITFLIL
                     DILSVTGTLRVTATMGINPFWKVGVFFLFGDVTWTKTTY"
     gene            <875830..>877842
                     /locus_tag="TRUGW13939_07074"
                     /db_xref="GeneID:55994567"
     mRNA            join(<875830..875974,876043..876313,876390..876737,
                     876963..877553,877650..>877842)
                     /locus_tag="TRUGW13939_07074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490216.1"
                     /db_xref="GeneID:55994567"
     CDS             join(875830..875974,876043..876313,876390..876737,
                     876963..877553,877650..877842)
                     /locus_tag="TRUGW13939_07074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346109.1"
                     /db_xref="GeneID:55994567"
                     /translation="MPIGPPSSPVSNAGSAKEDVTEPGPNARRASFWMWSVSIHRLQL
                     LSRHMQEFSNIRERLDYIAPLVKDLGAPPTFWKHAPYLQPQAPPITIKSQFLMQMVGL
                     RLDFPAFVYRLEEATPYIPAASVEGKLLRLSEEKVTAVIRIFTEEVHVWYPILHPDIT
                     NHFFETNSSGFPPSTKSCSCLLVASIAFILRKAQSESIYSEAALSMVPIVLQEDSVVS
                     IQCLILLSIHFACRVQPRQSYDYIRIASFRIHSLLRSEISMHLNLSTAYNRRRPGGSY
                     APIPFTTNDKSWDILAESSPSSSCLTPSPDTPSQSQHYPLDFTKELHLQQLLDKCMDS
                     ATGDSYPIHPTSISSAEERLSLQQLLDSLPPIPPFRVTSMPQDISTRHQHGTLLRAKY
                     HAYEISSYWPAIYRATLLKSADSELLPYGPLFVESIVSFLGTANVAGRSCIPKSWSLC
                     ASLFIVSMVAVWTVDNLRLQSPFLPRLRGYLKDTLDTLKQFSELSPSVKYMAEVLENR
                     LQEIDVL"
     gene            complement(<878213..>879942)
                     /locus_tag="TRUGW13939_07075"
                     /db_xref="GeneID:55994568"
     mRNA            complement(join(<878213..879487,879544..>879942))
                     /locus_tag="TRUGW13939_07075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490217.1"
                     /db_xref="GeneID:55994568"
     CDS             complement(join(878213..879487,879544..879942))
                     /locus_tag="TRUGW13939_07075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346110.1"
                     /db_xref="GeneID:55994568"
                     /translation="MRLKVLLLGAFVSQIEAAQSNVSYTELYRPQYHYTPARNWINDP
                     NGLVYADGTYHMYYQYNPGGDTWGAMSWGHASSKDLTHWKEQPVALLARGYPDNITEM
                     FFSGSVVIDQNNTSGFGNKGDAPWVAMYTSYYPLQQVLPSGKQVRDQQQAQSIAYSLD
                     HGATWTTYDEHNPIILDPPAPYQDQYLDFRDPNIFWYQPIKKWVAVISLAKLHKLLIY
                     TSPNLRQWSLESEFGPFNAVGGVWECPNLFPLPLDGDESKVKWVAIVGLNPGGPPGTV
                     GSGIQYFVGDFNGSTFTPDLNSIHGGDKDSERTRSFANSPATDDNANWLDWGPDFYAA
                     QAYNGLPQDQRTIISWMNNWQYGATIPTSPWRSAMSIPRQLSLKTIDQKIAVVQEPKE
                     SWKAITEAGNVSTVPSVTGVHRLGEIGKAVDIQLTFPSREAATNGSSEFGIIVRASED
                     FSQQTRVGYDFATQQVFINRTISGDVSFDSTFASAYYAPLSPATDNTVTLHIFVDWSS
                     VEVFGGQGQTTITTQIFPSDNATYAQLFSTGGSTNNVQLSISKVRSTWT"
     gene            <880710..>882260
                     /locus_tag="TRUGW13939_07076"
                     /db_xref="GeneID:55994569"
     mRNA            <880710..>882260
                     /locus_tag="TRUGW13939_07076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490218.1"
                     /db_xref="GeneID:55994569"
     CDS             880710..882260
                     /locus_tag="TRUGW13939_07076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346111.1"
                     /db_xref="GeneID:55994569"
                     /translation="MISRRITVTIKAFSLLWALVRPAVADDYRPAFHFCPAENWMNEP
                     NGLIKINSTWHLFYQADPTANEWGNECWGHATSSDLLHWDHLPVAIPVEDGIQSFTGT
                     SYYDSNNTSGLGTSANPPYLAFFTGYDPANNGTQDQRLASSTDLGKTWVKFPDNPIIG
                     IAQEAPHDISGGLESRDPKVFFHVPSGKWVMVLGHGGQDKLTFWTSSDTKSWTWVSDL
                     ASSQIQGFPSDITGWEVPDMFQLPIEGTNETTWVLIFTPAQGSPPGGNGVVALTGSFD
                     GKTFVADPVDPSTLWLDYGRDFDGALSWENVPESDGRRIIAAVMNSYGSSPPTTTWKG
                     LLSFPRTLTLKQIGSKQYFLQQPVTELSKVDSSLASIQNQTITPDQTLLSSVHGTSLD
                     IRVAFHIDSGATLSLAVRKGGSEQTVIRYSQSNSTLSVDRTASGDISYDPAAGGVHSA
                     QLAQDNTELVHIWALVDTCSVEVFGGQGEAVISDLIFPSSTSDGLSLEVTGGTATLQS
                     VEVYSVSL"
     gene            complement(<884520..>884816)
                     /locus_tag="TRUGW13939_07077"
                     /db_xref="GeneID:55994570"
     mRNA            complement(<884520..>884816)
                     /locus_tag="TRUGW13939_07077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490219.1"
                     /db_xref="GeneID:55994570"
     CDS             complement(884520..884816)
                     /locus_tag="TRUGW13939_07077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346112.1"
                     /db_xref="GeneID:55994570"
                     /translation="MVLEYENQIQRAEYAESTTPASSVRDSDKLKAYIPLAGLSDDGW
                     SKDNEATATCYCGAVQLAFVSPYSLEYENPQSCSAPIHLKFSPPSHLLSISPSK"
     gene            complement(<885471..>886648)
                     /locus_tag="TRUGW13939_07078"
                     /db_xref="GeneID:55994571"
     mRNA            complement(join(<885471..886034,886091..886219,
                     886486..886526,886594..>886648))
                     /locus_tag="TRUGW13939_07078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490220.1"
                     /db_xref="GeneID:55994571"
     CDS             complement(join(885471..886034,886091..886219,
                     886486..886526,886594..886648))
                     /locus_tag="TRUGW13939_07078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346113.1"
                     /db_xref="GeneID:55994571"
                     /translation="MPRDSLFGVQSVAGYLGEMTPSVDMCGRVTEESNEVPLLVHSMA
                     VIGMWATNMRSTRAAATELHETLNSAIYQQREKWDASIAENASSTCRWPIPMYQAILI
                     HIIFSIICKDSISLGLDLKPSLPATDTDLLAALVLSCRRLGMFYYPNILARYQPDDLS
                     SYVWIGIEEVKRFDLALYRVCKILGSSKSNTNVGDYGNPGVARWQLTASELQFPMPKN
                     DLLWNAVNKEEWNSAATEDVYHFNLNDTMELEWISNSAELMQRT"
     gene            <887034..>887978
                     /locus_tag="TRUGW13939_07079"
                     /db_xref="GeneID:55994572"
     mRNA            <887034..>887978
                     /locus_tag="TRUGW13939_07079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490221.1"
                     /db_xref="GeneID:55994572"
     CDS             887034..887978
                     /locus_tag="TRUGW13939_07079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346114.1"
                     /db_xref="GeneID:55994572"
                     /translation="MAPAILIVGATGNTGRSVTETLPKLLQTSNALSNHRVIALTRSA
                     DGPVAQRLTELPGVEVVEQNWVEITAEWLREHEVSRAFIASHNEPNQFAEESTFHVAA
                     LKAGVEYIVRISTTAANVRPNCDAYYPRTHWAIEALLSSPEFSSLQWTSLQPNVFTPL
                     YLSTAMEFITKFRKTGKQDTLRLMASEEAPVGIIDPDEVGVLAAHLLSQEDPTVHNKA
                     KYVLNGPEDITGKQIVSMVEQYIGTQVNSVSYKDMSFLDIALQDTRHSKNVISSIKYA
                     PVTAWEGKCMASTTSKKVLEIAAPKRTPADVLRAMLGE"
     gene            <889497..>890354
                     /locus_tag="TRUGW13939_07080"
                     /db_xref="GeneID:55994573"
     mRNA            <889497..>890354
                     /locus_tag="TRUGW13939_07080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490222.1"
                     /db_xref="GeneID:55994573"
     CDS             889497..890354
                     /locus_tag="TRUGW13939_07080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346115.1"
                     /db_xref="GeneID:55994573"
                     /translation="MAQSNNNAGYTQGHSKFTVATQVTRTVEADAGFLVPHIKKTDKI
                     LDIGCGPGTITTGFAKYASEGAIVGVDISEQVLQKAKALAAEANVHTKGLGSVVFEQG
                     DVLKGLSYADESFDIIYCSQLFGHLPPPDVPLKAVTEMRRILKPGGILATRDSAEQHF
                     YPRSLDLDTLWVGNMRRVISHKDVPDVDPTATRMPALFRSAGFDANAGKVRVGGGATV
                     FSTPESRKWLYARAVGQLEEGDPFRQSWLDAGITEEVIQQTLLAAAKWAETEDAWYVA
                     LQCDMLAWK"
     gene            complement(<890837..>894001)
                     /locus_tag="TRUGW13939_07081"
                     /db_xref="GeneID:55994574"
     mRNA            complement(join(<890837..891136,891472..891940,
                     892273..893882,893939..>894001))
                     /locus_tag="TRUGW13939_07081"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490223.1"
                     /db_xref="GeneID:55994574"
     CDS             complement(join(890837..891136,891472..891940,
                     892273..893882,893939..894001))
                     /locus_tag="TRUGW13939_07081"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346116.1"
                     /db_xref="GeneID:55994574"
                     /translation="MSGTYTSETSLLTDIFWVNLLSQRDVSSQVPINYVTQPAIALTA
                     ACFNDHSYNGTAGSLCLSELLTIGYRRFIIDIYWSDENQQWLLCPVSLPSSSASSTSL
                     FHLGIYTCTGSFNLRTLTDLIHRYIQDSKENVETTFLYLIFNLHAAAASDTPDEPVPN
                     LSASNLPSETLLLGSLVNQQLKTYLYTPSQLTQERRNLNASWYADTSDKANPLASYFT
                     TNSDSRGIQSTPDGWPCAAYLEQKSNKRLLLGWGSIDDQMENYYFDTDASFVFGANEV
                     VSNISTTISSDDRGIQSGCLYDDNITQVSNVNASWAASIPANVNLGATVDNFALLLNL
                     TSCGISPIIDQPLGDGLASTNIDPYRNLSMSTMWSWDIGEPRNASDTPELENASTFRC
                     AVMDANSQGHWRAGNCSDEHRAACRIDNRPYSWILSPNATSFSDSTDGCPENSSFDVP
                     RTGLENTYLYHTAMSAVGEASDELVWLNFNSIEIQYCWVYGGSNASCPYSPGANDVER
                     RMILVPTVAAFVVLIITALTLFIKCNSNRRVSRKRKRVIEGWEYEGVPSYSAAMAPDL
                     NSLPPSRSSTSSPLNTRNLPSTMEGHSSNNGASPVVLSQSPVAAPINIADLSHRSSLS
                     GHLGSPRSNRPSISEGRRRSGIGMHLNLNDPPGADHREHRSSSISNYLRNASPSSLGG
                     SPIIGTGDPHHQRAPSLGELHQELEQEQEAQVPTSAIDPVHGSFSSDWSVVGESAVPA
                     TRRSSRDEGSFYQAEAAMLTRENQMLRMRIRELERQLSGLSSASNDSNEAGRPGGNTS
                     SADDSSASAEAVEKT"
     gene            <894416..>895799
                     /locus_tag="TRUGW13939_07082"
                     /db_xref="GeneID:55994575"
     mRNA            join(<894416..894911,894977..895530,895593..>895799)
                     /locus_tag="TRUGW13939_07082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490224.1"
                     /db_xref="GeneID:55994575"
     CDS             join(894416..894911,894977..895530,895593..895799)
                     /locus_tag="TRUGW13939_07082"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346117.1"
                     /db_xref="GeneID:55994575"
                     /translation="MAAPPGMSPQQMAAFQQHMQQQLAAEASKRGMTPEEFIKMQREQ
                     VNAEAAKHGMTPEQYVNNMRMRALQQRAAAQQQAQAQGQGQPAQGQPQAQGQQQQQQQ
                     QQQGQPQGQPQQPPQQQTVQQQVPVNPNNPPDPKAIAVAKWLRSQNLKSRTCILDGQR
                     KDMFKVKRAIRALESPAYAKASGKSKGLLPPVTDRASAENVFKLLPLSLLALRISKHD
                     PHAGHGHGKGKRIKGLWTVKIEQHQETDPMMHYVFLYEGPQWKQKAMAAAVVAGIFAV
                     VLFPLWPIMLRQGVWYLSVGMMGLLGLFFAMAIFRLILFCITVFAVPPGLWLFPNLFE
                     DVGFFDSFKPVWGWQEKKKKKPKKAKKSAPEAASEPAATPVSTADATAPTSTSSATTS
                     GAAPAAGADTPTKRVLTASVEDVEEE"
     gene            complement(<896593..>899307)
                     /locus_tag="TRUGW13939_07083"
                     /db_xref="GeneID:55994576"
     mRNA            complement(<896593..>899307)
                     /locus_tag="TRUGW13939_07083"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490225.1"
                     /db_xref="GeneID:55994576"
     CDS             complement(896593..899307)
                     /locus_tag="TRUGW13939_07083"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346118.1"
                     /db_xref="GeneID:55994576"
                     /translation="MDAQPAPRSGIPRRGPPLAPIRTDLSQQLLQQQQLHQQKPQLQQ
                     PQKPKQLPTLQKPRPNRLRPAEPTTQQAEKVPPQPEPATRKPSKSSLKSLFSRNKAVR
                     DVKKKDNPLPQVSERRESDAQSIQPPETPRSFAGTVTSVTTVVASADLTTPIATPTEP
                     HFEKKGPIQTAKAKPTRKSSSPWVPPPLFQAYPQALKHATLFAPILSAEAILRIQSSK
                     TTAEAKEENSTPPDSSAAKKKDEKDKKHARRMSMASGDTLLARKIFVLVTSGRLLQYA
                     AEGRHDRLPEKLMRLGSTSAAFASDAIPGKPFVIQVTQQFSSDGKAPTETTGRGLLSR
                     FGIQGSDARRMVRTFLMVLSDPEEMNSWLVSLRMTIESVGGKHFVPESPVEDKNAAAG
                     KINQATSSTRASRQLNIRRPSLNDFSSQHSGGSFRAPSRTSIAPTMNRKNSYQDSTPS
                     TNLAKALSRRSITAPSDAISIATTATMSMEPDTIYEDPRDAPLPPTRTPTISQPPSLK
                     PSPATSPVQSPPTTPRLRNMPTIPSSTIRPSMYAASPPPQPDHRREDPAPSRRLSYIS
                     SAHSPPQSPSASPIPPNFSVPSFSTRFTIPRRGSGPSVNSDTDDPPTGPSSPVEQTEP
                     RRKYSGLNIDMGRIAAANMAKRSLATEARSNTPNPISPTKSSLPGPRGIPLHTTPSQP
                     SSRYAHKVQSPEISQKPSASDARAALPTPQKSRPLMRLPKPNEPDTLTALPSFAQSAP
                     GTDRIKRTSVTTATPSRPPSQIVPPSLQAPRIPSAVGQRASRMAIPASKSPPVGITEQ
                     ERQPTRRLSALPQQRSISPRKKSIPSPSLAMSPPAPPPDCPLPEVPSDIPGRRLPTWR
                     KHSLLPAPNMDARKQQSPELRQIGFARRQQISPPTPTSSIPRHDPHGP"
     gene            complement(<901520..>903254)
                     /locus_tag="TRUGW13939_07084"
                     /db_xref="GeneID:55994577"
     mRNA            complement(join(<901520..902413,902467..902901,
                     902964..>903254))
                     /locus_tag="TRUGW13939_07084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490226.1"
                     /db_xref="GeneID:55994577"
     CDS             complement(join(901520..902413,902467..902901,
                     902964..903254))
                     /locus_tag="TRUGW13939_07084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346119.1"
                     /db_xref="GeneID:55994577"
                     /translation="MSVSPASFLCSRCAPRSLRLLRRSPFRGLNAYTTTAAAPQHDRP
                     FRVAVIGSGPAGFYASYRLLSKADDAVVDMYEKLPVPFGLVRYGVAPDHPEVKNCEEK
                     FTEVASSPRFNFIGNTAVGSQLPFETLKPHYDAILFSYGASEDRELGIPGEDACKNVL
                     SARAFVGWYNGLPEYRDLSPDLTSGEHAVVVGQGNVALDVARILLSDVDALHKTDISE
                     HALEALAKSKVKRVRVVGRRGPMQAAFTIKEARELLQLPSVSFDPIRKELMPPDEVVA
                     TIPRAQKRLIQLLAKGSSNDARATSKSWSLDFLLSPHSLHWSPVYPYRLSHAKFTRND
                     IDSGDPFAPDAKVKPHTLSNGRPAEVNIPCNIFFRSIGYKSLPLPGFDYLGIQFDHRR
                     GIIPNDGFGRVTSSSEAAEDSKTPLDNTHISHIPGLYCAGWVKRGPTGVIASTMMDAF
                     GTADSIAADWEAQSKGSGEGRISFLNSTSGGSSGLGWEGVRTEAQQKGLLPTSWEDWQ
                     RIDAVERERGKEKGKIREKFARVADMLNVVR"
     gene            <903599..>905837
                     /locus_tag="TRUGW13939_07085"
                     /db_xref="GeneID:55994578"
     mRNA            join(<903599..903775,903832..904020,904080..>905837)
                     /locus_tag="TRUGW13939_07085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490227.1"
                     /db_xref="GeneID:55994578"
     CDS             join(903599..903775,903832..904020,904080..905837)
                     /locus_tag="TRUGW13939_07085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346120.1"
                     /db_xref="GeneID:55994578"
                     /translation="MGGAGSPPFLYDPPSQWSFNDTMTGGFNPKVVTDHSRAPRPPRH
                     HQEGPLVGFNRHPDSWGAPHQSTPYIPMSPYTKARVKRTRIFQLLFRLVQFLGALSIL
                     FCVISINHTGVALGWIIRVAPAVAILHTLYAVYHLARSPASRPPASSSSYHLFASCID
                     TGLVPFYAFTSFIAFEQEHENAYGWGTLFNNADIQHYILEIFFFASAVCGGLHLLSFG
                     ISVYLAVVFRQITKLPPDMNPLEDNLTARSPKRSSRSKRPKSAITEKHMSSSTLDSAY
                     FSVKSHLEDPVEAVPAPRTIPFTHTRQQSSNSVVNEPRPTSTQSHRTSQSNMRAQQSA
                     LGERASLANQPTETPAQRSQDSPSRPNSVVVDAPVLLPTRNNFVPTNFRWSSPAPSED
                     SNNWVAYPSRTPSLNGDEDVARRPSPLLTTDVAPPSTYNGAGNWLGPVPKFGRVESSV
                     PQAKARGEYAVLEADDEHLEYSMFADKENLEEDITNYLSKPMNNPLGMNPPTPQPKED
                     SEVPVPTSRKSSLRRAVLTDIPNISADNQSNNKKEISLPKVKESQPKSFGSIMSWGRK
                     SSKSAYESVKIKEDEDISANESSDDESREPPVLTTPKRRSKLLKANPDSNNNKKDTDD
                     RKGRVVSNSGVDLGAGFQLGIGSSSYSDYISGLGVGRRRDVSGKVAEEGRGGVAVAEA
                     EADEGTPEKKTSQGRAAGWARFAGL"
     gene            complement(<906212..>908428)
                     /locus_tag="TRUGW13939_07086"
                     /db_xref="GeneID:55994579"
     mRNA            complement(<906212..>908428)
                     /locus_tag="TRUGW13939_07086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490228.1"
                     /db_xref="GeneID:55994579"
     CDS             complement(906212..908428)
                     /locus_tag="TRUGW13939_07086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346121.1"
                     /db_xref="GeneID:55994579"
                     /translation="MDFHARKHDTADNNNNNKEEQSLSSLLDDSQRGSLMVLISEILE
                     HMRKIVFDNFEAPHTAPTSKKRPNDDAPPDSESQESSNNDQQSQSSQPSQPAPPGIDA
                     KSEAEALRYFDDWRDSVILRVGEVLNERKEPINKTTPGERDAAESKEEPPSRLRDVYR
                     PFENSLQSLHKAEKLLILHSLLLLLLSLQHYNAYSRVLLLHITSSLDLPLKYLNDDEA
                     KVARGLLDAAMVMTADEEAKKKAEENRGMRKWKVGFATVAGAALIGITGGLAAPLVAA
                     GLGTIMGGLGLGGTIAATYLGALASSGVVVGGLFGAYGGRMTGRMMDRYAREVEDFAF
                     IPTRGTRKNFTDEKQAAKEDHRLRVTVGITGWATEEDHIVLPWRVIDADSEVFALRWE
                     YEALLNLGNSMRTLVTTAAWKVASHQILVRTIFAGIMSAVFLPLGLTRLAKIAANPFN
                     VAIARADKAGEVLADALINKAQGERPVTLIGYSLGSRVIYSCLRSLAKRHAYGLIESA
                     ILIGSPIPADTVEWQLMRTAVSGRLVNVFSENDSVLALLYRATHLEVDISGLQSVKGV
                     PTVENINVSDKVDGHLRYQFLVGKILEDIGFEEIDQVQLAKEKDLLNAQDQEIEQEQA
                     NNQRKREAKMSSIRRKPVGESAKDSGQEAPPPTLPPRPQLQPPQPPQPPAKDDAAAES
                     DEEEEKLNYITMLDEEEEDQIQRDIARRTQEQMLNRKMRQTKINGPGERSRREDRG"
     gene            complement(<908615..>909199)
                     /locus_tag="TRUGW13939_07087"
                     /db_xref="GeneID:55994580"
     mRNA            complement(<908615..>909199)
                     /locus_tag="TRUGW13939_07087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490229.1"
                     /db_xref="GeneID:55994580"
     CDS             complement(908615..909199)
                     /locus_tag="TRUGW13939_07087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346122.1"
                     /db_xref="GeneID:55994580"
                     /translation="MPRARLQLNGPSPFRLVYGQLRAPSNLRFYSGPPKSTSEDIAAL
                     LDKPTWSVRSLIPSNDALEKTPSVTPGKLRHLLRLSALPEPVDEAEEAAMLKTLESQI
                     HFVREIQRVDAKDVPPLRAIRDESQEAIEESRIGLKQLEAALAKEKVVGRNNKIQRVA
                     TENNTTPDSDQWDGNALGAATKTIGKYFVVQNRK"
     gene            <909490..>910637
                     /locus_tag="TRUGW13939_07088"
                     /db_xref="GeneID:55994581"
     mRNA            join(<909490..909519,909588..909711,909804..910110,
                     910172..910346,910398..>910637)
                     /locus_tag="TRUGW13939_07088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490230.1"
                     /db_xref="GeneID:55994581"
     CDS             join(909490..909519,909588..909711,909804..910110,
                     910172..910346,910398..910637)
                     /locus_tag="TRUGW13939_07088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346123.1"
                     /db_xref="GeneID:55994581"
                     /translation="MGDPRALLQKADKALQGASGGFSFFGGRSEKYENAADLYVQAAN
                     AFRVQKLNKEAGVAFEKAAAVQRNNLNEPDDAANSLTEAFKVYRKTDPEDAVRVLSSA
                     IQHYIGKGNFRRAATHQQNLAETYEVEIGDAKRALQEYEKAAEWYESDNAEALANKFY
                     LKVADLAAIESEYPKAISHYEKVGNVSVNNNLMKWSVKDYFFKAGICHLASGDLVATN
                     RALEWYRETDPSFGSTREHSLLVDLLQAVEQGEQDVFADKLFQFDQLSKLDKWKTTLF
                     LRIKDNIEEEGEDFS"
     gene            complement(<910914..>912609)
                     /locus_tag="TRUGW13939_07089"
                     /db_xref="GeneID:55994582"
     mRNA            complement(join(<910914..911891,911953..>912609))
                     /locus_tag="TRUGW13939_07089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490231.1"
                     /db_xref="GeneID:55994582"
     CDS             complement(join(910914..911891,911953..912609))
                     /locus_tag="TRUGW13939_07089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346124.1"
                     /db_xref="GeneID:55994582"
                     /translation="MAAVTKSSARSGKRQSPQEIIEAREAKKCVTEATQKYGRGQAVR
                     LKAIKDRKLRGNLQAVEDRYQTAALRAKDAEILLENDAGFLEAEGELERTYKVRQDEI
                     KDNVGIEVAKKGFELKLEELGPYRADYTRNGKNLLLAGRKGHVATMDWRAGKLGCELQ
                     LGETVWDAKWLHNDQFFAVAQKKNVYIYDHAGVELHCLNKHIEARYLEFLPYHFLLAS
                     AANSGFLKYTDTSTGQLVAELPTRLGSPTSLCQNPWNAVLHVGHQNGTVSLWSPNSQT
                     PLVKALVHRGPVRSMAVDRQGRYMVSTGQDMRMNVWDIRTFKQVHSYSCYQPGSSVSI
                     SDRGLTAVGWGTQVSVWKGLFDAAAANEEKVQSPYMAWGGDGQRIENVRWCPYDDVLG
                     ISHDKGFASIIVPGAGEPNFDAMEVNPYENTKQRQEAEVKALLNKLQPEMISLNPDFI
                     GKIDQVSEKKLREEREEDRKPEEAIEKLKNRGRGRNSALRKYLRKKGKTNVIDEKRLK
                     AEALQKERSSRQNESLEQEKEQLGPALARFASKKDS"
     gene            <913021..>915487
                     /locus_tag="TRUGW13939_07090"
                     /db_xref="GeneID:55994583"
     mRNA            join(<913021..913132,913194..>915487)
                     /locus_tag="TRUGW13939_07090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490232.1"
                     /db_xref="GeneID:55994583"
     CDS             join(913021..913132,913194..915487)
                     /locus_tag="TRUGW13939_07090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346125.1"
                     /db_xref="GeneID:55994583"
                     /translation="MAPITQSVHHHRSTTKTSHKGFKSKHATKGEVKERNRGKVESGE
                     RGVRKTPHQQLMSKLDRKNQARQKQQLKHQEKANAVGIFSGQHGAPRQVAVVPLSEKI
                     DLPAVIRSLNESVDVTQDVNNDGLSRVRIDRFKQNLVYIPSKYDLMNALDVCRVADFV
                     VLVLPTDVEVSDEGEILLRSIESQGISNVLVVAQGVDNVNPPKRRTQVIASLKSYINH
                     FFPAIDKVLSLDSRQECSNAVRGLCTATPKGIRWREDRSWMLIQDVQWPETSSGSSNV
                     TVTGVVRGKGLKADRIVHIPGWGDFQVDSITAAPLSSPKGKKEDAMNIDDSESPQVLD
                     QPTEDQDDMATVAPEEIEMEDDMVSHAETEKRGVLLDDHHYFSDDESHMPSRPKRLPK
                     GTSDYQAAWFLEDDSDSGSDMVDMEDEDVDMEVDETEGRPEDGVFPERGDAMTEGGPS
                     EYPQSEVFLDPSPEDEAEQLEEYRASRRKEEENDLEFPDEIELHPNVLARERLQKYRG
                     LKSLKTSMWETSEDRPYEPEEWRRLLQFNDYKGIKNKLVREALMGGVVPGTRVNVHLK
                     AVPSTLRSRPTPVALFSLLRHEHKHTVINMNITVNSSVEEPIKSKEEVIIQCGPRRLV
                     VNPIFSGAGNTPNNVHKFDRYLHPGRSAIASFVGPVTWGAVPVLVFKNQAVKDPEVLD
                     SDEKTINRLELVATGTVVAPDHSRVVAKRAILTGHPFKIHKKVVTVRYMFFNSEDVSW
                     FKALQLWTRRGRSGFFKESLGTHGYFKATFDAKINPQDSIGISLYKRIFPRKARAIEE
                     VEA"
     gene            complement(<915690..>916615)
                     /locus_tag="TRUGW13939_07091"
                     /db_xref="GeneID:55994584"
     mRNA            complement(join(<915690..916224,916282..916380,
                     916446..>916615))
                     /locus_tag="TRUGW13939_07091"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490233.1"
                     /db_xref="GeneID:55994584"
     CDS             complement(join(915690..916224,916282..916380,
                     916446..916615))
                     /locus_tag="TRUGW13939_07091"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346126.1"
                     /db_xref="GeneID:55994584"
                     /translation="MASLDHSHAHSHDALGGHGHSHDILDGPGSFLNREQPLSLHEGR
                     DWKDRAYTIGIGGPVGSGKTALMLKLCLALRDEYNIAAVTNDIFTREDAEFLTRNKAL
                     APERIQAIETGGCPHAAVREDISANLLALQTLQRKFTTDLLLIESGGDNLAANYSREL
                     ADFIIYVIDVAGGDKVPRKGGPGITGSDLLVINKVDLAEAVGADLGVMERDAGNIREG
                     GPTVFGSVKHGNGVDHIVNLIISAWKASGAYEPSLERWKNGAVRGSGAV"
     gene            complement(<917730..>920430)
                     /locus_tag="TRUGW13939_07092"
                     /db_xref="GeneID:55994585"
     mRNA            complement(join(<917730..918227,918293..918562,
                     918614..918928,918991..919928,920124..>920430))
                     /locus_tag="TRUGW13939_07092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490234.1"
                     /db_xref="GeneID:55994585"
     CDS             complement(join(917730..918227,918293..918562,
                     918614..918928,918991..919928,920124..920430))
                     /locus_tag="TRUGW13939_07092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346127.1"
                     /db_xref="GeneID:55994585"
                     /translation="MMMTQPFPAHQGIPQHPGLPPGHHPMAQAQHPNMGVQAPGMVQQ
                     MHPGVSAAGPQVSQPGPMMGGMPPGATTGPGGPVANAHALQHLNPAQAHILQQQQYGM
                     NAQNNQMLQQQIARQRLLQQQQLAQQQQQQQQQQQQQQQQQQQQQQQQQQQQHHGGIP
                     VSLPAGTQGMSQAQLSAIQNSNMRGPANMMHFQQQMQHVPQNLQQQQQQYMAMQHAAH
                     AAAQAQAAAQANNQQGQHTPQQRAAVPPQSVTPQPQQGPQPPQGSGTPSQQSNPPQHA
                     TPQPPSHQGSQPPPQQTPNPQHQQIPQGQQVPQPPQQQAQPTPQMQQQQLPQTTQPQA
                     PNAQQQAVHQQQQQHQHQQQVQMTQGQQQHPMSAPDQIKMQQQILLEQQRRAASMNPI
                     VQNNKGPLTHYVNSYFETLSNFQSNGEDADLLFWQEVVNKYYNTTFQPTTGQPWGVLR
                     QGVFSARSGSKAFEVNATILPRYYVTLFNNGIRKIQTHMEATQEFTPQNGYRVVYSPK
                     ASFIYWFSNDCQLFVNGSLKVLVNPEFKFDLVDISVSGFREYIPRSLLQLQEANEQKQ
                     SPRVTKAANKRGQQKQLPPQPTITPPESLVNEYGLPASVQCFLEIAEPMSFMTSLIFH
                     SSGNPQKNAGDVLREVTSMMAQQSMNLQAQGGQRTPNMNGPSQFASPLVGQMGLPGAQ
                     ASPHLGHSAQPSPAQTHLMGPGMMAHQNQAGMAANGTQGSSANTSPSVSNKRRRASTV
                     KTEGDDGTEVNGTGPVGTSKVKASPRGGKRQKGTS"
     gene            <923458..>926280
                     /locus_tag="TRUGW13939_07093"
                     /db_xref="GeneID:55994586"
     mRNA            <923458..>926280
                     /locus_tag="TRUGW13939_07093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490235.1"
                     /db_xref="GeneID:55994586"
     CDS             923458..926280
                     /locus_tag="TRUGW13939_07093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346128.1"
                     /db_xref="GeneID:55994586"
                     /translation="MQSTLRLPLHAVRSCRLVAGRRYALASSTPYRSFHQSISWRTKP
                     SSDTNGSSGVNGNNNTSNEATPVDVPSQGLDPAVTKRSSPRRRSYIETIRSGMRDRRV
                     PDERPPANPIALPRWYLDRNIALYHEPYRVEKPDSRLGIISKPSTKDDSQAQSQATGG
                     DDTDGSGQDRSWNRGHRYVLSPAVWENLRGQAKAGFMLPPQEYINDPATENSHILLQA
                     PFKDGVTFLDTVVHKLARDLDANLVTLNAQDIAQLCSEQERLQGTVPSTIRSLSYEIY
                     NDHANEDWPSEGAEKDDEAPEETSRTFIAPISSIRSRILSADGGLPDISIPPWLKSLT
                     GSPAGDTAKRPVLDTISTRSLLNKIVSSALRPQPADSEKAPELPSKVIVQIQDYDDLK
                     SSRQGSKVLEMLQEIIRHARRRGDQILLIGTLSRDEVVTLEGAPPALDDSKMVSVEEV
                     KDFPTSTDPFPQTFLIVPATDPETTKGVFDEDYKARTRLINIRHLQDMIRTRVNPNTT
                     PIDSSILDSTSWELDSEAAIKSLESNYWNFGRVHGLVTYAIGRVQSNETFGLQHIQEA
                     FQLVDENEKAGQKVMDALEGISEPAESSGPHGKSKSPSALAPKCNKHEKKLLNGVVKA
                     DSIRTTFSDVHVPPETVEAINSLTSLSLIRPEAFSYGVLATDRIPGILLYGPPGTGKT
                     LLAKAVARESGATVLEVSGSDIYDMYVGEGEKNVRAIFSLAKKLSPCVVFIDEADAML
                     GSRSQGRHRSSHRELINQFLREWDGMNDMSAFLMVATNRPFDLDDAVLRRLPRRLLVD
                     LPTEKDREAILRIHLKEEQLEASVNLSELAHQTPFYSGSDLKNVCVAAALACVREEHA
                     QSMQQQKSGEGPHEFPRRVLTKAHFERGIEEISASISEDMSSLNAIRKFDEKYGDRKG
                     RRKRSAGWGFTAAAEAESGETGRVRP"
     gene            <926681..>927910
                     /locus_tag="TRUGW13939_07094"
                     /db_xref="GeneID:55994587"
     mRNA            <926681..>927910
                     /locus_tag="TRUGW13939_07094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490236.1"
                     /db_xref="GeneID:55994587"
     CDS             926681..927910
                     /locus_tag="TRUGW13939_07094"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346129.1"
                     /db_xref="GeneID:55994587"
                     /translation="MTADHPPSQSSVFASLHRKSKTSEPSVKDNRDAAVREAKQYIHD
                     VVRSDWAFEPPATLWSPSTTSPPSSILSAPATATTSNTNSNNTTAATTTSSESSQSLT
                     EVPASDVVEWRLREYGSSGSEFDTDTGPATTKPGPTEKSPYRFESPDAIHESLAERRR
                     TRRAALEEEAQWNPGLRFFLERRDAWTGSKKRKAISDHAAQQQHDTEPDGLANGECSS
                     AETKDQETTPLTEMLNDLKLGDKDTQSKNLNHSDCYESDDSLVPVMSPFIPNSNCIRS
                     SITPAIYASIYSKVILQGLTPTVPINLSDVIKAIVAGWKADGQWPPKITMPPPGSDVP
                     VRKKGRPVANNADKASRRGSFGGHGSGVANAVKKVLGFSHLRRLSRSSTNGEAGDAAS
                     TATNGLTVEVIEEAGHR"
     gene            <928436..>929988
                     /locus_tag="TRUGW13939_07095"
                     /db_xref="GeneID:55994588"
     mRNA            join(<928436..928475,928538..>929988)
                     /locus_tag="TRUGW13939_07095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490237.1"
                     /db_xref="GeneID:55994588"
     CDS             join(928436..928475,928538..929988)
                     /locus_tag="TRUGW13939_07095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346130.1"
                     /db_xref="GeneID:55994588"
                     /translation="MAESNRFIHEQPADRYQREFTLLSHLGFQSNVIVAASYENTSKD
                     DLSSKALLYPALRKVVQRYPELAMVHFCRPSETKKGQHRRWLGFLREINLDDHVRFLD
                     VPAAAADGLDDGLIEQYHDIWFEDPEKPPWLFVVVNGKHALFVFDHIITDGRGATQVH
                     DSLLKALNLGMGLDRDESPIVRVSPDDVPGFPEPDPIMRSGTSVSIPSAIWMFFIMIY
                     IRLVYRFTDAFFHDAHVRPISKPLTFSHPNKESHLVKTQTRTLRLKPATVKKCIDACR
                     AHQTTFTSLLHTLVKVTLAADFYPTSRFSHSQVALDIRPYLLPHARAQTMSTAVSIVS
                     SFDWLARFREAGTATAAANADLLIWDIAREHRAHVVKDLNHTHLWRKAWLAVSLLGED
                     EEDYISQFLPGYKNSQQNCFSVSNLGAFAPSHHHHSPLDGWTISNMEFSAGAIKAGYG
                     VNLTFDVAGVAGGDTVIHVSAEEGSLRDGFVSSLLERIQKRLEAII"
     gene            complement(<931134..>932604)
                     /locus_tag="TRUGW13939_07096"
                     /db_xref="GeneID:55994589"
     mRNA            complement(join(<931134..931162,931219..931513,
                     931566..931886,931936..932469,932524..>932604))
                     /locus_tag="TRUGW13939_07096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490238.1"
                     /db_xref="GeneID:55994589"
     CDS             complement(join(931134..931162,931219..931513,
                     931566..931886,931936..932469,932524..932604))
                     /locus_tag="TRUGW13939_07096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346131.1"
                     /db_xref="GeneID:55994589"
                     /translation="MGRTVDQEVHAAFVEFRAKEDDKARDRCLSVQCIYCQQIRAKNT
                     SRQKQHLLECPGLRGHAPAPQPPAPSTGPNGIGPANGYSATPNGPTASAPGPGPGPAA
                     AQLATPNGPMMSNGVSHHAAPIQTPLQNLQNRPSLPTPGPPQGPGPSVTPLSQQRPPH
                     SSSKQPKPINNNNNNNRQSTSSLPAPPLDDVHAAFVEFRAKEEDKCLSVQCIYCQQVR
                     AKNTSRQRQHLLECPTYLNVMKDSIPANNLLHTFPEGDIARSLQIPVPSIELDFRMSI
                     KLNPKIAIGNSLWGSRDWLSFVGGQWAGRWGKGIILPGGQDSQVTVKELATSINASYV
                     LQTADEPAAYIIVRTSGWLTGAKDVLEKLGDSNIADSINPSTYKYRINLTMETGDERY
                     AFANTVMWVGSGCRRGHEVIIDAFRLN"
     gene            complement(<933764..>941527)
                     /locus_tag="TRUGW13939_07097"
                     /db_xref="GeneID:55994590"
     mRNA            complement(join(<933764..934450,934507..935103,
                     935162..935612,935678..935812,935870..936010,
                     936095..936131,936214..936221,936815..936845,
                     936901..937141,937203..939632,940014..940024,
                     940960..941239,941399..>941527))
                     /locus_tag="TRUGW13939_07097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490239.1"
                     /db_xref="GeneID:55994590"
     CDS             complement(join(933764..934450,934507..935103,
                     935162..935612,935678..935812,935870..936010,
                     936095..936131,936214..936221,936815..936845,
                     936901..937141,937203..939632,940014..940024,
                     940960..941239,941399..941527))
                     /locus_tag="TRUGW13939_07097"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346132.1"
                     /db_xref="GeneID:55994590"
                     /translation="MADREPPYDPYIPAGGAGGAAGAAGAGGNSAQNGNQRTAALQAQ
                     IDDTVGVMRENINKVSQRGERLDSLQDKTDNLAVSAQGFRRGANRVRKQMWWKDMKMR
                     VCLVVVVIILIIVIVVPAGKSPSQTTENIVATDPSAILPAILLPLPLFRSCRMLAGKM
                     LAVRPAVRRAVVTQSSLRTISAPRAFALRALPSVRRQPVSLTSQTRSYSRPADPQLST
                     RSTVVQLLSNIGSKREVQQYLSHFTSVSSQQFAVIKVGGAIITEHLQNLSSALAFLNH
                     VGLYPVVVHGAGPQLNKMLEDAGVEPQFEDGIRVTDGKTLSLARKLFLEENLKLVEQL
                     ENMGVRARPITTGVFSADYLDKEKYKLVGKINKVDKKPIESAIEAGCLPILTSMAETP
                     DGQVLNVNADVAAGELARSLQPLKIVYLAEKGGLFNGDTGEKISAINLDEEYDHLMTQ
                     WWVRHGTRLKIKEMKDLLTDLPRTSSVAIIHPADLQKELFTDSGAGTLIRRGNKVHIK
                     SSLSEFEDINALKDVLIRDREGLDARATVDRYVEGLGDRPFKAYFDDPMEALAVVLPQ
                     QDSAFAHLATFTITKSGWLTNVADNVFTSIKKDFPKLVWTVKADDENLTWFFDKADGS
                     LSRGGDVVFWYGLEDGDEVKELVREFTQHGRQMFGDYNLEARLHRAAQAALDVSSAAQ
                     QKRSYSTMSSAVNSLRSYRRGNNLMTGRRSYSTTNPNPPLGEKNNSNTRPSKVALIGA
                     RGYTGQALIGLLNSHPNIDLRHVSSRELAGTKLEGYDKREIIYENLTPEDVRRMASNG
                     DIDCWVMALPNGVCKPFVDAVDQGADKGNLIVDLSADYRFDSSWAYGLPELVNRSTIA
                     RANRIANPGCYATAAQVGIAPLVPYLGGQPTVFGVSGYSGAGTKPSPKNDVNILTNNI
                     IPYSLTDHIHEREISTQLGTSVAFIPHVAVWFQGIHHTISLPLKEEMSSRDIRNLYQD
                     RYAGEKLVKIVGEPPLVKDIAGQHGVEIGGFAVHSSGKRVVICVTIDNLLKGAATQCL
                     QNMNLALGYSDHEVLTSQKHGVATIWLVATLGPRTTSKKVNRKAILGVDVPRACDTIM
                     NPEAPMALRLQGNLLYGVSRVYSRQCLYTLTDVQSMLDRMKTALKVVHGRGLNPDAGK
                     ARPEELIVPYDPAFIPEFTLPGLDVDLLKPTELMLCGPDLNSSVLSSHLSASSPSQLG
                     NTLPQLDIPSPSFVAGEFGGFSFQGYSGDVFVDTALGEEGVLLRPDFDFDEEGNIVEL
                     SIDGGMDGGLEVQVETPVRPQGEHAEAPEDVTRPPQDEDVMVLQDDDLIRADELDPRD
                     SPPPTSGRLPDPDYVEGNARSENAAYGRKQRGARKIQLDVSTQISNAELVQWEQEYLQ
                     NMSLAEKQKSYARLVAQARKNAALWVFGCGIGSVGLGVGGSSVAHPLQSFCGKQLLAA
                     LSDGNGDSESEQGRKRRSSEIGQDKIDGSRRVRRRTSEEVEMGLAREYEAGEYDTDML
                     VQRDVELGLGAPASLPDETSSQMPWNITASLQGSVAGSSSIPRPFDSFDRSSRRHFGR
                     SNRLPGRFANLSPLAGRGLRQDLSGYDRLSSLSLDDFGDINDNDMGAYLGEDIPLEDA
                     DLFRDAEGLDAAKTQETVSSLGHADRNFFDFLESRVQAVKNDGDQAQANAGTMPLQKM
                     GFSSIFPVESTSRSVATQALMHVLTLATKNVIRVSQRRATRGLPYSMEDLGDIYLAV"
     gene            <942760..>947472
                     /locus_tag="TRUGW13939_07098"
                     /db_xref="GeneID:55994591"
     mRNA            join(<942760..943066,943120..943486,943543..943601,
                     943656..943816,943877..944167,944228..944302,
                     945205..945235,945344..945471,945536..945546,
                     945599..945740,945812..946002,946062..946215,
                     946275..946370,946424..947104,947155..>947472)
                     /locus_tag="TRUGW13939_07098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490240.1"
                     /db_xref="GeneID:55994591"
     CDS             join(942760..943066,943120..943486,943543..943601,
                     943656..943816,943877..944167,944228..944302,
                     945205..945235,945344..945471,945536..945546,
                     945599..945740,945812..946002,946062..946215,
                     946275..946370,946424..947104,947155..947472)
                     /locus_tag="TRUGW13939_07098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346133.1"
                     /db_xref="GeneID:55994591"
                     /translation="MRITSTFQLLLASAALAAPNTEKALAVSRNHAVSPKNPFRPLPD
                     TRQRTKVCHVDSHGDGSDDSEYILDAIKKCNNDGRVVFDKNYTIGTALNLQFLKHIDL
                     DITGYVQFTNDTDYWQANAFKQIYQNATTFFQLGGEDVNVYGGGTLDGNGQVWYDLYA
                     EDALILRPILVGIIGLSGGSIGPLNLRYSPQWYHFVANSSDVLFDGLDISGFSTSDNE
                     AKNTDGWDIYRSENIVVQNSVINNGDDCVSFKPNSTNILVQNLHCNGSHGISVGSLGQ
                     YKGEVDIVENVLVYNISMFNASDGARIKVWPGLSSELSTDLQGGGGSGNVQNITYDTM
                     FVDNVDWAIELTQCYGQSNQTLCTEYPSNLTISDIWFKDFTGVTSTSKEPDVATLICS
                     SPNVCSNIYANNINVTSPTGTNEVICQNMAKAGAVEIWVSQFPNSLELRSKTWCTGYL
                     KLPSVFSTPGVFAVTMEMNYDESTLQHLEEELDVKIYPGTEIMTDVGTHHFVRSSGAS
                     SDVLVPQPSNDPHDPLNWNPYWKLGVISLITASNFVMGMGPLAVAPMFGDLMAEFKTD
                     LASVVQFTGVCILVLGFSNFFWVPVSETFGRRPVLIFSSIVCLGSNIWRAKATTYGSF
                     MGACVLNGFGAGPCETLQPQVITDTFFLHERGFYNTLYFTFYFGSLMVGPILSGSMAL
                     HVGWRSFWWLNVAAFAFIIVISVFLFPETKWHRLHPREIHRATSQERQQVNKDEKGSA
                     SQEEEVCDPFLHKGHPSKSQFNIYQPCQNWVKTMLLSFWTPWRLLLYPIVEYAAFVVS
                     WSASCFLTANLTQSQAFAAPPYNWSSQSVGFTNFATLAGALIGLFTNGPLSDWISMRA
                     TKRNRGIREPEMRLPTLIPYVLISILGNFIIAFGYEYRWDWRAIVIVGYTCAGIQVAA
                     LPAIASTYAVDSYKPVVGSVFIAITVNKNLWGYGFSKFITTWTEESGYIPAIMLNMCL
                     ATLWFSFGIVFYFYGKRFRKWTAKSDLHDAN"
     gene            complement(<947876..>948905)
                     /locus_tag="TRUGW13939_07099"
                     /db_xref="GeneID:55994592"
     mRNA            complement(join(<947876..948096,948166..948387,
                     948441..948800,948866..>948905))
                     /locus_tag="TRUGW13939_07099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490241.1"
                     /db_xref="GeneID:55994592"
     CDS             complement(join(947876..948096,948166..948387,
                     948441..948800,948866..948905))
                     /locus_tag="TRUGW13939_07099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346134.1"
                     /db_xref="GeneID:55994592"
                     /translation="MSAQTQKKVFIVTGGASGIGLGITRFLASQTHATLTPVHISIFD
                     INATAAAQTVSTLQQEFPAISLSSHQCDVASWESQAAAFEDVVKHQGRVDYVFANAGV
                     TERGTLIDKNEEKPSKPVLATLDVNLSGVIYSIKLAIHYMLKNAPNSSGSKGGIICTA
                     SNAGIYSFPMAPFYATAKHGVVGLVRSLAKPLGLEGIQINGLAPAVVETNIASDGDLF
                     KHMIITPMSTVTRAVETLLTDSSLTGKIAELYEGNVTFVEQPAYADENVKKNIEMFWN
                     LGYA"
     gene            complement(<949703..>952151)
                     /locus_tag="TRUGW13939_07100"
                     /db_xref="GeneID:55994593"
     mRNA            complement(join(<949703..950088,950142..950431,
                     950480..950571,950622..951555,951608..951635,
                     951692..951725,951776..951875,951927..951981,
                     952058..>952151))
                     /locus_tag="TRUGW13939_07100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490242.1"
                     /db_xref="GeneID:55994593"
     CDS             complement(join(949703..950088,950142..950431,
                     950480..950571,950622..951555,951608..951635,
                     951692..951725,951776..951875,951927..951981,
                     952058..952151))
                     /locus_tag="TRUGW13939_07100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346135.1"
                     /db_xref="GeneID:55994593"
                     /translation="MKQQTPDKHFRCNICQRGFTRIDHLKRHHLRHSGVKPYSCVFCS
                     ESFARCDNLRDHYPDCPQRGNRPIPETGQRGRRRHACESCTSMKLRCDGESDGGSKAV
                     QPMVALEFLPVKSEEYEPSDRGSISFLLNGGTDSFTENFHLPPHSDRARGMVFHTQTE
                     RENPSSPLITNTIETKNPGVDDAIFPDSDDLATFHDNFMSFITGPFADTHKSYLGGFG
                     GQTTLTPGHDLNLAVAGDSSYYEPERPFSTSLIQSILARSWTMNLDEKSQQEISTNLH
                     FLLTTQRIHKFVALYFRYWHPNCPIIHAQSFDVEHAPTPLLASVVFMGAMYSSDERET
                     YVAKRVLDFAELYIYSTDALSCENEVGRIFMGQPTTETERKDWAMFQNFQAAYLMVVI
                     QYWAGTKVSRNRAMETRFSEIILMARNMVLTKCRHLPEDRIQESLWIQKECRIRTINI
                     ISLLDCAFSFYQNFPCRLTPAELECDLPCEDLVFNSVHPFTHANFRFTRETTVYEAFQ
                     YLFDEDRPIDKQKETQASTGGMSLTVLDTFILIHLLYAYINSHMTVLAPIIRLRQFRE
                     QSRSLTPSNGSRSVSRKAFIPEDPILGHIRTALARWRTIWMNLREQIPAHEWASMGFF
                     KNGYNFYLVAQLLTTQKQSVDVIMQMEVKCEDKLGKLKVLLQDEND"
     gene            <953653..>959105
                     /locus_tag="TRUGW13939_07101"
                     /db_xref="GeneID:55994594"
     mRNA            join(<953653..953992,954047..954340,954451..954627,
                     954681..954749,954806..955498,955562..955746,
                     956399..956511,956561..>959105)
                     /locus_tag="TRUGW13939_07101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490243.1"
                     /db_xref="GeneID:55994594"
     CDS             join(953653..953992,954047..954340,954451..954627,
                     954681..954749,954806..955498,955562..955746,
                     956399..956511,956561..959105)
                     /locus_tag="TRUGW13939_07101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346136.1"
                     /db_xref="GeneID:55994594"
                     /translation="MPGEFIQKRFSRIAKLWSPSPIPAKEEAVAEKERPKEVITENKN
                     HPEDPWIVEDRPIDGARPIRVVIVGSGLSGILASIRFRQRIQNLSLTVYEKNEDIGGT
                     WYENKYPGCACDIPAHTYQATFEPNPEWSHFYAGAKEIHQYWEKVARKYGCMKYIQLK
                     HRVLEAHWDDNEAKWNLKVENLETNSVLSDSCDVLISATGGLNNWKWPDIPVTQGKRI
                     AVIGNGSSGIQVVPSMLPDVSHIDHYARGRTWLAPTIARAKIDERGGVGLDNIAFSAE
                     EIAHFKTDKAAYQKFRKEIEHDLQNDFAVTIKGTPEQLGGPDFFKVNMKRRLANKPEL
                     LDQLVPPFPPGCRRLTPGPGYLEALTDDKVDMIKTEIAAIDSEGIRTADGVHRPVDVI
                     VCATGFDTTFLPRFPFTGRGGISLADKWREVPETYISVATNEFPNYFISLGPNASLGH
                     GSLSLLIERAIDYMTYCVAKMQRDNIRWMMPRKEAVDRFTKHCEQYFTRTVFSTKCRS
                     WYKGGKEEGRITAVWPGSSLHALKTFSNPRWEDFEYEYVNDNPNGWLGDGWTAAEKAH
                     SFDVNYLDDDQIDFPPVVEEHSVFISGPVIYSDYGGCELAPPDETAYGVDGLSDFISV
                     YSWGGRDDDPLAFPYHDICLHTMLDRVISHMSSSGSSGESMDKEVVYRALKGFGTDSS
                     ENYAAHLDRLDYGEQMEDLHGQYWYISPGAESYMVNPVTIPALQEYYSQLPLLQSSPE
                     KSASVQGSEAATTSDIFAGLPLELVQHITRFIPIESVNALQQVNSSVAVFTQTNSFWK
                     ERILQDMPWLYDLPERKNTGLDWAQIYKELLLKSEKTEHIILGLANRRRIWLLCEQIA
                     ESYMALKQAKDTQRHSSLLEAVSDKMIKVGHLPGAKFEMSKLALFDNVEDVGEHESTL
                     KVHWTREGYLLGFSIKTAADSTYHHLGASNRVAARSDSVSIRQGDWLRGFVFISNDGI
                     EYTYLCEEDIGRVVVGIELIFEHGDSLLLGQSKGDRRIAQVAEGQLLIGLLAEWSQTG
                     GIVRLSLLRHAQKVMPSSDSSKKANIRTNKSLGSILWRKELPPPHLKITEPLIGYWAS
                     DFSVELNPHDAVVFGQNEAELAALTTISIDAQFGGLELGYADGSTKAYGPQRWGMSSF
                     RIDGPGGERVTAVFMDVKTHPNGLRLVTNRNRQFTVGPNLAPGSNITRSSARKVVCGL
                     FCAWSKDDGTGQARMDSLGVLTFPGSYEPANNIEEEDYEGPRDAAGLWWEPEAPPSSW
                     REDGPVYGQHELQTRWRTMQTKPSEHDVAYWFDLTRRVDNVRVTFTHGDKKLQNGAMS
                     LVSITLQYTDGNRVSAGPDGFDGYSKACDNHKNEKEKKGWPFCWCHYGFTDKKELAQA
                     PHYRHEEFAVGGEYIQAIRLWTCPWLQGLQFVSTRGGGAEGPTWGVCEGEPTTILQFG
                     HDTSAVGLKVGMAGNERPTTYLDRIVFSLQALVKA"
     gene            complement(<961571..>962531)
                     /locus_tag="TRUGW13939_07102"
                     /db_xref="GeneID:55994595"
     mRNA            complement(join(<961571..962262,962321..>962531))
                     /locus_tag="TRUGW13939_07102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490244.1"
                     /db_xref="GeneID:55994595"
     CDS             complement(join(961571..962262,962321..962531))
                     /locus_tag="TRUGW13939_07102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346137.1"
                     /db_xref="GeneID:55994595"
                     /translation="MNVASLMTTDWSYGTTRKYDDFQEKPSPYYFTSSRVSPQLPLSP
                     PADEQRKCSLPSISSLLEGADSMPAAKRARHNSAEYNRVFLPPTPPMRPCSGLADGTS
                     PSSLSRRSHSASIASITSIASINSAPAMQHSQSQASLPSICASLPTPPADRGSLSSQD
                     SRMSPPASTYRASPAPAPAQKSAAGNNFTPANESPYTRPQSVSPPGPRIISPVNPAWQ
                     HHHYFPPSGAAPYPQNHDRYVCRTCHKAFSRPSSLRIHSHSHTGEKPFRCAHVGCGKA
                     FSVRSNMKRHERGCHSGRPLAAVV"
     gene            <968572..>969313
                     /locus_tag="TRUGW13939_07103"
                     /db_xref="GeneID:55994596"
     mRNA            join(<968572..969034,969075..>969313)
                     /locus_tag="TRUGW13939_07103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490245.1"
                     /db_xref="GeneID:55994596"
     CDS             join(968572..969034,969075..969313)
                     /locus_tag="TRUGW13939_07103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346138.1"
                     /db_xref="GeneID:55994596"
                     /translation="MPDFIWPAPIKPIISEQLPATPKLTHPRIRRLWGYLHYYLRSFS
                     ETYCGWVGIPYDNQIAQLPFGLILKWSDGTRLEEVATMQVARKAGLPVPKVICYGEHP
                     DSPHAPISILMTRLPGSELGRAYKTLSESDRNSIFEELEGYLEAIRKWKNPWGVSAFL
                     ITTLVQDGHITGFLDWESSGWYPEYWEFTTALKATRKAFWWYDFVIRLGGDAYETELD
                     CERALTSLTSGSYYW"
     gene            complement(<969699..>971788)
                     /locus_tag="TRUGW13939_07104"
                     /db_xref="GeneID:55994597"
     mRNA            complement(join(<969699..971361,971414..971499,
                     971555..>971788))
                     /locus_tag="TRUGW13939_07104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490246.1"
                     /db_xref="GeneID:55994597"
     CDS             complement(join(969699..971361,971414..971499,
                     971555..971788))
                     /locus_tag="TRUGW13939_07104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346139.1"
                     /db_xref="GeneID:55994597"
                     /translation="MTDLDVLRKDQLETRLHNEKKLIKEGALKDENPLDFSEGFRQLC
                     DACRKGDLKVCQEKISEGVNINARDSYDYTPLILASLCGHFEAVQLLLESGALCERDT
                     FQGERCLYNALNDRIRNLLLQYDYSKSTDPLQPLAAHVSSLLTRHIPQTWDIVVTVTD
                     GDESLFLHKFILAARSPYFQKKLSVAPETNSWRLPSTIPPTAFGAAIRYLYLGDSARD
                     LRSGPGTGFTESEVVAGVDRIGQHLDIPHLLDSVLDSGDRRLARQRRTDEISRGRDQL
                     ETWFENNILGHKVVIETSKAKDVKWDRHNAIFADVLLQADEVPDAAGQDGDAQDGGHA
                     SSIPVGPGSGDPELPREQKSVLYPVHRAMLLRSEFFSAMFSSTFREAQMTEHLNIISV
                     DCSPEVLEIILRFFYTEKADFGLDVAVEVLFAADLLFIEKLKTKAGVVISSLGSANMS
                     QAQASKTRPGKGGGEQKGEIVEYDEIDVYDIMRAAWFTRVQRLEEFAARYLAYRLEEH
                     IDTEEFAELIKDSAARIQKRQETDSIELLDDIRFYLSERFRLRFDDAGLAEMIEEHEP
                     QNYYTETPANGEQVAANLAELNISGKDSKTKDTETPTTTNIAAQQDGTVLIDQGTVIR
                     TLDGVIVEDEFDKDAINYRILLDKLDRLLERLNLDA"
     gene            <972357..>974696
                     /locus_tag="TRUGW13939_07105"
                     /db_xref="GeneID:55994598"
     mRNA            join(<972357..972411,972467..972519,972586..972994,
                     973048..>974696)
                     /locus_tag="TRUGW13939_07105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490247.1"
                     /db_xref="GeneID:55994598"
     CDS             join(972357..972411,972467..972519,972586..972994,
                     973048..974696)
                     /locus_tag="TRUGW13939_07105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346140.1"
                     /db_xref="GeneID:55994598"
                     /translation="MAGIALAEADKYDVLEKIGAGSFGIIRKVKRKTDGFVLCRKEIN
                     YIKMSQKEREQLTAEFNILSSLRHPNIVAYYHREHLKASQDLYLYMEYCGGGDLGMVI
                     KNLKNSNKYAEEEFVWRVLSQLATALYRCHYGADAPAVGANVLNPSPPKQGLKGKQAQ
                     VMILHRDLKPENIFLGSDNSVKLGDFGLSKLMQSHDFASTYVGTPFYMSPEICAAEKY
                     TLHSDIWALGCIMYELCQKSPPFNAKTHIQLVQRIREGKFAPLPEFYSSELKSVIASC
                     LRVNPDQRPDTTALLNLPIVRLMRKERDVIDLNNKVKRREDAAMQKLKDLEAKIASHE
                     KDKVLTRDEIEATVRREWEVKARLEIERQVQMRYDELAKQFDSEVRARVTSELEKQEK
                     HEKQERQEKLDKQERHLKPKVQESQQSHQSSSSSEGYSEESDFPSTTDISDFSFESPR
                     SSRNKPVRKETRTPFCRAKTTVESPVDVQMGEPSPITIASLSLSPRRTAPVSKNLFSE
                     PQQKAKWEPTIITSDDEEDVPDLPSPTRPRVKPDPLKPTRRPLLRHQTAGMVQKMSHQ
                     PSIFPSGTSRLPPPAAAVSTLSTQSETRQVPELRSKSPNRRLSKIPSTSNLIGEAGSP
                     TRKGASRPLNSKNASGGEDMYKAVMQRNLGGRTLVELAQARAGGRAVDDPKRISSDSR
                     VYASGLSFEKSTDSPATWDPATEEMPSPFLSRKVGRSIR"
     gene            complement(<975688..>976551)
                     /locus_tag="TRUGW13939_07106"
                     /db_xref="GeneID:55994599"
     mRNA            complement(<975688..>976551)
                     /locus_tag="TRUGW13939_07106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490248.1"
                     /db_xref="GeneID:55994599"
     CDS             complement(975688..976551)
                     /locus_tag="TRUGW13939_07106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346141.1"
                     /db_xref="GeneID:55994599"
                     /translation="MAKDKERNVNPAQAQRKLEKQKALKKGKAEVAARRNEKLARRNP
                     ERIQRQINDLKAVEESGQPLRPRDKQVLEELERDLRAVQKAREALGDKAPQFARQPHH
                     QHQQGRGGGPVLGKRRRDEQQQQRWPESDGSETDESVRNIPMPRDTPPPIPRQHRRWG
                     DQGDASHRQQPHALPAKPEMAAPTAKTVYESAPVIRDLRQEAVSKFVPAAVRLQQDAI
                     KGRGKLVEPEEMDRLEKAGYVQASSGPGETSQKTEEDIEMALKQFEEETREPQQQQHT
                     VEIEEVSDEDL"
     gene            <978252..>978901
                     /locus_tag="TRUGW13939_07107"
                     /db_xref="GeneID:55994600"
     mRNA            join(<978252..978527,978674..>978901)
                     /locus_tag="TRUGW13939_07107"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490249.1"
                     /db_xref="GeneID:55994600"
     CDS             join(978252..978527,978674..978901)
                     /locus_tag="TRUGW13939_07107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346142.1"
                     /db_xref="GeneID:55994600"
                     /translation="MSVATSIPDTSLGLTSSEIQILRQQQQIALQGGGHAGSVSRGRG
                     SGRNSSSSSRATSAASSQGRLILDPMSLRALSHQLEYLQDQIRHRIDHLEDQMQISIQ
                     NTYDRAGNVIRNADAEIARTRSILASIDELDNELAKIGHIRDIVKSFRARIESLDHRL
                     DHSSRRR"
     gene            <979848..>981067
                     /locus_tag="TRUGW13939_07108"
                     /db_xref="GeneID:55994601"
     mRNA            join(<979848..979856,979916..>981067)
                     /locus_tag="TRUGW13939_07108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490250.1"
                     /db_xref="GeneID:55994601"
     CDS             join(979848..979856,979916..981067)
                     /locus_tag="TRUGW13939_07108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346143.1"
                     /db_xref="GeneID:55994601"
                     /translation="MEDSRLLGCPVEICCSVLEYLPRKDLCSICLVNSHLRNLAEQIL
                     YAKILISSRNWQSRTLTRLLRSLLRRPRLATYVRSLYLHGSAYFMPYDVGKLPQIRVS
                     GPELEEPLAFVASTTVPYRKDWLKQLRNGAIDAFVAALLSQPMRLNFLRIEQAFFLDS
                     YLIGMVFRSMFCEPQYCGLQLDFSRLESVFLGRSYFNLNENNTADVLPMFYLPSVKKL
                     LIDVENPTTFSWPTVQPPSNSSISVLNLLYVRECFLGDLVSVTKGLNSLEWEWMYTPE
                     LEDDKVQTPIIDLKRINKALYHVRETLTDLTIWAQCLYGYPHDWPMWDDYPQLSTRGT
                     LRVMTKLDKLTELTIPITFLLGFTPLLNRRMKDVLPPNIKDLTMTDDLCLFW"
     gene            complement(<981609..>982163)
                     /locus_tag="TRUGW13939_07109"
                     /db_xref="GeneID:55994602"
     mRNA            complement(<981609..>982163)
                     /locus_tag="TRUGW13939_07109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490251.1"
                     /db_xref="GeneID:55994602"
     CDS             complement(981609..982163)
                     /locus_tag="TRUGW13939_07109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346144.1"
                     /db_xref="GeneID:55994602"
                     /translation="MAASKNKKTASGGAQNHIRARLAYLHRASTYLLKREACLTTSES
                     ENATSAQNTAQSQTPCQTSKELEQTQEQATLPPQQACISRHYVSQMRGISLKAQQRLS
                     IETKRTFCKRCDLLLVPGVTSTEEILNASKGRKKPWADVLVIRCSACETEKRIPQNKM
                     RSKKLKDRQQEKKNKETQDQAGVS"
     gene            <982621..>984751
                     /locus_tag="TRUGW13939_07110"
                     /db_xref="GeneID:55994603"
     mRNA            join(<982621..982882,983508..983918,983982..984342,
                     984398..984655,984706..>984751)
                     /locus_tag="TRUGW13939_07110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490252.1"
                     /db_xref="GeneID:55994603"
     CDS             join(982621..982882,983508..983918,983982..984342,
                     984398..984655,984706..984751)
                     /locus_tag="TRUGW13939_07110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346145.1"
                     /db_xref="GeneID:55994603"
                     /translation="MATEEDLIDYSDEELQTTEAANAAAPAAADAANGGAATKKGDLT
                     VSGGRPDKKGSYVGIHSTGFRDFLLKTELLRAITDCGFEHPSEVQQICIPQGLLHSDL
                     LCQAKSGLGKTAVFVLTTLHSLDPVEGEVQALVMCHTRELAYQIKNEYARFSKYLPQV
                     KTAVFYGGTPMQKDIDLLSNKETRPNIVVGTPGRLNALVREKKLSLRNVKAFVLDECD
                     KMLDQIDMRRDVQEIFRNTPSEKQVMMFSATLSQEVRPICKKFMRNPLEVYVDEGTKL
                     TLHGLQQYYIKLSEQEKNRKLSDLLDNLEFNQVIIFVKSTTRANELDKLLRECNFPSI
                     AVHSGVSQEERIKRYKEFKEFNKRICVATDVFGRGIDVERINLAINYDLPGDADSYLH
                     RVGRAGRFGTKGLSISFVSNEDDENVLKEIEKRFEVALPEYPAEGVDASTYMA"
     gene            <987243..>989915
                     /locus_tag="TRUGW13939_07111"
                     /db_xref="GeneID:55994604"
     mRNA            join(<987243..987279,987457..987577,987642..987682,
                     987742..988171,988226..>989915)
                     /locus_tag="TRUGW13939_07111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490253.1"
                     /db_xref="GeneID:55994604"
     CDS             join(987243..987279,987457..987577,987642..987682,
                     987742..988171,988226..989915)
                     /locus_tag="TRUGW13939_07111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346146.1"
                     /db_xref="GeneID:55994604"
                     /translation="MAPSPPRLRILSVGGNAVSAFLSWRLQATNSCDVTLVWKSGFDA
                     VAQYGVSFRSKAFGNERFKPRHVVRSPEEASSRENAYDYVVLCVKALPDVFDLGSVIE
                     SVVTPQHTCILVNTTNTVGVESHLEQRFPTNVVLSLVSNVNLTQTGISDFEHEGSSEM
                     WVGPASKNPSIPVAIQNDMASALAITLTSGQVDCKVSSNIRQEQFERMIGPIAFHPAS
                     VLFDTPNHTQLLEKVGVRQLITDVIDELIKLAESQGCSFPSDFRQKTIEKMTAGPDTQ
                     SVMYQDFLARRPMEVETCLGSPVRLALESDIRVPRIETVYAMLHHINIVNQTKHSHSE
                     SPPPIPSQLPPRTSSVPPTQKPMTNGMRSSRTASGVGMGMPPPHQRRGPPPMNGPMNG
                     SMRPPSHQPGPRLPRDVSFDDNGLEEFSHLVVYDEFPGNDGVSNGNGVHPPDIPNGGP
                     GIPNDVALREREFALRQRELQLREREMHMRRGPPGPRRVAPPPQHAFDEEDEDDYVDP
                     MDFRPPPNVDPEQIDMMSVTSRRTRKAPSASQLRRNPDLGMPVNPRPPSSTSRFFGGP
                     PGGRKNTNSRLMSDMPSLHAALLDDPMMGYSSNRYGNVDRKEMHIDSRANSLSTVSRM
                     GDYGPGPGPYPPSRRTSASPAAFPPGPRGMGRPNTAQEPPYGPPNGMLGPNGMPPPPH
                     NRPSPPNMRAPVPRYPPGHGNTMAAQQVEQNLGVSNSYPVKNSQNVRSLTGSASVSGE
                     SGDSGASAHIDSENSAHSSQISLGHPMPMPVR"
     gene            <990845..>991207
                     /locus_tag="TRUGW13939_07112"
                     /db_xref="GeneID:55994605"
     mRNA            <990845..>991207
                     /locus_tag="TRUGW13939_07112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490254.1"
                     /db_xref="GeneID:55994605"
     CDS             990845..991207
                     /locus_tag="TRUGW13939_07112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346147.1"
                     /db_xref="GeneID:55994605"
                     /translation="MPPQIPGAHRRNESQMLSRGSILPAGSTTTTTSSAAAAMSATKS
                     RQYAHLHSQLAQLNAHLADTENLVRMTAVQAGDMRFLGGYIGGLFMGAAKVLGEEGVK
                     GAAAGKHGDNEAVVKEES"
     gene            complement(<991275..>992203)
                     /locus_tag="TRUGW13939_07113"
                     /db_xref="GeneID:55994606"
     mRNA            complement(join(<991275..991341,991400..991615,
                     991683..991946,992025..>992203))
                     /locus_tag="TRUGW13939_07113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490255.1"
                     /db_xref="GeneID:55994606"
     CDS             complement(join(991275..991341,991400..991615,
                     991683..991946,992025..992203))
                     /locus_tag="TRUGW13939_07113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346148.1"
                     /db_xref="GeneID:55994606"
                     /translation="MPTPRCFIIRHGETEWSLNGRHTGSSDIPLTANGEKRVKATGKA
                     LVGNDRLIAPKRLAHVYVSPRKRAQRTLELLQIGCKERLPWKETRSPEDEEPIRTDAP
                     IDITEAIREWDYGEYEGLTSAEIKVLREKNGQEPWDIWRDGCPGGESPEDVCRRLDAF
                     IAGIRETHHKKSFAGSDSTKVDVLVVAHGHILRAFAMRWVGKPLTETALILEAGGVGT
                     LSYEHHSVNEPAVVLGGGFVVED"
     gene            <993163..>994478
                     /locus_tag="TRUGW13939_07114"
                     /db_xref="GeneID:55994607"
     mRNA            join(<993163..993499,993559..>994478)
                     /locus_tag="TRUGW13939_07114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490256.1"
                     /db_xref="GeneID:55994607"
     CDS             join(993163..993499,993559..994478)
                     /locus_tag="TRUGW13939_07114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346149.1"
                     /db_xref="GeneID:55994607"
                     /translation="MPRTRTKFIWPPPNLVGDHSAEQQQQQQQQQQPQKKQKLESSEQ
                     LPSNPHTRTMRWNNDNSPAPSDAQESTQSSQAEWNPKSNDAPPSFEAVFRAHLQIPLE
                     KVIKNYQNWRRHGSVHDDYCMMCHRPRPAGLVPCYTCRRSFHDECMPPGSLYNDVKQW
                     YCAVCVQRNWHVHPPTMTPPASPPRLSAQLPTESTHNVSTTDIKPAHETTAEDSQALS
                     ILAEISRSMHRDVSHSQPPSHNHNHNHNNNNENTGNTRNSYITTPKPSARPGPLAQPS
                     PSTQSFSMLDSHARKSRFATLSSEVDSALWVLYRELESATSLRQRIAELEAEVVKLRQ
                     DVSIRDNQIILSQRSTQASPVSQAELEQLRTKAANWDACGPELEQLRAKNDALEQSLG
                     DARIECASKDEALNEWKGRLASLIGP"
     gene            <994967..>997057
                     /locus_tag="TRUGW13939_07115"
                     /db_xref="GeneID:55994608"
     mRNA            <994967..>997057
                     /locus_tag="TRUGW13939_07115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490257.1"
                     /db_xref="GeneID:55994608"
     CDS             994967..997057
                     /locus_tag="TRUGW13939_07115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346150.1"
                     /db_xref="GeneID:55994608"
                     /translation="MARKQKPATRDPSKLTGKPLSETVVPSQIYGPENGPPSSSPQNA
                     ENKYTQGWLTSPDLYETDLSFPPVAMERLSNFLLANPNMNASHLFRADILFDSSGELK
                     TPQEKERLLALKSGTLGDENEGSHEEDQSNTKEPTQQQPQQVETRIPAVEIEGLELSK
                     TVVLTLIPRNLNLDKPLDQTCHFYKGTMVSSTSGKTVERFLCIRFPHIDSVEDIPFYH
                     PRIRGFAFMYDFEKEESYEEEHTNPGKGTLSLHILPFPASEGFDPFPARLERTLQALL
                     STQTRLARNTKPMSSASSQSGSADPGKEQVDDSYNPFQDNLIPRHLIQNTYTRLKLTY
                     AQDLCRDWVETTEPSKHVFEDLSITAFLIELWRNMYGVAPKAEQKEGEKDEKKLFPGF
                     VDVACGNGVLVYILLMEGYKGWGFDARQRKTWSIFPDWVRQNLQESLYIPKPFAVARS
                     QGEDGISELTSNGIAYHTGEFPRDTFIISNHADELTVWTPLMAASACPEAPLPFVSIP
                     CCSHSLSGARFRYPPPKKQKSKPTKDDDEEKEEEQPATGDLKALRKAKIAASTAQPSA
                     DLESTAVLNSMYGSLTAKTQSIAAELGYDVDKTLLRIPSTRNMGVVGGIKSAVQKRMN
                     RRNVTEANQDVEELIAEIVRRECAREGGIDAAAKIWIQRAMGLQKGKKSGGGGHIIDH
                     SSNLDSKLHEDSSC"
     gene            complement(<997179..>1001045)
                     /locus_tag="TRUGW13939_07116"
                     /db_xref="GeneID:55994609"
     mRNA            complement(join(<997179..998339,998391..998518,
                     998569..998641,998688..999581,999632..1000543,
                     1000614..>1001045))
                     /locus_tag="TRUGW13939_07116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490258.1"
                     /db_xref="GeneID:55994609"
     CDS             complement(join(997179..998339,998391..998518,
                     998569..998641,998688..999581,999632..1000543,
                     1000614..1001045))
                     /locus_tag="TRUGW13939_07116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346151.1"
                     /db_xref="GeneID:55994609"
                     /translation="MSSSRLSVGPRRRRRVEDDSDEDDRSVRGTTPFSQSSNGSKRPR
                     IEAPDETDNNASQNEEHDEDDADRPTQKVPLTRAGLPDGYSTHGDFQPGAIVRIKLKD
                     FVTYTSAEFFPGPKLNMVIGPNGTGKSTLVCAICLGLGWGPQHLGRAKDASEFVKHGC
                     KEAVIEIELARGPPFESNPIIRRTIKHDGNKTSFTINGKDANKNQVQRVARTFSIQVD
                     NLCQFLPQDKVSEFAALSPVELLHSTQRAAAGPQMIEWHDSLKTLRAEQKKLLLDNKG
                     DRDHLTNLENRQELQRADVERMRERAQIKRRIEIMKLSRPYVVYTDYLVTFSEIKEHR
                     ARLERELQELKDELAPALRAVNEKQDYYGKTDDMVKYKRQKFNRAESTTTEIANRIEA
                     HEDAIKDLAAQIEAEKKTGSSHQQNLFKVQQSINRITRQMEEEPEDFDIDYYNERIRS
                     LTREMRDLEAKGEDLRNGRRPIFGKLQERKNRKQQAENELENLDSQSGQQEARLKKLS
                     SDTHKAYQWIRDNQDQFEAEVFGPALVTCSIKDPKYADALETLLQRNDHLAFTTQSTK
                     DFRTLQKALNGELRLHDVSIRNCTTRLNDLKSPLSDNELHDLGFDGWAKDYLTGPEPV
                     IAMLCNEQFLHRTPIVLRDISDQEYARMEKNTAINSWVSGKRSYKVNRRREYGPGATS
                     TQVKTVRPARIWTDQPVDVSLKQELLDVISSCNDEINEIQQEINAQRAKAELLKEEFK
                     AKEKEKVGLEQEKSNKQTALVKFRALPEMLNQEQEKKRDAQENFEQVRTRVLEIRSKQ
                     DQTAIEKAETAVAYADAVESLRKLHQDLLLAEIRNIEAFSDFGNVKARNVEIQNILES
                     KKEEVKKASEAQRESAKTGLAYQRQATEAIELAKTQPDLKELLDSHHAHVMTVDQLDA
                     DIDSEKAHLELTHEGSAGLIKEFEDRQKAIDKLQNKLSAYQTKLADIEYAIAEIRDEW
                     EPRLDALVEKISSAFSDSFARIGCAGQVTVDKVEEEPGPNGEKGRSDFDQWSIQIQVK
                     FREHENLSILDSHRQSGGERAVSTIFYLMALQSLSASPFRVVDEINQGMDPRNERMVH
                     ERMVDIACAPRKPAEGSADGVGGTGGSQYFLITPKLLSGLVYKPGMKVLCIVSGEHVP
                     SDYTTIDFGRAVQNMSRISGIPVRSAVNGITNDKGKGRAMDNTRVRSRVGVRA"
     gene            complement(<1002613..>1006117)
                     /locus_tag="TRUGW13939_07117"
                     /db_xref="GeneID:55994610"
     mRNA            complement(join(<1002613..1005681,1005749..>1006117))
                     /locus_tag="TRUGW13939_07117"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490259.1"
                     /db_xref="GeneID:55994610"
     CDS             complement(join(1002613..1005681,1005749..1006117))
                     /locus_tag="TRUGW13939_07117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346152.1"
                     /db_xref="GeneID:55994610"
                     /translation="MTERSMIQDSSHDSRQTPSATDDENPSDHSKPISRAAAIGATLL
                     PKSIASVVSFIAQSTSLSLRVGTYFGGAAIGGARVTTLTGLELSRALVEAVLTRAGRD
                     VAGRSNGELGRLEAESVLERSLEALHSTVTSASFFAAAGFHLSEVTLSSLSNLTQNLL
                     YTLDAILGSTESSRAIAAIITLIHREFSKNEGGDDNDLVGVGDLLVGSIGFALLQRWG
                     RLNTERQLRESEGEVTIWDVVILDNGLRADVIGTQTQEYAESTTNGLSSRPTSFLSPG
                     RNEEPFEALEHVGSRPNTPGQRWNFSPEEQPQLSDEDIRLYIMKQLPKGSRASVRTDL
                     VTARTVTVDVYDDDTAEIAAPPGTTMVEERFHNEQVSVGARRLPKHTIVFRTAFNESQ
                     SADLHPEDLHCPPTSPILSNKHKNNRNVSHQSKTASNPRNGTEKTKFAKNDPAHKTPQ
                     LSDSTETITDKGEKRPRRVTSSSSLSGSETPRNSFGKASLSKFAQKVKAAPTEKPGVS
                     SAKGLIKKAPKKSSGSNTPVLPEAINKPKTETLAGASMASRARIPKAKENNRPQAPTL
                     ASVNKTLPRVPPKDYSRYSSTPSPITTKASQHLRSSSRTDFFSVNNRTDADSYSICSV
                     DSRPGSASVTRTHFRSSSSLSRTRQEDINRALNRDSSPSHRRSHSFVPSIYSMANGSE
                     TSLILAPRPRKSIYEDESTIVGLNRNGLVPGIFPQNHLVNNVRRFCRFSSASYGSNAL
                     KVMGIPHNQKMIQHHDSDNHEHSSFSNMTGLPPSTILLSSYVDPDGGSNSIGETQSGF
                     PLVHYLSLDHESKAVVLTLRGTWGFEDILTDMTCDYDDLEWQGRSWKVHKGMHASASR
                     LLEGGGGRVMVTIKAALEEFPDYGVIFCGHSLGGGVAAILATMVSQPSNQTQGPSFVT
                     ASALQAAGPLLLTADHQQQADRVFSLPPNRPIHVYAFGPPACMSPFLRRATRGLITTV
                     INGKDIVPSLSLGTLHDFRAVALSFKNDTTGSKSHIRSRLLDGLRQSIVNKFYVNQPP
                     IPMNAGEGLGEDSWAWSALQSLREEMTAPKLIPPGEVFVVDTMRVLQRNPFTTAATTH
                     DSHPQLGRPATRAQLKFIRNVESYFSELRFTSGMLSDHNPARYEASLAALAQGVIDD"
     gene            complement(<1006667..>1008112)
                     /locus_tag="TRUGW13939_07118"
                     /db_xref="GeneID:55994611"
     mRNA            complement(join(<1006667..1007004,1007066..1007376,
                     1007442..1007767,1007828..1007849,1007904..>1008112))
                     /locus_tag="TRUGW13939_07118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490260.1"
                     /db_xref="GeneID:55994611"
     CDS             complement(join(1006667..1007004,1007066..1007376,
                     1007442..1007767,1007828..1007849,1007904..1008112))
                     /locus_tag="TRUGW13939_07118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346153.1"
                     /db_xref="GeneID:55994611"
                     /translation="MSDNYGQYQQTIYANSMYGSSRPVVTTDPRKLEEQARQMMDARA
                     FNYIAGGAGEKSTMDSNRLAFRQWKLIPKMLRISEVDTSVELFGQKYPHPLLMAPIGV
                     QSLAHADKETGLAEACSEVDVPYILSTASGSSFESVATSSGSGKRWYQLYWPRDNDIT
                     LSLLKRAKENGFEALVVTLDTWSLAWRPADLDNGYLPFLAGVGTEFGLTDPVFRAKFE
                     KETGTKAEENIAESSREWVQSIFGTNHTWEDVAFLRKNWDGPLILKGIQHVEDARNAL
                     KYGCDGIVVSNHGGRQLDGAIGSLEVLPEIVDAVGKDLTVLFDSGIRTGSDIIKALAL
                     GAKAVFVGRPAIYGYAINGKEGAKAVFQGLLADFHLSMLIAGIASIGECRRDAIRRIQ
                     YGGDLKALL"
     gene            <1008487..>1010138
                     /locus_tag="TRUGW13939_07119"
                     /db_xref="GeneID:55994612"
     mRNA            join(<1008487..1008819,1008890..1009698,1009754..>1010138)
                     /locus_tag="TRUGW13939_07119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490261.1"
                     /db_xref="GeneID:55994612"
     CDS             join(1008487..1008819,1008890..1009698,1009754..1010138)
                     /locus_tag="TRUGW13939_07119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346154.1"
                     /db_xref="GeneID:55994612"
                     /translation="MQSLSFVLGGLSLLAVLIQIFFNSQAGVPVLALFTNTVCSSTPL
                     ASNSPHSPGWSTWFHPERLGSTLSPWRFQERSILHHLGGNGPWIQKVTPGSPENSPPK
                     HCSVEQVHLLSRHSERYPTQTAGQRHLELVDRLKELDVPLNGSLAFVNNWTYFTQDPQ
                     QDFDQLTSTGPYAGTLASFTTGTRFRTRYGHLLPQNRKTRIWASDSQRVIDTARYFAA
                     GVFGIDWGKDGKAEVQIIPETLDQHTDTLTPGDTCVQFIEDTVLGHDYGKNMLAAFQN
                     AYIPRITERLLYEEENTALESFSNLEVYSMQEMCGFETIVRGSSPWCEAFTSKDWDHF
                     EYARDILHYYRAGPGNKYAAVMGWLWLHATGQLLKAGPKNGTMFFSFVHDGDIAPVLT
                     ALDLFHDSKYDPNLPVTHIAKDRKWRVSTVLPMGGRLTFERLQCTSNSLEEAFVRINI
                     NDGVVPLPDCDSGPGKSCPLDKFIKRIHERKVQIGEFVDVCGTSGVDTGITFLTQPDN
                     "
     gene            complement(<1010363..>1011466)
                     /locus_tag="TRUGW13939_07120"
                     /db_xref="GeneID:55994613"
     mRNA            complement(<1010363..>1011466)
                     /locus_tag="TRUGW13939_07120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490262.1"
                     /db_xref="GeneID:55994613"
     CDS             complement(1010363..1011466)
                     /locus_tag="TRUGW13939_07120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346155.1"
                     /db_xref="GeneID:55994613"
                     /translation="MMGNQNCHAEITFQDNIKWLARFRLIRTSSPPHEVRDCILRSEA
                     ATLMYLQRHTRIPVPKIFHWACESDPKNELGVGYILMEKLDGKPLEWQAITSTQKKKI
                     MQQLVNIFLEIEKNPFDAMGSLVYSVENTRDFHIKGLAQSPTFQVANKSPIGPFSSSL
                     EGTRAILKSYLAMIASGEIVAYDPVDIYLVHRLRLEIVDSLWKDIPSSNGRFFLKHPD
                     DKGDHILVNDTFDIVGIIDWEWTYTVSKAEAFCSPCMMWPVEEFYDGNNALDQDELRL
                     ADIFRERGREDLAQCVTQGRKVQRFFFGLGTETSFLDKSTFTSLFKGLQQAFSLEEED
                     WEQWKDSALGKWEDDEFLQALLNLEKKIRGAKK"
     gene            <1012373..>1013781
                     /locus_tag="TRUGW13939_07121"
                     /db_xref="GeneID:55994614"
     mRNA            join(<1012373..1012505,1012572..1012885,1012968..1013115,
                     1013180..>1013781)
                     /locus_tag="TRUGW13939_07121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490263.1"
                     /db_xref="GeneID:55994614"
     CDS             join(1012373..1012505,1012572..1012885,1012968..1013115,
                     1013180..1013781)
                     /locus_tag="TRUGW13939_07121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346156.1"
                     /db_xref="GeneID:55994614"
                     /translation="MALVLQAYTFAQQYVNSCLHPTPTKSPMALRLGVISSAQINAAA
                     VIHPVETHPDVILYSIASRDVQVAQQAAKKYNFRKAVGSYQELLDDPDVDIVYISTPN
                     GLHYEWSAKALRAGKHVLCEKPFTSNAEEARKLVGLAKEKNLICEEAFHWQFHPAAHL
                     FRQILESGQYGRILRTDAIMTASPGVPDGDIRWQFELAGGSMMDMTYALSFTRYALRD
                     AKLKDIQTATARPYKQDKRVDEAMHSLLLFEDSRDSHLIQSRVYTDMSRKWIINKIVP
                     RMWELPSIEVETDKAIIYFYNAMMPHLYHYIAISDKMTGKTEYKKQYDGGPCWGEAWT
                     TGGKGGKSYWSTYRYQLEAFTHKVRGKDVPYWIPGEESIAQMEVIDAIYQAAGLPVRP
                     SISTKA"
     gene            <1014729..>1016043
                     /locus_tag="TRUGW13939_07122"
                     /db_xref="GeneID:55994615"
     mRNA            join(<1014729..1014811,1014879..>1016043)
                     /locus_tag="TRUGW13939_07122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490264.1"
                     /db_xref="GeneID:55994615"
     CDS             join(1014729..1014811,1014879..1016043)
                     /locus_tag="TRUGW13939_07122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346157.1"
                     /db_xref="GeneID:55994615"
                     /translation="MEYHFVPQEERARDDKGNLLPWGYVYQDETRNPRRPPEESGPFG
                     RRRNARYDHARSRTRTGTPAKKENPNVAEFGRLFAQQQEEDKAAHTNLPKSSSSSNLE
                     GSRKPVEKVATECILYGYKNKETEWKVIDKYERISQGFVCEDYPRSDPSVSNKFSQLL
                     SGGDVVIRSNLSADANRKSKRYAGGLHWIKVTFDSTTAADRACFYSPQDVDGHLVFCE
                     LYHGQGPAEDIPMPKESSEATRTRSKARHTHTLTSSHSAAFLQGRELERSTLPRSFAM
                     NNLSAVSDIDEGDSQLSTATASSATATAVEQPPAIRQRAVPETTTEPKPESEFMTHIP
                     TVRRAVLRPVNEALPPQPTLTERVLRSIPILSWFTGDIVGDGPQFGDDGVFDYTKSNF
                     YWRFWYMIDQVLGTDICGLKEDS"
     gene            <1017146..>1018042
                     /locus_tag="TRUGW13939_07123"
                     /db_xref="GeneID:55994616"
     mRNA            join(<1017146..1017191,1017534..1017704,1017798..>1018042)
                     /locus_tag="TRUGW13939_07123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490265.1"
                     /db_xref="GeneID:55994616"
     CDS             join(1017146..1017191,1017534..1017704,1017798..1018042)
                     /locus_tag="TRUGW13939_07123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346158.1"
                     /db_xref="GeneID:55994616"
                     /translation="MDQAKLAKLQQSVRIGKGTPRRKTKRVHKTSTTDDKKLQATLKK
                     MNVQPIQAIEEVNMFKEDGNVIHFSNPKVHAAVPSNTFAIYGNGEEKELTELVPGILN
                     QLGPDSLASLRKLAESYQSLQKKEGEGKKDDEDEDDIPDLVEGENFEGTVE"
     gene            complement(<1018517..>1019720)
                     /locus_tag="TRUGW13939_07124"
                     /db_xref="GeneID:55994617"
     mRNA            complement(join(<1018517..1019409,1019486..>1019720))
                     /locus_tag="TRUGW13939_07124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490266.1"
                     /db_xref="GeneID:55994617"
     CDS             complement(join(1018517..1019409,1019486..1019720))
                     /locus_tag="TRUGW13939_07124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346159.1"
                     /db_xref="GeneID:55994617"
                     /translation="MTSSQTTTPDQSRQARSTLADDLHAIYRFFVSGLDSPTELWTSS
                     APSLSELTFGLVGYSFSPERDIGDLSGKVILVTGGNAGLGKETVLQLARHNPARIYLA
                     ARTESKALDAIKSIQDELSESSSLPSTVDIQYIPLDLASLSSIKEAAEHFNRNNSRLD
                     ILVLNAGVMAEPAATTPDGYEIQFGTNHVGHFLLTKLLLPTLLKTTKNQPDADVRVVS
                     VSSAANFIAPANHNLYEAMTSTEKLLELTTWQRYGISKAANILFASELARRYPAIKSV
                     ALHPGIVSTQLYDGTRETNQTAKYGLSVAMRLAFRSTQSGALNQLWAAAGARKDELVN
                     GGYYTPIGLRLDHNRFSEDKELAKNLWDWTDNDISKKLGAL"
     gene            complement(<1020267..>1021373)
                     /locus_tag="TRUGW13939_07125"
                     /db_xref="GeneID:55994618"
     mRNA            complement(join(<1020267..1020963,1021063..>1021373))
                     /locus_tag="TRUGW13939_07125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490267.1"
                     /db_xref="GeneID:55994618"
     CDS             complement(join(1020267..1020963,1021063..1021373))
                     /locus_tag="TRUGW13939_07125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346160.1"
                     /db_xref="GeneID:55994618"
                     /translation="MGTGDVTATAVAPLTTKFTPASSCLLDLYLEVTANAGGQSIPGG
                     YSWIHLGPTTSKAACVPSGWAPETYYSPGICPADYTLGCDASTHTIGESSTEYRATCC
                     PTGYACRDSYDASLYPWATIDPCTIRDLTTTTALVTYTANTAAPATLALGVTNYYQAL
                     GVSIRWQKSDSLPVQTGPPTGTTTTTAAATTSTATTTTTSHSSSTTSTTSHTTSTTEP
                     SSLAGPPVSAETHSSLPVSDSSSSSGLSTGAKAGVGVGVAIAGVLIIFAAVFFFYIRP
                     RRNKNMSQNAWNGEKKTELDALPIHPSSHELASRTVNELEGNSRHIAHEMDAPSNGWR
                     K"
     gene            <1022761..>1023784
                     /locus_tag="TRUGW13939_07126"
                     /db_xref="GeneID:55994619"
     mRNA            join(<1022761..1022899,1022958..>1023784)
                     /locus_tag="TRUGW13939_07126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490268.1"
                     /db_xref="GeneID:55994619"
     CDS             join(1022761..1022899,1022958..1023784)
                     /locus_tag="TRUGW13939_07126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346161.1"
                     /db_xref="GeneID:55994619"
                     /translation="MAPIYPLFPVRESGHLQVSSIHSIYYEDCGILTGVPVLYLHGGP
                     GEGIVDSDRQYFDPAHYRSVLFDQRGCGKSLPAASLEDNTTWTLVADIEALREHLKIE
                     KWIVCGGSWGSTLALAYSQKHTGRCMGLILRGVFTMRREELEWFFQKGADMLFPDYFE
                     PLKACIPEAERGDMIAAYYKRLTGDNEEEKLKCAGAWSNWECSTVKLIVDQETIENAA
                     DPKWALASARIESHFFANAGWMRDGQLIEEAYKIKNLPIFIVQGRYDVVCPAKTSWDL
                     YQALGGEQNPNVEYLVIPDCGHSAHESKIEEALVDAAEKFKALNM"
     gene            <1024639..>1026105
                     /locus_tag="TRUGW13939_07127"
                     /db_xref="GeneID:55994620"
     mRNA            join(<1024639..1024833,1024915..1025113,1025211..1025309,
                     1025379..1025708,1025793..1025891,1025962..1025985,
                     1026053..>1026105)
                     /locus_tag="TRUGW13939_07127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490269.1"
                     /db_xref="GeneID:55994620"
     CDS             join(1024639..1024833,1024915..1025113,1025211..1025309,
                     1025379..1025708,1025793..1025891,1025962..1025985,
                     1026053..1026105)
                     /locus_tag="TRUGW13939_07127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346162.1"
                     /db_xref="GeneID:55994620"
                     /translation="MFSRAGRIFSTHPGLFFFNFLEIALIAWWLARGSLSTEDWFVDN
                     ECQNPEWQDTVWDGYDDAVKAAEVAYDYIMEIRTSVQYSRARHQLSPRQKRTLNIFET
                     IYGKTLFDRRDPDYRQAGAQAYRRFDKILASLNDDNPQAIAHYHMFCDDDMFVPFLVD
                     PQGQDWVLDTRPVRDGGGTVVNIHGTCDNDGTANVLSYSWKAPYGRHYQTAYCPDWVE
                     HWERYGALSAYRDSRGRSVPVLRGTIHITQIALSFMTPSVLHELTHSQDILGNDVLGD
                     QDCMGRGVGGYGWPCITFLAQNHPDLAAKNADNFAYLVTALYLDYADWRDGLGLRD"
     gene            complement(<1026448..>1028949)
                     /locus_tag="TRUGW13939_07128"
                     /db_xref="GeneID:55994621"
     mRNA            complement(join(<1026448..1026550,1026621..1027009,
                     1027068..1027121,1027190..1027280,1027328..1027339,
                     1027413..1027495,1027915..>1028949))
                     /locus_tag="TRUGW13939_07128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490270.1"
                     /db_xref="GeneID:55994621"
     CDS             complement(join(1026448..1026550,1026621..1027009,
                     1027068..1027121,1027190..1027280,1027328..1027339,
                     1027413..1027495,1027915..1028949))
                     /locus_tag="TRUGW13939_07128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346163.1"
                     /db_xref="GeneID:55994621"
                     /translation="MAQLAKNLLRSYPWATTPFIVSAPMRVMAGPALALATSRAGGLG
                     FLGPTVKTSDMVADLEKVSATLKSSATSSNSPSGFNDISSKTASLPIGVGFQLWSDDL
                     EAAASAIHKFKPCAAWLFAPREGQRDIEEWSRRIRSASPGTQIWVQIGTITEAKLLAQ
                     SSEQPDVIVVQGSEAGGHGRAKDGLGLMALFPEVADVLADTHIPLFAAGGIADGRGAA
                     AALCLGASGIVMGTRFLASTEARISKGYQDEIVRASNGAITTTRTLLYNHLRGTTGWP
                     EPYSPRTIINRSFIEHQAGRSFDELKELHDQATKTGDNGWGPEGRLATYAGASIGLIH
                     EVKDAASIVHDMSGRAPFIVPALKKHTATVIMAHGLGDSGAGWVGLAQNWRRRNKFDE
                     ISFIFPNAPSIPITVNMGMSMPGWYDIAHLGRDMGFEELQQNQDERGILKSRDYFNTL
                     IKEEIDKGIDPSRIVLGGFSQGGAISLFTGVTNTRKLGGVFGMSSYLLLAERLKEFCP
                     EGELPNQKTPFFLAHGMVDDVVKFEFGDMTQKHLKSLGFDVEFHSYPDLPHSAEPAEI
                     EDLENFISKVLPPQSEAGAAGL"
     gene            complement(<1029908..>1033938)
                     /locus_tag="TRUGW13939_07129"
                     /db_xref="GeneID:55994622"
     mRNA            complement(join(<1029908..1030043,1030120..1031106,
                     1031164..1031433,1032310..1032714,1032783..1032945,
                     1033003..1033267,1033324..>1033938))
                     /locus_tag="TRUGW13939_07129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490271.1"
                     /db_xref="GeneID:55994622"
     CDS             complement(join(1029908..1030043,1030120..1031106,
                     1031164..1031433,1032310..1032714,1032783..1032945,
                     1033003..1033267,1033324..1033938))
                     /locus_tag="TRUGW13939_07129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346164.1"
                     /db_xref="GeneID:55994622"
                     /translation="MSASFLGEAAVKEKDARDYGTPVESINDTSDIEGRITSGFEENG
                     QFIQGLHQRHIQMIALAGTLGTGLFLSIGQALARSGPLGTWLAYSIIGATLFSVVLAV
                     GEMGALVPLNGGIVRYSEKFVDPALAFANGWNEIYAHIVGIPGEITAAAVLVEFWIQI
                     NNGIWITVFGVVMLCSALVFVRVYGELEFSFALMKIALVIGLNIMSLVVTCGGGPNHK
                     SIGFQYWRNPGPFVQYLAIPGSLGRFLGFWQSANSALYAYSGLENFTIAAGELKSPRH
                     SIPQAAKRVFWKIVMFYVVTIFMVGLLVPSNDPSLLNSTGNASESPFVIAARRAGIKA
                     VPSIINAVVLTSAWSAGNSSLLGGSRILYGMAREGHAPSFFTRVNRFGVPYLAVSLYG
                     LFMCLGYMTLSRTAAEVFSWLQHLVSIATLVNWMAICVVYLRFFYGCKKQGISRKELP
                     WAAPFQPYITWISLTLFIILLLTGGFTTFIHGHRHSTQIPQVAASSDKDSEALQFTQT
                     QTNHLQQTAMETNASYSIKGVYENPLSMGRGRAIPSPFPSSDDYIVDFDGPDDPDHPY
                     NWKFSVKLYLSVIACFGTFVSSFTSAMFAPGISGVAREFSVSSEVGTLGTTLYVLGFA
                     SGPLIWAPASELIGRRWPLTVGKLGGAIFTIASAVGKDIQTVIICRFFAGLFGASQLS
                     VVPALLSDIYDNSERGIAIAIYSLTVFVGPFSAPFIGGFIASSPLGWRWTLYIPAFMA
                     FACGIAFAIFLKETYSPCLLSSKAAMIRKQTLNWAIHAKHDEMEIDFRELFHKNFLRP
                     LRMLITEPIILLISLYMSFIYGLVYALLEAYPYVFETTYGMSPSIGGLTFIGLIIGQL
                     LACAFILSQHSTYMKNLVANKNVSVPEWRLSPAIIGAPVFTAGIFWFGWTGFTDSIHW
                     MAPTAAGVSIGFGILCIFLPCFNYLVDSYLPL"
     gene            <1034670..>1036357
                     /locus_tag="TRUGW13939_07130"
                     /db_xref="GeneID:55994623"
     mRNA            join(<1034670..1034801,1034872..1034913,1034989..1035391,
                     1035465..1035676,1035732..1035979,1036050..1036268,
                     1036324..>1036357)
                     /locus_tag="TRUGW13939_07130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490272.1"
                     /db_xref="GeneID:55994623"
     CDS             join(1034670..1034801,1034872..1034913,1034989..1035391,
                     1035465..1035676,1035732..1035979,1036050..1036268,
                     1036324..1036357)
                     /locus_tag="TRUGW13939_07130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346165.1"
                     /db_xref="GeneID:55994623"
                     /translation="MLSQRGLKSAASQDIPWRFAPGGNNRYDMVSNPRGVVPFGTAEN
                     ALVQDELATYVAEKVEIPPDAFLYRFSTMGGPRFPIAMASHMNKYFQPFHPVKPEQII
                     TASGLTAIHELMACSLGDPGDGMLVSRPVYGRFELDFGNTANLKIVYADMEGVDPFGA
                     EVVPKYQSALETALKENVKVKALLIVNPHNPLGRCYPPLALRELMVFCQKNSIHLISD
                     EVYALSVYGTGYDAEKSINFSSVLSIDCKGLIDPERLHVFYGMSKDFGAAGLRLGCLV
                     TQNVPLRKAIACNIRFHNPSGMSIAIATQLLEDRDFVKYFVKTSHERLRAARKYTTQV
                     LDHAGIRYHRGSNAGFFLYIDLSPWLIESCDDQHAGENDAEYALAQKLLDGGVGLHPC
                     EEHGEFKGHFRVVFSHPKEVLEEGLKRLVHVLNDQSS"
     gene            complement(<1038868..>1039626)
                     /locus_tag="TRUGW13939_07131"
                     /db_xref="GeneID:55994624"
     mRNA            complement(join(<1038868..1039143,1039210..>1039626))
                     /locus_tag="TRUGW13939_07131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490273.1"
                     /db_xref="GeneID:55994624"
     CDS             complement(join(1038868..1039143,1039210..1039626))
                     /locus_tag="TRUGW13939_07131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346166.1"
                     /db_xref="GeneID:55994624"
                     /translation="MRTAFILSPLLPIAAAHFTLDWPAARGFDEDKMPTFPCGGFNTP
                     SSNRTSIALDANVLPVDITFHHSQTAVSYLLALGSNPGDNFNITLEPTLGAHGLGEFC
                     LPSIPLDSKTLGVSLHDGQNATLQVVTDGDNGGGLFACADIVFSSSVTTNTPTSCKNN
                     TGVEATPFSGSAATRIANESDANGAAQSGSGTATSSGTSPTSTSQGAGVPLQTASWGI
                     LGAAVLGGVAML"
     gene            complement(<1040244..>1040829)
                     /locus_tag="TRUGW13939_07132"
                     /db_xref="GeneID:55994625"
     mRNA            complement(join(<1040244..1040352,1040417..>1040829))
                     /locus_tag="TRUGW13939_07132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490274.1"
                     /db_xref="GeneID:55994625"
     CDS             complement(join(1040244..1040352,1040417..1040829))
                     /locus_tag="TRUGW13939_07132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346167.1"
                     /db_xref="GeneID:55994625"
                     /translation="MDTGSGMLSVFSNSQGTSLYSSSWTPTTSGQYAGTCIFLIILAI
                     ISRLLAAFKVAMERKWLAIALNRRYVVVAGKKQEADSSNSDPDSVNTALLTTQGAQEN
                     VKVVRRVSHGPQPWRFSVDLPRALLFLCIIGVNYLLMLAVMTMNIGYFLSTLAGAFIG
                     ELAVGRHIEWGEH"
     gene            <1041204..>1043350
                     /locus_tag="TRUGW13939_07133"
                     /db_xref="GeneID:55994626"
     mRNA            join(<1041204..1041361,1041415..>1043350)
                     /locus_tag="TRUGW13939_07133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490275.1"
                     /db_xref="GeneID:55994626"
     CDS             join(1041204..1041361,1041415..1043350)
                     /locus_tag="TRUGW13939_07133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346168.1"
                     /db_xref="GeneID:55994626"
                     /translation="MDDMSGMDMGSTASGNGIPSLSEFQKYYWAIVGTVIGVGAVANL
                     LNRFLASQRLCDKSNTPAKPKSIIFETYATVTAAAREAANVTLRPIAFGSYTLHLPPL
                     GPVSLVLANLVTIVVMMFYGFDTMDNYSWENIGYRAGFMTICQLPLVILLAGKQNIIG
                     LLTGTSYERLNWYHRWISRTLWLSATIHMGFWFRDYGQYDYIVTMLKTDSLTRHGFAA
                     WCVLTFIFLSSFAPLRKWNYEFFVFQHIVTMAGFLAAVYLHAPDEVKVWVWIPVGLVF
                     LDRFSRILVLAFANLSIVHFSAQKKRPFFANKATFTPLPGNITHISIPDPVINWKPGQ
                     HVFFGCHSIAPFQSHPFTIMSLPSDKKLDFLVRAERGGTHRIFQVASKYHALFGETQT
                     PPKNQRTVFIEGPYGYVRPLRQFDTVVLFAGGMGCTFTLPLMRDIVQAWKTEYGDPLA
                     IGSKHRIIPQKRLTATKRIRFVWVIKSRSQFSWLESWIRSILEDIQRCRQLCPEFDKE
                     IELSVYLTCDETLEKSTSVRSPEAWTLEGEDTKNVSFKKDQVLIQSTPTTPPNSTDTA
                     ERKACGSNSTCCCITTVENEETSSPPICNCSGPAAISLADADNSSGGSKSPLSISLTD
                     SENFRMISGRPHPRTLIRNALERAEGESAVVVCGPNGLAVDVRQSVVSLSDERAVHKG
                     TGAQGIYLHVEHFGW"
     gene            <1043638..>1043886
                     /locus_tag="TRUGW13939_07134"
                     /db_xref="GeneID:55994627"
     mRNA            <1043638..>1043886
                     /locus_tag="TRUGW13939_07134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490276.1"
                     /db_xref="GeneID:55994627"
     CDS             1043638..1043886
                     /locus_tag="TRUGW13939_07134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346169.1"
                     /db_xref="GeneID:55994627"
                     /translation="MWNSKFDPIERPYTAPEFPQGWGDADVLRLTNPDVDIADNINFA
                     GQSVDAHGRIVGEKGYGKVEGGKVLIGAGEVALVKLQT"
     gene            <1044172..>1044733
                     /locus_tag="TRUGW13939_07135"
                     /db_xref="GeneID:55994628"
     mRNA            join(<1044172..1044183,1044249..1044587,1044644..>1044733)
                     /locus_tag="TRUGW13939_07135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490277.1"
                     /db_xref="GeneID:55994628"
     CDS             join(1044172..1044183,1044249..1044587,1044644..1044733)
                     /locus_tag="TRUGW13939_07135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346170.1"
                     /db_xref="GeneID:55994628"
                     /translation="MFRLHKTLDVITLFHKPSQASSTRVLNILRTASANATETATIDQ
                     ASDHSAAHTASPRGEFELEVTEEPPTNDQLSTILDYLQTKGVKPSAVIQGASTKQDAL
                     KKLKEVGDQGFIRPVVVDWSNGRAAVGENESEILKLVREGEASS"
     gene            complement(<1045222..>1048792)
                     /locus_tag="TRUGW13939_07136"
                     /db_xref="GeneID:55994629"
     mRNA            complement(join(<1045222..1045303,1045353..1046667,
                     1046743..1047476,1047525..1047532,1048323..1048554,
                     1048629..>1048792))
                     /locus_tag="TRUGW13939_07136"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490278.1"
                     /db_xref="GeneID:55994629"
     CDS             complement(join(1045222..1045303,1045353..1046667,
                     1046743..1047476,1047525..1047532,1048323..1048554,
                     1048629..1048792))
                     /locus_tag="TRUGW13939_07136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346171.1"
                     /db_xref="GeneID:55994629"
                     /translation="MGSFLSKVTEKKSPSVKESKMATPIAMNYFEKAQSTFKPPLIAN
                     DNAFLGDIATSEKNDAEKPVSCGLYRLEKGTPLVYEYTYHEMKIILEGEFEISDETGQ
                     KVTAKPGDVFYFPKGSKITFSTPSYGLAFYFHLAESSSSSGDSGRHPPRHRLASSFNR
                     DITQTYTTAPYYVLIISTPDFRTMAARDPAARPSPLQLPNPPPLLHTRASHENYDRPT
                     TPTHSQNDFMSPVQTPTGSPSKNRMPPGALTLPGVFEKAMKLAPSSPTKSAFGAPGSP
                     GKGLSVIDGFNGSVVHNDVHQAPGSPTRRSNKENAPPNFPRLGKDLGLNANSSAATSR
                     LQPYQQREAETARKPQVQPTQGLTPAEIQKLQSPKVKRLANVTQLYFLDHYFDTLSYV
                     HNRQNRYNQFKAAYPAPPETDIEVYEPALQKYLGRERANLRRRRTRLRQGDFQILTQV
                     GQGGYGQVYLAQKKDTREVCALKIMNKKLLFKLDEIRHILTERDILTAAKSEWLVKLL
                     YAFQDDNQIYLAMEYVPGGDFRTLLNNTGVLHNRHARFYIAEMFSCVDALHSLGYIHR
                     DLKPENFLIDGTGHVKLTDFGLAAGMLNPGKIESMRIKLEEVGNTPVPFGRPMEQRTA
                     AERREGYRSLRERDVNYANSIVGSPDYMAPEVLKSEDYDFTVDYWSLGCMLFEALAGY
                     PPFAGSTTDETWQNLKRWQKVLRKPQYEDPNYFLSRRTWDLITRLVASKETRLRSIQQ
                     VHSHEYFAEVDFNKLRDRPAPFVPELDSETDAGYFDDFTNEADMAKYKEVQDKHKALE
                     EMEEREEKMSKGLFVGFTFRHRKPAVEDGRGGRKSILTDGTFGTIF"
     gene            complement(<1051288..>1053295)
                     /locus_tag="TRUGW13939_07137"
                     /db_xref="GeneID:55994630"
     mRNA            complement(join(<1051288..1051301,1051364..1053205,
                     1053262..>1053295))
                     /locus_tag="TRUGW13939_07137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490279.1"
                     /db_xref="GeneID:55994630"
     CDS             complement(join(1051288..1051301,1051364..1053205,
                     1053262..1053295))
                     /locus_tag="TRUGW13939_07137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346172.1"
                     /db_xref="GeneID:55994630"
                     /translation="MAPAKVVPKKKASPPPDSTLQESASPPPRKAARRTSAPTLPVNI
                     PPGQGWQFSPTRDTFPEEISFQNTPINTNNTPIMNHTPSISFCEDLLDTFGVPIIPET
                     TEMEVSGFMLSDSDFTPLSHSLPLELEHPGMTLAGEEPSFSSILEDGNNEIEDIVRQS
                     ETDLQLWPVQDPPLFSTTMGSATNLPIMTKLLQQPKQLPGSEEGLIIRFDRLTCGILS
                     VKDGLTENPWRTYIWPMAKESPALCHAVFAMAAFHSSNENSSMRVFGMDHMRKSINYM
                     VQGMVQMQTDAALATTLSLAFAESWDQQTSTGILHLKGAKALMRQTLRNRLRRHTPAD
                     ERARLRFLYNTWLYMDVIARLTSVDEGDKEELGGVPFSLPTNGIHDVDPLMGCATTLF
                     PLIGQVANLIQRVRKSEKNSFVIISQARELKNAIDQWDLPTHFNPPDDPHSELQDSIQ
                     TAYAYRWAVLLYLHQAVPEIPSPSSAELADNTLKFLATVPLTSRTNIVHIFPLFAASC
                     EFENEEDRGWIMDRWQMMQNRLKIGNIDRCVDVIREVWRRRDLARAERGRTRSLDRGE
                     PIAVSRPGAQNGLCLEDIPATLMGTRVVSTFSTVEELNFEQTVRGRHHWVGVMKDWDW
                     EVLLG"
     gene            complement(<1055454..>1057339)
                     /locus_tag="TRUGW13939_07138"
                     /db_xref="GeneID:55994631"
     mRNA            complement(join(<1055454..1055734,1055788..1056311,
                     1056361..1056960,1057034..1057269,1057322..>1057339))
                     /locus_tag="TRUGW13939_07138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490280.1"
                     /db_xref="GeneID:55994631"
     CDS             complement(join(1055454..1055734,1055788..1056311,
                     1056361..1056960,1057034..1057269,1057322..1057339))
                     /locus_tag="TRUGW13939_07138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346173.1"
                     /db_xref="GeneID:55994631"
                     /translation="MVLSLSIDPDELIKTLRTTPDKNVKANIYTENAVASTTPYSTRY
                     SSKESIPKYRLPQNGAPGDVAAQLLRDELDLDGRPNLNLASFVGTYMERQANVLMAEN
                     IAKNLADADEYPALMAMHSRCISILANMWGAQPNEKAIGSATVGSSEAIMLGGKAMQR
                     RWQEKRRAAGKDTQRPNILMGANAQVALEKFACYFDVEARILDVSEKSNFALDPDMVR
                     KNIDENTIGVFVILGSTYTGHFEPVEEVSKVLDKYEEETGHDIPIHIDGASGGFIAPF
                     TYAGAGQKWNFELPRVKSINTSGHKFGLVYAGLGWVLWRDESYLPKDLIFQLHYLGGT
                     EESYTLNFSRPGAPVIGQYYNFIHLGFNGYRDIMENCLANARLLSKALERTGWFKCVS
                     SIHQPIKKSKTAKDVVLGSSSGETSADYAAGLPVVAFHFSDEFQKDYSHVKQESVSIL
                     LRAKQYIIPNYPLPPTANEIEILRVVIRESMSADLLERLISDIVAVTERLVKSDPVDL
                     SNLQTEAHHTRIERHQRKSKAHEQQNSGKNWMKSMGQGVHKSVC"
     gene            <1062166..>1063812
                     /locus_tag="TRUGW13939_07139"
                     /db_xref="GeneID:55994632"
     mRNA            join(<1062166..1062175,1062282..1063642,1063693..>1063812)
                     /locus_tag="TRUGW13939_07139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490281.1"
                     /db_xref="GeneID:55994632"
     CDS             join(1062166..1062175,1062282..1063642,1063693..1063812)
                     /locus_tag="TRUGW13939_07139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346174.1"
                     /db_xref="GeneID:55994632"
                     /translation="MQFVEGSLPSHKPSLLDSSGAFGGRFWSLETPIANLEATTAAPA
                     SLTAASSFIDSDYLRSTQVDHQQPGNLAALAIPPPGMGTALDALNTAPQPLTARRPAA
                     SNLPVFELPPPTNFGHMSATSKFPTLSPVNALSNVSNLLTPPSNHSTEGTNHNISASY
                     STAGPDIPAYSNLWPNQNSYSYAAPSHTSWGPNSSTLYSTQRGAISPGAASLGRSSVT
                     LPSSNPEGMSQQYDLNHLPHPFHQQSIPVSSPQGQHQQQAAMMSNSIPTTSTAQSHAM
                     ISGDPYSKSAGAQMYSPSQSVATHPSAYPPPSYGTSAQSGLGIHARMPSLQSPPIQQP
                     QLGYNRAPWPSYSLPAMNGPIMTNVHNPNGHMSVMGNMPQGLMPNFTSGHLASMQHMY
                     GGHASHHPGHGQPPPPNDRPFKCDQCPQSFNRNHDLKRHKRIHLSVKPFPCTHCEKSF
                     SRKDALKRHLLVKGCGKNTDSGNKDEEGLTKTESHSDRASPLSNGI"
     gene            complement(<1064269..>1065658)
                     /locus_tag="TRUGW13939_07140"
                     /db_xref="GeneID:55994633"
     mRNA            complement(join(<1064269..1065567,1065632..>1065658))
                     /locus_tag="TRUGW13939_07140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490282.1"
                     /db_xref="GeneID:55994633"
     CDS             complement(join(1064269..1065567,1065632..1065658))
                     /locus_tag="TRUGW13939_07140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346175.1"
                     /db_xref="GeneID:55994633"
                     /translation="MAALVQSFTQRSSRLGSVLRNRSILCSSHPLERQGRNSARHIHA
                     RATEYLQNNDVDLTDSQRTVRDAISKICSQYTDEYWLKQEEIKKFPAEFHRTLAQDGW
                     LGICMPQQYGGSELGIAEAAVMMQTISESGGGMTAASAVHMNIFGLEPVVKFGTDEQK
                     KRWLEPLVAGKERACFGVTEPNTGLDTLKLQSQAKKNGDHEYILSGQKIWISTAQNAQ
                     KILILVRTTPLDQVQKPSQGLSLFYTDINPSVVEITEIPKMGRAAVDTNTLFFDDWRV
                     PASDMVGKENEGFKMIMHGMNAERILIGAEALGLGYAALRKAAIYAGERIVFGRAIGK
                     NQAIQHPLADSWMKLEAARLMLYHAARMYDQGYAAGEYANAAKYLAAEAAFESCERAV
                     MTHGGMGYAKEYHVERYLREVFIPRIAPVSREMICNYIGERVLGLPRSY"
     gene            <1066300..>1067933
                     /locus_tag="TRUGW13939_07141"
                     /db_xref="GeneID:55994634"
     mRNA            join(<1066300..1066452,1066518..1066589,1066660..1066835,
                     1066907..1067004,1067054..1067728,1067791..>1067933)
                     /locus_tag="TRUGW13939_07141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490283.1"
                     /db_xref="GeneID:55994634"
     CDS             join(<1066300..1066452,1066518..1066589,1066660..1066835,
                     1066907..1067004,1067054..1067728,1067791..1067933)
                     /locus_tag="TRUGW13939_07141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346176.1"
                     /db_xref="GeneID:55994634"
                     /translation="RSSRVASSLTFRSCILLTTSPTRANHTHAQQNRNSGPLEGVKIL
                     DLTRVLAGPFCTQILADYGADVVKVEHPQGGDDTRLWREAGEETIWKPEAGNTSIYFN
                     TINRNKRSIGLNLKSEKGREIILELTRKADVVVENFIPGKLDKLGLGYDVLKTVNPSI
                     ILASISGYGADGPFAQRAGYDVIGAAEGGLLHITGEPDGPPTKPGVGLMDMCTGLYLH
                     GAIVSALLSRERTGFGQKIDTSLFETTISILANVGMSWINMGKEAQRWGTAHPTIVPY
                     EAFKTKDTFLVVGAVNNRQFKNLCERLGNKDLANDSRFIDNNARIQNRKDLKRIFDEL
                     FMTRTTQEWESAFEGSGMPYGPINTLEQVFSHPQALARDMVQTVEQNAAVSGKVKVLG
                     MPVKFSQSKPSIRDGPPSLGQHTEEVLQELGLSPEAILQLRKADVI"
     gene            complement(<1068048..>1070276)
                     /locus_tag="TRUGW13939_07142"
                     /db_xref="GeneID:55994635"
     mRNA            complement(join(<1068048..1069158,1069210..>1070276))
                     /locus_tag="TRUGW13939_07142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490284.1"
                     /db_xref="GeneID:55994635"
     CDS             complement(join(1068048..1069158,1069210..1070276))
                     /locus_tag="TRUGW13939_07142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346177.1"
                     /db_xref="GeneID:55994635"
                     /translation="MHACERCYSRKTKCDRRLPECGSCIKSRSLCHYPNKRRDRQLQQ
                     EHLKSVELRLKELENENERLRGRASSQTEPFDILDETFRSHQLGPNGRQPTPDQQDVT
                     ESHNVEVQQSPEQSASSVQQTPSEEARYLGSSNGVDFVDVVERVVDSSHATSGLFGRV
                     TDSYRIVDRVAFPSIPQTAKLVDREVAMPLINSYFAHWHMIFPLLYRPGFMQMVHQIY
                     SDPDFYQQNSACAFAFDIVLALGSVPSKRVEWSYRDVESHSARALTRLNEVSSLRDIR
                     SLQALLLYCIYGIHASLRDTSREMWETLGKATRLCVEIGLHHKISKDLMRCQLHITGP
                     IPASVQVEMQRRCFWCYHNLERIVSISLGRPLALHDDDIQVQLPSVADDEALDRASRD
                     MPLSPSNTTSPFVMHILLRKIQSKIHRSMYTSQSIQALPMHERQAIRREIFNELQLWQ
                     SNISLLNLPPKDNLSATTSSYLHPSWYQALYHSGCLLLFRPSATFPATEGLESYEDMD
                     DVPQMIWNSSRLVLSHYYELLRDRHLNYSWVCLYTIFMAGLANTYSVGCCAQRRKRGI
                     MAFLPSFFDVVSDVRDCSNILTAICERWDDARGSCDIFNRLSMSALKELVASTSFHQR
                     TIPVSGNNQTNAESTSVTFENGGVRQPTVNGRRLTPQTLPSPGFPDAAMHPDQYGNDS
                     FSAFDPIVDFQQIFQEMQDTINTSGPPQTNEVMLGFSQEWFGR"
     gene            complement(<1070762..>1072267)
                     /locus_tag="TRUGW13939_07143"
                     /db_xref="GeneID:55994636"
     mRNA            complement(join(<1070762..1071086,1071148..1071736,
                     1071803..1071897,1071954..>1072267))
                     /locus_tag="TRUGW13939_07143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490285.1"
                     /db_xref="GeneID:55994636"
     CDS             complement(join(1070762..1071086,1071148..1071736,
                     1071803..1071897,1071954..1072267))
                     /locus_tag="TRUGW13939_07143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346178.1"
                     /db_xref="GeneID:55994636"
                     /translation="MATSQVVKSQGPFHGLPTYPQNESFSDLTAVVTGANGMSGYHMV
                     RVLAAAPERWSKIYCLSRRTPPSNFFDDLGDGAKRVEHIPVDLLEEESSIADKLKGKI
                     QKVDHVFFFAYLQPQQKGQVLGMWSDADELAKVNSTLLKNFIGAIRLSNLQPKRFLLQ
                     TGAKHYGFHIGPATNPSFESDPRIPLEANFYYPQEDALFQYCKDTGASWNVVRPSYII
                     GAVRDSALNHMVGLAIYGAIQAHLKQPLAFPGDFAAWDREYCQSTAMMNAYFEEWAAL
                     TDGAANEAFNIQDGLPFTWGRFWAYLASWYGTGWKSPEDDQSKYRTNVSRHVQTPRGY
                     GPLGTTHSTFSLHEWSGRPEVQAAWTELAQKHGLVLDPFTDKSRAQIFSMTDSAVIGS
                     WPLSLSMRKARKLGFLGNVDSYETSFNAIRDLARLKVVPPPAVAEFSE"
     gene            complement(<1072868..>1074199)
                     /locus_tag="TRUGW13939_07144"
                     /db_xref="GeneID:55994637"
     mRNA            complement(join(<1072868..1073045,1073104..1073775,
                     1073838..1073932,1073999..>1074199))
                     /locus_tag="TRUGW13939_07144"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490286.1"
                     /db_xref="GeneID:55994637"
     CDS             complement(join(1072868..1073045,1073104..1073775,
                     1073838..1073932,1073999..>1074199))
                     /locus_tag="TRUGW13939_07144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346179.1"
                     /db_xref="GeneID:55994637"
                     /translation="RLMKIYEPAAMQAVIYEGPFNISVKEHPKPVIINESDAILKVQI
                     AGICGSDLHMYRGHQKTTTGHIMGHEFVGIVEDIGSEVSRFKVGQKVMSIFSPMCMKC
                     WFCEHGYTNRCVNGPSFGSMSLNGGQSEYVRVPYADSTLETIPPEVSDEQMIIMCDIF
                     PTGYYGAMKALMKLKNGRETAESIVGGTLHAPSALRPNFKQQPLSEAVVVCLGCGPVG
                     VCAVLTAKVLGAGTVYAVDSVDDRLEEARKMGAIPLNLNTDDISAIVKSVTGGRGADA
                     VVESVGNQSALKLAFDVVRACGVISSIGFHQSELPFTGFEAYSKNIDLNMGRAAVRPV
                     FGEALKVFAENQDKFADFITHRMPLAEAPKAYEIFEKHQARKVILTL"
     gene            <1074573..>1079134
                     /locus_tag="TRUGW13939_07145"
                     /db_xref="GeneID:55994638"
     mRNA            join(<1074573..1074951,1075004..1075085,1075145..1075382,
                     1075433..1075578,1075633..1076143,1076199..1076264,
                     1076321..1076361,1077231..1077261,1077315..1077660,
                     1077722..1077814,1077868..1078032,1078093..1078491,
                     1078541..1078667,1078744..>1079134)
                     /locus_tag="TRUGW13939_07145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490287.1"
                     /db_xref="GeneID:55994638"
     CDS             join(1074573..1074951,1075004..1075085,1075145..1075382,
                     1075433..1075578,1075633..1076143,1076199..1076264,
                     1076321..1076361,1077231..1077261,1077315..1077660,
                     1077722..1077814,1077868..1078032,1078093..1078491,
                     1078541..1078667,1078744..1079134)
                     /locus_tag="TRUGW13939_07145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346180.1"
                     /db_xref="GeneID:55994638"
                     /translation="MSDSTIQSAAELTKLYIDGEYVAPKSGQVYTVYNPSDGSVVSSQ
                     VPIAGQEDVDAAVTAAEKAFNGPWSKFTGAQRSACLRKLAELLDENDNLLSILTLDTL
                     STGNPVSLIPTREKNYIMGQLLYYAGWTDKLRGDYFPDDDGFVKLVRHEPLGVCAGIN
                     PFNAPVATLIMKAAPCLATGNTLIIKPSEYSPLGSLAIAPLFEKAGFPKGVLQVVTGA
                     GDTGALLAGHMRIRKVSFTGSIATGKKIQIAATQSNLKRVTLELGGKSPAVVFEDANL
                     DNALTWTINAILARSGQVCVAASRVYVQRSIADKFIEGYKERMKAAADNIGNPLDKTT
                     TMGPLVGKAAFERVSKMIERGKTEAELVVGGVRHGEQGCYIEPTVFLNPQKDAQIYKD
                     EVFGPVSVIKTFETEEEVLEMANDTEFGLMSGVFTKDINRALRFSSRLESGVVGVNCV
                     SYMNVQAPFGGKKSSGIGREFGEYALRGFTEPKTVLINARHVSAFNLAIVLALCFGSL
                     TYGYSFSVTSTTLGQPSFFEYFNLSQDTASPRYAFTNHVIGGLNGCFSGGGFFGALVG
                     GWACDALGRKKTLFLATPIAILGGALQGGAVNLEMLLVGRILGGFAVALSVGILMVLI
                     PLFQCEIAPPAVRGFLVSQHGVVIVFGYAAAAWVGFGCFYTTKPAFQWRFPLSLQCLW
                     PLILLLLTPILPESPRWLLMQGRRQEAWDIVEKLHNSEKDSSRISFAREEFYQMTYQV
                     SADQEMARSETVLTLFTKPSYRKRMFCAFMTMFASESTAILVVYNYSVLLYEGLGFTN
                     SISLLLAAAYVTVACFGNYISSLLMDHVGRVKLLVIGITGCLISLIFEAALSARYIGT
                     ENSSGLSAGVFFLFLYISFYGCCIDATTYVYCTEIFPTHIRSRGMAWSLAILFATTVA
                     YLIPAPTAFAEVGWKYYLLFIILTIINIPIIWVFFPETKGLALEEVGEKFGDDVVVRL
                     TNITTEQREQLDEAIKAEKSTSESTHVEQMSA"
     gene            complement(<1079720..>1080713)
                     /locus_tag="TRUGW13939_07146"
                     /db_xref="GeneID:55994639"
     mRNA            complement(join(<1079720..1080328,1080377..1080524,
                     1080592..>1080713))
                     /locus_tag="TRUGW13939_07146"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490288.1"
                     /db_xref="GeneID:55994639"
     CDS             complement(join(1079720..1080328,1080377..1080524,
                     1080592..1080713))
                     /locus_tag="TRUGW13939_07146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346181.1"
                     /db_xref="GeneID:55994639"
                     /translation="MSSSTDVSSLLVQAAVPGFKCPTGTKMHILDLGTLEADESWILR
                     GSNSSSLSNKNPVNKRRELMILSALIELPGVGLILYETGCAEDLDVKWGAPLTDIFPR
                     IMYSEEKKLPAAIKSTGHDIKDVKAVIIGHLHLDHAGGLEHFVDTDVPIYVHEEEFKH
                     ACWAVATGADLGVYLGHYMLLDRLKWNTFTEEHLDLFQGITLHHSPGHTPGLCIMQVN
                     LEKDGTFIWTTDQFHVAENYELGHPHGGLARDHTAWFRSLNMIRRLQRLFNARLVFGH
                     DKDVATKYLNEKKFFE"
     gene            <1085874..>1086970
                     /locus_tag="TRUGW13939_07147"
                     /db_xref="GeneID:55994640"
     mRNA            join(<1085874..1086082,1086134..1086204,1086250..1086297,
                     1086357..>1086970)
                     /locus_tag="TRUGW13939_07147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490289.1"
                     /db_xref="GeneID:55994640"
     CDS             join(1085874..1086082,1086134..1086204,1086250..1086297,
                     1086357..1086970)
                     /locus_tag="TRUGW13939_07147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346182.1"
                     /db_xref="GeneID:55994640"
                     /translation="MQSLRFRQFYRFSSNSTTAVFSRQQPLSSVVHLKTTRHYNTNNH
                     SRVSSVREFANCSSAAMAGVSKACCSIPPVVTQGYKEKGEYKTIGGLKTYVTGPEDAT
                     KAILVIYDIFGFFPQTIQGADILSTADKDQKYRVFIPDFFEGEPADISWYPPTTDETK
                     QKLGKFFETKAGPPATLSKIPGVIADANKLSPSSGNFTWGILGYCWGGKVANLAVGAE
                     GASGFKAAVQCHPAMVDPNDATKVKVPMALLASKDEDPAAVKGYEDNLKVAKHVETFP
                     TQIHGWMAARSDLADPEVQKEYERGYRTVLSFFNAHL"
     gene            <1087414..>1090176
                     /locus_tag="TRUGW13939_07148"
                     /db_xref="GeneID:55994641"
     mRNA            join(<1087414..1087452,1087516..>1090176)
                     /locus_tag="TRUGW13939_07148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490290.1"
                     /db_xref="GeneID:55994641"
     CDS             join(1087414..1087452,1087516..1090176)
                     /locus_tag="TRUGW13939_07148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346183.1"
                     /db_xref="GeneID:55994641"
                     /translation="MSDSSDDPNLISTPLERTTSLDEEPKQPSNIPNALDHALRSIDL
                     ASNDNDKTTTHFTSKDVKYLFSGAPHFMLEKGRHNHWYPHALFPWDVGAVSIQDFWDR
                     EAMRHEAFTLGTLHAHLPVPGVHHETEREEAEAKEAKGAKRSTFDLGIFEVPNMLSMN
                     GKERGAVGIRHFLELPIADERRYRAKSPKAGDGVDHQALNNMHITQAFEKLEHMRDAY
                     SECNQDAVFDRRRVLSQGPEAWKRIGVRDVHIKKIVERLIELSEFRTGALEKNKNMTI
                     LDKEPVATLHEQLYTHVLYPPPKCWGHHHGKKQDEENLKSQIEVLTKVLAVKGAWLDF
                     SIPDSRLRVGQVLWEMPADPTSQKDHQSSSKGKTDAERKWLLLQLLLAGELLMRLDAI
                     VRLAVLKPSKNISVSSQDVRDLDKLRHGKVNWDVLLVQRFMDNLKPKYCPSTKSSPSP
                     PQEKAKRGLLAKFGRRQSQKPTQSLADSDSNSAWDCIFTPHHAERQLQGLSVFAAGID
                     WPNRDTIIGEIRAQINKDTYNTPLTNHQQQENRKQETLAPQYVLLRHEPSSSEFKSGW
                     LSRAWLTGFVLPGNSINALLMASILENDPSALSAIGSLANLQGGFSYMGASWWSTKCI
                     AGRVLAAADESKVCMGWVKVSKEKLTPRDQASGAEFGDTWFSVAVRDVKKSSCPRIRQ
                     GPKLAIESHPLGHGEVSGSTFTIPVDQQQQHGFAVTINSFDLAVSESSSDHKIVSARQ
                     ASISFSLTEETAATPISLCMPLTYNIHFISSFPCRPPRGSVHHHSFSADTASETEKET
                     AANHHNLPGHPLHTSYSYKHIPLSSLRPDTAPPPERNSEPVWILDARCSRDHEVFARA
                     WCAAVGVDAVVGRVGRSCLACCVREARAVEAAVVIRVSVHNNK"
     gene            complement(<1090757..>1091849)
                     /locus_tag="TRUGW13939_07149"
                     /db_xref="GeneID:55994642"
     mRNA            complement(join(<1090757..1091322,1091384..1091710,
                     1091774..>1091849))
                     /locus_tag="TRUGW13939_07149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490291.1"
                     /db_xref="GeneID:55994642"
     CDS             complement(join(1090757..1091322,1091384..1091710,
                     1091774..1091849))
                     /locus_tag="TRUGW13939_07149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346184.1"
                     /db_xref="GeneID:55994642"
                     /translation="MDLPGASSADKKRNKLGYHRTSVACVHCRRRKIRCLVSADDTQG
                     RCENCIRLRKECHFYPVDQQPPTEKKHSRPGSKLESSLDPTASSSPPGLPSGSMDPTD
                     MYTYSIPMHSTPDMAGFHPASFPANPMGPFTPDGVAHPDMMSGQTIDPSASWDASAAH
                     RISPVMWTQGQVVSSLPTASPIAGMPGQPQMMAAGPSPYATVQPDGTLWPGPLQRSMT
                     VPTQQDLGSPFPSPGAFPQNIPPELKRRMTSPAQAVGPIATPSPMQSPSPGSLQVPVT
                     YTGQPMAYRQWSGMGAMPMDGSGYPMFSPGQVPSNFPMNHHPSSGP"
     gene            complement(<1097081..>1098220)
                     /locus_tag="TRUGW13939_07150"
                     /db_xref="GeneID:55994643"
     mRNA            complement(join(<1097081..1098003,1098051..1098123,
                     1098173..>1098220))
                     /locus_tag="TRUGW13939_07150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490292.1"
                     /db_xref="GeneID:55994643"
     CDS             complement(join(1097081..1098003,1098051..1098123,
                     1098173..1098220))
                     /locus_tag="TRUGW13939_07150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346185.1"
                     /db_xref="GeneID:55994643"
                     /translation="MGSSQKRKREKQKDFQKPKLKVGKAKAKPANFTDTSFKAKAIVL
                     NQQSLSTNAPSSSSQFSHHLSLLSAKSDTQRKESLAHLTTSVLSRPVDSALPQPVSTI
                     IPKLVPLLLDASNNVRAQLLKFLKTLPAADIDAHATQLLPYIRAGMTHLAADIRLSAV
                     EVLGWLVDTAGSEVVSCAGGWIKTLNCFLSLLGWHTAESAKWSANRSSFGKAGSQGRP
                     MVRALQVLAEFLRVGIGKEEDLDGDVNNNNDPERSVSSHYFPLDSSVRQNVISNRPTP
                     YAYLNLFGQPRDAEGEMYESRDDRLRVFADQFRSVVERGVENARKEGGEVGRASATVF
                     KVLRDAGPATATT"
     gene            complement(<1098697..>1099407)
                     /locus_tag="TRUGW13939_07151"
                     /db_xref="GeneID:55994644"
     mRNA            complement(join(<1098697..1099338,1099393..>1099407))
                     /locus_tag="TRUGW13939_07151"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490293.1"
                     /db_xref="GeneID:55994644"
     CDS             complement(join(1098697..1099338,1099393..1099407))
                     /locus_tag="TRUGW13939_07151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346186.1"
                     /db_xref="GeneID:55994644"
                     /translation="MAQPPPPQIPQHVSALLSHLTSRPGVQSTLILSRKDGSIIQSTG
                     LLAANTGSTGNGNGNGNANSNLPASRTNSGSISTTENPASGVAAATAGSPETIAQDNS
                     NNATTLVKSPYKPTQAEALAAHIHAFTTSASGVTLALSGSTSAAQIGHESRPSVNGVA
                     DSTADDQDKDNERDEDDEIKLLRLRTKKHEIVVVPDRKYLLCVVHDASGASAPAGASR
                     "
     gene            <1100024..>1101133
                     /locus_tag="TRUGW13939_07152"
                     /db_xref="GeneID:55994645"
     mRNA            join(<1100024..1100626,1100686..1100913,1100972..>1101133)
                     /locus_tag="TRUGW13939_07152"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490294.1"
                     /db_xref="GeneID:55994645"
     CDS             join(1100024..1100626,1100686..1100913,1100972..1101133)
                     /locus_tag="TRUGW13939_07152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346187.1"
                     /db_xref="GeneID:55994645"
                     /translation="MLLDILDTFDVSKFRIRKQDPNEYSPVVVRPRSSTETKKHSRKT
                     RDSIPQRVLLTLGEVPKWYDINPFILTGYRHQTNSLLGCLASWTYVHNESGNIYSHLI
                     PAVAAIFGHRLLYNYLRAEYANLRDKDWTIISLQLWAALACMSTSTMYHTMICHSPKV
                     KHNCLMYDYVGIIAVMLGNFISGIYFGFYCEPRLRLTYWILVTTMSLATGVVMLNRRF
                     HGPKWRRFRMNCFLLTGFFASAPMVHGTIRWGREFVRKTGVRYYLLEVLLILVGCFFY
                     ERRLPERLFPGRFDIWWHSHTIWHLFVVGAVAMHLVGTLTAFDYDYHHRSVCYA"
     gene            complement(<1101233..>1101573)
                     /locus_tag="TRUGW13939_07153"
                     /db_xref="GeneID:55994646"
     mRNA            complement(join(<1101233..1101441,1101507..>1101573))
                     /locus_tag="TRUGW13939_07153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490295.1"
                     /db_xref="GeneID:55994646"
     CDS             complement(join(1101233..1101441,1101507..1101573))
                     /locus_tag="TRUGW13939_07153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346188.1"
                     /db_xref="GeneID:55994646"
                     /translation="MAQSARESAQAMRDRVATAMQPGDNKSTVHSLPPDERESMLGLD
                     HEEHPVEGSARGGQKQPGTAGRKMGGGGGPLDSVADTVTKAFGGKSK"
     gene            complement(<1102476..>1105178)
                     /locus_tag="TRUGW13939_07154"
                     /db_xref="GeneID:55994647"
     mRNA            complement(join(<1102476..1104323,1104384..1104723,
                     1104952..>1105178))
                     /locus_tag="TRUGW13939_07154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490296.1"
                     /db_xref="GeneID:55994647"
     CDS             complement(join(1102476..1104323,1104384..1104723,
                     1104952..1105178))
                     /locus_tag="TRUGW13939_07154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346189.1"
                     /db_xref="GeneID:55994647"
                     /translation="MLRDSIFPDWRDDVPHDAVDSPDEMQRKDPLATQIWKLYSRTKS
                     QLPNQERMENLTWRMMSMSLRRQERERAEQARRAAQRLEKPAPSGIAQLRQSVDQRTP
                     RASSVDPMNLDEFIIPSSIGSPAGIEPSQLDLAVPSAIPIKGRKEHIQSHNNLAPASL
                     PYTSQDLHRSDEFGYVQRRVRKTSVDERKAARKRPAEFSPQVVPTTNLMISNDHELDS
                     SMMPDYNLDHSHSAYPTNHTSPNVPFNLDTFQLNEDSLLTSAGPFQQNFAFSPTESPL
                     VTSGPFGHIYAQTPIASSLNSTDFYSPPASAFQSTASTPQPAYDGEHSMYFEQNPMDA
                     RAQRRVPTYATQRSNLTASLQPRYMFNANNEAAAFNSMSGPPSSLPSPGFAMSQQHVD
                     PSRVLNQNDFAAPATHRNLTLNNRENMFTFGADSDNEDDDGVSFSDRNMAMQADFHGL
                     DDVSGDVNSNIQWDAQLAGHFGSMPNFSGLHNGRMGDPMDQSRDWDNSNLSRVHGSAL
                     SVSDLRSQHDPRRPKLARAISTPNTNHLSQQGLQSHTSPNTPPESGLSSAVPSRPPSP
                     GGTKPGDQGGAPTTCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLSLKTDV
                     IKKRNRGGGNSLSIGVSSSRSKKNTRKNSIQQAIAVTPPSSSKPHSVNASESPPSIAG
                     SVSSTSGASIGIKNGVVPIAAAPPKTTPSAGAQARAVQVAPKRQRRLDKGSIGSLSSI
                     QASLSQDSPEGDDGSRGGPLAARSKVVPLAPAMPPAATNPAHHSLAAGSGQTASQEWE
                     WLTMSL"
     gene            complement(<1111400..>1112431)
                     /locus_tag="TRUGW13939_07155"
                     /db_xref="GeneID:55994648"
     mRNA            complement(<1111400..>1112431)
                     /locus_tag="TRUGW13939_07155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490297.1"
                     /db_xref="GeneID:55994648"
     CDS             complement(1111400..1112431)
                     /locus_tag="TRUGW13939_07155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346190.1"
                     /db_xref="GeneID:55994648"
                     /translation="MARLPGRLIAVCALFAAWTSAVPLVIVEGNNNLNLQQQQAILNE
                     DSDPLKDYVSDVANDKELSSPPPPSSDSVKIPSSLSSLLRSSLHHIVDESPSINTVIN
                     LFHEEEEDDDEDREENTLIRRPSWFTSTLMARRLLALSSIGVASSVYQTPSRRGPAGL
                     EGVSVSLPEYIADCASSTLEETEIGNGNPVLLGLYVSTTFQNAASGSNVSLSIDWWDH
                     IDRTEPLYPGFPLSAAGLPRVSLLGYIERIPFSSSSVRKALEECFTAAHPDAQVWLPG
                     NTDSPHSGFWARLVVTQAYWIGGFGDTQQIGWINMTEWREIGRESSPPGIGDGRGWED
                     VRLPGEGHQ"
     gene            complement(<1113516..>1115714)
                     /locus_tag="TRUGW13939_07156"
                     /db_xref="GeneID:55994649"
     mRNA            complement(join(<1113516..1115203,1115270..>1115714))
                     /locus_tag="TRUGW13939_07156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490298.1"
                     /db_xref="GeneID:55994649"
     CDS             complement(join(1113516..1115203,1115270..1115714))
                     /locus_tag="TRUGW13939_07156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346191.1"
                     /db_xref="GeneID:55994649"
                     /translation="MTGMDVLGLSISDPGQQKTTIVHPYSTSTGSSASSSSSSIFSLD
                     GISSQSSIASSTTSAADVIWENEESSARGLPSHSENASHCLPAGLRGCPSKATDAALP
                     AELRKHPRRTGSSAVSSNGPSATCSRLPPPLVRQCERKVSFVDNLVDSASQIVETIWP
                     LSVVALRSDSSLGCKGVLPLRHFIQETLRRSRTSYSTLQVALYYLIKIRPHVPNHDFT
                     MEQPCDRSVPRAMQCGRRMFLAALILASKYLQDRNYSARAWSKISGLKTCEINQNEMM
                     FLQAVDWKLHVPEAIYHRWTDIVLKYTPGPATSHPSEDCWRTVVSKLTPDLDTIPVDV
                     SSPRSSVAMDTLVDLPSPQRCTGWDASVVPPTASSEPKPPCPRSNPPLTLEPTPRIDS
                     SNPTLPTLQKLGLLPTPQLTPQSSTASTPAVSAGGICSRRPSIGTVMSQAQSLGIARL
                     ALDPRPCSKPACADGFPILTRRSSLARSTSSASSPESMISDVSTISSRSSRSSSISSC
                     ASATCAPTRLRMAVAATRRCAAKSLKESRKNLAIQSPIDEMSLVGVYQSPEADAGSCG
                     SVPDLSNFSINTPVDMTAHEAAQGLCELSGAMPPVQPAPQKVGETTRCRKRGRTYSED
                     QILQNNVRQMMTTGRDEQMVLPDSQMANSFLLPEAKSLQQPFGCGLSSMKLPIPVAIP
                     NGGIKRACCSAEARSRFVRPGQTAYAEQ"
     gene            <1119254..>1123100
                     /locus_tag="TRUGW13939_07157"
                     /db_xref="GeneID:55994650"
     mRNA            join(<1119254..1121102,1121164..1122164,1122243..1122604,
                     1122682..1122836,1122886..>1123100)
                     /locus_tag="TRUGW13939_07157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490299.1"
                     /db_xref="GeneID:55994650"
     CDS             join(1119254..1121102,1121164..1122164,1122243..1122604,
                     1122682..1122836,1122886..1123100)
                     /locus_tag="TRUGW13939_07157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346192.1"
                     /db_xref="GeneID:55994650"
                     /translation="MDIFCRNVPIHIKKHHLKKELTPILAGFDILAFECRVHANGGHA
                     TITISDIDKATRFLTRYQQKKGTQKKGQQKPPHQQLMIFGTTIFVEEGRYKPDSFLLS
                     SLQNEETERRSRPRRPISVSGGSAVHVKKIFPIFYLSCGRFNFSDTGPIFIERWKMAS
                     SGHVKFGLTKLTVIITQDMYSNLKLDFNYLAFDDCIYLGDSRMPSITFSSYNSPHMYN
                     VPFPALPPHPKAARFMANPRPAEKKKTRLGFLNPDHRMVVSSCFVYRVVLTNISDLSL
                     IPSLSRNRNIPSIERWNDTLFNPGVPYATQLQGFLVTLSEQPFSFIIKFQLQMLVWNG
                     ELPIMTVVQLFPCLKELLSRRKDEYVAKIIKEIPRRLVHPTPHADIADVGLDSIVKML
                     HEIEDSHALDYFKPGHPGYLHQNQVEIHRASVTPSGIYLDGPNPEAQNRVLRKYSAYS
                     SYFLRVRFIEESGDMVMYDMSSNLDKIFQGRFREVLRDGIIIAGRHYVFLGFSHSSLR
                     SRTCWFMAPFEDRGETITVSKLIPRLGDFSHIRSPAKLAARLGQTFSDTLTSIPIEKK
                     VVKKLPDVERNGRVFSDGCGTISKEILRRIYRDYPRHATVCPTVFQVRFSGAKGMLSL
                     DSSLKGNKIFLRDSMIKFEAGQDSNIEICGSGIEKLPCYLNAPLIKILEDLGVARDVF
                     LELQREEVESLRAVVQSPRQVAGFLEQSHISKSTRLPWLVSVLKGLNLRYVQDPFLKR
                     TIELALVMKLRDLKYKARIRIPKAVTLYGIMDETGILNEGEIFVPVMNERSRREVLVR
                     KNVIITRSPAFHPGDVQLANAVDVPEDSPLRQLHNCVVFSQKGSRDLPSQLSGGDLDG
                     DLFNLIYDDRFRLQRIESPADYPRVAGVVLDRPVTMDDIQDFFITFMQQDQLGRIANT
                     HKVFADCRPDGTLDPDCLTLAQLHSTAVDFSKTGTPVDVTKIPRNPPYRPDFMAPGPR
                     VRVAESIEVLEKEDRYMQEDEEDDEDARPLLHYYKSLRVLGFLYRMIDEKEFLQDLQK
                     VPEARQPAVNVLQRLWEYIARETTGFIWEHNKDHGYYVRDIYEDGLQDIMYCYSDSPW
                     KTPLTEEEVFIGNIMGSNHKQTTHQKESSRTMREAYDELVKWTMSLITGKGTDKGPES
                     LELSIACFWAALNDKKGSFVPSQGKLHSFPWIAAIACIQEVDRLVTV"
     gene            <1123806..>1124732
                     /locus_tag="TRUGW13939_07158"
                     /db_xref="GeneID:55994651"
     mRNA            join(<1123806..1123843,1123920..1124031,1124094..>1124732)
                     /locus_tag="TRUGW13939_07158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490300.1"
                     /db_xref="GeneID:55994651"
     CDS             join(1123806..1123843,1123920..1124031,1124094..1124732)
                     /locus_tag="TRUGW13939_07158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346193.1"
                     /db_xref="GeneID:55994651"
                     /translation="MFRNNYDNDSVTFSPQGRIFQVEYAQEAVKQGSVVVGLVSKTHA
                     VLVGLKRNAEELSSYQKKVIEIDSHMGIAIAGLSSDARVLSNFMKQQSLGSRMTYGRA
                     IPLDRIVTQIGDRAQTNTQHYGKRPYGVGLLVAGVDDAGPHLFEFQPSGLTHEMLACA
                     IGARSQMARTYLERNLDEFPESSRDELINHGLKALRETLSQDKELTVENTSVGIVGLA
                     PKDSKARIETFKLYDGQSVGPLLEALDGATEGGEEEGEMEVDTQ"
     gene            complement(<1124904..>1127571)
                     /locus_tag="TRUGW13939_07159"
                     /db_xref="GeneID:55994652"
     mRNA            complement(join(<1124904..1125588,1125644..1125715,
                     1126492..1126988,1127056..1127417,1127478..>1127571))
                     /locus_tag="TRUGW13939_07159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490301.1"
                     /db_xref="GeneID:55994652"
     CDS             complement(join(1124904..1125588,1125644..1125715,
                     1126492..1126988,1127056..1127417,1127478..1127571))
                     /locus_tag="TRUGW13939_07159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346194.1"
                     /db_xref="GeneID:55994652"
                     /translation="MDQSQDVNLEELFWRSPQHVQMMGGFLHSNNIIFYFAESPFFDA
                     TSNNASLAIQANYNEALRHFLETREVFEGRLKTMQGLEFMVTYDPLQDAAQSDTEFAH
                     TPSNIWVIRKQLRQKRPGKEDDVVVLSTYYVVGDAVYMAPAVSSVVGNRILSAVTSLT
                     KLLTVASPLPIFTPSYGHVYMPPGPKAVDAPQTTTTTTSQSSQQSKELTPVPDSQSSA
                     KTFLTTTSTTSNAKDTSYQHTRNLMEAMNLLSRYGDEFMDETPLSGEPGSFILSKANE
                     STTAARRVAKTTTTTNMHAPAVPRKTGTPSVTESSTPAKGGDSTIQIANMTVTTGQQT
                     KQAVVCVFCGSVGGNNPAHLEAAVALARAFHEQNVHLVYGGGTHGLMGAVARELVRLS
                     GPKAVHGIIPKALVKFKDGQQQQQQEDGKVHEGAGKTHERTVQETDKRTELNETEYGL
                     TTIVPDMHTRKRLMATKVLEGGPGSGFVSLAGGFGTIEEVMEMTTWNQLGIHTVGIVL
                     LNINGYWDGVLEWIQNAVREGFISQANGEILVQVQQVKDVLPKLREYTASVDRFQLTW
                     GQE"
     gene            <1127969..>1128514
                     /locus_tag="TRUGW13939_07160"
                     /db_xref="GeneID:55994653"
     mRNA            join(<1127969..1128010,1128074..1128287,1128381..>1128514)
                     /locus_tag="TRUGW13939_07160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490302.1"
                     /db_xref="GeneID:55994653"
     CDS             join(1127969..1128010,1128074..1128287,1128381..1128514)
                     /locus_tag="TRUGW13939_07160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346195.1"
                     /db_xref="GeneID:55994653"
                     /translation="MATQGLRTIIALSFILAIGFLLVILSAALWHNFLPLIVVATYII
                     APLPNWICSQCGNPDDFIESSGSAVVDFGRFLTAFLVLMGIALPTVLAHSGAIEVPAM
                     VMSILGGLLIYGTIISFSMFFREQEEF"
     gene            <1128931..>1130554
                     /locus_tag="TRUGW13939_07161"
                     /db_xref="GeneID:55994654"
     mRNA            join(<1128931..1128976,1129056..>1130554)
                     /locus_tag="TRUGW13939_07161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490303.1"
                     /db_xref="GeneID:55994654"
     CDS             join(1128931..1128976,1129056..1130554)
                     /locus_tag="TRUGW13939_07161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346196.1"
                     /db_xref="GeneID:55994654"
                     /translation="MDLWSGSIPTGSFDLNIKLVNATPKRDHTIPPKSRLSFHSFVNP
                     ALIPLYARAGPSVEVHTANVESAEWLKTRLLGSLWLEEWGDDQEEEMERAAVEIQCPV
                     ALLLTVGSSQTSDVSHTSTNNVSDLLVYGILTASNSDQNPLPSPSDSASGDGRDQLVE
                     PRRRELRIYAAPLATSYVQKAQDLPSPPSSPIEGENSRSCGEDGLVAQFLPDLRSPTP
                     KRKRMLSIFETAAQHHRRVRQYGGQAVAQMMATKSQTHQTQPLKIKREPTDDGSSNNN
                     NKSGLDRLGGLRRARSLSIGGNQLARLDNTRVAADESRPSSSRGLQQQTRRMISKNDG
                     GSHSFHEFERSRSIAPTSNLASYNEAATALSSSSPKTGEMLVASNKDVITRSILTGMR
                     LYGYHRKPNRAASKPAPFVNNSDLDGIGEDGAITPTMTEDCSRQSVTDEDDFKAMYHA
                     TYKAATFALRHYLKTDTILNSDDSRDSARGMQKTGPAVLSRDTATNVIDEILKLFCDD
                     QLRPAG"
     gene            complement(<1130946..>1131668)
                     /locus_tag="TRUGW13939_07162"
                     /db_xref="GeneID:55994655"
     mRNA            complement(join(<1130946..1131009,1131063..1131160,
                     1131225..1131485,1131573..>1131668))
                     /locus_tag="TRUGW13939_07162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490304.1"
                     /db_xref="GeneID:55994655"
     CDS             complement(join(1130946..1131009,1131063..1131160,
                     1131225..1131485,1131573..1131668))
                     /locus_tag="TRUGW13939_07162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346197.1"
                     /db_xref="GeneID:55994655"
                     /translation="MESESRLWRFSKPEWLNNSAIRTTGVYTSGALFSIGFFFLVDAA
                     AFSMSPKNGSKVHVKFVDWIPGICSALGMLVINSIEKARLSADSFSYSGGGVAWKARF
                     VLFLGFALLAGGLAGSVTVLVLKYVMNNYPLQTTYFGIANVIANSLVMLSTVVLWISQ
                     NLEDDYTYNLAL"
     gene            complement(<1132196..>1132904)
                     /locus_tag="TRUGW13939_07163"
                     /db_xref="GeneID:55994656"
     mRNA            complement(join(<1132196..1132432,1132500..>1132904))
                     /locus_tag="TRUGW13939_07163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490305.1"
                     /db_xref="GeneID:55994656"
     CDS             complement(join(1132196..1132432,1132500..1132904))
                     /locus_tag="TRUGW13939_07163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346198.1"
                     /db_xref="GeneID:55994656"
                     /translation="MDRGLNELLKWGVENSGASRQPTDPSDPSIVPPPTTRGLNEDAL
                     KALMGGPSDADLMRESMAALLSDELDLDNKMVAFDNFEQLVETIDNANNMEPLGLWTP
                     LVGLLGHKEADMRRMAAWCIGTAAQNNEKAQDKVLVMNALPTLVSLATTDSDSKVRRK
                     AIYALSSAVRNYQPNMNEVLLHLPADFKPAETVDSGDMAAIDAIMEKLRNAPS"
     gene            <1134399..>1136201
                     /locus_tag="TRUGW13939_07164"
                     /db_xref="GeneID:55994657"
     mRNA            join(<1134399..1134405,1134571..1134601,1134784..1134839,
                     1134999..1135029,1135139..1135910,1135971..>1136201)
                     /locus_tag="TRUGW13939_07164"
                     /product="actin"
                     /transcript_id="XM_035490306.1"
                     /db_xref="GeneID:55994657"
     CDS             join(1134399..1134405,1134571..1134601,1134784..1134839,
                     1134999..1135029,1135139..1135910,1135971..1136201)
                     /locus_tag="TRUGW13939_07164"
                     /codon_start=1
                     /product="actin"
                     /protein_id="XP_035346199.1"
                     /db_xref="GeneID:55994657"
                     /translation="MEEEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIM
                     IGMGQKDSYVGDEAQSKRGILTLRYPIEHGVVTNWDDMEKIWHHTFYNELRVAPEEHP
                     VLLTEAPINPKSNREKMTQIVFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDGVT
                     HVVPIYEGFALPHAISRVDMAGRDLTDYLMKILAERGYSFSTTAEREIVRDIKEKLCY
                     VALDFEQEIQTASQSSSLEKSYELPDGQVITIGNERFRAPEALFQPSVIGLESGGIHV
                     TTYNSIIKCDVDVRKDLYGNIVMSGGTTMYPGISDRMQKEITSLAPSSMKIKIIAPPE
                     RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF"
     gene            complement(<1136922..>1139490)
                     /locus_tag="TRUGW13939_07165"
                     /db_xref="GeneID:55994658"
     mRNA            complement(join(<1136922..1138558,1138616..1139143,
                     1139211..>1139490))
                     /locus_tag="TRUGW13939_07165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490307.1"
                     /db_xref="GeneID:55994658"
     CDS             complement(join(1136922..1138558,1138616..1139143,
                     1139211..1139490))
                     /locus_tag="TRUGW13939_07165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346200.1"
                     /db_xref="GeneID:55994658"
                     /translation="MLRERLRVLVVGNGGREHAFAWKLSQSPSVDVVYVAPGNGGTGS
                     GSSQKVVNASVKSDDYPGLVALAQKNNVNLVVPGPEAPLVDGIQGYFQAVGIRCFGPS
                     KTAAQMEGSKAFSKDFMKRHQIPTAAYENFTDYEAARKYLDSVDHNVVIKASGLAAGK
                     GVIIPTTKEEAHTALREIMLDHQFGEAGDEVVIEEYLDGDELSILTFSDGYTIRSLPP
                     AQDHKRIFDGDQGPNTGGMGCYAPTKIASKEVLAQIDRNIVQPSIDGMRREGFPFVGI
                     LFTGLMMTKDGPKVLEYNVRGGDPETQTLLPLLSSDTDLAEIMVACTEHWLDGVSIVI
                     QPNFSTTVIAVAEGYPGSYAKGRAVTLDPVPQDTIVFHAGTSLVNNELQATGGRVIAA
                     TSVASTLEEAVRKSYEGIATIHFQGMHYRKDIAHRAFRSPAQEKESLTYASAGVSIDA
                     GNALVNKIKASVARTSRPGSDAVIGGFGGTFSLAAANPAYHPDSPTVIGAIDGVGTKL
                     KVAHAVGVHNTVGIDLVAMNVNDLVVQGAEPLFFLDCYSCGHLDVETAAAFVTGVAEG
                     CVQAGCALIGGETAEMPGLFLDEAYDAVGAAVGAINTQGPNRRTILPDTTAMKPGDVI
                     LALASDGVHSNGFSLVRKIVDKSGLTYHDPVPFPFTSSIFPNPVLGTALLTPTRIYVK
                     PLLKALAIPSSQHAPASSAAIKGMAHITGGGLLENVPRMLPPTLAAHIDVSAWKLPPV
                     FQWLKNTGNVSSHEMSRAFNCGVGMVLVVDRDCATAVRELLEREGETVYQIGELKIRH
                     DREEGCILDGLATWDS"
     gene            <1140335..>1142914
                     /locus_tag="TRUGW13939_07166"
                     /db_xref="GeneID:55994659"
     mRNA            join(<1140335..1140517,1140589..1141015,1141070..1141133,
                     1141201..>1142914)
                     /locus_tag="TRUGW13939_07166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490308.1"
                     /db_xref="GeneID:55994659"
     CDS             join(1140335..1140517,1140589..1141015,1141070..1141133,
                     1141201..1142914)
                     /locus_tag="TRUGW13939_07166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346201.1"
                     /db_xref="GeneID:55994659"
                     /translation="MFQSTLRSFSRPVDSHVLYSLGSKRPCRFSRYYYAADITKQPFS
                     SSVAQSQNEATTHSEPPSTGTPAASEGNSPASVTNRESDNASVDEQLDIVSRVKSRKK
                     KRKNKRDDPGSSPLLLKLQERFNEKEEQPKKIIGRMAAEKRLKAREEKAKRLSRARSE
                     MAERSRKKKDLAQLPKSQQIWGLKDHVFENHKGSIESMGQDITALDVETAPVPNLSFG
                     LDRVIFNPGVYHLRDPRTRIYNFDPYLDNIMPVSEFDFEALKEYITSSKDESLIQLAR
                     DYNKKYVGSSSSMTGVLSHFHYLLSQWRPINRDMVSAGFPDKLLTFTRLLRSPAAMFL
                     HYKDGVYAIDADKEFDTANVLMNLGKSMEKLLTLPKEEFERYRKSSENKISAEEERAI
                     PEAYHFSTIGDFIMRSQLDGYDPRLPGTGMFDLKTRAVVSIRMDVKNFRKGMGYEIKN
                     RFGMWESFEREYYDMIRAAFLKYSLQVRVGRMDGIFVAFHNIERIFGFQYISLAEMDQ
                     ALHGQEDQTLGDREFQLSLKLWNIILDKATAKFPGKSLRLHFETREGKVPHMRIFAEP
                     VTDAQIKAIQEKNKDMIEKLQRELLHPELVGKGEDEEAARVAEQEEQTRFEAEIEAAD
                     AAEAIAERDEEVVMSTESGTVSEDAESTTSAEDVSETATASLDDDRSTTQIANEEDPN
                     LPPLMGMTLTITNRVNGRTVARPNFLKPTDTWEMQYDISELKNNRYLHGSYASLKKRR
                     ATSLTFGGEDETFYIRGLRKMAEAGRVHRAEQDQLDKEKGIAVYEPINSVSQNSK"
     gene            complement(<1143347..>1144867)
                     /locus_tag="TRUGW13939_07167"
                     /db_xref="GeneID:55994660"
     mRNA            complement(join(<1143347..1143780,1144177..1144229,
                     1144296..>1144867))
                     /locus_tag="TRUGW13939_07167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490309.1"
                     /db_xref="GeneID:55994660"
     CDS             complement(join(1143347..1143780,1144177..1144229,
                     1144296..1144867))
                     /locus_tag="TRUGW13939_07167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346202.1"
                     /db_xref="GeneID:55994660"
                     /translation="MFSFTSNFPKEGELLGMLWPVWEELEELLHFDQLPPFVRLHYGS
                     LPTAVQDAETREEPGDQPLGLEELYEEDSEGSADFYPEPGEEAQGDSPEDAHGDFSAS
                     GLVIAERIQKNLQKADNWNVQHPSIVLPSLGQVDRIKLLDHMIFKAKEIHRYEGFFQQ
                     VGENKVKEILDSLLPRKIKDLCQRGVIHKQSILDLKEDLRDPASSKDPGPPETRRQWD
                     EMAAGVGRETFETFLRSPDPEIRQWAKSMRDGFLSLRDSPDGKLRGYFAKQFERFLEA
                     GHRAQEQNVIDKWKKVLEEGEEFTVKKSGEFKPGKFYPKSYLTKGAFLFRIHQKLHLG
                     IVEGENVMLKLSLTKALL"
     gene            complement(<1147842..>1149212)
                     /locus_tag="TRUGW13939_07168"
                     /db_xref="GeneID:55994661"
     mRNA            complement(join(<1147842..1148219,1148278..1148427,
                     1148483..1148608,1148663..1148915,1148983..1149130,
                     1149191..>1149212))
                     /locus_tag="TRUGW13939_07168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490310.1"
                     /db_xref="GeneID:55994661"
     CDS             complement(join(1147842..1148219,1148278..1148427,
                     1148483..1148608,1148663..1148915,1148983..1149130,
                     1149191..1149212))
                     /locus_tag="TRUGW13939_07168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346203.1"
                     /db_xref="GeneID:55994661"
                     /translation="MPSHLRPDASKNFVGDFTFHHFNMILSGACTGVTCLVIFTVMAR
                     HATHLSDPHQQLKIMRIATLFPLYTLYSFLSICFPNAYVYMVGWTKVFQGVALYWFLM
                     LLCDFLAPNDRHRVEFFASLSIPKRYGRTKTTNGLLWLKHTWYLVLQYPIVTFVLAIV
                     QSITQAQGIYCLEGKGAHFSHLYITVIEILSLAVAMTSILRFHSNLKSYMQEHKPMMK
                     LLAFKMVVGLEFLEQIIFMILNSTGTLKISDTMTYADIIIGLPTLIICLQVVPFALLF
                     YYAYSLKPYTTLNVRRVGDSQQYLTEVDSETGSPHVKRYQGGPLGIHAWLALFNPVEF
                     FRDIKSTFNMFRDTKMEQSGLGKA"
     gene            complement(<1153190..>1157256)
                     /locus_tag="TRUGW13939_07169"
                     /db_xref="GeneID:55994662"
     mRNA            complement(join(<1153190..1155968,1156055..>1157256))
                     /locus_tag="TRUGW13939_07169"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490311.1"
                     /db_xref="GeneID:55994662"
     CDS             complement(join(1153190..1155968,1156055..1157256))
                     /locus_tag="TRUGW13939_07169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346204.1"
                     /db_xref="GeneID:55994662"
                     /translation="MAETLVNKKQRRKSFTFFHSSSTTTPIPASHDRSSSDGLSSTKK
                     RTRRNSGFFGTRDQSPGRSTNVLRRPQTSASESAFSIAAPPEAHKQQRKSFQRNKRSS
                     MLGSLRSLQSFEDDDRANRSPLLDDDDSNPPSPHPKRLLGHVVLHHGEVQTAGTMWRK
                     RHHYLVLTDTHLIRFKSQGKASDLFPTISAPSGRTTPVNRQSIVSIASLQDHGVSAYS
                     SDIAAIALTSIVSVHRADDSRHQSTLELSYLDDRTNKAALMAIQFADPDEQNLWLIGI
                     RSAAHSMRTLEPLPFEGRALENAIRVLEQDRDYDPENFQLFRVVQRSSNKLANRSSAD
                     EIVKLSATVYYLAIGLHKIHLLPLQKQSSRSSLISLSELDNGASFGLMALTSLLMHSG
                     DDRFQLTFRVPPGNPCFLHLASVSSVEIALWIRQRTEFLRPLWLHQPYEIIASAEVVH
                     GDLIPAPELDEDFGCFDRTLIAYSASYAIDTSNICYTIDLDCEDAPCFRLLPPAASRR
                     QHYTVLELLAVMRALRYNETFVSISFSGISLDALQKTRDSHGLDPDILVSRTGSPVNI
                     AGQDRLSLLSQEIRALALKSKRLRKVDFSFCLSRTPIFDSGARDPGCGIPEAIFPLCR
                     RQYTNVDWIVLNGIKLGDSDLDYLVDAASQRTSHLRALEVGDCGLSVHDLDLILSTLI
                     TQEATLEAINISGIQGRLSPELFQQQIGYFGHIRKINLTRVARTSGPGPLIAPETLLN
                     WRLEELSLSQTAMNEQTVDSIAAYLASDRSSSLRTLRLDQCGLTGADVATFLRCITQK
                     PQTSREMHLHVNENNLDTDYTLLFQAIAENHAPTHLSMRMIDFKKEEHFRELVEAVRK
                     NTTLRYLDISKASLPYDAGPETCEALQLMFEENETLEELDISGEYAHLDVARFGIGLN
                     QALTGLQKNKSLRVLRIEHQKLGLPGASTLATVLEHNSSLREIYCENNDMNLQSFTVL
                     VNGLQQNTSVILLPNMNSDRHNSLEKIRREIENIHRETALHPPSSAASSLRRSFHAAI
                     AIGQPSGGHKLAKHQVSPQLSKGSFIGSYSSSQSLAEPSNSDPLRHEVETTLLSLNNR
                     WDDEVDRLRQCLYRNYCILHDIPLDSIDHKEIDPNKPTVVDESHPGMSSDLFAMLGDM
                     HKLDVNGPAKVSDSSQVDDDALEDSSASGSPVITMSSSFSTRTLESLKVGETTRPVSP
                     TSVAFEKAARVSTAEYTASSNSSPQLALPVPAIRKTAHTAESIRSTGSSSNLSTSTGT
                     GSKSFHSTSGLAASSLRKLLPNRQSAMRGMRQFSSFGDSKESLRVKTTDAPPQINWTL
                     PQMDFE"
     gene            complement(<1158793..>1159305)
                     /locus_tag="TRUGW13939_07170"
                     /db_xref="GeneID:55994663"
     mRNA            complement(join(<1158793..1159158,1159213..>1159305))
                     /locus_tag="TRUGW13939_07170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490312.1"
                     /db_xref="GeneID:55994663"
     CDS             complement(join(1158793..1159158,1159213..1159305))
                     /locus_tag="TRUGW13939_07170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346205.1"
                     /db_xref="GeneID:55994663"
                     /translation="MPPPTSVRAQVEPPEQITNEAVKGFATGALRFGSMSILAHLILV
                     LPHPFTFDKASPPTNTDTTTSTSTSASSKKSPFSAHGIRQHVFYRPLTSLSESLAPMS
                     RVYRGLTPQFKVFLHIAVMTLGGSIWAEKRAGEYMEMLRKKRRLERRMGE"
     gene            <1159850..>1160646
                     /locus_tag="TRUGW13939_07171"
                     /db_xref="GeneID:55994664"
     mRNA            join(<1159850..1160174,1160231..>1160646)
                     /locus_tag="TRUGW13939_07171"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490313.1"
                     /db_xref="GeneID:55994664"
     CDS             join(1159850..1160174,1160231..1160646)
                     /locus_tag="TRUGW13939_07171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346206.1"
                     /db_xref="GeneID:55994664"
                     /translation="MAGTLSRRTASISRITNETKIQVSLSLDGGALLPFGASDHFPAP
                     ESAEDIAAAKKGVIPDKNAPHSTQFTSTQQITINTGIGFLDHMLHALAKHSGWSLAIR
                     AKGDLYIDDHHTTEDTFLGLGTAFTHALGARASLTRFGRGDAPLDEALSWAVIDLSNR
                     AYAVIDLGFKREKIGDLSTEMITHGLESFAQAAGVTLHVGCTYGANDHHRAESAFKAL
                     AVAVRTACARRSAGEVGAGDIVSTKGVL"
     gene            <1161101..>1161829
                     /locus_tag="TRUGW13939_07172"
                     /db_xref="GeneID:55994665"
     mRNA            join(<1161101..1161379,1161437..1161515,1161582..>1161829)
                     /locus_tag="TRUGW13939_07172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490314.1"
                     /db_xref="GeneID:55994665"
     CDS             join(1161101..1161379,1161437..1161515,1161582..1161829)
                     /locus_tag="TRUGW13939_07172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346207.1"
                     /db_xref="GeneID:55994665"
                     /translation="MSLLQAIQSRRSTYRLTNKSPIPDTRIQEIVNFTVRHAPSAFNV
                     QSARAVVLFREQHEKLWDVGLQVIQTEMPPAVRPVLETKVAGLRAAYGTVLWFEDGAA
                     LDALKDKNPAIQGLIPEWSAHSSGIHQFITWTALDNEGLGCNLQHYNFSTTFIENVHK
                     LWNIPSSWKLQAQLVFGQPEGSGPEKEKEIQPVEGERVLVF"
     gene            complement(<1161907..>1162582)
                     /locus_tag="TRUGW13939_07173"
                     /db_xref="GeneID:55994666"
     mRNA            complement(join(<1161907..1162202,1162288..>1162582))
                     /locus_tag="TRUGW13939_07173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490315.1"
                     /db_xref="GeneID:55994666"
     CDS             complement(join(1161907..1162202,1162288..1162582))
                     /locus_tag="TRUGW13939_07173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346208.1"
                     /db_xref="GeneID:55994666"
                     /translation="MRLSTLIPFLALALVSAAAALTTDQLLTISPNSLSCANAPAAGE
                     CATAADAVPIINDVFTSYLIYSPGEQAALLSLMAFETGDFKYNRNHFPGVAGQGTRNM
                     QSPSFNKQYASSIPEIKDRVNNNVSATLDLLLSRAHWDFGSAAWFLTTQCSEEVRLGL
                     LQGSQAGWEAYISGCVNTTVTEERRAYWKRAVDVLF"
     gene            complement(<1163085..>1164296)
                     /locus_tag="TRUGW13939_07174"
                     /db_xref="GeneID:55994667"
     mRNA            complement(join(<1163085..1163333,1163392..1163748,
                     1163799..1163954,1164018..>1164296))
                     /locus_tag="TRUGW13939_07174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490316.1"
                     /db_xref="GeneID:55994667"
     CDS             complement(join(1163085..1163333,1163392..1163748,
                     1163799..1163954,1164018..1164296))
                     /locus_tag="TRUGW13939_07174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346209.1"
                     /db_xref="GeneID:55994667"
                     /translation="MRRGVLIFIVVNLLIVAFLVRNVFTLLTLLVEDASEDAIHRTDF
                     PSADSGSPETRPQIIPKIIHQTYINESIPPQWVEPRQSCLELHPDYEYMLWTNEKSRE
                     FIATEYPWFLETFDGYKYPIQRADSIRYFILSHYGGTYIDLDDGCQQRLDPLLSYPAW
                     VRRTKPTGISNDAMGSVPQHPFFLRVIESLQAYDRSWLLPYITVMYSTGPLFLSVIWK
                     EYMGQSRDAERVRVLMPEEYNGTPWSFFTHNVGNSWHGADAQLIFWMLRYWVLLTVVG
                     FTLAGVVGFCMWSVYGRLLVAGQYRFRARGSSPSRRRPLSIMPNFLRRISSKTSISSD
                     EEIGRKSEGYFD"
     gene            complement(<1166507..>1167302)
                     /locus_tag="TRUGW13939_07175"
                     /db_xref="GeneID:55994668"
     mRNA            complement(join(<1166507..1167058,1167114..>1167302))
                     /locus_tag="TRUGW13939_07175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490317.1"
                     /db_xref="GeneID:55994668"
     CDS             complement(join(1166507..1167058,1167114..1167302))
                     /locus_tag="TRUGW13939_07175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346210.1"
                     /db_xref="GeneID:55994668"
                     /translation="MADVWGNGGQGGQFPLEQWFFEMPPCTRWWTAATVATSVLVQCE
                     ALSPLQLFYSLPAVYLRSQYWRLITTFLYFGPLNLDLLFHVFFLQRYSRLLEESSGRS
                     PAHFSWLLFYAMSSLLILSPFLSLPYLGSALSSSLVYIWSRRNPDTRLSFLGLLVFTA
                     PYLPWVLMAFSLIVHRIVPKDEICGVIVGHVWYFFSDVYPSLHNGHRPLDPPAWWRRL
                     FEGRASADDTQAANINPDIMAAAAPEVL"
     gene            <1168023..>1168708
                     /locus_tag="TRUGW13939_07176"
                     /db_xref="GeneID:55994669"
     mRNA            join(<1168023..1168269,1168359..>1168708)
                     /locus_tag="TRUGW13939_07176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490318.1"
                     /db_xref="GeneID:55994669"
     CDS             join(1168023..1168269,1168359..1168708)
                     /locus_tag="TRUGW13939_07176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346211.1"
                     /db_xref="GeneID:55994669"
                     /translation="MPPKSVRARPKSGGAADFERPTTREGDAGPSTTTTSPAITRSPK
                     ATKTAPSPAQGKKRKATATAGRVGKQPAAKKPRTSNIQPGDPTPTGRRRRYKPGTVAL
                     KEIRKYQRSFDLLLLKLPFARLVREVALDLLPAEVGAELRWQSHAIQALQEAAEAFLV
                     HLFEDTNLCAIHAKRVTIMQKDIQLARRIRGMWGGLGY"
     gene            complement(<1169251..>1172525)
                     /locus_tag="TRUGW13939_07177"
                     /db_xref="GeneID:55994670"
     mRNA            complement(join(<1169251..1170095,1170151..1170800,
                     1170853..1170968,1171017..1171034,1171089..1171199,
                     1171254..>1172525))
                     /locus_tag="TRUGW13939_07177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490319.1"
                     /db_xref="GeneID:55994670"
     CDS             complement(join(1169251..1170095,1170151..1170800,
                     1170853..1170968,1171017..1171034,1171089..1171199,
                     1171254..1172525))
                     /locus_tag="TRUGW13939_07177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346212.1"
                     /db_xref="GeneID:55994670"
                     /translation="MSYPPPYNTGQYPSQYPQYLQQLPPNPPHPPPHPAPVPQQQYNV
                     SPNVHYQHYPGAYGYPQAVLPQYVPGYGQQPMQQQPSPQQFQSPVIHQQQLQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQQQLQQNQQRISHPLPPQS
                     PQIQQQQRQQQFHSPVTQQQHIPPQQHHLQHQLQQQQQQQQQHYQQHQHQHQVPQHSQ
                     HSQPQQPPLLQFVNPADTFAAPAIHGTAPGSGSYTNGSPPAPSPVPQYAAAPPSVPTG
                     QPLAPYHTASSETKEKQYTSMTPPTTTPLPPQSTNPTPTPLRPDPQARKASSSPFNLV
                     PQVVIPSPGHLQQMSPKTPAVAAPQAPQVQARAPDEDVDYQTLLLALADEYLNAAHGK
                     GTTLALSKNSVDLADYYKLVATGLGCLEAAQVNFRLPPRTEALTRLRYARILIEETDN
                     DVEAETALSKGIEVCERNKLVDLKYTMQQLLARMLHKSNPKAAVKAIDNMIQEVETYR
                     YVPWEYAFRLLRVSLALSSGSHQEFVHAIHNLHKLSSLATRNGDKLVAVVASLMEALA
                     HLQLSTNSDSVEQAQNAVAAARRHQLDPSVQDIPQIGSMVQMVDISCSLLEYDLNQAS
                     QKLQIMQTLMDQRINDSRWRDDGSFSIPLNSKPPPTQGEMGDILRIEEGKLCLTLSWL
                     PQHDLYALCYFLSSVTLGSKNSHDGRKAEKYLQEGLRMVRGNFKAPEEIEESFVAAGK
                     RVEWRRILHCNILLHQMFLACARTDWDAAGQTLKDLRAATEQLGTAVPETVKCLMQYA
                     MGVISQGTGDLTSALAAFGSPILSLSSSSKTTRNDPRRDTAILAALNTILIIREPSHY
                     AHGRLNEVLSTVEPLCLSSSNKYIQAAYYLVCAIVHTDSTIQTKQYLQQALQSATAIS
                     NSQITCVTLTFMSWKYFRGVVGEQSEKSARASRAMAKKANDRLWVSVTDELLAETLDR
                     QGKTDEAHAVREEADRVLMGLPAPLKHAEYR"
     gene            complement(<1173278..>1174255)
                     /locus_tag="TRUGW13939_07178"
                     /db_xref="GeneID:55994671"
     mRNA            complement(<1173278..>1174255)
                     /locus_tag="TRUGW13939_07178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490320.1"
                     /db_xref="GeneID:55994671"
     CDS             complement(1173278..1174255)
                     /locus_tag="TRUGW13939_07178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346213.1"
                     /db_xref="GeneID:55994671"
                     /translation="MELNPDLYTVAWIAPLEIEAKAALFMLDNRHQGLFTWSPGHDYL
                     FHAGDIVGHNVIIATLPAGQECTTSSAAALASQIKIIFLNIRFGLLVGVASGIPNLSK
                     TPPCDIRLGDVLVALPDGESAGIVAYQLGKETKYGFQLLHGGHMLPRTETIIRSAIGK
                     IKIEAPDDADMFLPFYRSMQDKSHENGIFLDPGQDRDKLYAIYEDGVERAVNRKQRPD
                     SERTRVWYGPLGSGDNLMENGEKRNELRNKYNIIGLETGAAGTMNQIPVGVIRGVCDY
                     GDERKNKEWQPYASAMAAAYAKAVLYEILPRRGITHPIFTSRSDSGISV"
     gene            complement(<1174656..>1175870)
                     /locus_tag="TRUGW13939_07179"
                     /db_xref="GeneID:55994672"
     mRNA            complement(<1174656..>1175870)
                     /locus_tag="TRUGW13939_07179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490321.1"
                     /db_xref="GeneID:55994672"
     CDS             complement(1174656..1175870)
                     /locus_tag="TRUGW13939_07179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346214.1"
                     /db_xref="GeneID:55994672"
                     /translation="MRIHSLNLFARLRVSKRNVSKKEEMETSEENNDSGGSSNGRCYL
                     LELPTELLAMISEHLDPLSGACLSLTCKRMLVISGKSLVSDTLQFKKDFAPLFHHYRS
                     SHSFGADRWKLLVRLEDDRWLACSKCLKLHPRSAFTSKELRRNAADQRVCDFGEMAGI
                     VDLCPCRKLTFQDKVNMVKNLKDREVLTRMPSSILGSRHYDERYLWHSCTARYGTTET
                     KIELYPEIGDDGSLIMRTEYRLYVEPNRLGKHQHITPRFGCAHRSVDLWLSSVCQTLY
                     CHRYNSYCSSCKRITACSTCDTTLKCPKKRPFHCQETNRMFYFFWTQRNLGRSNNMPD
                     KEWAVQRTHPVEPHVTWNNCRELCPWTIRMHPPPPHAPLLDNDILNHGEEFASQVYTS
                     LHLEEVSTTNSH"
     gene            <1176897..>1178579
                     /locus_tag="TRUGW13939_07180"
                     /db_xref="GeneID:55994673"
     mRNA            join(<1176897..1177625,1177678..1177838,1177895..1177975,
                     1178039..1178162,1178222..1178350,1178412..>1178579)
                     /locus_tag="TRUGW13939_07180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490322.1"
                     /db_xref="GeneID:55994673"
     CDS             join(1176897..1177625,1177678..1177838,1177895..1177975,
                     1178039..1178162,1178222..1178350,1178412..1178579)
                     /locus_tag="TRUGW13939_07180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346215.1"
                     /db_xref="GeneID:55994673"
                     /translation="MGLLSWLLPSTEVSLVHCEQNQLLLQKKKSDSKDDKEKQEQVKL
                     IDLCRQATPPTCNLNPLLFNGHLQTGWTTIKENVEIPIYYKRKIFEQDDPSFPGQFAV
                     DFVVPPYATPVDDDEASDKARKYTLPSGLPTRTAMFTKNELSSLPSEDTRPMLIAIHG
                     LSGGSHEVYLRSALAPLVLGDKGWEACVINSRGCAQTKISTPVLFNARATWDVRCLVK
                     WLRKNFPNRPLFGIGFSLGANILINYLGEEGENCQLKAAVACANPWNLELTNHLLKST
                     WIGSEIYSAYLGSSLSGLFKDHVEQLEQHPGLSLEAVNGIKYIYEFDRLVQCALWGYP
                     TEGAYYRDASSIDSLLSIKIPFLAINAEDDPISAKQAIPYGEFQQTPYGVLLATSWGG
                     HLGYFETGGSRWFAKPASNFLDLMATEIDLTVAPVESKHDEKSEDVSTSVQKTPDRYS
                     FQPMRRRWFRSEE"
     gene            complement(<1178710..>1179423)
                     /locus_tag="TRUGW13939_07181"
                     /db_xref="GeneID:55994674"
     mRNA            complement(join(<1178710..1178850,1178910..1179059,
                     1179112..>1179423))
                     /locus_tag="TRUGW13939_07181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490323.1"
                     /db_xref="GeneID:55994674"
     CDS             complement(join(1178710..1178850,1178910..1179059,
                     1179112..1179423))
                     /locus_tag="TRUGW13939_07181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346216.1"
                     /db_xref="GeneID:55994674"
                     /translation="MAPIKGPSKGSSKGSSKSSSKGKPLSSTGSKISKSSSAKRNNVK
                     RPPPKEVKSQSRSAPDRQKKTKTREYTEKELGLPTLNMITPVGVQAPRGKKKGKVFVD
                     DQESMATILAIVNAEKEGQIESKMIKARQMEEIREAKKKETEARADKKKSKLEDVKDE
                     LRNKKKGGRTDKSSSAPKDSAKDKESTSKYKGKRKSVSFA"
     gene            <1179765..>1180408
                     /locus_tag="TRUGW13939_07182"
                     /db_xref="GeneID:55994675"
     mRNA            join(<1179765..1179807,1179889..1179950,1180079..1180333,
                     1180397..>1180408)
                     /locus_tag="TRUGW13939_07182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490324.1"
                     /db_xref="GeneID:55994675"
     CDS             join(1179765..1179807,1179889..1179950,1180079..1180333,
                     1180397..1180408)
                     /locus_tag="TRUGW13939_07182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346217.1"
                     /db_xref="GeneID:55994675"
                     /translation="MTINPTYLAQRTRQSINLADAQARVRMSYREWLRASPEIQTMYS
                     LNIPVSVIRTKIRQQFEKHRYVSQLKVVDVLLYQSHAEFQETLNYWKQLSHVMKYFRQ
                     EEEPAARLPANFISGFLEGRN"
     gene            complement(<1180732..>1181353)
                     /locus_tag="TRUGW13939_07183"
                     /db_xref="GeneID:55994676"
     mRNA            complement(join(<1180732..1180865,1180933..1181009,
                     1181070..1181161,1181228..>1181353))
                     /locus_tag="TRUGW13939_07183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490325.1"
                     /db_xref="GeneID:55994676"
     CDS             complement(join(1180732..1180865,1180933..1181009,
                     1181070..1181161,1181228..1181353))
                     /locus_tag="TRUGW13939_07183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346218.1"
                     /db_xref="GeneID:55994676"
                     /translation="MPSAQPEEQDQSMVDVDVVDEVPEEEIDEDKEIEIEENRVTVLS
                     GATETAASFQFKDEGHTLGNALRYVIMKNPAVEFCGYTIPHPSEAKMNLRIQTYENTT
                     AVEALEKGLDDLMDLCDVVTDKFTIARDNFNATKADQMAV"
     gene            <1183162..>1184560
                     /locus_tag="TRUGW13939_07184"
                     /db_xref="GeneID:55994677"
     mRNA            join(<1183162..1183352,1183420..>1184560)
                     /locus_tag="TRUGW13939_07184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490326.1"
                     /db_xref="GeneID:55994677"
     CDS             join(1183162..1183352,1183420..1184560)
                     /locus_tag="TRUGW13939_07184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346219.1"
                     /db_xref="GeneID:55994677"
                     /translation="MSTAVAPATAAPPLPTALDRASSPQPYPASASASASASTSTPSR
                     MPHDGHGGQSSPEGKNTPSSNNARKIVVKTEPPSSPSMSAQNTRPRPRKLDLSASTLS
                     VRGPAGPMTAREGRGMHHVGLACLSPGFQTDDPVRQEQLQRSMTVRDQQRSIIESRLQ
                     RSAKGDGPDMSKALDSNPFSSARGPKKRPPPGLSIVPPSAAQFANERVVQSAPLNQTF
                     TGRHDPPSMTRHVLNQTANLPSPSHIQHVPAMQTNNRLPPLADVFGSDLSSRERERDR
                     SGHLPAVGANTAQSTIPPFSSSPGHSSQQRPREYRSAEEAVLELSGGHEELIPRTIHY
                     SGQHQPATPPSPYTNGNFSTAPTAQQAHVPPPAQGTSRRRTRSEYEQDNGSPPLGTAP
                     EPRYRNGPGPAVPSSSSYGPFGAGRDSPETQRKKKEEFLQLCARAWDLFHS"
     gene            complement(<1185271..>1186269)
                     /locus_tag="TRUGW13939_07185"
                     /db_xref="GeneID:55994678"
     mRNA            complement(<1185271..>1186269)
                     /locus_tag="TRUGW13939_07185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490327.1"
                     /db_xref="GeneID:55994678"
     CDS             complement(1185271..1186269)
                     /locus_tag="TRUGW13939_07185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346220.1"
                     /db_xref="GeneID:55994678"
                     /translation="MAISEALNKRIRARHDEDEDDLATESSSNEEVDEPSDEDAEMND
                     NASDDSEKDDDDDEKEEDSMSESAGDENEAVQSEMRQISFGALAKAQDSIGKRKRGQS
                     DSIKDTKVSTLDDIRERLRKAREEKQQGSKTPNSTYAENSTKRPAARSSKHAPKVQSS
                     KYQVTRRRIVVEPPNAAKARDPRFDPTVAATRHNEAAMNKAYSFLDEYRSSEIKQLKE
                     QMAHTKDAALRDKLKRAITSAKDRQRAMDNKKHEQEVLGEHKKKERQLLREGKKSQPY
                     FLKNSELKREVLKKKYESMGSKERAKTLERRRKKVASKEKKDLPWARRGMENADGS"
     gene            <1186737..>1188794
                     /locus_tag="TRUGW13939_07186"
                     /db_xref="GeneID:55994679"
     mRNA            <1186737..>1188794
                     /locus_tag="TRUGW13939_07186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490328.1"
                     /db_xref="GeneID:55994679"
     CDS             1186737..1188794
                     /locus_tag="TRUGW13939_07186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346221.1"
                     /db_xref="GeneID:55994679"
                     /translation="MATDDISDSTSRGKRKHNHNHVANPAHQENNNSNDPSSQTDEPT
                     AQSQWKPFHGRWQQQQPNRTKSNNNNNNTHISQQQKKNAKGKGKGKANANANTDTSAD
                     PPQPRRSRRVMKAQRKAEQDAQKEARRIAHDLKQLGRQVACDTTANNSTALFGDATTS
                     MGYAGSQGVVGPAATPVFTGSSQGYPFLQGHQSLHGLQSLQNPRLPLQFPSQLTSQPG
                     LGLWSGNLQQTSALSTNAGVESAMQEEDAEIGDSDASNNIKQVDAVKDVSHAQNQQPS
                     RKAPAYPAPVPTASYLEQASKPPKEALDFMQPLLIILDLNGTLLHRINKKMPPRFVKR
                     PALNHFLERVTARHMVMVWSSAQPATVETICRQIFTPVQYAKLVAIWNRTHLGLPEDL
                     YRNKIQVYKQLERVWADKKIQSQYPNSKHRCGKAIHHVIKYNPHAPVENEMTGVNSLR
                     WDQSNTVLIDDSRLKAAANPYNIFEVPEFTNKPNDDDELVLKALLERIKFIAKSNDVS
                     RCLRSWSEQGGEGITMDRGHILDVARDEMTHGPQIRSTNKKKLQAITKDLTKADEKTD
                     DKVRRLIRRDKKMGHRTLLKPTPPPMPLLQTEEDREKTAKIAGEKGDEFQDDGETTGS
                     ISSLLDSPELLSEESESEYVVNLERSGSAFLTKKKMYREKKKGKGKRATSNKDRGQGD
                     QDD"
     gene            complement(<1189159..>1190720)
                     /locus_tag="TRUGW13939_07187"
                     /db_xref="GeneID:55994680"
     mRNA            complement(join(<1189159..1190171,1190407..1190608,
                     1190691..>1190720))
                     /locus_tag="TRUGW13939_07187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490329.1"
                     /db_xref="GeneID:55994680"
     CDS             complement(join(1189159..1190171,1190407..1190608,
                     1190691..1190720))
                     /locus_tag="TRUGW13939_07187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346222.1"
                     /db_xref="GeneID:55994680"
                     /translation="MSFGKLYGVPTNPRTIPARVAAKANELDLEFVEIDVAPDAAFKN
                     SAEYRSLNALGKIPTFVGANGFVLTEAIAIAIYITSQNEKTTLLGKTKQDYASILRWM
                     SYANSELLPRVGSWYRPLLGLDPYNKKNVEDAAKTALTNLAVLEKHLTAQTYLVGERL
                     TLADIFASASISRAFATVLDKKFRSEHPAIARWYTTVINQSIYQAVVENPVLVEEAVK
                     YTPPKKEEKPKKEAPKAAPKAAEEEEDEPKPAPKPKHPLEALGKPTLVLDEWKRQYSN
                     EDTRPVALPWFWQNYKPEEYSLWLVDYKYNNELKLTFMANNLIGGFFARLEASRKYLF
                     GAAGVYGQNYDCLIRGVFLVRGQEAIPAFDVAPDWESYEFKKLDHTSEEDRKLIDDLW
                     AWDVPVVREGKEFAFADGHVFK"
     gene            <1191063..>1192057
                     /locus_tag="TRUGW13939_07188"
                     /db_xref="GeneID:55994681"
     mRNA            join(<1191063..1191903,1191966..>1192057)
                     /locus_tag="TRUGW13939_07188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490330.1"
                     /db_xref="GeneID:55994681"
     CDS             join(1191063..1191903,1191966..1192057)
                     /locus_tag="TRUGW13939_07188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346223.1"
                     /db_xref="GeneID:55994681"
                     /translation="MALQRSRCLSRGVGEAVLSAATSTTARPMGPLSLRVKQMRQFST
                     TPRRRELEEIKAAPPIELGKFAVSPTRIIPASPSYFSGSPKFIDHQIKLEAFLDKYSS
                     MPTVSATEAPRMAWFKLAQFRDFLGEPIPAKKYKNFQKVLQRLNRIQPSIAPPAVRSA
                     LNDYVRPGNPYANKPAPREVDEFGRGRGKGKRKESSAVVSLVEGEGQVMVNDRNIVDV
                     FPRVHDRESALWALRCTARLDKYNVWARVSGGGVTGQAEAITLAVGRALMVHEPALKP
                     ILRQAGVITVDARRVERKKPGHVKARKMPTWVKR"
     gene            <1194597..>1196090
                     /locus_tag="TRUGW13939_07189"
                     /db_xref="GeneID:55994682"
     mRNA            join(<1194597..1194629,1194699..1195704,1195798..>1196090)
                     /locus_tag="TRUGW13939_07189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490331.1"
                     /db_xref="GeneID:55994682"
     CDS             join(1194597..1194629,1194699..1195704,1195798..1196090)
                     /locus_tag="TRUGW13939_07189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346224.1"
                     /db_xref="GeneID:55994682"
                     /translation="MLINLFSDLGNKTLVAKLDLYPSPPFSPPTSRKGTAFDSLGGGP
                     RGMDGDNTKQDDPSSFPSSFNLSQHLVQQHMSPRHSTERFRRPTTPRANRAPSSHGRG
                     RTHVPDYATYGYPAAQPSSSSSSSLASGSLQSVALPFQDPLSPESVRQQYSRRQASSQ
                     DFSYPLHPQQQQSPYDPGLVYGLAQPGSAQVAYNIGMFQPRSAESLEPMTPQFGVSQY
                     LESSEHVGEDLTHYLNTQRQPYQQGSPSTQSTSAYPNTINSYNPARAVDNMDQQQQYH
                     QYHQQQHQQQPQEEHQQYNKKNPIYWEPPYMDYSLSLKTAFSYTSEGRLEESMRLTIE
                     LSTWLVNNAKELGLFRDDPARHEWHQGLWRDLNHCWLAIFQKQKDVTSSLVPGSGQIR
                     EAANLLTYWVLKNAGNTLIGLCDQLAGEGLVDYEMGVWENEIISSKKRSHF"
     gene            complement(<1199160..>1199904)
                     /locus_tag="TRUGW13939_07190"
                     /db_xref="GeneID:55994683"
     mRNA            complement(join(<1199160..1199493,1199551..1199624,
                     1199678..1199730,1199796..>1199904))
                     /locus_tag="TRUGW13939_07190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490332.1"
                     /db_xref="GeneID:55994683"
     CDS             complement(join(<1199160..1199493,1199551..1199624,
                     1199678..1199730,1199796..1199904))
                     /locus_tag="TRUGW13939_07190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346225.1"
                     /db_xref="GeneID:55994683"
                     /translation="MEQTHEPNSAALYNTRRRQGSIGGQQVLDSIISASNFDRDEVDR
                     LRKRFMKLDKDNSGTIEREEFLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLS
                     AFSSKGNKEEKLRFAFKVYDIDRDGYISNGELFIVLKMMVGSNLKDVQLQQIVDKTIM
                     EADKDQDGKISFDEFKEMVENTDVSMSMTL"
     gene            <1200427..>1202365
                     /locus_tag="TRUGW13939_07191"
                     /db_xref="GeneID:55994684"
     mRNA            join(<1200427..1200585,1200731..1201213,1201263..1201559,
                     1201610..>1202365)
                     /locus_tag="TRUGW13939_07191"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490333.1"
                     /db_xref="GeneID:55994684"
     CDS             join(1200427..1200585,1200731..1201213,1201263..1201559,
                     1201610..1202365)
                     /locus_tag="TRUGW13939_07191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346226.1"
                     /db_xref="GeneID:55994684"
                     /translation="MTRYGGMGRTRPKKLTSKASIPIVREDQIDYLDEDIHATLQQIE
                     TGVEKAEESEVHLQAAINAAALGKVSEANIPTPETILSNIQYDELYPPTFSQPATYIR
                     FSSTVEDCCGCPYDLVEEDDVFLKIMNEKKDPEARCTENQFEEVMHFFEETAQTKQPF
                     AAVDNPPVISFEEIEESFDAAVEEHIKIFAKEIYDHWKRRRIEAGNRPLQLALKFETG
                     QETDDGDPYVCFRRREVRQIRKTRGRDAQSAEKLRRLRKELEEARQLVGFVRSREVAR
                     REMLKNERQIFQQRAQVKDMKRKLNIKDDDEDLINQKPKKKQAEMPSVQRPAAPQLRV
                     STRPGSNVADDLQLLEDVQADKENEILRDIKQNLQKHIKWNEGYVDLTTAPLSTSPKR
                     TFEAAFRPAITTQLPTPPSSDSSEPNDSTVDALHPYFRERFAEMYVEDNTNKMPSFRR
                     RIGRGGRVMIDRRNLTTRVSPDVDPLKMDRFKYDDEDDDDVIFERDKYDVQVMQHRVV
                     MAAKARDLAAQVQAQAQAQAQAAQAARQLLGERNGAQGAAMGANSGPSAVTANSAA"
     gene            complement(<1202763..>1204395)
                     /locus_tag="TRUGW13939_07192"
                     /db_xref="GeneID:55994685"
     mRNA            complement(join(<1202763..1203239,1203292..1203519,
                     1203584..1204180,1204234..>1204395))
                     /locus_tag="TRUGW13939_07192"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490334.1"
                     /db_xref="GeneID:55994685"
     CDS             complement(join(1202763..1203239,1203292..1203519,
                     1203584..1204180,1204234..1204395))
                     /locus_tag="TRUGW13939_07192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346227.1"
                     /db_xref="GeneID:55994685"
                     /translation="MPTSHFPDAGSFQRQSDEFAAWLSQQPGVKLSPKIRISDLRAQG
                     SGRGVGMFALPLLVASSDIEEGEELFSIPRNIILTVQNSRLNNHIPQELAELGPWLSL
                     ILVMIHENLLRDQSIWKPYFHVLPTEFDTLMFWTGQELSSLQASAILDKIGKQEAEQS
                     ILETLLPVVRSHAHLFPSTPEIPSFDGDAGARSLLQMAHRMGSLIMAYAFDIEKGEDE
                     EEAGEDGYLTDDEDQLPKGMVPLADLLNADADRNNARLFQEETSLVMRAIKPVKAGDE
                     LFNDYGEIPRADLLRRYGYITDNYTKYDVVELPLPLICQAAGLEDVESKPYPQLEFLE
                     QLEVLEDGYCVPRALPDESLQDILPYELLVLLKVLTLNGEELQQHHEKNKPPKPSLGS
                     HEAQILLNAVQAKMSQYATSIEQDLQTLQQLAPISGLDTSTRRHKMAIQVRVGEKEVL
                     HQLYLMLASLIPSDAQATKKRAADTTLQGLQHKKGRN"
     gene            <1204785..>1205943
                     /locus_tag="TRUGW13939_07193"
                     /db_xref="GeneID:55994686"
     mRNA            join(<1204785..1205136,1205207..>1205943)
                     /locus_tag="TRUGW13939_07193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490335.1"
                     /db_xref="GeneID:55994686"
     CDS             join(1204785..1205136,1205207..1205943)
                     /locus_tag="TRUGW13939_07193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346228.1"
                     /db_xref="GeneID:55994686"
                     /translation="MIAIGLEGSANKLAVGVMLHPKDGGPAQVLANIRHTYSPPPGEG
                     FLPKDTAQHHRAWVVKLVKQSLQEARVNVEDIDCICYTKGPGMGAPLQSAAIAARTLS
                     LLWGKPLVGVNHCVGHIEMGRCVTGASNPIVLYVSGGNTQVIAYSSQRYRIFGETLDI
                     AVGNCLDRFARVLYIPNDPAPGYNIEQLAKKGKQLVELPYTVKGMDCSFSGVLAYVES
                     LANSLGINGESGAASEELTQADSDDKGQVDGKLTRADLCFSLQETIYAMLVEISERAM
                     AHVGSKDVLIVGGVGSNERLQEMMGIMARDRGGYVYATDERYCIDNGIMIAQAGLMAY
                     KEGFRTKLEDATCTQRFRTDEVLVTWRD"
     gene            complement(<1206084..>1206767)
                     /locus_tag="TRUGW13939_07194"
                     /db_xref="GeneID:55994687"
     mRNA            complement(join(<1206084..1206521,1206576..>1206767))
                     /locus_tag="TRUGW13939_07194"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490336.1"
                     /db_xref="GeneID:55994687"
     CDS             complement(join(1206084..1206521,1206576..1206767))
                     /locus_tag="TRUGW13939_07194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346229.1"
                     /db_xref="GeneID:55994687"
                     /translation="MDASTWQLAWRSSTALLYYLTYPIFLLAKAILGILAIISTPFVY
                     LGKTLLDWGLAPFRFLAKFESRSRVIRSVRIWTNQDYAQALFIFLGWAALIGCAVGFL
                     LYTIYDAVEGVLQSLEPYPSPEKTPKDYSQTLGSQWDLQWNKANSKHSRSQPCYDYFS
                     ATSAKEPAKFSDLYSAWESSSQRFPSTKDTALISTTILEEEDDSYDVED"
     gene            <1207218..>1208691
                     /locus_tag="TRUGW13939_07195"
                     /db_xref="GeneID:55994688"
     mRNA            join(<1207218..1207960,1208064..>1208691)
                     /locus_tag="TRUGW13939_07195"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490337.1"
                     /db_xref="GeneID:55994688"
     CDS             join(1207218..1207960,1208064..1208691)
                     /locus_tag="TRUGW13939_07195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346230.1"
                     /db_xref="GeneID:55994688"
                     /translation="MGNNPSKSPAGDLQAPVTNSHNTSGHERKVNRRTSINALSGTKA
                     TAADPSASRESATGQPASHGQNTVQQRLQSRKVPQPAPRIQEIPDKYAGRKAEGRYHP
                     STAVEASSPKQVPSASARPAARKDAPITPVNQLNTYYGSSHLQRPPRLPLPIGDATAT
                     PGSPVMAPTGAQVDSVPFEIDDQVPRASIALDDTHIEDEELEDELQSYALVDPGKAVP
                     TAIQWKAPGDRVYVTGTFVNWEKKFRLHKSEAEPGTMSTTLHLRPGTHHLKFIVDGDM
                     RASDNLPTAVDFTNHLVNYVEVIADEMQGQRSRRESDRAMKNVVPPGVHPPQVLPETL
                     TTQEKQENIYSEGEEEGEPEEEIPVGDFRDTLPPFLVDIDAEDEGAEYQRAANVIADT
                     STPPILPLFLGRSILNGTTPMKDDNSVLNYPNHTVLNHLATSSIKNGVLATSVTTRYK
                     RKASNR"
     gene            complement(<1209526..>1211856)
                     /locus_tag="TRUGW13939_07196"
                     /db_xref="GeneID:55994689"
     mRNA            complement(join(<1209526..1210625,1210676..1210946,
                     1210999..>1211856))
                     /locus_tag="TRUGW13939_07196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490338.1"
                     /db_xref="GeneID:55994689"
     CDS             complement(join(1209526..1210625,1210676..1210946,
                     1210999..1211856))
                     /locus_tag="TRUGW13939_07196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346231.1"
                     /db_xref="GeneID:55994689"
                     /translation="MAGKRLLDAAQFLGAAKSISGKHIAARRQQLDVYTRTSSLTEGL
                     RDKGNSLIVTAQAASAIFQRFNEAPQPSSSDAETSGYSQTAQKARESAAQYGQNAGQP
                     FTGGTKEANTGAEAEKPRDQSAHQVPQEQAVHNVDGKPDDLIISQAQETFYRPSQKSK
                     SVPSNVPELKLPAATSTTQQQGSQHDVDKNINPDVFHSQTSEHEGPPDEILQSVFHSP
                     RVANLLLSKEKRPHLAGVKSHLPEHRPVEYSQNPDVRSKIEATQDSILQNEKNESVSE
                     ILEPLSRELENNDIPTASPSYQMLESRVPSTRLGRLWQYGGLATSMAFGAVGETLRRA
                     TGSKDESNGSIMFSAGNMERLVAKLSKMRGAALKLGQMMSLQDSQMLPESIAVVLQRV
                     QDRADYMPQSQRDTVLVDNLGANWRELFESFEEVPMAAASIGQVHGAVLKDGRRVAVK
                     IQYPGVADSIDSDLNNLSILLTASRLLPKGLFLDRTISNARTELGWECDYIREAQCAD
                     RFRALLGNKQASFVVPEVIHEASGKQVLTMERMDGIAVTKIKTFTQEQRDWVGTEILR
                     LCLREICEFRFMQTDPNWTNFLFNAEKNRLELLDFGASREYPAEFIELYVQTLVAAAR
                     NDRARCKDLSVKLGYLTGYESQAMVDAHVDSIITIAEPYRDSAPDVYDFRDQTITDRV
                     RSLIPVMLRERLAPPPEETYSLHRKLSGAFLLCAKLESRVPCKELFWSVVKEVEKGKQ
                     SN"
     gene            <1212073..>1213071
                     /locus_tag="TRUGW13939_07197"
                     /db_xref="GeneID:55994690"
     mRNA            join(<1212073..1212217,1212284..>1213071)
                     /locus_tag="TRUGW13939_07197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490339.1"
                     /db_xref="GeneID:55994690"
     CDS             join(1212073..1212217,1212284..1213071)
                     /locus_tag="TRUGW13939_07197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346232.1"
                     /db_xref="GeneID:55994690"
                     /translation="MSSNANLNGMSPVELESEITELELRLKDARSRLQDAGKLSIRNL
                     SMDHQDTNKNTQLPSFLHPLLLICDTALPLGSFAYSSGLESFIAHNKVSSTQNTQSAS
                     FQRFLKLSIASVSSTSLPYLLEAYRFPGELERLDNDFDASTPCTVARRASVAQGRALL
                     NVWEKSFRMTYSRRTHTIDPSTTISAVAAIENFSQALKSGGFDDELLGPNGHFAPLWG
                     TFCSAVGIDINLAAYTFMLNHAKAVLSASVRASVMGPYQAQSILASDQLRDSLNNRIQ
                     AEYHTKTEDAGQVAPVLDLWVGRHELLYSRIFNS"
     gene            complement(<1213536..>1216052)
                     /locus_tag="TRUGW13939_07198"
                     /db_xref="GeneID:55994691"
     mRNA            complement(join(<1213536..1213625,1213669..1213713,
                     1213765..1214832,1214895..1215445,1215506..1215557,
                     1215617..1215760,1215870..>1216052))
                     /locus_tag="TRUGW13939_07198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490340.1"
                     /db_xref="GeneID:55994691"
     CDS             complement(join(1213536..1213625,1213669..1213713,
                     1213765..1214832,1214895..1215445,1215506..1215557,
                     1215617..1215760,1215870..1216052))
                     /locus_tag="TRUGW13939_07198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346233.1"
                     /db_xref="GeneID:55994691"
                     /translation="MPTVEATPVTSESGLIKMEDRKRPAGHDQSDVTPPLKKQATSIN
                     GNKPHPDADMPWKDDLDRFTKDAIWRQMQEFKREKVTLETKVKEMTKTATFHQDHLRI
                     IDAWFKQLIDEVKILVSDSDIQAKDHPPFRTSLLFDDDDKFKKHLKDRSDDIKETISR
                     LISTSPKATAEVSELQSKLAKKLAEEKVSITELEKALSERQQFEEQLEEASLRYMMAE
                     KKLDRARSLTVAKLEKQYLLGAQRPGGDGSSSVGREESSPVNGSGPAPEKNTGLEETY
                     NKAMAVSQKQREQLEVLEAENAKLTSQVTSLTVKNSRLTDDDYANTALFKQFKSQHED
                     VIKRINHLEALNVQLRQEAEKLQAERTAYRNQMDAEKQKEVEEKDAQLQKAETDLARI
                     RNARDELLADQQMRKAAQDQERTAVEKVRELAAAREAQITALESELERSRIQVDASKE
                     SSAEELPIEELRAKYQSLERQYSLLNTELTSMQTVCKKYSTLAMQKTTDFSALEEKTQ
                     RLVAEKAKADQKYFAAMKSKEARDAEVRTLRLQNSKSSDIISQLKDAESATRQLVMNL
                     EKQLSERKEALNSVSTKYRALQQQGNESSIIVEGLKAQVAELKTMATTKDSSLSNATS
                     ACRKAETEIESLKSSLADTTKSLENWKTKSLGNSSSEYEMLRSLALCTVCRRNFKDTK
                     NDRFRGPGSVQIATNRSEAMIICISRFE"
     gene            <1216453..>1218245
                     /locus_tag="TRUGW13939_07199"
                     /db_xref="GeneID:55994692"
     mRNA            join(<1216453..1216480,1216543..>1218245)
                     /locus_tag="TRUGW13939_07199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490341.1"
                     /db_xref="GeneID:55994692"
     CDS             join(1216453..1216480,1216543..1218245)
                     /locus_tag="TRUGW13939_07199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346234.1"
                     /db_xref="GeneID:55994692"
                     /translation="MKSFTSSAINKSGKKFAPKAPARRPAAASKPAAPAPKPNPDIEN
                     QNAPTVPQPEAGHAAAGALVADPPIEKPSDSQLSQTVEPPAPTSVPVSQPKPVPSVPV
                     LKTSGQPQKKRDAVGKAVPIPIPIPKPRRATALPTPTTETSSSKARVTSNVPQTDAPP
                     ARQSTEETALRERDINNLGQVQQSYNDYNDETTPQQLSTAQNRLPELDEPTGNVETNN
                     VDLDSTLEPLRTDESSVTPVSREASHAEENGSATTVPKKGRKPPTAPRKTKRTGAEPQ
                     VKKQRTKRKREATPEESEAVEIAPTVIKMSELCRDLRTGKKSKREVELRGLESAEAER
                     KQRAKDDSRNSVSTVKQQSENNETGADNPESTPQKNQSGPRMRIVNGEIVIDNESLQV
                     DRRADLESSHMEDVLESRLSRKINQASYGKRTKAESWDEEMTDLFYRGLRMFGTDFMM
                     ISKMFPGRSRRQIKLKFNNEERRDPERIKSTLMGPPEAVDIQSYSEMTNTVYEDPQLI
                     QQELDEDKKRIEEQHAKEKLAQEDLLRNPGGPSGDANVAQSVEKPARSKKQTSASKNV
                     YWGKEEILND"
     gene            complement(<1218481..>1219377)
                     /locus_tag="TRUGW13939_07200"
                     /db_xref="GeneID:55994693"
     mRNA            complement(<1218481..>1219377)
                     /locus_tag="TRUGW13939_07200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490342.1"
                     /db_xref="GeneID:55994693"
     CDS             complement(1218481..1219377)
                     /locus_tag="TRUGW13939_07200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346235.1"
                     /db_xref="GeneID:55994693"
                     /translation="MQAILVNYLPFCFTLLSLAFAAAPGQDAILLSNVQTLTLHGGRM
                     TSHRRVSPVPQLKCVGPSSSICKLYSIDTMRCTNQGHAYDEEDVEWTCTASLPAEFKL
                     GSTNVICEGYRDSNDPWVLKGSCGVEYRLLLTDEGKKRYGHHYAKHGTTNDKPSTSSL
                     GWVVWLVLFVILVLVLFTLCDNSSNPRRRGSNRRRRPRGPGGGGGGGGWDDPRDPPPP
                     YDYNPDTHWKPSTSSSSSRPGFWTGAATGATTGGAAGYAMGRRSRGSSSFQTDPGEGS
                     SRRSSGFSSTSPSTGFGSTQRR"
     gene            <1220036..>1221630
                     /locus_tag="TRUGW13939_07201"
                     /db_xref="GeneID:55994694"
     mRNA            join(<1220036..1220054,1220116..1220146,1220217..>1221630)
                     /locus_tag="TRUGW13939_07201"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490343.1"
                     /db_xref="GeneID:55994694"
     CDS             join(1220036..1220054,1220116..1220146,1220217..1221630)
                     /locus_tag="TRUGW13939_07201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346236.1"
                     /db_xref="GeneID:55994694"
                     /translation="MSQHSQNDASGVLAQPSLSFTQGFILGQLSIVLLIGAFIKFFIF
                     GEAPVPPSRGLASRTAAHRRSYSINQADNSGVSPRTLREKPSTSNVLRPVPASATNTL
                     SILRKTYYNAVPPQFSTKHGRNRIQHSTHQPESLDWFNVIIAQTLAQYRQTAYLLKDS
                     PTSSVLDSLSAAINDPDKKPSFIDTIKVTDISLGEEFPIFSNCRVIAVDDPTSDGGRL
                     QALMDVDLSDDNLSLAIETSLILNYPKPRSAVLPVALSVSVVRFSGTLCISLIPANAS
                     ASSQGPASAPDTTPLGARSLFQQIIPEASEPAENTSPESPKTGVPKTNLAFSFLPDYR
                     LDLSVRSLIGSKSRLQDVPKVAQLVEARIQSWFEERVVEPRVQVVGLPDFWPRMGRTG
                     VREDGDTATTNTAASSRAGQSRTADVAGSEEAIIESDTEQEGLRFRGPSRYESARADD
                     IPRASGVYGEESDARRPVNLTSSQSYDIPGSMPGSAL"
     gene            complement(<1221773..>1222426)
                     /locus_tag="TRUGW13939_07202"
                     /db_xref="GeneID:55994695"
     mRNA            complement(join(<1221773..1221883,1221933..1222304,
                     1222397..>1222426))
                     /locus_tag="TRUGW13939_07202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490344.1"
                     /db_xref="GeneID:55994695"
     CDS             complement(join(1221773..1221883,1221933..1222304,
                     1222397..1222426))
                     /locus_tag="TRUGW13939_07202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346237.1"
                     /db_xref="GeneID:55994695"
                     /translation="MKAYYYDNAPGDQREDHDSGRQVDTSYLESLGVVYRLCPQVADV
                     DALARDRGYKNRDEITVSPEKMGDIYEEKVKSFFHEHLHEDEEIRYILDGEGFFDVRS
                     QNDDWVRIRLVKNDLLILPAGIYHRFTTDSKNYIKAMRLFQDEPKWTPLNRGPEVDVN
                     PHRQSYLQRS"
     gene            <1224362..>1226506
                     /locus_tag="TRUGW13939_07203"
                     /db_xref="GeneID:55994696"
     mRNA            <1224362..>1226506
                     /locus_tag="TRUGW13939_07203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490345.1"
                     /db_xref="GeneID:55994696"
     CDS             1224362..1226506
                     /locus_tag="TRUGW13939_07203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346238.1"
                     /db_xref="GeneID:55994696"
                     /translation="MQASTMALRLRSTAPFRRGYNAHNLITAHRRHFASHSSARYLPL
                     NFTSAQPHISKTTNADQCFSCTRPYDVVVIGGGHAGAEACAAAARSGAHTALVTPSLS
                     NIGVCSCNPSFGGIGKGTMIREIDALDGVAGRIIDKAGIMFRMLNRSKGPAVWGPRAQ
                     IDRDLYQRYMRDELVSTKNLSILEGKVADIVLSREEDGVLSAGTKGKIVGVRLESGEV
                     IPTSRVVITTGTFLGGEIHIGLEVYPSGRMGEAATFGLSKSLRDAGFELGRLKTGTPP
                     RLDKKSIDFSSLEVQPGDSPPNPFSYMNDAVQVGDEGQLTCWMTHTNEESHKIIRANL
                     DKSIHIRETVKGPRYCPSLESKIIRFTDKPQHQIWLEPEGFAPNDVIYPNGISMTVPA
                     DAQEAMLRTVRGLENVRMLQPGYGVEYDYVDPRNLKPTLETKLISGLYLAGQINGTTG
                     YEEAAGQGVLAGTNAGLAALGRPPMILSRADGYIGIMVDDLITKGVSEPYRMFTTRSE
                     FRISARSDNADLRLTAMGREASVVSDKRWNHFAETKAQIDELWSLLENTRFTSNHWSR
                     LGFPTRVDTSYRTALDMLCLKGVSVESLIPYIESSTKGIAYSATSFPAEIRKRVTIEA
                     QYAPYVTRQNLMAERFKREENMLLPPGLDYATVHGISTEERQILGRVRPESIGMMRRI
                     EGITPTGALRLMMHVRQAERLGEQDIASATLT"
     gene            <1230971..>1234971
                     /locus_tag="TRUGW13939_07204"
                     /db_xref="GeneID:55994697"
     mRNA            join(<1230971..1232403,1233525..1233641,1233713..1233805,
                     1233873..1234198,1234257..1234521,1234932..>1234971)
                     /locus_tag="TRUGW13939_07204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490346.1"
                     /db_xref="GeneID:55994697"
     CDS             join(<1230971..1232403,1233525..1233641,1233713..1233805,
                     1233873..1234198,1234257..1234521,1234932..1234971)
                     /locus_tag="TRUGW13939_07204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346239.1"
                     /db_xref="GeneID:55994697"
                     /translation="VDMVNGAAAVLEPTYHGYVATTQDALILFEACLTGVLHHVPRRP
                     HDRERSHLVRSGSVFIYEENSSGIKRWTDGVTWSPSRILGNFLVYRELDKPFPPGEKK
                     RAMKKGNRRPGQPARPGEPYARPESNGQAYSPTTPSSAFGDRPAQSDVERALVGSLVD
                     SYGFKDSGLVKKTMSVTVSGVTHHLVSYYSVEDVLKGILSPPSMHEELRFVRPRGELT
                     TKQSFRAPIDDVDTGLESPHDPSQALYGYRPALVTPSAYGMPNPHPDYYMHSSTYASH
                     PSQTGSISAYPSGPLPPQTSSNPYLPSPSNSSHMGLKPDTDHSSFRTNPYGSAFDSMS
                     QNHLPTTLPPALNTTGLPNSLDRNRSHQTSSPSIYRNASIPSRSLTTDLSPPNDPSPT
                     ANSYSRGTYNLPGQLDNASTQSLEQRNIAAASFDPTIPRRDTATISSYYTGSADRQSY
                     YPGVAHSNYPTAQPMSAWTTAAPAQPGIRQQQLFNTTSYLTSTSGLSSRNGVVGSRRE
                     FGFCTSLKRGQSGQFRFAGSTGQKRWSGSSNPPEGQTPGKTENGDKKKPSLLSKLPGP
                     VVHENIYTVPNLLTFSRLLAAPAVGYLLVHNHHAAALSLFAYAGITDLVDGYIARRYN
                     LQTVVGTIIDPAADKLLMTISVVCLALNGSMPAWLAALILGRDVGLSISAIYYRWVSL
                     PPPKTMARYWDFSLPSAEVKPTTISKANTALQLLLVGTSMAMPVVPAWLAGAWGLHDG
                     LIGLQCAEIEAPLISSD"
     gene            <1236792..>1237754
                     /locus_tag="TRUGW13939_07205"
                     /db_xref="GeneID:55994698"
     mRNA            <1236792..>1237754
                     /locus_tag="TRUGW13939_07205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490347.1"
                     /db_xref="GeneID:55994698"
     CDS             1236792..1237754
                     /locus_tag="TRUGW13939_07205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346240.1"
                     /db_xref="GeneID:55994698"
                     /translation="MGKGRDKKKYKKKGKKRTSEEAGIQQHQLDEEEEKIRELATSHP
                     DLFKQILEDMRTEQGADSNEEKTEDERTPPPKKKSKKKKSKSLGEGKPDFKMIKGMSD
                     NAGNIYHDAPGSIYTRDEYRYFWCELPFTIPPIPSKPMKPELIDVVSSEIVGVVNSNA
                     SPIEDSKTKQICASQLVRIRAKSNGQGYDFVLAQSRKIVSSEHVILGGNWTKSSVSDL
                     AKAIWDNYTEDKVRRKKDYDTQFNAWLKEMRGWEWEMFLLAQKHAEAITWSPNANKAK
                     ILAASFKEEVLLPAGEEIERHPGHFYASTTDKNRSWAHHPRHEF"
     gene            complement(<1238765..>1239697)
                     /locus_tag="TRUGW13939_07206"
                     /db_xref="GeneID:55994699"
     mRNA            complement(<1238765..>1239697)
                     /locus_tag="TRUGW13939_07206"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490348.1"
                     /db_xref="GeneID:55994699"
     CDS             complement(1238765..1239697)
                     /locus_tag="TRUGW13939_07206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346241.1"
                     /db_xref="GeneID:55994699"
                     /translation="MGRHRRQKRDSDSVEKIMMKGDDIAKRIRSFSKGNPERFEQLVK
                     ESTSQVAGQQQTKCQTKNKTKSKSKSLRTPKQPEFELQKGMSDYDGNVYAEAPGFAFL
                     KSQYKFFVTGDLPFEIPTIPPKPMKSNATVDLVSTQIVGVVEGNCAPMLDDNTKQMAA
                     GQFVRIRAKKTLDVFQFDYVLASTGEIVNRAFVSLAGCTEEDLAALAKKMYENYIIDR
                     DNRQHDYDRRYCIWMKGLRDWEWSMFLLAQRFAGSVTWSPGAIKSQILAAVSKDEVLF
                     PWNNESDPHPEVFYAATVDNAHLWVHHKRYENVD"
     gene            complement(<1240345..>1241552)
                     /locus_tag="TRUGW13939_07207"
                     /db_xref="GeneID:55994700"
     mRNA            complement(join(<1240345..1240552,1240628..1241188,
                     1241255..1241361,1241520..>1241552))
                     /locus_tag="TRUGW13939_07207"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490349.1"
                     /db_xref="GeneID:55994700"
     CDS             complement(join(1240345..1240552,1240628..1241188,
                     1241255..1241361,1241520..1241552))
                     /locus_tag="TRUGW13939_07207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346242.1"
                     /db_xref="GeneID:55994700"
                     /translation="MSQPTVPPLPQIFNFLQLAAQNPTQYGGNAADAPELTRILQEIR
                     DLSIPNGAQHSAQGLEPYQSIARANNPTWNARPDLRPKISKFRIVKHTHWGKAYWSPV
                     DLLGLFFSRLEPAPLGATVRTFFLPMTALFGRWAFQLVGHYAGMQSCMWKIQDNGPAQ
                     FFLGASIVGYDADIPTCGNWRRVIQKARYSLLPNESLFLRDWSFANSPHGPIHPKDDY
                     PLGNCAELYPYLHLLRGVDESNKNVYGIALKKKGVRSPSYNDTLQGSVWQNVQWPCVK
                     CRELIHIQEGVLANFAPYAGSKGAPP"
     gene            complement(<1241656..>1242051)
                     /locus_tag="TRUGW13939_07208"
                     /db_xref="GeneID:55994701"
     mRNA            complement(join(<1241656..1241976,1242031..>1242051))
                     /locus_tag="TRUGW13939_07208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490350.1"
                     /db_xref="GeneID:55994701"
     CDS             complement(join(1241656..1241976,1242031..1242051))
                     /locus_tag="TRUGW13939_07208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346243.1"
                     /db_xref="GeneID:55994701"
                     /translation="MADPNSSMNPSPTPPPGWSMDPKDLDYEDDWVAEDGCGTMLAAK
                     YKLERCTPIMIRLDPHNDVVLFESGGKFYLYSQMTGAFSQIIVPDTLDEIIAVMKGER
                     RRKNLVQKAIT"
     gene            <1243205..>1244184
                     /locus_tag="TRUGW13939_07209"
                     /db_xref="GeneID:55994702"
     mRNA            join(<1243205..1243427,1243485..1243702,1243759..>1244184)
                     /locus_tag="TRUGW13939_07209"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490351.1"
                     /db_xref="GeneID:55994702"
     CDS             join(1243205..1243427,1243485..1243702,1243759..1244184)
                     /locus_tag="TRUGW13939_07209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346244.1"
                     /db_xref="GeneID:55994702"
                     /translation="MTTIPVPQSCIYTGATTTDTAWTFPTYTTNATQPTSLPLAPGTL
                     SNCSTYTQYYATSRNTSTINSCYVVAGFYDEDVDDFVSWNPSLSYDPDSPSDCQLKQG
                     YQYCAQLNVPTATVTTTVISVTSTTSTQQATSTGPNGEPTPLPIQTGMTSNCDKFYLV
                     QPDDGCYDLAAANDIALSDFYSWNPALNGDCSGLYPNYYVCVGVFSSTSTVAPTTTTT
                     TTTAPNGTPTPTQAGMVSGCKTFYLVQSGDGCYDIATSYQITLDQFYSYNPAVGDDCS
                     GLWPNYYVCVGL"
     gene            complement(<1244303..>1246106)
                     /locus_tag="TRUGW13939_07210"
                     /db_xref="GeneID:55994703"
     mRNA            complement(join(<1244303..1245344,1245688..1245890,
                     1245954..>1246106))
                     /locus_tag="TRUGW13939_07210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490352.1"
                     /db_xref="GeneID:55994703"
     CDS             complement(join(1244303..1245344,1245688..1245890,
                     1245954..1246106))
                     /locus_tag="TRUGW13939_07210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346245.1"
                     /db_xref="GeneID:55994703"
                     /translation="MANQYLGLPIKPSDAAFGLMANFDADSHPNKVSLIAGAYRDERG
                     KPWILPSAKERLGETTHEYLGIAGSPVFIDLAKDLLFGPLAASLKGDNVASIQTVSGT
                     SANHLAATFLALSFRRRAITVNVDRTPLFLDEATLALYNRAINDPSSLTDAERRTITN
                     RPPPEEEDSLCRAACGLSFSELITKAIQNSDSLTYKEGHLVTAGVVPNQAGRLLDERV
                     RLSPEERDLLHRANAAATTEHLKTAKENAQTVNGRRLDAKSAAMKACTNDDLRNIRYA
                     LQVPWQQHVLDLTETSVCGLVIYFLEIPETAPFREEIKTAIYHGLYLYPNLTNDATVD
                     KFTLHWEVYDTDPASLPSQFLSSRNEFPSGLRLDSFLYIDQESLNSRNTPRPFVWLWE
                     PSNETTKPLKVDIKQICPTLYARLIQRDLDTDRAKTWPYRHTSQLEDLHRAASFSRNA
                     NWEQDWIWPPPARYM"
     gene            <1246437..>1247800
                     /locus_tag="TRUGW13939_07211"
                     /db_xref="GeneID:55994704"
     mRNA            join(<1246437..1246649,1246737..1246767,1246841..1246900,
                     1246956..>1247800)
                     /locus_tag="TRUGW13939_07211"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490353.1"
                     /db_xref="GeneID:55994704"
     CDS             join(1246437..1246649,1246737..1246767,1246841..1246900,
                     1246956..1247800)
                     /locus_tag="TRUGW13939_07211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346246.1"
                     /db_xref="GeneID:55994704"
                     /translation="MSQRGILERLSVLDTNTVSDALDFLQLKGATYGLQPLWDCLKIV
                     GRASTVKVGIKHNAAPSVHLLTPVVDAIKGIRGTIIDAHADRAARVRLRAAGARWCHG
                     NRIEDVVELAERIGRRQAVMVQDVRDGKPVSEVMYDSKFEASHPKTSSPATAVSSKEA
                     CPEDQELSALFAGLDTPAVSDALDKLGIPGQAFDIMPLANYSKVTIGPAFTVRYIPAS
                     NPPGSVGDFIDDVAAGDVVVIDNGGRTDCTVWGDIMTQYTGLRGIAGTVIDGVCRDVS
                     RALNDGYPVFTAGRWMRTGKDRVQVGAVNETIGIGKAHVRPRDIVVADANGVVFVPRD
                     QAREVAELAQKIEKSEDDIRELISAGVSISETRQKLGYPTLQRKVKNH"
     gene            complement(<1247985..>1250083)
                     /locus_tag="TRUGW13939_07212"
                     /db_xref="GeneID:55994705"
     mRNA            complement(join(<1247985..1248247,1248303..1248454,
                     1248591..1248742,1248794..1248964,1249532..>1250083))
                     /locus_tag="TRUGW13939_07212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490354.1"
                     /db_xref="GeneID:55994705"
     CDS             complement(join(1247985..1248247,1248303..1248454,
                     1248591..1248742,1248794..1248964,1249532..1250083))
                     /locus_tag="TRUGW13939_07212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346247.1"
                     /db_xref="GeneID:55994705"
                     /translation="MALLYTKIPLQVQGVNLSLSTMHNLNANPPILFLHGFGSCKEDL
                     ADIILKPALQQYGLLAYDAPGCGHSHSDNLYAIDIPFLVATASAVLSHFKIDKFHIMG
                     HSMGGLTALLLVHQHRDRVLSFIDIKGNLAPEDCFLSRQIFDFPSDNPEAFLDEFIVR
                     TRETKSFSSPLYASTLRARVQAGVSPPPSTFVLYPTAMMSLLYNPQLRLLNALRANGK
                     PIMTFLGLPSFRTAQVVAQTGVDGVIIDCEHGHISDDSMHSAIAAIAALGVSPLVRLR
                     MTHSYLVKRALDAGGQLAWAGFRFSSQGIDLPTYLKTANETLITCVQIESKDGVKNAD
                     AICAVAGVDMVFIGPNDLALSVLGYVPAKGDEPEFVNAIETIVTAARKHGKWVGRLSD
                     NGASAKEHLKSFDTAAMSYDIRAIQNWYRSELQVARL"
     gene            <1250395..>1252506
                     /locus_tag="TRUGW13939_07213"
                     /db_xref="GeneID:55994706"
     mRNA            join(<1250395..1250546,1250596..1251193,1251244..1251762,
                     1251818..1252441,1252498..>1252506)
                     /locus_tag="TRUGW13939_07213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490355.1"
                     /db_xref="GeneID:55994706"
     CDS             join(1250395..1250546,1250596..1251193,1251244..1251762,
                     1251818..1252441,1252498..1252506)
                     /locus_tag="TRUGW13939_07213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346248.1"
                     /db_xref="GeneID:55994706"
                     /translation="MVTANRPSCRRCHARKVKCSGGMPCSGCLQADKTSECVYPRKAR
                     LVKVSEQYIEDLVSENQRLRRSSSRPPNEETAVLAQCPVLAEVPWFVNADSLHTPILV
                     AEASDSAFATRWRQAMSNAQHGHLPRVNFPSDEQLLALSDAECPWPTPARAHLLVRAA
                     LNGIGRCYHIIRRSSISQELERTIQNHSQTGLLSKSKLWAVFAIGEIYTTRHSALERG
                     FPGLHYFCKAMNILRIVSERPSVDMVEIQLLLSVYSLFLNRRHAAYSLAGSAVRLATI
                     MGLHLNVPETQMSDAGEREHRNRICWTAYTLDRMWAAKLGYPAAIRGDEIEVDLPSNP
                     VGLDDNASMDFPDRAYSIARIELAQLSGRIIYSIYGHKADTPSLSHRVQDAFSDLRRW
                     LKDLPPSLQIDAPDEGELDPRGRSLHLLFNQLAILATRPILLHVLRAHLEAREQQPDT
                     EANVPASAVALSETCIRCARHSCRLLVDSWMNGTFMIFDFFYTQYLFSATTVLGISTL
                     LGSKDRQIDEEQFEIATCFLEQLRDGGNYAAAEFYQHIEAAMSLMETAKTRLSVHDGN
                     ATAIPKDSTTSSSLNAGSLEEASSIMDDYMTAGTALSEPLLQELLDQPLPDLQFIDSS
                     MYLDEQQPE"
     gene            <1252940..>1255883
                     /locus_tag="TRUGW13939_07214"
                     /db_xref="GeneID:55994707"
     mRNA            join(<1252940..1254018,1254305..1254420,1254466..1255081,
                     1255144..1255491,1255553..>1255883)
                     /locus_tag="TRUGW13939_07214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490356.1"
                     /db_xref="GeneID:55994707"
     CDS             join(1252940..1254018,1254305..1254420,1254466..1255081,
                     1255144..1255491,1255553..1255883)
                     /locus_tag="TRUGW13939_07214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346249.1"
                     /db_xref="GeneID:55994707"
                     /translation="MATSRALVLHSRDKPLALETVPRPVAKAGQAVVRILAADIVPYM
                     SQVLDGSRPYPLSLPMTPGNTAIGRVFEVGPDAVKLTVGQLVFCDITIRARDNPNVSI
                     LFGIHGGGYPAAQKLMDGEWRNATYAEYTKFPLENLYPLNEDVLFGKLGYTVSDLCLM
                     PVCLVPFGGLSEVDVKPGEVVIVAPATGRYGGAAVAVALAMGATVVAAGRNKNALKAL
                     ENIHASTGRLKTVTLTEDSSSNTEVFKTAAGKPEGADVYIDFSPPAIKDGSLLVAAVG
                     ALRPFGRLAIMGGHSGNINVPYLDIMFKSIRIQGRFMYSPQHVLQLIHMTESGLLKFG
                     SKLGIKETQEFGLELVEDALQAAGKLKIVLETRSSQTALPGFVSTARRENASATKRYL
                     HVLDVTDLRLMLRCEYESADLMADDGLHPSVISLNSVNWAAWVRSFYLSMHNKPEDFV
                     SVYFATVHKWLPIINEGRFRGRLEWRSYNYDTDHLLLLTSLYLIVRRPDELPQPPLMM
                     DDPVYQVVRHFYFHVFADIASSPSIQLIQSGLLLATYEYGHGMVDSASSTLFPCLSAS
                     MTLGLHQKKAPLDMNIAWKSAMEDESTLVWWAIVITDRIICASYISKPRLPVTIIIDE
                     ANFLSDLGNTKNPKDDRLSWDHDSYAATNFYRQVQSSVLLGHVLYLINSSDPFSEESQ
                     SRFRVLDSQLLRAIQVTLQTETAGKLNSVSEALSLNRSAFLLLHRWQYDHSKRINNDT
                     MLLQSTMAIESIITITIQTVRDFIPRIQAGWFKSHHPQGVQSVFLATIAWLHMGSYDN
                     TCVEDLKEMMKIQSRRWNIAGMDCARYILRE"
     gene            <1256508..>1258040
                     /locus_tag="TRUGW13939_07215"
                     /db_xref="GeneID:55994708"
     mRNA            join(<1256508..1257133,1257646..1257953,1258006..>1258040)
                     /locus_tag="TRUGW13939_07215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490357.1"
                     /db_xref="GeneID:55994708"
     CDS             join(<1256508..1257133,1257646..1257953,1258006..1258040)
                     /locus_tag="TRUGW13939_07215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346250.1"
                     /db_xref="GeneID:55994708"
                     /translation="LGQVCYYRTTTKPNNNSLSLGSLGLPDWHLLTQTGITDAVRTRG
                     LATIGGKGEVLKMASEYLETIHTWFPVIQPTRYYQQMAVVWSQPRPDLGLQALATFLL
                     TCTPENEKLTSQTLSLYTFVKSIIGALESTGVNTLELIHVRLLLAIFEAGHGIIHAAY
                     ISIGATIRAAAALGFDNIHTNQAVLECLDPPINVEDAKQTWRGIMCIDNTSITLFVFW
                     ANLQRPNNDSCVFSAEAFLASAVEDILDHFQHLEYKHSAVALDSLPIFVSQSIFKAAV
                     VLTHELKYTSRLDVRKSLMSCKVMLKRISKRWLVGKQYLEYLETDQ"
     gene            complement(<1258214..>1259415)
                     /locus_tag="TRUGW13939_07216"
                     /db_xref="GeneID:55994709"
     mRNA            complement(join(<1258214..1258683,1258741..1259112,
                     1259181..>1259415))
                     /locus_tag="TRUGW13939_07216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490358.1"
                     /db_xref="GeneID:55994709"
     CDS             complement(join(1258214..1258683,1258741..1259112,
                     1259181..1259415))
                     /locus_tag="TRUGW13939_07216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346251.1"
                     /db_xref="GeneID:55994709"
                     /translation="MTSNLFLPQSKGSTVDVSIIHGGRTTVPTLYVFQNKIPGHDVLD
                     IPCYSFLIENKKQGKKVLFDLGIMKAWKEKQPPQILGQIEFAKAVMDIDKDVTEQLSE
                     SKVALESIDSIIWSHHHIDHTGDPSLFPASTALVVGPGFKSNKTTFPGYPENPEALVA
                     NDAFLGRELIELDFSTDLKIGGFPAVDYFGDGGFYILQAQGHTHDHISALARTSDDKF
                     VFLGGDVAHHPGEYRPTAHLPLPESVQPSPFAINTLTSSCPGALFEECHPAKGTSKDY
                     RTTPFYELNPAMNVSLPDAIESVNKMEAFDASPNVFVVIAHDTSLLDVLPFFPKTINN
                     WDSANYKSIGTWRFLKDFGGAIKS"
     gene            <1259775..>1261974
                     /locus_tag="TRUGW13939_07217"
                     /db_xref="GeneID:55994710"
     mRNA            join(<1259775..1259970,1260036..1260214,1260285..1260408,
                     1260475..1260573,1260659..1260892,1261262..1261637,
                     1261686..1261722,1261780..1261835,1261896..>1261974)
                     /locus_tag="TRUGW13939_07217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490359.1"
                     /db_xref="GeneID:55994710"
     CDS             join(1259775..1259970,1260036..1260214,1260285..1260408,
                     1260475..1260573,1260659..1260892,1261262..1261637,
                     1261686..1261722,1261780..1261835,1261896..1261974)
                     /locus_tag="TRUGW13939_07217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346252.1"
                     /db_xref="GeneID:55994710"
                     /translation="MEPDSGMLAKDYTLKLRLWRRYTTPWQKIVSHPYEGSGTEENPY
                     IVTWLDDGDDENPLKWSSGYQWTVTWLVAWTTLAASFASSSYSAAIQKVQQDFPGYSS
                     QVYIMGISAFVLGYAFGPLLWAPMSEVLGRRRLFIVAYTLFTIFNAAVCASQNIWTLT
                     ILRFLAGSFGASPLTNAAGVVSDIFPAEKRGSGMAIFSAAPFTGPTLGPIVGGFLGEA
                     AGWRWVCATNAILSGTLTILGTLTIPETYSPVLLRERANNLTAASQLPNGGGRVYRSV
                     FDDNPRYIALLRNHREKTTNTPLPPESRLAPAMLGAILLPLGLFWFAWTCQPSVHWIV
                     SILANIPFGMGMVMIFLSFFVWLLLSDAVVAYSTNIGGKTYIADVYNVHAASALAANS
                     VLRSLFGVAFPLFTTAMYDSLGINWASTLVAFLALAMTPQPFLFYKYGKKIRLRSKFS
                     RHAAETSLE"
     gene            complement(<1262393..>1263407)
                     /locus_tag="TRUGW13939_07218"
                     /db_xref="GeneID:55994711"
     mRNA            complement(join(<1262393..1262851,1262907..1263191,
                     1263243..>1263407))
                     /locus_tag="TRUGW13939_07218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490360.1"
                     /db_xref="GeneID:55994711"
     CDS             complement(join(1262393..1262851,1262907..1263191,
                     1263243..1263407))
                     /locus_tag="TRUGW13939_07218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346253.1"
                     /db_xref="GeneID:55994711"
                     /translation="MEFSHLPSDYFVTSTQFTKTTYRDVYPAIDPESDPLNQKGRVVL
                     ITGASHGIGRHAIAKAFAKAAARAIILVGRDGAGLREAATELHDIDPDVEIRIEEVNI
                     CEQGSVTAMFDRVGKEYGAVDVLVNNAGSGESPLPLRDVDPASFWYNFEVMVKGTFLV
                     TQQFLQLNGQEKKAIIITVASAAALNATPGLSSYSLSKLVQIQFQRFVTAENPNIAAV
                     SLHPGIVMTRMTPPAFAPFTKDTFELVGGAAVWLASKQADFMNGRYFSVNWSVDEILQ
                     RKDEIMSQGLLQIGLQGKFGADQFIA"
     gene            complement(<1263869..>1265374)
                     /locus_tag="TRUGW13939_07219"
                     /db_xref="GeneID:55994712"
     mRNA            complement(join(<1263869..1264062,1264123..1264354,
                     1264412..1264491,1264551..1264732,1264823..1264883,
                     1265011..1265098,1265168..>1265374))
                     /locus_tag="TRUGW13939_07219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490361.1"
                     /db_xref="GeneID:55994712"
     CDS             complement(join(1263869..1264062,1264123..1264354,
                     1264412..1264491,1264551..1264732,1264823..1264883,
                     1265011..1265098,1265168..1265374))
                     /locus_tag="TRUGW13939_07219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346254.1"
                     /db_xref="GeneID:55994712"
                     /translation="MPALSGPPFLILVTGANGFVGTWIVHHLLENGYSVRAAVRTKEK
                     GQYLLETFKSYGTKLQLTIVGNMTEEGVFNGAVQGVDGIIHTASPVGTVADDPNELIE
                     PAVKGVTGILLSALQYGSGIQRIVFTSSCAAILDTSDKEVTVSEKDWNDQRVEECERL
                     GRDASGLSKYSASKTLAERAVWDFYLKHREEIMWDLVAINPPYIFGPIIHDVTSPDIL
                     NSSSKRWYDALVHNDFRGLSPATHPGHGWVDVRDVAEAHIKALTTPGAGGERIIVSAG
                     SWVWQDMINAASTLPGSIYKRHPDARFQGGQSRAITFNTEKADLILGLKFRSMKELAY
                     DILLDFTKRGWYP"
     gene            <1267180..>1271827
                     /locus_tag="TRUGW13939_07220"
                     /db_xref="GeneID:55994713"
     mRNA            join(<1267180..1271226,1271285..>1271827)
                     /locus_tag="TRUGW13939_07220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490362.1"
                     /db_xref="GeneID:55994713"
     CDS             join(1267180..1271226,1271285..1271827)
                     /locus_tag="TRUGW13939_07220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346255.1"
                     /db_xref="GeneID:55994713"
                     /translation="MEDKNYQLSDQSSDVVDDAAIRHEPITGPESTAVSTLASHSQLS
                     VDGHWGEKTEGDPVSRHGAMEDFEEMRRELTRVSLQRTRSQTSRPLSRLRSAVSQKSR
                     PADEEETYSGSGDTQADFDLGEFLMGGTLERRTTAGEPAKKVGVIFKDLTVKGVQASA
                     SFVRTLPDAVMGTFGPDLYRIIQHFIPSLRIGGAPPTRNLIHDFTGVVRDGEMVMVLG
                     RPGSGCSTFLKTIANNRDGYAAVLGEVSYGGIPAEEQQKYFRGEVIYNPEDDQHFAAL
                     TVEQTLKFSLMNKTKKRDQSSVPIIVDALLKMFGISHTRNTLVGNEYVRGVSGGERKR
                     VSIAETLATKSTVVCWDNSTRGLDASTALDYAKSLRIMTDISRRTTFVTLYQASQDIY
                     ELMDKVIVIDQGRMLYQGPSLEAKKYFTDLGFYCPSQWTTADFLTSLCDPNARQFQPG
                     KEASTPKTAEELEAIFRKSDTYKRILEDVTDYEQRLKETECSDTKRFQQTVGQSKSKT
                     VSRKSPYTVSIPKQVAACVRREVWLLLGDKTSLYTKFFILIANALIVSSLFYGESLDT
                     SGAFTRGSAIFFSVLFLGWLQLTELMPAVSGRTMIQRHKEYAFYRPSAVSIARVVVDF
                     PLIFTMVSFFTIIVYFMCGLDVDVSKFFIYFLFVYTTTMCITSMYRMFAALSPTIDDA
                     VRFSGIALNLLLIFVGYVIPKPTLINSSIWFGWLFYVNPISYAYEAVLANEFSNRMMD
                     CAPSMLVPLSGPGIDSNYQSCSLTGSQLNEKSVSGAAYLETSFGFTRGHLWRNFGVVI
                     AFTVLYILVTIIANEMMSFTGGGGGALVFKKSKRTKQIAQAETKNGDEEGAKTEADLP
                     PSTSSGSEEPIGSLSTSDRVFTWSNVEYTVPYGKGERKLLNGVTGYAKPGVMTALMGA
                     SGAGKTTLLNTLAQRQSMGVVSGEMLVDGRALGPEFQRETGFCEQMDLHDGTSTIREA
                     LEFSAILRQDRSIPRQEKIDYVNRIINLLELEEIQDAIISSLGVEQRKRVTIGVELAA
                     RPNLLLFLDEPTSGLDSQAAYSIVRFLRRICDAGGAIVCTIHQPSSMLIEQFDLILAL
                     NPGGNTFFFAPPSSVVKYFSDRGVTPPESKNVAEFILETAAKPMIRDGKKIDWNDEWR
                     NSAENANLKQEIQRIIDERSKVPAPESGNQTEYAAPVTTQTFMLTNRMFKQYWRDPSY
                     YYSRIFVSVIIGIFNGFTFWKLGVTVSSMQDRMFSVFLIILLPPIIMNSVLPKFYMNR
                     ALWEAREYPSRIYGWIAFSTANVVCEIPIAVVTSVIYFVLWYYPAGLPTDSSSAGYVF
                     LMSMLFYMFQASWGQWICAFAPSFTVIANVLPFFFVMCNLFNGIVRPYSTYPVFWKYW
                     MYYVNPVTWWLRGVLSSILPSVTHIECADSEITYFNAPPGQTCQDYAGDSILQGYLTN
                     GSATSICGYCPYKDGAEYMHTLNVHDDDKWKCFGIFLAFVIINWALIYFFIYTVRIRG
                     WSFGMGFVFGLFGTAISSVKYAITSPFSSKKDDTA"
     gene            complement(<1272230..>1274605)
                     /locus_tag="TRUGW13939_07221"
                     /db_xref="GeneID:55994714"
     mRNA            complement(join(<1272230..1272476,1272535..1272635,
                     1272691..1272974,1273027..1273087,1273144..1273255,
                     1273305..1273483,1273540..1273731,1273784..>1274605))
                     /locus_tag="TRUGW13939_07221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490363.1"
                     /db_xref="GeneID:55994714"
     CDS             complement(join(1272230..1272476,1272535..1272635,
                     1272691..1272974,1273027..1273087,1273144..1273255,
                     1273305..1273483,1273540..1273731,1273784..1274605))
                     /locus_tag="TRUGW13939_07221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346256.1"
                     /db_xref="GeneID:55994714"
                     /translation="MSSNEDDDPQLAAALLLSIQEQQHSPSDRKQKTAEDIVDLTGDS
                     DNERQSQKNNMINLDEEEEEEDDDLKRAIALSMQQSRVSEEPKETSDTPGEAETIQAI
                     AITNKQNEQPSNAFSILGLDRKKLEQERLARIAKRKAEQSISPPPLSRERKAAKYTVV
                     SPEDVTTKPLVSLQPSSSQMNPATPTNGEKKQVPSTSPSSTPSIQFPKGTVKKTWVFG
                     CPRKGDDIKIEEVLQCSDLELAVLSAFQFDIEWLFAKFQTSKTRLMLMMQAKDEMTKH
                     QYEADTAGMSRIRLCFPPMDGQVNCMHSKLMLLFHPNYLRIVIPSANLVPYDWGETGG
                     VMENTTFLIDLPKKLETHSETSQTAFYEDLVYFLKASTLHQNLIDKLSNFDFAETARY
                     AFVHTIGGSHSGDTWRRTGYCGLGTAVNALGLRAHSPINVDFVTSSLGSLTDEFLRSI
                     YLSAQGDDGLIEYTLRTNKSFPAKTRADPPTVVQKTAGSDWKDRFRVYYPSQEIVNQS
                     RGGPQCAGTICFQEKWFNGPKFPKHVLHDCISQRDGVLMHNKMLFARPETPIKLSDGS
                     TCAAWAYVGSANLSESAWGRLVQDRGTKEPKLNCRNWECGVIVPVIQEDSTEKEEDTE
                     KVDNNGDMARIFGSGVVPVPMRIPAPSFAAEHDRKPWYGAW"
     gene            <1275273..>1276977
                     /locus_tag="TRUGW13939_07222"
                     /db_xref="GeneID:55994715"
     mRNA            join(<1275273..1275332,1275380..1276765,1276813..>1276977)
                     /locus_tag="TRUGW13939_07222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490364.1"
                     /db_xref="GeneID:55994715"
     CDS             join(1275273..1275332,1275380..1276765,1276813..1276977)
                     /locus_tag="TRUGW13939_07222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346257.1"
                     /db_xref="GeneID:55994715"
                     /translation="MAPSQKKKSVAIIGGGAAGMSCAATLAQHPDKFSVSLFETSTHI
                     GGQATSIDIDESRYGARWLNDGVQGGSAIFRHTFGFFRRYGYEPQEVKLQVSFGKGRD
                     SFWTNVFPSPLVDELSQEIKKLGRVLNWIKYLLPILGLIPAKLLLHMFRFSRDFSNKM
                     VLPLLALFLGTGNQTPNVPSALLERLFDDPNMRLWDYDPDTLLPNLPSMYTFPNLGNF
                     YRDWASDLQSKGVEFRISCEVEVVERGSTGVLLRTKKKGQPPQNTSNVPHLMHERPDE
                     IEPEHFDELVLCVQADDAKKLLGKHATWKEKFILGGVRFYNDITVTHSDSEYFQSIFE
                     NRFQKALCADATTTSRKDQISFATSEPQCRKDGWVGFQPMYFVHSFPSDPEKIEMGFD
                     CTNYQHQFRSSVGEGNPPPKQDQHVFQTIFLNDQEKHLWTIDQIKKGKIIGKKWWHQW
                     GHRWSHYLRVVPLMMFINGKNHTFFGGSWTLVNMHEVACVSGIAAAYRLGATYDSNGF
                     GEFAEDFFSKYLLLTHGVRYKPNEQQLR"
     gene            complement(<1277044..>1280344)
                     /locus_tag="TRUGW13939_07223"
                     /db_xref="GeneID:55994716"
     mRNA            complement(join(<1277044..1278009,1278080..1278310,
                     1278519..1279088,1279149..1280174,1280228..>1280344))
                     /locus_tag="TRUGW13939_07223"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490365.1"
                     /db_xref="GeneID:55994716"
     CDS             complement(join(1277044..1278009,1278080..1278310,
                     1278519..1279088,1279149..1280174,1280228..1280344))
                     /locus_tag="TRUGW13939_07223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346258.1"
                     /db_xref="GeneID:55994716"
                     /translation="MDVVAAVSGYLSRMVTVGDAASAGSASAKMKILLVDSETVSIVS
                     TAITQSALLNHEVYLVDRLDNPSREKMRHLRCLCFIRPSPESIQLLIDELREPKYGEY
                     NLYFSNIIRKSSLERLAEADDHEVVHVVQEQFADFIVINPDLCSLNLGFPLHRIWSNS
                     PDTWNADALRRTTDGVIAMLLALKKNPLIRYEKNSLMAKKLATEVRYQLTQEEQLFNF
                     RKSDTPPILLILDRRDDPITPLLTQWTYQAMVHEFIGIHNGRVNLHDVPDIRPELQEI
                     VLSQDQDPFFKKNMYQNFGDLGGNIKQYVEQYQVKTQSTMSIESIADMKRFVEDYPEF
                     RKLSGNVSKHVTLVSELSRRVGEDNLLDVSELEQSLACNENHSSDLRSLQRIIQLSTV
                     PPENKIKLVALYAIRYERQPNNSLPVLLDLLTAAGNVPAHQVNIISKLLTYYHSLQAP
                     PMAGGFSDLFESASLLSGARDRFKGLKGVENVYTQHSPRLEATLQNLIKGRLKELQYP
                     FLEGGGHTRDKPQDIIVFMVGGATYEEAKTIAQVNASSPGIRVVLGSTSMHNSTTFLE
                     EVDDARRLQLTPGPHFCGATRLEERCALTFLRITTTMDAFGSPPLYVNALSPSSAARD
                     PRVQLPLTTDPPGPQNPPKQLVWLIFGATGHIGLSLAKAALLHNDLVVAVGRTFENSY
                     ESMQKMQAENANCLGLLCDVRARETVREVIEKSISHFGRIDIIANCSGHGVIGACEDQ
                     DDYDIRNQFETNFMGTLNIIQLSLPHFRERGSGRYVIFSSTSGTLGVPGLGPYCASKY
                     AVEGLMESMLYEVDGFNIKGTLIEPGHIRRDDVVNPLTPRSPENTSLVNPLPAYGHFF
                     IKPTSEPYQTSTSPAAHARRMLLWLGDKQPVSAVKAAELVWQLGHCSFPPLRLLLGYY
                     AVDSIRDRLKCITEEIEDWKHLSFPLNDNAPSGEYSADKRSMTEKSDDEEEREAE"
     gene            <1280912..>1282767
                     /locus_tag="TRUGW13939_07224"
                     /db_xref="GeneID:55994717"
     mRNA            join(<1280912..1280945,1281001..1281045,1281109..1282227,
                     1282298..>1282767)
                     /locus_tag="TRUGW13939_07224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490366.1"
                     /db_xref="GeneID:55994717"
     CDS             join(1280912..1280945,1281001..1281045,1281109..1282227,
                     1282298..1282767)
                     /locus_tag="TRUGW13939_07224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346259.1"
                     /db_xref="GeneID:55994717"
                     /translation="MAAALRSYIDAPFVFASTQTGASTDDLKLIGSFLLSYPLAAILK
                     RLPDKDPWKKNVFIITVSLFYMIGLYELWDGLRTILYSSVATYVIAYYVDGSLMPWIG
                     FFFLMGHMSISHIYRQMLDDPTVVDITGPQMVLVMKLSAFCWNIHDGRLPQAQLTDAQ
                     KYAAVTEFPSVLDYAGYVLFFPSLFGGPAFDYIDYRRWIDTTLFDVPPGTDPSKVPPT
                     RKKRRIPRSGRPATKKLAMGLFWILAFLQLSGMYPAELVLNDDYMQYSLLRRIWYMHM
                     IGFVTRLKYYGAWALTEGACILSGLGYNGFDPKTGKVFWDRLENVNPWGLETAQNTRG
                     YIENWNKNTNHWLRNYIYLRVTPKGKKPGFRASMATFITSAFWHGFYPGYYLTFVLAS
                     LIQTVAKNFRRHVRPFFLTPDGTKPTAAKPYYDVASWVATQAVMSFTVAPFIILSFSD
                     TIKAWSRVYFYGFVAVASSMAVFSSPVKGYLTKTLKKRNRPPPMTRAVSADPPMLGLP
                     GDPEKEVEGAVKEMMDEIEEMRKNGVSIPTGPELRALIEKNTGKKLA"
     gene            complement(<1284013..>1286224)
                     /locus_tag="TRUGW13939_07225"
                     /db_xref="GeneID:55994718"
     mRNA            complement(join(<1284013..1284054,1284116..>1286224))
                     /locus_tag="TRUGW13939_07225"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490367.1"
                     /db_xref="GeneID:55994718"
     CDS             complement(join(1284013..1284054,1284116..1286224))
                     /locus_tag="TRUGW13939_07225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346260.1"
                     /db_xref="GeneID:55994718"
                     /translation="MSPRPSTSGTAKRRVLHERTPSQTNEGSPNRSPKEKQGIDIYSA
                     TPYPTKPTQVFLPRPGIGQPYAHHGAYGVSDVSLASAQTDHTATGPADEHHHLDAGPH
                     APWEFSSSVDLGHSSSQVWDDDPQSSQSSFPTPLLPSDDPDEHDVTYHDDKSILSFQH
                     VDVESKYQPHSESGPVDARGTEEDEAEDDDDDDVVTLPPPLRTTVKTVFPEHSSPRTE
                     LATSDNYVTYEHSSSPNVVPIGAPSSPNFVAYDSSSPNLIAYDSSSPRIMTHVPSDST
                     GSSSNSLGTVIRTYTGNPGWPGPSPEPNSSQPASFTSSPPEQLLREYQSASSLALSAG
                     TQLSRTRTASSGSGPSEGSSQFGPENTAAIQYPRICEPSSSSSYAESFNPGSQARRAV
                     RTASDRSTGRWNPTLSTVPSNTPTSINNQPTSSDRQGLGLIPAKKSKLSIGSVDDNTE
                     HLDRLSSLPRSTLRHIPSSLMGSNESRPGSSSSGNVILNMLPNWVRLYYHSNGQYTQN
                     PAQSILETSRPATAASRPASPIRYVNQAPDNLSLPRIRPNDKRVQPTRLLEDHPADPR
                     NHWKRGQGEKDSSSEISVPQPVAKPHSPHLHPDKGQTSPRHTWLAPSLDSRNEPALGR
                     RNVQVYSFCLGFVFPLAWVIAAFLPLPPQPSGVDEEMVAGASAKYRIQQHEKRRYQSA
                     RWWRNVNRVMIPVGTAIIAIIVTLAVVGTTTGFS"
     gene            <1288615..>1289815
                     /locus_tag="TRUGW13939_07226"
                     /db_xref="GeneID:55994719"
     mRNA            join(<1288615..1288669,1288723..1288769,1288822..1289202,
                     1289288..>1289815)
                     /locus_tag="TRUGW13939_07226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490368.1"
                     /db_xref="GeneID:55994719"
     CDS             join(1288615..1288669,1288723..1288769,1288822..1289202,
                     1289288..1289815)
                     /locus_tag="TRUGW13939_07226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346261.1"
                     /db_xref="GeneID:55994719"
                     /translation="MAPTWIFDRVKKLYTKQTDDFPPVISVNSAALLSMLVTLAYVLP
                     FYISKTTRPSASLSRDAPSVIRSRVRAVTLACVASTLFVIALASLQDNVSLLETLKLL
                     GWWPIGFLEIAQSLLLTAVLFSGPLFERGIAEGDWKSWIRGEGLSETLRSWIGFRNFV
                     AGPITEEITFRSIIISLHLLAKMSPGRIVFISPLHFGIAHVHHFYEFRLTHPDTAVTV
                     AIFRSLFQFAYTTVFGWFVAFVYLRTGSLPAVILIHSFCNWCGLPRLWGRVEAGIPIG
                     PPLVRAKDDTEVSQFQVADGRLDISWTVAYYVLLVAGAVGFYYLLWPLTESSLALASF
                     HF"
     gene            complement(<1289940..>1291867)
                     /locus_tag="TRUGW13939_07227"
                     /db_xref="GeneID:55994720"
     mRNA            complement(join(<1289940..1290815,1290874..1291017,
                     1291081..1291707,1291808..>1291867))
                     /locus_tag="TRUGW13939_07227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490369.1"
                     /db_xref="GeneID:55994720"
     CDS             complement(join(1289940..1290815,1290874..1291017,
                     1291081..1291707,1291808..1291867))
                     /locus_tag="TRUGW13939_07227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346262.1"
                     /db_xref="GeneID:55994720"
                     /translation="MVYCGRPSAGCEACRERRVKCDQTRPACIRCTRIKRACPGYRDI
                     SSLLFRDESQSTARKAKVAASSGLNSPSTSSLVPQRSGTGSPISLFYAGDTTDEAESS
                     SDTSGSRRDQVIVPFIPPNPFKLDEKYKATCFFFDSFAWIYSGVIQKCDPSGDPSPNS
                     PLAEKALTKAITSVGMANISSIQRSQPLRMAAWREYAEALKWTNAAISDREQAAEDAT
                     LASILCLSMFEIITCKKPESMTDFIKHTNGALALLALRGESQLQRQEGLQLFLALRSE
                     VMISCILKRYPYPPALITLSEKVVKLPGATISTKIGYQLTCLMAEVCDLRICHENNLK
                     TINTDLLSRSFALDSRAEALESTFPPDTMYETVAAMPGQSFQVKDSRRILPLDQWYHI
                     YPNWILPNMWNNYRYCRILVNEIILNQLELMTTHPDADDPPTQDFKNICYRSCNLTRK
                     LAHDICAAVPYMLGLIDDHKGQTKSAAGKMTILFPLYIAANVDGPGSPMCVWAQDCLT
                     KFGRALGIDQALILADLLSRENSMTGFVDAMHGRGDSPGDAEGQFNVPSNVFNQFYVH
                     GA"
     gene            <1292446..>1293428
                     /locus_tag="TRUGW13939_07228"
                     /db_xref="GeneID:55994721"
     mRNA            join(<1292446..1292726,1292786..>1293428)
                     /locus_tag="TRUGW13939_07228"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490370.1"
                     /db_xref="GeneID:55994721"
     CDS             join(1292446..1292726,1292786..1293428)
                     /locus_tag="TRUGW13939_07228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346263.1"
                     /db_xref="GeneID:55994721"
                     /translation="MKIDYRHGVSILELIAFIPSLFMSILLAWRHGFGRTAGWYFFIL
                     FSLLRIIGNGCYLATLNDPENRSLYIAWAVCSSIGMSPLLFGLLYNLSRVNDSIQRQT
                     GKAFWPQIFRIFGFITLLAIILNIVGITGGSNLTSGTTSVETKVATILYLVSWVGLVG
                     LIVMVGSRYSGIEAGEHRLLWAIVICTPILVIRLAYSFISTFGHNRHFNMVDGNETIL
                     LVMVVIEEIIIVYVMLLTGLTLDTRDKAAYGPAASVEAGDTAYEPYGSQGEGYSSGGQ
                     PRKPKRPIRGGPIHMLAAYTMNKMDERREKS"
     gene            <1293864..>1298505
                     /locus_tag="TRUGW13939_07229"
                     /db_xref="GeneID:55994722"
     mRNA            join(<1293864..1294241,1294296..1294989,1295035..1295045,
                     1295402..1295986,1296042..1296182,1296235..>1298505)
                     /locus_tag="TRUGW13939_07229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490371.1"
                     /db_xref="GeneID:55994722"
     CDS             join(1293864..1294241,1294296..1294989,1295035..1295045,
                     1295402..1295986,1296042..1296182,1296235..1298505)
                     /locus_tag="TRUGW13939_07229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346264.1"
                     /db_xref="GeneID:55994722"
                     /translation="MIQPLRLARHQERALVTLNRCARTAQARTQISFRSLTSASFPLP
                     TTSKFPEPTCECAPTPSMPEGLPIDHQRPLNATMAPYTQQILVSTGKSDWTSRIEDDG
                     EGESWGGLIRGIKGLFGRGGKYADPYNNLVVTTSSLTPSPSTSPEFASAFLFPAFKYV
                     PKIPIATTSASETTSLETFARALLLPRELHPAHPDLPESKKSAMIRSPELASHFPEIL
                     DIKQSPTILICGHGGRDMRCGIMQPVLQAEFERVLRRKGFTTTGDENNNFIVDGTSHA
                     NIAAISHIGGHKYAGNVIIYIPPGLTATSSSLSEKAPASPLAGKGIWYGRVEPKHVEG
                     IVEETIFKGNVVEDHFRGGIGMDDSTLLDAVTMIRQRPLFRDDFRVYSLVHRTTLQAR
                     LVPSYSFRITPTNETATRLASTVHTHQDLDLRAIDRKWQAKWKQAESQKAQESAGIGS
                     RDKNNNNHNHNNNNRPKSYILSMFPYPSGTLHMGHLRVYTISDVLARFYRMRGHDVLH
                     PIGWDAFGLPAENAAIERGIEPAEWTVANIQRMKTQLKSIGVGFDWDRELMTCSPEFY
                     KHTQRIFLMLHEKGLAYQEEALVNYDPVDKTVLANEQVDANGFSWRSGAKVEQLNLKQ
                     WFFRITAFKESLLQDLDSLSGGWPERVLSMQKHWLGKSPGAKVKFAVTAGEKQQDVEV
                     FTTRPDTLYGVEYIALSLDHPLVEESAKSDPKLRMFLDEAVNLPPDSKEGYRLNGAHA
                     SHPLHTIDKESAHISRDLPVFVAPYVLSGYGEGAVMGVPGHDTRDLAFFKKNLQPEFI
                     SMVIQPDAGSQDEALSAVPAHDSKAYTQEGYLTAKCWKYQGLHSKEAARQMVMDLQQI
                     GRGEATETWRLRDWLISRQRYWGTPIPIIHCASCGPVPVPVDQLPVELPKIDSEWFKS
                     QKGNYLESAHEWINTECPSCGGPAKRDTDTMDTFVDSSWYYLRYLDSKNENAPFSPSV
                     ARPVDIYVGGVEHAILHLLYARFIYKFLAQSELFPELAHSEPGSTSPAEPFRTLLSQG
                     MVHGKTYSDPSTGRFLLQSEVDLSNKDRPLIKGTQISPNVSFEKMSKSKHNGVDPTTC
                     VEKYGADTTRAHVLFSAPAGEVLEWDEAKIVGIERWFARLWKLVHDTTATLSESNIKL
                     SMDAVMQQPHALELPVLLNLSDADVDALLATHQTISSVSDCMQNNPYGLNTVISDLTK
                     LTNTLASSSTPTTPAISYICVSSLLRLLCPVAPAFTAEAWEILNNSLSFSSQTEGNQA
                     IANAPWPTPLLTEPEANALASRGGQTVAVQINGKRRFSVTIPRLMSSATSATDDQDWI
                     VDRVLETGEGKTWLREKNDWEKRKRVIVVKGGKLVNVVF"
     gene            <1299305..>1301915
                     /locus_tag="TRUGW13939_07230"
                     /db_xref="GeneID:55994723"
     mRNA            join(<1299305..1299466,1299518..1299693,1299742..1300623,
                     1301081..>1301915)
                     /locus_tag="TRUGW13939_07230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490372.1"
                     /db_xref="GeneID:55994723"
     CDS             join(1299305..1299466,1299518..1299693,1299742..1300623,
                     1301081..1301915)
                     /locus_tag="TRUGW13939_07230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346265.1"
                     /db_xref="GeneID:55994723"
                     /translation="MVLSRSLFRQFQRPAASLFASRPLRAAPAPVFSGIRTLTATAAQ
                     QGKVLLVLYDGGEHAKQEPALLGTTENELGIRKWLEDQGHTLVTTSDKEGENSTFDKE
                     LVDAEVIITTPFHPGYLTAERLAKAKKLKIAITAGIGSDHVDLNAANKTNGGITVAEV
                     TGSNVVSVAEHVVMTILTLVRNFVPAHDQVRNGDWNVAAVAKNEYDLEGKTVGTVAVG
                     RIGERVLRRLKPFDCKELLYYDYQPLKPEVEKEIGARRVDTLEELVAQCDVVTINCPL
                     HEKTRGLFNKDLIAKMKPGSWLVNTARGAIVVKEDVAEALKSGHLRGYGGDVWFPQPA
                     PKDHPLRYAEHPWGGGNAMVPHMSGTSIDAQVRYAKGTKDILDSYFSGRHDYRPEDLI
                     VYQGDYATKAYGQRKKSRLAPMTGDSRFVFVGDTPFVVQKPLIQATSDLFKDTEVEHL
                     PDEKPNDFNKYLSWAEGKGIPDEEDSNPRWWNSAGNDDDDDDDDDDTWLDLGGLWFFG
                     GRIGARQFQDAVIIKCMEKRRCKTNPLNDLTVDHFFSSLFPEKTPFHTFLVDTCFMTM
                     IDEDEMSEYDNMVFQMACSARQAFLSEVISKMMIEKRKREKRKREGNEDTEESENPAI
                     RMNVLFDYIVSSSPPYDDKKSPAARRADDSSDEDERGSTRMRGSVKLDLIKRVLKNGT
                     VD"
     gene            complement(<1305270..>1307263)
                     /locus_tag="TRUGW13939_07231"
                     /db_xref="GeneID:55994724"
     mRNA            complement(join(<1305270..1305288,1305364..1306978,
                     1307083..>1307263))
                     /locus_tag="TRUGW13939_07231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490373.1"
                     /db_xref="GeneID:55994724"
     CDS             complement(join(1305270..1305288,1305364..1306978,
                     1307083..1307263))
                     /locus_tag="TRUGW13939_07231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346266.1"
                     /db_xref="GeneID:55994724"
                     /translation="MRFMPSARHTLCDEKGNLSKKFPHLDNQIQQWIFHDLCAVNSAG
                     AGCHCSNSAIWTGVSAYPKPRTAALRALYDPSQETSQNTVLDAGALVLYFPSPRTATG
                     EDILELHVHGGPAIIKAVLAAIDKCNNNDRGSIRYAEPGEFTRRAFMNDRLDLPQIEA
                     LGDTLHADTEQQRRLAVRGANNALSQRYELWRNELLYARGELEALIDFSEDQHFDESP
                     AQLVDSVAAQVRVLRRQIRFHIENASKGEMLRSGIKVALLGAPNAGKSSLLNRIVGRE
                     AAIVSTEEGTTRDIVDVGIDLGGWYCKLGDMAGLRSSKSGGGGVGSGGIIGIVEQEGI
                     RRAKARALESDVVVVVLSVGSSSSSPTMLAVDPELLEAVQACQKQGKRLMVAINKSDK
                     LPAHSREEVVGRLIDHVRTLFAGIPAHRVFSISCKESEDESGLVVADPGHIQAFLRGL
                     ITTFKELTTAEGLGESKEANDISYWEDSLGVTHRQRSNLQTCLQHLEDFLYDTNTDTA
                     LFAETHADALDEIQTERQKTLSKTPSDDDADKDNFVHKKYTGNNTVVNMETEVDIVTA
                     AEHLRSAAESLAKITGRGEGGDVEDVLGVVFEKFCVGK"
     gene            complement(<1308026..>1313472)
                     /locus_tag="TRUGW13939_07232"
                     /db_xref="GeneID:55994725"
     mRNA            complement(join(<1308026..1308763,1308819..1312194,
                     1312253..>1313472))
                     /locus_tag="TRUGW13939_07232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490374.1"
                     /db_xref="GeneID:55994725"
     CDS             complement(join(1308026..1308763,1308819..1312194,
                     1312253..1313472))
                     /locus_tag="TRUGW13939_07232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346267.1"
                     /db_xref="GeneID:55994725"
                     /translation="MPTTASVPDKQRQSAASKSFFGRKLHKDRSGDDRYYEPGSGAAT
                     PAADTQSLAGSMAGSRSSRYSKRGSIGSFDADDGYGAFPSNAGILTSIPFDNMPSDSK
                     TPIPVEYLPKQDPNARREPSPSHLAKGAADFHQYPIWDPKAVPNAPAHVSGPRPPPHA
                     SNMTITSSSSGDRGARYQQWGRPGSSAANTGFSYTSSSTGDSSANSRTSLDQTSIYSS
                     HSSATRGSYFSDSNSNRTLTNPYSAGDRNPNLASGPSTSRNLNAQQAYPPPQQPPSHM
                     TPSSSHSSLGPEYLSRPKDDRVVDQLFLELMQKRGWQNLPEQAKRQMQAYPASKKWTL
                     VHQDRLTELQGEQKRRHNARLTHGYEGNASSSLIGRADEEGSPEWYVKKVMDDTITSK
                     QLASLSVSLRTQPISWVKAFVEAQGQVALTNVLLKINRRKASGPAGSATSAEKDLERE
                     YDIAKCLKALMNNKYGADDALTHQQVIVALVSSLLSPRLQTRRMVSEVLTFLCHWGEG
                     QGHQKVLQALDQVKNHQGETGRFDAWMRIVEVTIDGRGKMGSLVGASEEYRSGGVGME
                     NLLMEYAVATMLLINMFVDAPQEDLQLRCHIRAQFISCGIKRLLTKMEGFQYEVIDKQ
                     VERFRENEAIDYEDLLQREASSTKDSIEGEVKDMSDPLQITDAIGNRINGTRAGDYFL
                     SAMQHMLLIRENSGEDVLRMFQLVDAMLSYVAMDRRLPDLDLRQGLGFTVQNLLDKLH
                     TDAEARHAFDESLEARQVAEAAIAERDEMKAQIELGADGLVKKLQKQIDEQASVLELQ
                     RRQNDSLKSELNDVHRLRAQELQRNELETRELYLMLRDAQDIAASNAKKTVDAKLVET
                     DTSQMRGILDREKLLERLERQLERTKTQFKLEGKVWNQDGPSDRLRELREQMDGTGVV
                     EEEFEQQTRRTLTSSTLGSVARKKVPGSESEEHLPELTEKDEETVKEQQPVKPSLEFE
                     RSRMQALHATGLLGEIAAKVYRYDDDEAEDAEKPKPEEKEVEKEPEKKEEALPTAAPP
                     PPPPPPPPPPPPPPPPPPPMSGGAIPPPPPPPPPPPPPPGFAGGIPPPPPPPPPGFAG
                     GIPPPPPPPPMSPGIPPPPPGPPGAPGAWRGNYLAANNSSYNAPPSMSSIRPKKKLKA
                     LHWDKIDTPQVTVWATHTPTTEDKEQKYTELAKKGILDEVERLFMAKETKILGGGPSA
                     KVRKDKKQIISNELSKTFQVALAKVSQTPVDELVRMIIHCDKEILDNDVVMDFLQRDD
                     LCTIPENTTKLMAPYSKDWTIPDAATTEREQDISELTREDQIYLQTAFELGHYWKSRM
                     RALALTRSYEIDYDHISSKVQQVIKVCDSLRDSVTLMNVLGLILDIGNFMNDATKQAQ
                     GFKLSSLARLGMVKDDKNETTFADLVERIVRIQYPEWEGFQEEIAGVVSIHKLNIDLL
                     RQDAKKYITTIKNVQSSLDSGNLSDPKKFHPQDRVSQVVQRSMKEARRKAEQMQILLD
                     DLGKTFDDIMIFFGEDNTDENGRRDFFSKLASFLQEWRKSKEKNVSLEENRRRMESSL
                     ARKRVNPTLSNGASNESLMSPTQSGAMDSLLEKLRAAAPQARDQRDRRRRARLKERHQ
                     VRVASGQQIPNLQPGEDEEGEGESTISGQDDSSHLNPQEDENATNQETQISEGEDIAD
                     RAANLLQGLRSNMDGDEERARRRRENAEDERRARRMRMRSRNMTNGSKDSADGSLPSI
                     KEPASPGEADDDSSAQPMSTPSIVVSQSTDHAEGEAAEEGSTPDKPLEISD"
     gene            <1315418..>1315951
                     /locus_tag="TRUGW13939_07233"
                     /db_xref="GeneID:55994726"
     mRNA            join(<1315418..1315444,1315517..>1315951)
                     /locus_tag="TRUGW13939_07233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490375.1"
                     /db_xref="GeneID:55994726"
     CDS             join(1315418..1315444,1315517..1315951)
                     /locus_tag="TRUGW13939_07233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346268.1"
                     /db_xref="GeneID:55994726"
                     /translation="MGSSLDLVKTLAVPALISLSIYLLFGYLIIPFFRRYHQRYAHYL
                     PLNTISAHTLTLRERVADSLMHFFLPSSWSLLRRRGGMPEDNHDAISIYEEEGEHMTA
                     MDITVARREALERRRSTSEAQDRLSRDLEEGFMDDSSDDDEEEERRRREVR"
     gene            complement(<1316314..>1317701)
                     /locus_tag="TRUGW13939_07234"
                     /db_xref="GeneID:55994727"
     mRNA            complement(join(<1316314..1316480,1316534..1317000,
                     1317074..1317242,1317293..1317336,1317389..1317557,
                     1317608..>1317701))
                     /locus_tag="TRUGW13939_07234"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490376.1"
                     /db_xref="GeneID:55994727"
     CDS             complement(join(1316314..1316480,1316534..1317000,
                     1317074..1317242,1317293..1317336,1317389..1317557,
                     1317608..1317701))
                     /locus_tag="TRUGW13939_07234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346269.1"
                     /db_xref="GeneID:55994727"
                     /translation="MSTMETTTASRSRNLWSAEEDSLLRRLVESHEKDKVDWRVIASF
                     LPGRNNKDCRKRWHYRVSASMNLGPWSQTEDELLKVGIQRYGTHWSRVAQVVGTRNGD
                     QCFKRWNDVLDPGIDRSPWTRDEDRMLLLAIGKYGRSWKQIVDTYFPGRTGLDAKNRH
                     RQLTRKRKREEKVENNSERAPETPAPPVLSMSQSPNRQQQAPEYVSAPKYNPAASVMR
                     LNTQSTNSLLAPRSSPQSDERLLSAQSCPDWNLTPDTLLSPQLPTTPYSSGSNSSFSN
                     AGGSMSELNEYFPQHLTPALHVEQASELLTPVSDASLISSYPFFMQMPDGHAAGVQHH
                     QNYMGVLDLRSDTAPIRPMSSPRISYWNPGWNVAT"
     gene            complement(<1319514..>1320671)
                     /locus_tag="TRUGW13939_07235"
                     /db_xref="GeneID:55994728"
     mRNA            complement(<1319514..>1320671)
                     /locus_tag="TRUGW13939_07235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490377.1"
                     /db_xref="GeneID:55994728"
     CDS             complement(1319514..1320671)
                     /locus_tag="TRUGW13939_07235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346270.1"
                     /db_xref="GeneID:55994728"
                     /translation="MQSFTVRSPGHCLRRQCCGLKVSRRASPPVLQVRHNSSTSSSPP
                     KKRTWLRLTVVSLGAAGLGAYFRTHQDAQNSQLNPLSFAHYRLVSRDPVSSTNSIFTL
                     EPSSPANNQETYELAWQTGIWSVMFKQPQLQIGRDYTPLPPLDEGVEEGGHEIPDSLR
                     FLIRRDPHGEVSRYLHSLQVGANIEIRGPQVECEISPEVNNVLFIAGGTGIAPALQAI
                     HVLLRKPAGEEKPKIHILWANRKREDCLGGKSDTLADKSAKSTWWPFGNRDKAGPATA
                     PEPTSSSSTEQGAIVRELQKLKAQYPGQITVDYFVDEESSFISPKEITTFTESAQPST
                     AEKRMIIVSGPEGFINYMAGNKVWAHGYQLQGTVGGVIQQLGLKDWTIWKL"
     gene            <1321076..>1322959
                     /locus_tag="TRUGW13939_07236"
                     /db_xref="GeneID:55994729"
     mRNA            join(<1321076..1322104,1322156..>1322959)
                     /locus_tag="TRUGW13939_07236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490378.1"
                     /db_xref="GeneID:55994729"
     CDS             join(1321076..1322104,1322156..1322959)
                     /locus_tag="TRUGW13939_07236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346271.1"
                     /db_xref="GeneID:55994729"
                     /translation="MSRVTFTTDRQAHPPRDSLELASLASSSSPDSAGRSSIESSRSG
                     ISSSRKLSLEADDPLSDHNALESSQTRHARSYSVTSAFDFGSNLFPLSQTAGGYAPLG
                     APSVTSLDRYTGLRDGSLEKHKSLTYLNGLSLIVGLIIGSGIFSSPSQVNTNAGSPGA
                     ALIVWAVAGLLAWTGAASYAELGGAIPLNGGPQVYLSKIFGEIAGFLFAWCAVFVLKP
                     GSAAIIAIIFGEYVVRAFIGAEVEQISPWINKGVGLVGVLGVTLLNCASTKLGTFVGD
                     ISMFFKFIALIAVTVIGIVVAITGLSSKGQASQDWKNMSWFEGTSTDISGWAVALYAG
                     LWAFDGWDNTNYVTGEFKNPRRDLPRAIHTAMPVVIICYMMANVAYFFVLPVATIAKS
                     NTIAVQFGSQVFGKVGALILALVVSGSCLGALNATVFTSGRLVYAAGKEGYLPAIFGN
                     IGFGKKGSSITGGRLQRRSRLQRALVRLFGDAGGIGYTPINAMLFNAIITSAYVVVGE
                     FGTLITFYGVAGYSFYFLTVLGLIVMRIREPHLERPYKTWITTPIIFCCVSLFLLSRA
                     VIAEPLQTLIVVAFVAAGVPAYFWRMYQRDGTIQLPNWKFWKRR"
     gene            <1323446..>1326597
                     /locus_tag="TRUGW13939_07237"
                     /db_xref="GeneID:55994730"
     mRNA            join(<1323446..1323534,1323606..1323826,1323889..1323988,
                     1324050..1324472,1324532..1324710,1325043..1325284,
                     1325346..1325765,1325821..>1326597)
                     /locus_tag="TRUGW13939_07237"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490379.1"
                     /db_xref="GeneID:55994730"
     CDS             join(1323446..1323534,1323606..1323826,1323889..1323988,
                     1324050..1324472,1324532..1324710,1325043..1325284,
                     1325346..1325765,1325821..1326597)
                     /locus_tag="TRUGW13939_07237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346272.1"
                     /db_xref="GeneID:55994730"
                     /translation="MVQAESSAAAARNGLQASTAGAPPDYELPWVEKYRPVFLDDIVG
                     NTETVERLKIIAKDGNMPHVIISGMPGIGKTTSVLCLARQLLGDAYKEAVLELNASDE
                     RGIDVVRNRIKGFAQKKVTLPAGRHKLVILDEADSMTPGAQQALRRTMEIYSTTTRFA
                     FACNQSNKIIEPLQSRCAILRYARLTDAQVVKRISQICEAESAKFSEDGIAALVFSAE
                     GDMRQAINNLQSTWAGFGFVSGDNVFRVVDSPHPIKVQAMIKACWDGKVDAALEILNE
                     LWGLGYSSHDIISTMFRVTKTIPSLSEHSKLEFIKEIGFTHMRILDGVQTLLQLSGCI
                     SKLSAWAIKIATAAVDNSWHPPETSAISDLDLNLDSDGVFGFIFNSSNTPDENYGQYN
                     YCNMPHVRRREYEKAPEGYELVYVEVIHRHHKRTPYQSNTFPTEEYAWNCNDTHLYYY
                     GQPTANTRNSPSTTFWMIEDNPLDVFPVEGFPGSCAFPQITSAGLEDSWQHGRDIFEV
                     YHDLLGFLPDTLDSQKMHFRVTNNVITSQVIGMVIAGMYDVQNNVPLHVQKKGIDSLE
                     PQYPCPGGSYIFDTIKDSDIGSTPWTRHLEKTAELFKSLDLVSGVPPDAKGWHANYDH
                     YFDSLSSRLCHSKPLPCSPGNPSQCISQSQANAVLRLGQWEYSYLYRGAPASLTASTA
                     LYGVFVAELAQHIRTQIDILSSPNNDDDSSRVVYTHNVAHDGSISRLLSILQIKNMVW
                     PGMGAELVFELYRNNIQKTQGDQKFSVRVLWGGRVLESSNPELQGSEDGMLRAEKLLE
                     YFDSLVGRGGKSVLGLCR"
     gene            complement(<1326834..>1331367)
                     /locus_tag="TRUGW13939_07238"
                     /db_xref="GeneID:55994731"
     mRNA            complement(join(<1326834..1327373,1327438..1328614,
                     1328671..1330842,1330893..1330986,1331046..>1331367))
                     /locus_tag="TRUGW13939_07238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490380.1"
                     /db_xref="GeneID:55994731"
     CDS             complement(join(1326834..1327373,1327438..1328614,
                     1328671..1330842,1330893..1330986,1331046..1331367))
                     /locus_tag="TRUGW13939_07238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346273.1"
                     /db_xref="GeneID:55994731"
                     /translation="MVLPVPAAEEPNVTLADEALQKLVASTYKTSHLEFFLNGTRVKL
                     QTPNPHWTLLDFIRSQHGLKGTKLGCGEGGCGACTVVLQVADAKQKGIIRHLAVNACL
                     YPLVGVVGKHVITVEGLGSVNNPHPLQERLAKLHGSQCGFCTPGIVMSTYAMIRNAYD
                     QQSGKLKLSRHDVELKGYLDGNLCRCTGYKPILEAINTFVTQDLQGEILPNACVADTS
                     GQTNNEKIPYELSSLPNAANASSTGSCGRPGGCCKDDPAKESCSSTPSSDAGDSEDTS
                     LTSVSDEDTTESTRHKRGVPQIKFLQYAPDTELIYPPSLHKFEHRAICYGDETKIWLR
                     PTRLQELLELLDVYPDAKLVGGASEVQIEVRLKASSYPVSVFIADIAELAEVSVPKDV
                     ATMKELVIGGNTLLSNLETICIDLEARLKERGSVFGAMAKVLRYFAGLQIRNAASLAG
                     NIATASPISDMNPVLIAADATIVTQTLNTKTVIPMKSMFKGYRKTALPQGSVITRIHI
                     PIPPAGIKEVTKSYKQARRKEDDIAIVTAGFRVRISYDGTVEETSLVYGGMAPMTVEA
                     TECSDSLTGKPWKSQKTLQYALTLLARTFPLPYGVPGGMASYRRTLALSMFFRFWHES
                     VAELGLGKFDSGLEEIERGLSFGSRDNYNPNEQKIVGKQIPHLSGLKHATGEAEYLDD
                     MPHQDRELYCALVISQKAHALLKSVDWTPALRPGLAIGYIDKHNIDPDKNNWGSIIKN
                     EPWFATDKVTSHGQPIGVVYAETALKAQEAARAVKVEYEELKPILSVDEAIEVKSFYD
                     FYKKDLRKGAPPEELDQVFAKCDYVFEGTSRAGGQEHFYLETNTSMVIPHVEDNSMEV
                     WSSTQHTLETQEMISYATGIPSNRINTRVKRMGGAFGGKESRSVQIAGLLAIAALKER
                     RPMRIMLSRDEDMAVSGQRHPIRCDWKIGVTKTGKLVALQADCYSNAGWSLDMSSAVM
                     DRCITHLDNCYEIPNVYIKGWLCKTNTHSNTAFRGFGGPQSMYFTETIMYDVAERLKI
                     DVDELRLRNLYNEGNLTPYLQKIDEDWHIPLLLEQLKKEADYEARKAKVEEFNSKNKW
                     RKRGICLVPTKFGLSFSAAHLNQGAASVKIYTDGSVLLNHGGTEMGQGLYTKMCQVAA
                     QELKIPIDNIYTADTSSYQIPNASPTAASSGSDLNGMAIKDACDQLNERLQPYRERLG
                     PNASFKEITRAAYMDRVNLAATGHWKMPRIGYVFGVYDPELVKPLYYYFTQGAACTEV
                     ELDLLTGDHSVLRTDIKLDVGRSINPAIDYGQIEGAFVQGQGMFTIEQSLWTNDGTGQ
                     LFTRGPGTYKIPGFGDIPREFNVTMLQGVSWESIRTIQSSKGIGEPPVFLGSTVLFAL
                     RDALRSARADNNVFEPLRLDSPATAERLRLAVCDDLVEMAKVQPGPGEKPFFLTAV"
     gene            <1332097..>1332810
                     /locus_tag="TRUGW13939_07239"
                     /db_xref="GeneID:55994732"
     mRNA            join(<1332097..1332526,1332590..1332655,1332713..>1332810)
                     /locus_tag="TRUGW13939_07239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490381.1"
                     /db_xref="GeneID:55994732"
     CDS             join(1332097..1332526,1332590..1332655,1332713..1332810)
                     /locus_tag="TRUGW13939_07239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346274.1"
                     /db_xref="GeneID:55994732"
                     /translation="MPPTRRNLFQSHLTRRPTPGAASTSTSVSHSSNNNSTASTSVPN
                     DALSDGASQSAAIQSTASSRETSVLMSTSTDNNGGDIIARDKNGNFQLDIPVLPPLPP
                     DEEADEETMEGIEEGRPSGGSGSSGANASGVDSEIGGRDKEKFEANLIEMVQRSRGRH
                     LSTEPEILNLIQQSLRAKVASLDEDNWMFEVEDDSLA"
     gene            complement(<1332908..>1334147)
                     /locus_tag="TRUGW13939_07240"
                     /db_xref="GeneID:55994733"
     mRNA            complement(join(<1332908..1333500,1333562..1333714,
                     1333784..1334037,1334104..>1334147))
                     /locus_tag="TRUGW13939_07240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490382.1"
                     /db_xref="GeneID:55994733"
     CDS             complement(join(1332908..1333500,1333562..1333714,
                     1333784..1334037,1334104..1334147))
                     /locus_tag="TRUGW13939_07240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346275.1"
                     /db_xref="GeneID:55994733"
                     /translation="MTSNIEKTIARQQEKIAAGSFYEAHQQLRVIAARYMRQSKYDAA
                     AEILTGGAKALLRAGSQQGASASGGDLAIMLVIEVYTKAEWEISEENDAASRAHKKRL
                     IELLREFPPDEPSRKRYISEIIGWSSKFGPLERGDPEIHHAVGSVYAEENEPYDAEKH
                     LIIGTTDSAETLAKLEFEWYTGDDSHTAALYASRAVIPYLLTGNLRSANKALLIFTSR
                     LSSVNPSLASQHVSSASSDIRIYPSLPLLNFLGLLLVAVQRGSADLFRDLTRHYAPHI
                     QEVGIWNDALAQIGEMYFNIKIPRQGNPLLDMMGSMFFGGNNQSGGNQKPGASSRAAS
                     KRVEAAPSSAELD"
     gene            <1334439..>1336058
                     /locus_tag="TRUGW13939_07241"
                     /db_xref="GeneID:55994734"
     mRNA            join(<1334439..1334513,1334603..1334854,1334928..1334959,
                     1335009..1335036,1335095..1335102,1335162..1335265,
                     1335324..1335494,1335553..1335852,1335910..>1336058)
                     /locus_tag="TRUGW13939_07241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490383.1"
                     /db_xref="GeneID:55994734"
     CDS             join(1334439..1334513,1334603..1334854,1334928..1334959,
                     1335009..1335036,1335095..1335102,1335162..1335265,
                     1335324..1335494,1335553..1335852,1335910..1336058)
                     /locus_tag="TRUGW13939_07241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346276.1"
                     /db_xref="GeneID:55994734"
                     /translation="MNSHDYKIQPLQRFSGSNAAIRRPKEIACFSYDREHNFRLDESS
                     LSYYFPPLPSQMPADLNEGFETFQKLDDSGDEHLDALLDTVVALEENTGSKCEADIIT
                     WRGMMTKIMTAPFDMLNGFEMNATYFQGSIFIEENNAYKNAQKEVQRNQRPQPGMPSQ
                     DVMAYWGYKFETLAVIPDTWDATPREKIEGRVHEVVNNKAQYCSVVRTGIGKTKLVIG
                     GEVDAIWDSKPARKEDPINWVELKTTSELFNDKEKLKFERKLLKFWAQSFLLGVPRII
                     VGFRDRAGMLLRLEEIETHTIPGKVKRDGRGSWDGNVSINFTAAFLEWLKTVVNTDGT
                     WRIRKREKSPVIEVFKLEESGHGDILSSKFREWRMKQE"
     gene            complement(<1336226..>1337711)
                     /locus_tag="TRUGW13939_07242"
                     /db_xref="GeneID:55994735"
     mRNA            complement(join(<1336226..1337602,1337661..>1337711))
                     /locus_tag="TRUGW13939_07242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490384.1"
                     /db_xref="GeneID:55994735"
     CDS             complement(join(1336226..1337602,1337661..1337711))
                     /locus_tag="TRUGW13939_07242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346277.1"
                     /db_xref="GeneID:55994735"
                     /translation="MEPLITVVGATGTGKSNLAVDLAKRFNGEIINGDAMQLYRGLPI
                     ITNKISVEERQDVPHHLIDFVDLEEETWRISRFRNECLRLIKDIHARGKIPILVGGTS
                     YYVQGVLFHDGLVDKGTEDSDQTSDQECGGHQEGSSSARSKDWAILDAPAEVMLAKLR
                     EVDPIMAGRWHVNEARKIRRSLEIYLKTGRPASEIYAEQQRQRQATIDHVEGAVTGQL
                     RYPTLVFWMHAEREKLYTRLETRVEKMVEQGLIPEAQSLSEYLRDKESQGLHVDRTRG
                     IWVSIGFKEMEPYFNMLRAGNSSDEQIEALKRACIESVKTSTRQYSSKQTRWIRLKLW
                     TALADVSATDRLYVLDATDPSAWDSCITEPTERIVQEFLSNGNLPKPESLSVLAQTTL
                     EERTKTYKKENQTDFTVKQIACEPCGKMLMGQEQWDLHVRGSAHRRTIKSIAKRAQAQ
                     EYLRSRASAEVPEETAPADETRGLA"
     gene            <1338111..>1339001
                     /locus_tag="TRUGW13939_07243"
                     /db_xref="GeneID:55994736"
     mRNA            join(<1338111..1338225,1338289..>1339001)
                     /locus_tag="TRUGW13939_07243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490385.1"
                     /db_xref="GeneID:55994736"
     CDS             join(1338111..1338225,1338289..1339001)
                     /locus_tag="TRUGW13939_07243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346278.1"
                     /db_xref="GeneID:55994736"
                     /translation="MAPSIEVQGLSYKFPDGSSGLKDIKLSLPPGSRTLLIGANGAGK
                     TTLLRLLSGKRLAPTDTVAVGGVDPFKEGLEGVTYLGVEWVLNSIVRTDIDVPTLLAS
                     VGGDAFPERRDELIDILDIDLNWRMHAVSDGERRRVQLAMGLLRPWQVLLLDEITVDL
                     DLLSRSNFLAFLKQETETRACTIVYATHILDNLSQWPTHLVHMHLGQVKQAGSMASFE
                     QEVPHRSAENSLLGDLVLHWLKQDLQARGPRGTKSGQGKTYPTAEAIGGYGLEKPPK"
     gene            complement(<1339304..>1341803)
                     /locus_tag="TRUGW13939_07244"
                     /db_xref="GeneID:55994737"
     mRNA            complement(join(<1339304..1341613,1341675..>1341803))
                     /locus_tag="TRUGW13939_07244"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490386.1"
                     /db_xref="GeneID:55994737"
     CDS             complement(join(1339304..1341613,1341675..1341803))
                     /locus_tag="TRUGW13939_07244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346279.1"
                     /db_xref="GeneID:55994737"
                     /translation="MVNVAAEYISVGGNRHPGAADWDVASGVLAYGADNNVALWAPED
                     KSNHGVFALLVGHRDKVSAVRFLSSPETKTSLLLTGSVDHTIRVWKPHATRGYTFACE
                     LAGHTGSVNAIAVGKASNTVASGGADGTVKIWRLNIENDSISGQLLQTIPMKPRFFPL
                     ALALLSLDTQDPKRPMVLAVGGTTNHVHIFATQDTTENGEFLWFAKLSGHEAWVRSLA
                     FKENTSQSQNDFFLASASQDKYVRLWRIRRGEAEPMVSTDPDDIMLAGDAPTLSNKAY
                     TFNASGSIYSVTFEALLLGHEDWIYTANWNPNADKTQLLSASADNSLTIWEPDATTGV
                     WVTIDRMGEISAQKGSTTATGSTGGFWIGLWSPDGKQIVSLGRTGSWRAWEHDQEADF
                     WQQKLGITGHVRSVNDVRWDARGSYLLSTSSDQTSRLHAQWLRDGSSSWHEFSRPQIH
                     GYDLNCLDSLGPARFVSGADEKLLRVFNEPKQIAQLLENLCGISPPTDDELPETANIP
                     VLGLSNKAAGEDITVTDDQMMANQGNKESEAAPPVLLPMHQPPLEDYLARHTLWPEYE
                     KLYGHGYEISAVAVSHDRSLIATACKASSIDHAVIRLYDTKDWHEIKPSLAAHSLTIT
                     ALSFSETDEYLLSVGRDRQFAVFKRDDAEPSKFSLLSSNPKAHSRMILDAAWSPALTE
                     SPVFATAGRDKSVKLWQMKSDNTFECVSTIPLQTSVTSISFCSPEQQQDVFYLAAGEE
                     TGQISVHRVSASTLESQELVTIDKAIAPSKSITQLAWRPLDINKKAEAGETSRLLATA
                     SEDASVRIYRVTEL"
     gene            <1342011..>1342496
                     /locus_tag="TRUGW13939_07245"
                     /db_xref="GeneID:55994738"
     mRNA            join(<1342011..1342075,1342146..1342310,1342379..>1342496)
                     /locus_tag="TRUGW13939_07245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490387.1"
                     /db_xref="GeneID:55994738"
     CDS             join(1342011..1342075,1342146..1342310,1342379..1342496)
                     /locus_tag="TRUGW13939_07245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346280.1"
                     /db_xref="GeneID:55994738"
                     /translation="MSTNAEEGKPPVETIPITVEFTGGLEILFANVRKLQLSIQSKQD
                     DGKRPNIAWLIGHLVKHEMKDKRTELFVLDGHVRPGILVLINDADWELEGEEAYEIQS
                     GDNILFVSTLHGG"
     gene            complement(<1342615..>1344748)
                     /locus_tag="TRUGW13939_07246"
                     /db_xref="GeneID:55994739"
     mRNA            complement(join(<1342615..1342851,1342904..1343080,
                     1343132..1343506,1343563..1343682,1343732..1343839,
                     1343888..1343968,1344016..1344185,1344245..1344342,
                     1344402..1344437,1344489..1344677,1344735..>1344748))
                     /locus_tag="TRUGW13939_07246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490388.1"
                     /db_xref="GeneID:55994739"
     CDS             complement(join(1342615..1342851,1342904..1343080,
                     1343132..1343506,1343563..1343682,1343732..1343839,
                     1343888..1343968,1344016..1344185,1344245..1344342,
                     1344402..1344437,1344489..1344677,1344735..1344748))
                     /locus_tag="TRUGW13939_07246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346281.1"
                     /db_xref="GeneID:55994739"
                     /translation="MDTLLTADVVASSPRFRRKSSTFVDAIHDLPEKADMAPAQLYST
                     ESGRLFHSGRIVIITVGLPARGKTHISVALARYLRWLGVKTRIFHLGDYRRATIGPGQ
                     DMPDDYFFVNASASSVLLRQKIVKKCRDDIAHFLSHENGQIAIYDAVNPIAAGRRSLA
                     KEFSKQNIETLFIESMCDDPKIIEENVRSVKISSPDYVNWDADEAIKHYLGRISARIP
                     HFETMEEKDLNYIKMINAGERLIVNNCSFGYLSHRIVFYLLNLHIKARHTYFARAGVS
                     LDANSYKQDSSLSERGEDYAKKMTDVLLQHRESERKALLEQGESPAALKPLTVWTSTR
                     RRTVETAKCLHEKGYTVRQRSQLSQLNPGVCEKMSEHRIRLEYPEEVAKHEADPYHHR
                     YPRSESYHDLAVRLEPIILELEREHNDLLIIAHESVLRVLYGYLMACNAADIPFLSFP
                     RDEIIEIIPASYQNEARRVKIPDLPEETIPASPEDIKIPVPPSGYTSPTAGLGTPATG
                     GSTPQSGFRTPREPERLTQQHVEDVV"
     gene            <1345349..>1346531
                     /locus_tag="TRUGW13939_07247"
                     /db_xref="GeneID:55994740"
     mRNA            join(<1345349..1345660,1345726..1346373,1346424..>1346531)
                     /locus_tag="TRUGW13939_07247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490389.1"
                     /db_xref="GeneID:55994740"
     CDS             join(1345349..1345660,1345726..1346373,1346424..1346531)
                     /locus_tag="TRUGW13939_07247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346282.1"
                     /db_xref="GeneID:55994740"
                     /translation="MADFSSTLSALTDNSVGALIKDVYGSFSERRAALGLSNPGTVDN
                     IAREVQKEVLLSNFMFTGLRADLTKVFGMSPLFRMSHAFAMGSAGNMPPYNFSAMYGT
                     PKVFMQGNIGSDGGLSAVGNYRWNEALVTKTNAQIMAGGAQGILQIDNDYTGSDFSAS
                     IKAFNPYPFDGGLTGIFVGSYLQSVTPSLALGFEAIWQRQALNTRPESTLSYCAKYRG
                     EDWIASAQLQAQGVIAASYWRKLSERVEAGVDMNLQFAPSAAAMMMGGPSREGTATLG
                     AKYDFRASTFRAQVDSAGKVSCLLEKRIAVPISLSFAGEIDQVKQQAKVGLAVSLEIA
                     SDDLMEQQEKAEAQGTIPPPF"
     gene            <1350877..>1352397
                     /locus_tag="TRUGW13939_07248"
                     /db_xref="GeneID:55994741"
     mRNA            join(<1350877..1350922,1350988..1351160,1351213..1351296,
                     1351355..1351703,1351757..1351950,1352009..1352213,
                     1352264..>1352397)
                     /locus_tag="TRUGW13939_07248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490390.1"
                     /db_xref="GeneID:55994741"
     CDS             join(1350877..1350922,1350988..1351160,1351213..1351296,
                     1351355..1351703,1351757..1351950,1352009..1352213,
                     1352264..1352397)
                     /locus_tag="TRUGW13939_07248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346283.1"
                     /db_xref="GeneID:55994741"
                     /translation="MSQNRPGVFSGLRMGEVVREKVQDGLTGETKEMQYTQCKIVGNG
                     SFGVVFQTKMSPSGEDAAIKRVLQDKRFKNRELQIMRIVRHPNIVELKAFYYSNGERK
                     DEVYLNLVLEYVPETVYRASRYFNKLKTTMPMLEVKLYIYQLFRSLAYIHSRGICHRD
                     IKPQNLLLDPNSGILKLCDFGSAKILVENEPNVSYICSRYYRAPELIFGATNYTTKID
                     VWSTGCVMAELMLGQPLFPGESGIDQLVEIIKVLGTPTREQIRTMNPNYMEHKFPQIK
                     PHPFNKVFRRAPHEAIDLISALLEYTPTQRLRAVEAMVHPFFDELRDPNTRLPDSRHP
                     NNPARELPELFDFSHHELSMAPELNSRLVPDHARAALEARGLDIDNLTPLSQEEMRAH
                     LD"
     gene            <1354016..>1356939
                     /locus_tag="TRUGW13939_07249"
                     /db_xref="GeneID:55994742"
     mRNA            join(<1354016..1354100,1354166..1354260,1354337..1354443,
                     1354508..1354775,1354828..1355720,1355784..1355965,
                     1356020..>1356939)
                     /locus_tag="TRUGW13939_07249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490391.1"
                     /db_xref="GeneID:55994742"
     CDS             join(1354016..1354100,1354166..1354260,1354337..1354443,
                     1354508..1354775,1354828..1355720,1355784..1355965,
                     1356020..1356939)
                     /locus_tag="TRUGW13939_07249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346284.1"
                     /db_xref="GeneID:55994742"
                     /translation="MADSDRRNNGYRGGGGGGGGGGRKRRYRDDDDFDRRSQRRRYEE
                     PLGAKVRRQLLLIAESPTRRIEDDAASIAKIVSENNEDEEIRGAFLDTVIQLAIEQPF
                     KIPFVATVVLAVNSQKPDVVVDVLKRIGSTVGDALDAGVWRDVKLLVRLLGCLQGALE
                     GDGVFTILEELFSRAVDLQTASSEDSIGLEIVKIILLTIPYVMVSSASGFETQASALL
                     EKTEIIAATPHALETLVNPFALDRDDSKPLQSFIGLLQIQLQKEAGAGWELTCLPRPW
                     KMFNSEGEDAISFENAAKHPLPAITVPSPAKNGPRAIYPEVYFSVYHDQEIETVPGPA
                     DITSTLLRDALVDTINILDFNRMAAAKFLIDVDCYFSPGIFVKRATPFDRLRDFPEGR
                     TTWKPEDVAVDAVFSQLFQLPNPEHKLVYYHSVLTECCKLAPAAIAPSLGRAIRFLYR
                     NLDKIDVDLAHRFLDWFAHHLSNFGFTWKWTEWIEDLQLPPVHPKLAFITGALDKEIR
                     LSFAQRIKGTLPEPYQGLISKGKEKDTPDFKYASDTMPYAKQGSELMQLIRKKATDEE
                     IEPIIAEIEQEAKEHGLEDVMIPSTDAFVTSVCFVGSKSLSHVLSCIERNKERLLAIG
                     PRSSPARRQILTSVMEYWAEQPGIAINIIDKLLNYTILTPLSVVEWALLDRIDAGKIL
                     AQTHVYEMLAATVGKVTNRIRQIVAARTQPGLYEPQLSVLDETLVRERNDMQALFGLI
                     GDCLAPVARGSNDELMERGDDEHTQAENELIHQWAQRWLRVFKRKAEVEAAFIEDAMA
                     SATPVGTQAPPPPPPAVPVEEESATSAVVQEDERVVEDAAANGDMDIADIS"
     gene            <1357386..>1358713
                     /locus_tag="TRUGW13939_07250"
                     /db_xref="GeneID:55994743"
     mRNA            join(<1357386..1357587,1357652..1357730,1357805..1357884,
                     1357943..1358007,1358064..1358263,1358324..1358603,
                     1358654..>1358713)
                     /locus_tag="TRUGW13939_07250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490392.1"
                     /db_xref="GeneID:55994743"
     CDS             join(1357386..1357587,1357652..1357730,1357805..1357884,
                     1357943..1358007,1358064..1358263,1358324..1358603,
                     1358654..1358713)
                     /locus_tag="TRUGW13939_07250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346285.1"
                     /db_xref="GeneID:55994743"
                     /translation="MSPTTTLFSKAQEAATHLQSSLDPSLQKPKVAIICGSGLGTLAD
                     AVDEQLPKAAVEYSSIPYFPLPTVQGHAGKLVFGFLGNQTPVVLMVGRIHYYEGHSME
                     DVTFPVRVLKLLGVETIILTNAAGGLNPEYAVGDITLLNDHIFPAGFAGAHPLRGPNP
                     DEFGVRFQPLSDAYDLTLRRRVHAAWQKIEKTNNRRLHEGVYAFVSGPSYETRAECRM
                     LRQFGADVVGMSTVPEIIVARHSGMRVLAFSLVTNNAVLTPVPRGDDHLLQSSSTSDL
                     DAILEEGKANHEEVLEAGRLAAKDMQRLVVQVIVDASEKKEGIPQ"
     gene            complement(<1358769..>1359704)
                     /locus_tag="TRUGW13939_07251"
                     /db_xref="GeneID:55994744"
     mRNA            complement(join(<1358769..1359134,1359344..1359494,
                     1359556..>1359704))
                     /locus_tag="TRUGW13939_07251"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490393.1"
                     /db_xref="GeneID:55994744"
     CDS             complement(join(1358769..1359134,1359344..1359494,
                     1359556..1359704))
                     /locus_tag="TRUGW13939_07251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346286.1"
                     /db_xref="GeneID:55994744"
                     /translation="MPHSLVKDDHSTEDALIQELLNQAEARLQSSISPAEKSLTATAP
                     NDVQAKLPALSAGTGLKSYVQREGEISVLNSAQTTPHAAIQPPEVTFRSGADQAIQKK
                     EDAGSDWFNLPKTNMTPELKREFQLLRMRNVLDPKRHYKKEGGSSIIPEYSQVGTIVE
                     GPTEFFKSRVVKKDRKKTFLEEALATENEYGRFKSKYNDIQTAKTSGKKAHYNRVQAK
                     RRR"
     gene            <1360310..>1361320
                     /locus_tag="TRUGW13939_07252"
                     /db_xref="GeneID:55994745"
     mRNA            join(<1360310..1360391,1360448..1360461,1360525..1360581,
                     1360664..>1361320)
                     /locus_tag="TRUGW13939_07252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490394.1"
                     /db_xref="GeneID:55994745"
     CDS             join(1360310..1360391,1360448..1360461,1360525..1360581,
                     1360664..1361320)
                     /locus_tag="TRUGW13939_07252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346287.1"
                     /db_xref="GeneID:55994745"
                     /translation="MEQPTQPTGQQQNRQQPVYDTRNGGHYGASAALSAQGYAPVAEL
                     YTGTWSNVNQGLQGNSRDILTTYWQQVINHLESENHDYKIHQLPLARIKKVMKADPEV
                     KMISAEAPILFAKGCDIFITELTMRAWIHAEDNKRRTLQRSDIAAALAKSDMFDFLID
                     IVPREEATSHAKRSGQPGVAPPTAPAPPAGHISANQAGVQHPQHHLGAPEYALSQHPI
                     PQDQDYRNQPGMYPGAVQSDPGAYGQPQPQMFDGMYTAYSHLPTQQVRSPQ"
     gene            complement(<1361739..>1364420)
                     /locus_tag="TRUGW13939_07253"
                     /db_xref="GeneID:55994746"
     mRNA            complement(join(<1361739..1362035,1362113..1362562,
                     1362622..1362757,1362809..1362918,1362969..1363070,
                     1363128..1363259,1363318..1364310,1364370..>1364420))
                     /locus_tag="TRUGW13939_07253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490395.1"
                     /db_xref="GeneID:55994746"
     CDS             complement(join(<1361739..1362035,1362113..1362562,
                     1362622..1362757,1362809..1362918,1362969..1363070,
                     1363128..1363259,1363318..1364310,1364370..1364420))
                     /locus_tag="TRUGW13939_07253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346288.1"
                     /db_xref="GeneID:55994746"
                     /translation="MPSATAARNDSSSILNQIVMSPSDSDYLDQLIPSIREYSYGNRT
                     SQLLRSLSRFANERETQIENICNTNHQGFVTSVNQLLRVREGTVSLTSEILDLNQSIQ
                     SSTEKLAEQKKALVESRSHRQNIVESFRALQDCLEVLRLSNQVHDLLGKKNHYAALRG
                     LDELQNVHLKEITQYKISEMIQRSVPATQKAIAEAVMLDLNTWLYRIREMSQYLGEIA
                     LYHTDLRKTRLKERSQKLTYMEQFKLNSAIELVSDEHEEYDLLQNEDLQVDFTPLFEC
                     LHIHRSLGQMDRFRSEYATTRRRQKDLLLPSSITLVDDDGASLHTLLEEITGFAIVER
                     STMKKVPDLRSPVEVEELWDSTCHAAVNLITNALDVVDNAESLLKIKNLVALFMQAMD
                     TWNFSVTAFDKLLLTLFGKYADLLKKRFSDDFQEIVSTDDYMPMPIQNLEEFDKVINV
                     SWYTPEKPREEQVFPCVLPFSQMYPLCCIDIRNFLNQFYFFSNDDFPHLDVIDETLKT
                     ALDDLLSNQVCETLVERLGSQYLGQIVQILINLEHFEMACQELEGLLVAARSQSTTPS
                     PVSLNATEKFRNNKKAAEKRIFEVVNSKIDDLIETAEYDWVAPVEPTEPSNYMQTLTR
                     FLSNIMNSTLLGLPTEIKELIYFDALSHAANEILALPLSPEVRKINPNGVIALSKDID
                     YLADFVDSLDVPILKENLDELQQTVNLLQSENSDEFYDISTRNKKYGRVDAMNGPVLL
                     EKYETSPSSRENSNNTN"
     gene            <1365685..>1368348
                     /locus_tag="TRUGW13939_07254"
                     /db_xref="GeneID:55994747"
     mRNA            join(<1365685..1365872,1365924..1366284,1366341..1366772,
                     1366838..1367185,1367243..1367278,1367331..1367397,
                     1367450..1367468,1367523..1367553,1367604..1367621,
                     1367675..1367703,1367758..1367801,1367865..1367944,
                     1368010..1368115,1368188..>1368348)
                     /locus_tag="TRUGW13939_07254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490396.1"
                     /db_xref="GeneID:55994747"
     CDS             join(1365685..1365872,1365924..1366284,1366341..1366772,
                     1366838..1367185,1367243..1367278,1367331..1367397,
                     1367450..1367468,1367523..1367553,1367604..1367621,
                     1367675..1367703,1367758..1367801,1367865..1367944,
                     1368010..1368115,1368188..1368348)
                     /locus_tag="TRUGW13939_07254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346289.1"
                     /db_xref="GeneID:55994747"
                     /translation="MLSDRRALTSSSPRSSEETMTNIDSPDTKLTAYSPEQLRGPFHS
                     HPKRNATQSLGGMNSFSIAPAVDPFGGPEYSVQPSQFSPSSLNFQPFGLGRSEQGIAN
                     EPSVGRIDYTGLPTPNTGSHSNKFRLSEGAIPISPLFEAKVGSGSLRGNVGPIYPAPK
                     SRAFAVEGVSPTVSHLAVASLFTRREFESIQGPDLSDLHSIGRFVVGFADFRDTQKAL
                     EKLRIIHPGWQVIPLTAREHAQESKHAIECSSDFEGHVSITVLLNEQRPDLDMSSIYS
                     TVQGIARSFGAINAFKAASLQITKANDFFVEFCNTRDAANAVAVLNGACIENLFLETK
                     HIRPDIESSPSSFFRQAIHGRDEFSPTTGSRQQPETPIRDHHAALVLSPTGRSTVPME
                     DISELMDMLSPAQKRLSLEHDGTHFADQRLKHPQNVVDNDRIRLGLDVRTTIMLRNIP
                     NKVDLPLLKTIVDETSFGKYDFMYLRIDFANNCNVGYAFINFEDPIDIIDFVQARAGR
                     TWNCFNSDKVAEVSYATIQGRDCLVQKFRNSSVMLEDPSFRPKLFYTGKGPLAGTEEP
                     FPGPNNISKMRRSVENAEQVGLFAPRITRDVRRGGQGMRSPTSQTQFTRNGLSQRQVL
                     LNATPETSPISRRDF"
     gene            <1368949..>1369583
                     /locus_tag="TRUGW13939_07255"
                     /db_xref="GeneID:55994748"
     mRNA            join(<1368949..1369154,1369211..>1369583)
                     /locus_tag="TRUGW13939_07255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490397.1"
                     /db_xref="GeneID:55994748"
     CDS             join(1368949..1369154,1369211..1369583)
                     /locus_tag="TRUGW13939_07255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346290.1"
                     /db_xref="GeneID:55994748"
                     /translation="MDLSRVEEVSSKIHLIYHRNKNQHGPAAWWRWLSMLRRTLLKLL
                     ATTQQEKQVQISKYLHAFIIPRCYVAFSTVVAEGQFSTLGSVLIAALAQARDATSLGV
                     DQIADSSNDVLIDQKANESYAGDLGVRIGRPTDRPTETPVEVKQKKTSKPLLAAPVPR
                     QESSIPKPKKSKSKAKKAKSANAIDDIFNFID"
     gene            complement(<1369670..>1373863)
                     /locus_tag="TRUGW13939_07256"
                     /db_xref="GeneID:55994749"
     mRNA            complement(join(<1369670..1370226,1370281..1370756,
                     1370806..1371310,1371375..1371745,1371800..1371927,
                     1371994..1372285,1372343..1372387,1372440..1372666,
                     1373477..1373538,1373604..1373645,1373698..>1373863))
                     /locus_tag="TRUGW13939_07256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490398.1"
                     /db_xref="GeneID:55994749"
     CDS             complement(join(1369670..1370226,1370281..1370756,
                     1370806..1371310,1371375..1371745,1371800..1371927,
                     1371994..1372285,1372343..1372387,1372440..1372666,
                     1373477..1373538,1373604..1373645,1373698..1373863))
                     /locus_tag="TRUGW13939_07256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346291.1"
                     /db_xref="GeneID:55994749"
                     /translation="MAKSVRSSTRKRNAAQLRSTVFGPAADARTARLSAKLQELSAQS
                     RETSNPSKESSDDLDEKKLQEDAANQMALDDEQTDKSKSTKTRANRSFPVPVLRCFFR
                     MAGSLAKAALVLANAFIPIAVVLFSSGYFPYKPIIPGEATIVGNGAAPPIFDKVIVMV
                     VDALRSDFVYSNNSGFLFTQELIRTGDAMPFTAHASSPTVTMPRIKAITTGSVPSFSD
                     VILNIAESESMSTLTHQDTILGQLKRGLSGKLVMYGDDTWLNLFPNIFDRSDGTTSFF
                     VSDFVEVDNNVTRHVPGELIRDDWSVMVLHYLGLDHIGHKAGPKSSHMIPKQKEMDAI
                     VEDIFTAMQEREHLQSTLLVLCGDHGMNEAGNHGGSSAGETSPALTFISPKLKNHIAS
                     IESTSWNADEYEYFQMVEQSDITPTLAKLLGVPIPLNSLGVFIPAFLDMWESGSDRLG
                     ILLENAHQILDIVKMAFPKHSFNAKTSVTDCTAGVLSSIEELECEWISILELLTGLDT
                     HVSHDVLQKAIYRFLYRAQSLMSGAASTYKLSMLFSGSLAAAAACVFSLVVAFGPLRK
                     SGFPGIFLVVTALLSGAIMFASSYVEEEQQYWYWIVTAWAAYLHIRLSQRGGASAASL
                     TGVSSTIFLAILNRIMRRWNQTGQKFAGESDIVHGFLSSRPKFLWALILLTYVASFWG
                     LVRSSPIKSKAWLSIWTTLCAALSVAAVSFKVSFAAADSPELLNEWMLKLVEAGSSFS
                     LVLQARVVFLGIFVLFVILTWANSTFGQKRSVTSKRLFHELLTLFLVTQSRATNIPLF
                     LIFRAQASIISKCRLSGVEATINSILMQHMAFFAFGGSNAISSVDLSNAYNGVSDYNV
                     VVVGLLTFISNWAGPTWWISATALVQDHSTPVKATDRIALLTFNTAFSLMSVMAACTM
                     LRTHLFVWTVFSPKFLYSIAWALVNHIGLNLLVASSLSSWLS"
     gene            <1374198..>1376096
                     /locus_tag="TRUGW13939_07257"
                     /db_xref="GeneID:55994750"
     mRNA            join(<1374198..1374345,1374420..1374614,1374670..1374741,
                     1374794..1375110,1375164..1375269,1375326..1375551,
                     1375598..>1376096)
                     /locus_tag="TRUGW13939_07257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490399.1"
                     /db_xref="GeneID:55994750"
     CDS             join(1374198..1374345,1374420..1374614,1374670..1374741,
                     1374794..1375110,1375164..1375269,1375326..1375551,
                     1375598..1376096)
                     /locus_tag="TRUGW13939_07257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346292.1"
                     /db_xref="GeneID:55994750"
                     /translation="MASSGQSSELQSLAALVKTLTNIQMKEILRSEFLAVSGVKTTLQ
                     LRIIEYFERIYQSGQMDRYENIKKFICSFTNRSLPSSPATHQYQSHYNSSRPTQVKET
                     VGSTMSPQPFSNGRLTFKESPFYTILEPLSSTVECKVREQTRDSVDMKFTLSPSIASS
                     LQSDPNLRVMVYCAGDTGLNQFSKSDIAFPHQVELKANLDEVKANLRGLKNKPGTTRP
                     ADITSYTRKKAGYVNQVTMTFALTQKKFYAVVNLVQRRPVEALVAELKDRKIISKEQV
                     LREMRSRAEDTDIVATSTVMSLKCPLSTLRIQVPCRSMVCTHHQCFDASSFLQLQEQA
                     PTWTCPVCNKSTSFEALQIDQYVDEILHSTSSDIEQVTIEPHGAWHYAKTDDDSQNNN
                     IPTGGADDDDDDDFIEIGHLFTPKLKREDASDSFDLHTTPSAQDRIPSVPKSSQKRPA
                     PQVIDLTISDDEDDEPPRPPKRQALGTGDHPLSLTRGNSLQNGFSENGILGFPSGSES
                     LSPGQSTFYIDV"
     gene            <1376677..>1377454
                     /locus_tag="TRUGW13939_07258"
                     /db_xref="GeneID:55994751"
     mRNA            join(<1376677..1376912,1376989..1377106,1377163..1377252,
                     1377323..>1377454)
                     /locus_tag="TRUGW13939_07258"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490400.1"
                     /db_xref="GeneID:55994751"
     CDS             join(1376677..1376912,1376989..1377106,1377163..1377252,
                     1377323..1377454)
                     /locus_tag="TRUGW13939_07258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346293.1"
                     /db_xref="GeneID:55994751"
                     /translation="MSFDSQSPPLNTSDPYARFLGASCLDLLLIEIVPMAERLAEQFT
                     LTEGKEKAEEDELREATFYRLESLGYRVGQGLAERFSRDRPRFADNLDVIKFICKDLW
                     TILFRKQIDNLKTNHRGVYVLTDSAFRPLSRMSMAVRSEAVVGAEAFLWFPCGLIRGC
                     LANLGINATVHAETSELPGATFQIKTTQAKT"
     gene            complement(<1377882..>1380751)
                     /locus_tag="TRUGW13939_07259"
                     /db_xref="GeneID:55994752"
     mRNA            complement(join(<1377882..1378022,1378090..1378234,
                     1378287..1378371,1378427..1378804,1378859..1378946,
                     1379000..1379110,1379184..1379215,1379311..1379321,
                     1380008..1380175,1380258..1380382,1380438..1380461,
                     1380522..1380616,1380712..>1380751))
                     /locus_tag="TRUGW13939_07259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490401.1"
                     /db_xref="GeneID:55994752"
     CDS             complement(join(1377882..1378022,1378090..1378234,
                     1378287..1378371,1378427..1378804,1378859..1378946,
                     1379000..1379110,1379184..1379215,1379311..1379321,
                     1380008..1380175,1380258..1380382,1380438..1380461,
                     1380522..1380616,1380712..1380751))
                     /locus_tag="TRUGW13939_07259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346294.1"
                     /db_xref="GeneID:55994752"
                     /translation="MSNVSSDLIWQITRGQNAFLVKRNDAGGVQFSRDPLNPTNYHSR
                     KYAGFVNEKAIGLESSENGGVSLIAKNASNTQNPAKNIRTTTFGPNTSNRKIYKSVAS
                     ASAKNGYRADLREVAVARVSALRRSQKPKKDVPASKPRGAKAKKAAEQDFLKIVLGAS
                     GGIGQPLSLLLKASPLVDELSLYDVVNTPGVAADLSHISSPAKLQGFLPADDGLKKAL
                     TGADVVVIPAGIPRKPGMTRDDLFKVNAGIVQTLVKGIAEFSPKAFVLIISNPVNSTV
                     PIAAEVLKAAGVFDPKRLFGVTTLDVVRAETFVQEYSGEKDPSKATIPVVGGHSGDTI
                     VPLFSLAKPALQIPADKYDALVNRVQFGGDEVVKAKDGAGSATLSMAFAGFRFAENVI
                     KALKGTKSETEPTFVYLPGVPGGDAIAKATGVDFFSVPVELGPDGAAKAINVLEGASE
                     QEKKLVEVAVKGLKTNIEKGVDFVKNPPPK"
     gene            <1381321..>1381762
                     /locus_tag="TRUGW13939_07260"
                     /db_xref="GeneID:55994753"
     mRNA            join(<1381321..1381372,1381443..>1381762)
                     /locus_tag="TRUGW13939_07260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490402.1"
                     /db_xref="GeneID:55994753"
     CDS             join(1381321..1381372,1381443..1381762)
                     /locus_tag="TRUGW13939_07260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346295.1"
                     /db_xref="GeneID:55994753"
                     /translation="MSYLLYSASFFVLVIGTALYLTRSRWLPHVPVPDYVYDRLPDSF
                     TGDIEAGFTSSDFDLASNVVEGDSRSGLDKKAKREIRRIMRKRGVNFDEARRLYTEQR
                     FANNNIGPDGRPRDPKFVSFS"
     gene            complement(<1382142..>1383334)
                     /locus_tag="TRUGW13939_07261"
                     /db_xref="GeneID:55994754"
     mRNA            complement(join(<1382142..1382831,1382883..1383258,
                     1383315..>1383334))
                     /locus_tag="TRUGW13939_07261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490403.1"
                     /db_xref="GeneID:55994754"
     CDS             complement(join(1382142..1382831,1382883..1383258,
                     1383315..1383334))
                     /locus_tag="TRUGW13939_07261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346296.1"
                     /db_xref="GeneID:55994754"
                     /translation="MSGARHWEQDKEATVYIGNLDERVSDSLVWELMLQAGRIVNVHL
                     PKDRVTQAHQGYGFVEFISEEDAEYAARIMNQVRLYGKPIRVNKASADKQKTMEVGAE
                     LFVGNLDPMVSEQVLYDTFSRFGALLSLPKVARDDANLSKGYGFVSFADFESSDGAIA
                     SMHGQYLMNKEISVQYAYKKDGKGERHGDEAERMLASQARKHNVQPQGQPLPPQLVGP
                     GTPMMAGGMPNGDVPRLMPPSAAAPPPDYGAGRGAMPLQMLPQQPRPGPPPPTQPMAA
                     PLAAPPPGLPARPPPSQAGYGGPPPPQGFAPPPPGFNNAAQPPTNYPPVAPAPPGFAP
                     PPGFGGAQGAPPPLPPGFQPPGYGRGR"
     gene            <1384587..>1385664
                     /locus_tag="TRUGW13939_07262"
                     /db_xref="GeneID:55994755"
     mRNA            join(<1384587..1384704,1384766..1385017,1385081..>1385664)
                     /locus_tag="TRUGW13939_07262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490404.1"
                     /db_xref="GeneID:55994755"
     CDS             join(1384587..1384704,1384766..1385017,1385081..1385664)
                     /locus_tag="TRUGW13939_07262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346297.1"
                     /db_xref="GeneID:55994755"
                     /translation="MREQNASSTSFIETIAGFTAGIVSTLTLHPLDLLKTRLQVDSIS
                     RTRVVGSSTRLLRHIYTREGGIAAFYRGLTPNIIGNSTSWAAYFLFYGNIKQALSRRG
                     GSGGDSKELGASEYFFASGAAGILTALLTNPIWVLKTRMLSTGSAAPGAYTSFIAGAR
                     QILKHEGFAGFYRGLVPALFGVSHGAFQFMAYEKLKAYRTSTTTTATTTTSSTTAANA
                     NNSRNSLGTLDLLGISGLSKVFAGCITYPYQVLRTRLQSYNAAIVYRGVWDVTRQIWR
                     QEGITGFYKGLGPNLLRVLPGTWVTFLVYENTKGVLYKSIG"
     gene            complement(<1385790..>1387527)
                     /locus_tag="TRUGW13939_07263"
                     /db_xref="GeneID:55994756"
     mRNA            complement(join(<1385790..1386131,1386184..1386357,
                     1386408..1386461,1386514..>1387527))
                     /locus_tag="TRUGW13939_07263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490405.1"
                     /db_xref="GeneID:55994756"
     CDS             complement(join(1385790..1386131,1386184..1386357,
                     1386408..1386461,1386514..1387527))
                     /locus_tag="TRUGW13939_07263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346298.1"
                     /db_xref="GeneID:55994756"
                     /translation="MEATVPVSYRIPNSDLRALEPPRFLGSHVDQSLPYFPSASVAYA
                     SHLAAPPSYDVIGNYQSYQQQPFFCPPATSQHHQQQQNQNHPQQQQQQQHQPHQQQHH
                     HQQQKQQPHQQQQHHQPYQQQQHHQPHQQPHQHHQQLHQSHQHPQVRLPEAVPLSASP
                     EHQPKTVIYSSHSSHSSHSSNSSYHGHPRPLPDTQPRLLTNYHPNTTHITPVVRHPPS
                     PTIKKEQDSSTKEVEFATEIDVLMKAIQSHDGSGSGSSTPGPQQFSPVQPYQQNPYAV
                     NAPPYQYPPHPRVPASSPDRIQDQSQKAKRKHQCTLPECGKFFTQKTHLDIHMRAHTG
                     AKPFQCKEPSCGQRFSQLGNLRTHERRHTGEKPYSCEICHKRFAQRGNVRAHKITHEQ
                     AKPFTCQLDNCWKHFTQLGNLKSHQNKFHATTLRNLTLRFANVDPDAMTPDDRSLWTY
                     FASLYKNSNKGIKGRGKDRKISYSTVLRSKDPDMKELPPSDDSSYDGGEYDDEPHKRY
                     IHAGLMHHLHHNPYTKKEQ"
     gene            complement(<1390123..>1393061)
                     /locus_tag="TRUGW13939_07264"
                     /db_xref="GeneID:55994757"
     mRNA            complement(join(<1390123..1391719,1391782..1392360,
                     1392409..>1393061))
                     /locus_tag="TRUGW13939_07264"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490406.1"
                     /db_xref="GeneID:55994757"
     CDS             complement(join(1390123..1391719,1391782..1392360,
                     1392409..1393061))
                     /locus_tag="TRUGW13939_07264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346299.1"
                     /db_xref="GeneID:55994757"
                     /translation="MVRPATAVTSAVLFFVHASAVITLPPGANTGQNLLPNIDDPNAV
                     NAQTACPGYTATNMQTSNHGMTATLSLAGDACNAYGTDVDSLDLTVEYQANDRLNIEL
                     VPSHIDSTNSSWYILPETLVPKPQSEQANADDSDLKFTWSNKPSFNFKVTRRSTGDVL
                     FNTEGTVIVFENQFIELVSSLPEDYNLYGLGERMHGLRLGNNFTATTYTADNPDPLDV
                     NIYGFHPFYLDTRYYEVDGDGSYTYVPADTADASKNYVSRSHGVFLRNAHGQEVLLRP
                     DNITWRTIGGSLDLYFYAGPSQAEVTSNYQASTIGLPAMQQYWTFGYHQSNWDWPNWD
                     TLEQVVANFSMYAIPLETMWSDIDYMDQYRNFQNDPVNYPYDQGADFIDSLHQNGMQY
                     VPIVDPIIYYPNPNGDTADYAPYDRGTEANVWLTNPGGSVYIGAGWPGYTVYPDWHHP
                     NTSAWWLNELALWGQSIKFDGIWIDMNEVSSSCVGSCGSAYVTQDAEHEARDFEVAAD
                     ATSTASYLVTTPTPGVRDINYPPYVINHVQPGHDLAVGAVSPNATHIDGVQEYDVHNL
                     YAYQETNGTYQALTQIIPGKRPFILSRSTFAGSGKWAAHWGGDNIADWLHMYLSIPQA
                     LSFSLYGIPMFGVDTCGFEGNTDEELCNRWMMLSAFFPFYRNHNCIGSIPQEPYQWTT
                     VTQASKFIMGIRYALLPYMYTLFHDAHTTGSTVMRALAWEFPDDPSLAAVDRQFLLGP
                     SLMIIPVLDQGATSVDGVFPGIAQGEIWYDYYMQTEMAVEAGVNTTLDTPLGHIQLFI
                     RGGSVLPMQQPALVTRDVRNSPWSLLVALSGNGTAKGSLYVDDGESIVQNATLSVDFK
                     ANTTDTETGSASSSLYASVSGDFQDTNALGNVTILGVSSVGNVTFNGNAVGSDSIAYN
                     EESKVLIVNGLLDLTQSGAWDQDWVLSW"
     gene            complement(<1394045..>1396234)
                     /locus_tag="TRUGW13939_07265"
                     /db_xref="GeneID:55994758"
     mRNA            complement(join(<1394045..1394142,1394195..1394327,
                     1394376..1394846,1394940..1395472,1395548..1395861,
                     1395921..1396002,1396114..>1396234))
                     /locus_tag="TRUGW13939_07265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490407.1"
                     /db_xref="GeneID:55994758"
     CDS             complement(join(1394045..1394142,1394195..1394327,
                     1394376..1394846,1394940..1395472,1395548..1395861,
                     1395921..1396002,1396114..1396234))
                     /locus_tag="TRUGW13939_07265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346300.1"
                     /db_xref="GeneID:55994758"
                     /translation="MYNAHRGMVPAPNSRLSELLEQLRQEFDNQSRSTGEFEHQLTGQ
                     LQEMEMIRQKVYQLEQTQIKMKTDYENEIRVLRHELESRGVQTVPSHVGGPPHAGPSQ
                     APPALGHGTNNLFGGIMANQGGSGPGLAPPPPQDQQPPQHGLQQPAPAAQQGPPQPPS
                     SYGAYQPGAAVNGYGPPPPPTASPGPGKGRGRPPPGPATPQQTHQLAYPAPGASPQIP
                     RPTPPGQALVRERPGNTLANWNPDDLPATQKREGPDWYAVFNPEVQRVLDVELVHHLV
                     HDSVVCCVRFSRDGKYVATGCNRSAQIFDVATGQNVATLQDESVDKDGDLYIRSVCFS
                     PDGKYLATGAEDKQIRVWDIATRSIKHVFSGHEQDIYSLDFAGNGRYIASGSGDKTVR
                     LWDVLEGKLVYTLSIEDGVTTVAMSPDGHYVAAGSLDKSVRVWDTTTGYLVERLENPD
                     GHKDSVYSVAFAPNGRDLVSGSLDKTIKMWELTAPRGMLPGTGVKGGKCVRTFEGHKD
                     FVLSVCLTPDGHWVMSGSKDRGVQFWDPNTGNAQMMLQGHKNSVISVAPSPTNNLFAT
                     GSGDMRARIWRYVEFLP"
     gene            <1397616..>1398744
                     /locus_tag="TRUGW13939_07266"
                     /db_xref="GeneID:55994759"
     mRNA            join(<1397616..1397884,1397955..>1398744)
                     /locus_tag="TRUGW13939_07266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490408.1"
                     /db_xref="GeneID:55994759"
     CDS             join(1397616..1397884,1397955..1398744)
                     /locus_tag="TRUGW13939_07266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346301.1"
                     /db_xref="GeneID:55994759"
                     /translation="MDVILEVWDLVIGDRLYAATLPATLKSSPSLSTFIQDANNTLSL
                     FGDARSYTYEPASSYLYLEPSKYAYLSMWPRDNIYRQASSLFLITWIFGVLIYFFFST
                     LSYIFVFDKTTVNHPKYLRNQMRLEIAQTMRSMPVMSILTTPFFLAEVRGYGNMYDTF
                     DQEPFPYYSVLQFPLFILFTDLCIYWIHRGLHHPLIYKTLHKPHHKWIMPTPYASHAF
                     HPIDGWSQSIPYHVFPFIFPLQKFAYVLLFVFINFWTILIHDGEYVANSPVINGAACH
                     TMHHLYFNYNYGQFTTLWDRVGGSYRKPNEELFRRETKMGKKEWENQSKEMETILKTV
                     EGEDDRQYLGEKDTKKRI"
     gene            complement(<1399259..>1400803)
                     /locus_tag="TRUGW13939_07267"
                     /db_xref="GeneID:55994760"
     mRNA            complement(join(<1399259..1399810,1399863..1400564,
                     1400625..1400744,1400801..>1400803))
                     /locus_tag="TRUGW13939_07267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490409.1"
                     /db_xref="GeneID:55994760"
     CDS             complement(join(1399259..1399810,1399863..1400564,
                     1400625..1400744,1400801..1400803))
                     /locus_tag="TRUGW13939_07267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346302.1"
                     /db_xref="GeneID:55994760"
                     /translation="MTRDIHVGIVGAGIGGLAAAIALRRAGARVTVLEAAEELGEIGA
                     GIQMTPNVSILLQRWKVADVIGENLVQFEELNMRRKDGTLVGHTEIATLEHNLNRPWW
                     VVHRAHLHEGLATITKEHGAQIHIASRVVHVDFDKTEQVTVATDKGSKYTFDLVIGAD
                     GINSIVRKALFPNVAPEPPTTNCAYRAIVPYEQIRKDPISKTLIDKLTMEVWMAPNAY
                     IITYPISAGKDFNLVLSHHRPEKLRATESDVPIEEMYREYKDFDPRIQRIVNMITETS
                     RWPLMVTGPLKSWSSPKKNVVLMGDAAHSMVNHMAQGAATSMEDGAFLAKCIGSVVQG
                     KLKLQEAISLYEQERMPKAYAKQQVSFINGALWMLPDGPEQQARDRSMAPELEGKYYV
                     RSANLYGDPQTVLDVYGYDVEAHADEAVAKYLNGGKEPAHPVTGVTPAMQEKYMGWML
                     EARGQSKL"
     gene            <1401147..1408051
                     /locus_tag="TRUGW13939_07268"
                     /db_xref="GeneID:55994761"
     mRNA            join(<1401147..1401566,1401629..1401985,1402059..1402243,
                     1404331..1404517,1404641..1404735,1405064..1405373,
                     1405429..1405529,1405585..1405871,1405924..1406421,
                     1406475..1406667,1406718..1406867,1406918..1407399,
                     1407462..1407671,1407732..1408051)
                     /locus_tag="TRUGW13939_07268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490410.1"
                     /db_xref="GeneID:55994761"
     CDS             join(<1401147..1401566,1401629..1401985,1402059..1402243,
                     1404331..1404517,1404641..1404735,1405064..1405373,
                     1405429..1405529,1405585..1405871,1405924..1406421,
                     1406475..1406667,1406718..1406867,1406918..1407399,
                     1407462..1407671,1407732..1408030)
                     /locus_tag="TRUGW13939_07268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346303.1"
                     /db_xref="GeneID:55994761"
                     /translation="FGLSILFRPRYIIIPFKMTVLRQTLKVPHLGGTTVGFRSSASVL
                     DPAKPTLVLVIPFTTTVDYYAPEFEDTTLTNKLNLIAIEPLGHGATRTGSEAFTYWDS
                     ALINLQLLEILGVDRVFAGGTSQGGWIAVQMALLAPQKVQGLVLIGTSMDSESPQSRD
                     LGCWDGPSATSGFVKLGADMSPQHDDFEPGQGYYDFLMEIGYGKGLDASLRSFWEETI
                     KTTYQGDEGKRRICMAAINLASRDGLYERLPYVKCPVIWLHGTADVVFSLANAQEGIK
                     HFVNSPEARLVPLDKGVHFLSFTHPREVHENILEFTARWSRQGRLRQVLPKEETNANG
                     FQIPKDLVTLNRLFDSAKNILAIVEAKKHRREDKAENTMMQEAVEVAAWTWVTFISYS
                     NDYLGYLDPEKGQVTTNTHMTMQNKNVGAHLKREWRVPSRSPRRPSTPDSPDSHPPPT
                     SIAYACMHGSIMKTGLSSNPPNNNSSPSLTHDITNAVASPSPSNPDGHAHKRRRVALA
                     CGTCRSRKSRCDGARPKCSLCRELGHECVYQQVGSSPNLTVGKEYVAQLEHRIEQIEE
                     FLRPLREGRAEITPVKSFPLPEENDLYQHNGLATAGDPGKLPSHQGNHHNANEMGEAD
                     TSEDPIDGMAAISFQYEQDAGFFGPSSNIAFMRHISKAISQATYRNPSLLSVPSNDKH
                     GSGMANPSPAHAHTEKTPHMKNSRGVNIYALPSEEQSWDLIEKYFSKTGQLLPFIHEQ
                     SVRETYFQMKRNDSTKVRRTWLGLLNIIFAIAMSLCTDSDMPAQQRIDQSDVFYQRAN
                     ALCDRESRRNISLEMVQYLLILGQYLQGTQKSVQAWTTHGLAITAAFQLGIHSPEANK
                     AFPALECEIRKRTWFGCVLLDRTLSMTFGRPCIIPQSYVRLDMPSHEMQVLGRIPQPE
                     TRAHRDGCFFNAAVQLYVVMYNVIDTSYDQNLGFSTSETSYDIVSKVLEGDRQLEEWR
                     HGLVPSLGLHVLQKPLTARDIDLMTVDSVIFQRFNIVLSLRFHNLRILLHRKFLEKFL
                     DKGGMAGSEVKFPQQVGVNSVHNCVESAIVIISTVHTVATTTGWHRGLLGAWNYSLYY
                     TFNAGLVIFGALLVSSRESPKNPSLWEPVERSRPYLDLAADALRQLDSGNRVIERCVE
                     YLSQLALALAALDSNPTPGNIPITTLTSTNASTYPDTIVPPSTHMVPFNGHPQFSLSQ
                     SPVSVDLGEFMIDSDLDYLGKVFFDLSHNNNNNTNSDNRASAVYQQPSGLYRG"
     gene            1402667..1402788
                     /locus_tag="TRUGW13939_07269"
                     /db_xref="GeneID:55994762"
     tRNA            1402667..1402788
                     /locus_tag="TRUGW13939_07269"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:55994762"
     gene            complement(<1408181..>1409347)
                     /locus_tag="TRUGW13939_07270"
                     /db_xref="GeneID:55994763"
     mRNA            complement(join(<1408181..1408973,1409040..>1409347))
                     /locus_tag="TRUGW13939_07270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490411.1"
                     /db_xref="GeneID:55994763"
     CDS             complement(join(1408181..1408973,1409040..1409347))
                     /locus_tag="TRUGW13939_07270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346304.1"
                     /db_xref="GeneID:55994763"
                     /translation="MPRIPTSLILKSYRENPLLPSLLKECRTLESARNELRWLREGAI
                     KASKNNNNASPIEARLSWQLALRKMCALRSRGRPLQYILGDQPFGELEILCEKGVLIP
                     RVETELYTIHAKDLILEGLNAKRLDSKTLRILDVCSGSGCISLLLHSLLAPHVGNLTI
                     AGLDVSPQALNLALKNKTHNIDGGLLAPRAETEITFRRFDIFDELDTPGGLLSINNAP
                     NRASTDTTTLTRGQSTWDVLISNPPYISPSDLIGGKTSRSVRKYEPMQALVPPVIKDR
                     SLWEESLGLKNVPREDVFYPRLLYLARKLDVKLVVFECGDVAQAQRIVDMARVIFAKS
                     EGNENLSIYIWSGYDTSSDCDDGARAVVVKRV"
     gene            <1411210..>1411559
                     /locus_tag="TRUGW13939_07271"
                     /db_xref="GeneID:55994764"
     mRNA            join(<1411210..1411344,1411428..>1411559)
                     /locus_tag="TRUGW13939_07271"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490412.1"
                     /db_xref="GeneID:55994764"
     CDS             join(1411210..1411344,1411428..1411559)
                     /locus_tag="TRUGW13939_07271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346305.1"
                     /db_xref="GeneID:55994764"
                     /translation="MEDASEDVAEDVVMADTGSNQVFSPAKTMEKVPSNITAEIEDIV
                     MILQEAADKPDEVEDVEDNTEIEFQVVGSFTAVGMVEKTKKNSL"
     gene            <1412408..>1415176
                     /locus_tag="TRUGW13939_07272"
                     /db_xref="GeneID:55994765"
     mRNA            join(<1412408..1412452,1412503..1412609,1412669..1412740,
                     1412811..1413235,1413299..1413463,1413777..1414150,
                     1414225..1414305,1414377..1414492,1414540..1414658,
                     1414722..>1415176)
                     /locus_tag="TRUGW13939_07272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490413.1"
                     /db_xref="GeneID:55994765"
     CDS             join(1412408..1412452,1412503..1412609,1412669..1412740,
                     1412811..1413235,1413299..1413463,1413777..1414150,
                     1414225..1414305,1414377..1414492,1414540..1414658,
                     1414722..1415176)
                     /locus_tag="TRUGW13939_07272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346306.1"
                     /db_xref="GeneID:55994765"
                     /translation="MLAKNLLRPSGRSLQAALFTRSFATQAPPPSEPSTTKTTVDKKE
                     GKAAKPPPSTATTKQPKEGEQEKEAEPVKPWPLRLDDTGEKFRLPRSVQALYLRPLRR
                     TAEHGLPVCDLQLRSYSVRNLEFFADFAIRAAYYLKLPVSGPVPLPRIVERWTVPRSN
                     FIHKKSQENFERITLRRLIQIKDGHQDSVQLWLAFLRRHAFYGVGMKANVWDFDDLDV
                     AGGLDAAVEDVNKTLEPYFAQFGQRKGAKESQSVGSYLDSERFANLQSPLNEVPVKAN
                     RILRHPFRPVSKLSGSFLPHRNLQTSAAASSSSQQQIIFSGIQPTGIPHLGNYLGALR
                     EWVRLQNESTGDRKLIFSVVDLHALTVPQEASQLRQWRREIFAVLLAIGLDPKRSTLF
                     FQSAVPAHAELMWILSTVASMGYLSRMTQWKSKLQLPEDVSLDDTNATSKLRLGLFSY
                     PVLQAADILVHRATHVPVGDDQKQHIEFTRYTANSFNHLFGPIFPAPEGLISPAKRVM
                     SLKSPLRKMSKSDADPRSRILLTDSGEDIHKKIKQALTDSEPNITYDPDNRPGVSNLI
                     EILGHFDSSGKTCTELADELRSTSMKSLKSVVATTIDAHLRDIRERYFEIIGKEAGYL
                     EGVAEEGARQARANADITMGAVRSALGL"
     gene            <1415949..>1417558
                     /locus_tag="TRUGW13939_07273"
                     /db_xref="GeneID:55994766"
     mRNA            join(<1415949..1416137,1416228..1416546,1416609..>1417558)
                     /locus_tag="TRUGW13939_07273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490414.1"
                     /db_xref="GeneID:55994766"
     CDS             join(1415949..1416137,1416228..1416546,1416609..1417558)
                     /locus_tag="TRUGW13939_07273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346307.1"
                     /db_xref="GeneID:55994766"
                     /translation="MMWSTLAVFLAVANFDVGQAISLHKRDVATVVSLDITRNHVPDP
                     ATRDLRRRSMTVIESLDNEETLYFCNVTLGTPAQKVRLSLDTGSSDLWCNTASSTLCS
                     GKGDNCATSGTYDANSSSTYEYLSSDFNISYVDGSGAAGDYVTDTISIGGATLKSFQF
                     GIGYSSDSTEGVLGLGYPINEAEVSRARTSPYANLPKAMVDDKLINSNAYSLWLNDLD
                     ANTGSILFGGVDSDKYIGDLETLPILRVDGEYAEFLITLTGVAFDNGSTDKKYNSSDL
                     PAAVLLDSGSSLTYLPDSIVEDIYDDVGVTYDTASGVGYVPCSYMNDDKNFTFTFSSP
                     SISVDMSEMVLEAGTGSTYPDGTSACVFGIAPAGTSTVVLGDTFLRSAYVVYDIANNE
                     ISLAQTNFNSTSQDIQEIGTGSSSVPGATAVSNPVTSVVGAGSDATAVITGAVASATG
                     SSGAATTRSSLMGGLTHLPAVMTVAGFVLTLWMWT"
     gene            <1419108..>1419712
                     /locus_tag="TRUGW13939_07274"
                     /db_xref="GeneID:55994767"
     mRNA            join(<1419108..1419359,1419419..>1419712)
                     /locus_tag="TRUGW13939_07274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490415.1"
                     /db_xref="GeneID:55994767"
     CDS             join(1419108..1419359,1419419..1419712)
                     /locus_tag="TRUGW13939_07274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346308.1"
                     /db_xref="GeneID:55994767"
                     /translation="MAFKHLLVATLPALAVACTGPPVNQNGLNLIKSFESFQPSVYDD
                     GFGNPTIGYGHLCSDSTCSEVPNQPLTEEAASQLLAGDLVTYQDALTNALADPVTLND
                     NQYGALVSWTYNVGAGNMGNSDLVSRMNGGEDVVIVTHDELPQWNKVNGQVVDGLTRR
                     RQAELDLFDAPATLPALPVPC"
     gene            complement(<1420347..>1421518)
                     /locus_tag="TRUGW13939_07275"
                     /db_xref="GeneID:55994768"
     mRNA            complement(join(<1420347..1420547,1420610..1420874,
                     1420926..1421172,1421233..1421315,1421382..>1421518))
                     /locus_tag="TRUGW13939_07275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490416.1"
                     /db_xref="GeneID:55994768"
     CDS             complement(join(1420347..1420547,1420610..1420874,
                     1420926..1421172,1421233..1421315,1421382..1421518))
                     /locus_tag="TRUGW13939_07275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346309.1"
                     /db_xref="GeneID:55994768"
                     /translation="MNFRALTFYTALAVTLSILLYLRNSYWLVPPSISNSARPRMYWF
                     AFGDSYSATGFDIGSTQPSASNPTGNAAPGLGTQSGGDNWIGYLTTEYNTSLILSYNL
                     AIAGATIDNSLATWEFDDVASQVAAFRSNYASRPESAPWTANNALASFWVGINDVYYG
                     FAHDEDPSTFVPTLLDKYRSLVEDIYSDGVRQFLFLNCPPSTRSPQVHEENDLPEQFD
                     RHAAMVSAYNDGLVDMAFQFSQDHDDSTVVFYDSWAFMTRVLDNPAEYGYQDATCIND
                     DGSSCVWWNNLHPGWTYHRSQADDMLASLTPLGW"
     gene            complement(<1422050..>1423721)
                     /locus_tag="TRUGW13939_07276"
                     /db_xref="GeneID:55994769"
     mRNA            complement(join(<1422050..1422742,1422938..1423407,
                     1423715..>1423721))
                     /locus_tag="TRUGW13939_07276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490417.1"
                     /db_xref="GeneID:55994769"
     CDS             complement(join(1422050..1422742,1422938..1423407,
                     1423715..1423721))
                     /locus_tag="TRUGW13939_07276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346310.1"
                     /db_xref="GeneID:55994769"
                     /translation="MGGSAEREIIRKGGRQTLRQHRSLCLTSFNTDNVHIIDPEDRLF
                     ASSGAIYPGGPSTWYVVDWDQRRLVSVTMDEELESEDPALEHLLKHIDDLAPDVYEIY
                     VSSEGFLISTSTDAKDDETYCPFYPPLSTVQNAEDVQVISRAGLEELDRLSANVDLVI
                     VVDELKGRFVGFTTVYIAGGTLEENKTRQFKLKWLQQLIDVVDELNLNLGIAHQDVAP
                     RNIVINEETDSLMLFDFNFSVRIGRAGYSEPRNDIKGVMFSMYEIITRNDDLRDIRHE
                     DQDVSVIENQDWVKHPDVLLDHPVSEFRALLTRWCEKRRSGKHITVRTEAPNFLDWPP
                     LPDPPLSEVETHYQDGTAVKKLKKVYQWRRTELRELGRTILNWQRPPQRRLAQNA"
     gene            <1424694..>1426558
                     /locus_tag="TRUGW13939_07277"
                     /db_xref="GeneID:55994770"
     mRNA            join(<1424694..1425684,1425741..>1426558)
                     /locus_tag="TRUGW13939_07277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490418.1"
                     /db_xref="GeneID:55994770"
     CDS             join(1424694..1425684,1425741..1426558)
                     /locus_tag="TRUGW13939_07277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346311.1"
                     /db_xref="GeneID:55994770"
                     /translation="MAIASEENSAIKVTDVDMRWPYRAGYPRLCAQPVGTRFLPEGNP
                     ILASLNLLELRAQVKEVLDEHSIALRSFTWDNIAHPIQLAYRAYDHELDTPSPTQIRL
                     IVRCIYEKEASNSVTWVLAIPKIYKVIKTLASQVTGMELFDHEYMKSCQLCELPATDK
                     SLVPEWEKEGGYREKVLEIFDGYPRMFQVMMPIGLRAVGPRASDHEIVLFLSAINAED
                     DRWAKIQDKLQSILPENIGIEIRQSVGPLLYNDFFRPFLPGDATELNRPPKPGNKISP
                     QTETERQNLLNGTPTAEADFLPGGRLGGYVTTQNEETKIQTTYGLTSGHVVLPTSDRE
                     VTYKKQHYQNGHPIAIQSPSGKTRQKYAYRPTEHIAHLESNNLRVQEVYEATKDPGTA
                     QKCERLLRKTQLELDAARNNLRTAQQQNPCIRSVAAATLSCRKYVLSPVQNKLMMDVA
                     LVDVGSAVPESRNEWDVGTDRAMCDTWDVDGLGNGIDFVAKLGETGLKHQGVVNPFKA
                     DIMFDSFDGNDGNLVSAWTVSPVWESNHRTETFATPGDSGTFIVSLYDWGRPLPLEKL
                     LAEVPPSLLACCLVAVYRLGWASLFPLTLSRTKSRT"
     gene            complement(<1427038..>1427806)
                     /locus_tag="TRUGW13939_07278"
                     /db_xref="GeneID:55994771"
     mRNA            complement(join(<1427038..1427119,1427185..1427547,
                     1427623..1427679,1427736..>1427806))
                     /locus_tag="TRUGW13939_07278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490419.1"
                     /db_xref="GeneID:55994771"
     CDS             complement(join(1427038..1427119,1427185..1427547,
                     1427623..1427679,1427736..1427806))
                     /locus_tag="TRUGW13939_07278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346312.1"
                     /db_xref="GeneID:55994771"
                     /translation="MGVKKKVRKFAQVKRAITLRDNRLKPQSETTDKKKEDDVVREIP
                     QVSSSLFFQYNTSLTPPYSVLVDTNFLSHSVQHKLEVIPTMMDCLYAKCIPIITDCVL
                     AELEKLGQKYRLALRIAKDPRFERVKCDHKGTYADDCIVDRVIKHRIYIVATNDRDLK
                     RRVRKIPGVPIMNVARGKYTIERLPDAPEK"
     gene            <1428039..>1429828
                     /locus_tag="TRUGW13939_07279"
                     /db_xref="GeneID:55994772"
     mRNA            join(<1428039..1428298,1428367..>1429828)
                     /locus_tag="TRUGW13939_07279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490420.1"
                     /db_xref="GeneID:55994772"
     CDS             join(1428039..1428298,1428367..1429828)
                     /locus_tag="TRUGW13939_07279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346313.1"
                     /db_xref="GeneID:55994772"
                     /translation="MGIPNLSRHLASLSEPIVFGGSHDGPSTNSVRSVVIDGPALVYH
                     VHSILASKGSSRLSQIDRQPSCNEVSVAVMNYLVLLKTLNISVLKIYFDGALPLHKRD
                     TRLSRLEKSRKQLETFCRATSRESGLISVERGAVAIWPRDLFQGFESSGKRPKLPENA
                     FMVSAVIEDLVSRWNISEIKSNLLGNLANLYMDDTDHPWSDICEVVPGEADIACAALA
                     YREPGLAILTSDSDLLVYDFGSSSSVIFFNTFSTESWYDKDPSQSTVRAMSISPGSVS
                     RRLGIPALSYFAYELSLDPHAGFRELIRRAKHASAESSQPVPAAYTEFMRQYDFQCFQ
                     NGSLDPSLLRGIDVRLSELLVQCLWTSEYLEETPRIYLPFLQEDHSRRCGWAEGSRIR
                     RLAFSLLNFNPTGVVKYSTITECTRRGTRFCFDQVALYTRETIDLEARRLLDIFNHIQ
                     TANPQEDGSPIFWRIFAIAEIHLNATDTLPPRLDKQALASFLGFGKTKKINNSSSSVV
                     GWEEIHALAQMQSVLYSLRILSQIITTVPHSQGLVGQLHAILSTLPPLHVLMRSYREV
                     RDEFYNV"
     gene            complement(<1430058..>1433379)
                     /locus_tag="TRUGW13939_07280"
                     /db_xref="GeneID:55994773"
     mRNA            complement(join(<1430058..1430651,1430702..1431340,
                     1431392..1431661,1431723..1433204,1433263..>1433379))
                     /locus_tag="TRUGW13939_07280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490421.1"
                     /db_xref="GeneID:55994773"
     CDS             complement(join(1430058..1430651,1430702..1431340,
                     1431392..1431661,1431723..1433204,1433263..1433379))
                     /locus_tag="TRUGW13939_07280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346314.1"
                     /db_xref="GeneID:55994773"
                     /translation="MPSVSAEDVDFPLAKRQRTLQPRSAKKDEPSSRIFSHFRTLGLV
                     SPTSVPFTSVRLGKSTYQITTSIGNVLQTYDFKRGLSLVFASQPRTPKPITATFAWRN
                     VVFAAWGGQQVGDESGVWVFRRGKKIASLEATPSFAGPVTRLLVFGSWIVGCCESCIQ
                     VWNSTSYAHYTTLIAKPSRSTPDLPIFTGNICTMPTYLNKIFAGRYDGTVEIWNISSG
                     KLLHTILPLTAQDGAVTAIEPTPALSHIAIAYKAGTVVVRNVDTEQAVLSLNSNSPHP
                     VTSISFRTDGIGAGDEGRLPGVMATATSYSGDITLWDLNNGGRRTGTLREAHELHQKD
                     SDGGVNKTEFLDGQPFLISSGRDNALRSWIFDESPFSPIPRMLHSRGGHAAAVSALSF
                     LPASSDGSDSAGKWLLSGSKDHSLWGFSLRKDSQNSELSQGNIKSKSQKKGILRSGPT
                     SEDLKAPEITSIACSLNRDAGMGASSQQVWTNSKDAKKSLQNANGWESIVTGHKGDKF
                     ARTWYWGKKKAGRWAFETSDGTEVKSVAISTCGTFAVIGSAGGSVDMFNLQSGVHRQH
                     FPPRVSTQKSRLSLPGTAVRLHRPDESHKKHTKAVTGIAIDSLNRYVVSCGLDGKVKF
                     WDFSTGRLFTELNWSPMTAITGLRASNINELVAFSCDDLSIRVVDLETKRVVRELWGC
                     RGQVNDFAFSNDGRWIVASSMDSAIRVWDLPTGHLIDKIQVPTTCTALAFSGTGEFLA
                     TAHADELGIHIWNNKSLFSTLQPNHIDEMNTEQNWDSSAITETKSGMIDAAYAVEAEG
                     GNQEPSIISTEQLGDDLMTLSIVPRSSWQTLINLETIKERNKPKEPSKAPERAPFFLQ
                     TIDEKEKAGTDARLTQEPATAELSRASVIQNHQILPSQKDHVSKLLKTGASRQNFAPF
                     IDYFKTLSPGKIDLEIRSLNVQFSSQGHSELVDFVNALTERLRQKKDFELVNAWMAVL
                     LKVHGELIRNIWEAQDTETGSSHALQAALMAWKREQQSETKRLSELMGYCRGVVGFLR
                     STR"
     gene            <1433960..>1445015
                     /locus_tag="TRUGW13939_07281"
                     /db_xref="GeneID:55994774"
     mRNA            join(<1433960..1436549,1436603..1437893,1437949..1437993,
                     1438460..1438666,1438747..1441749,1441817..1441839,
                     1442132..1442245,1442312..1442393,1442462..1443142,
                     1443354..1443369,1443735..1443780,1443831..1443934,
                     1443999..1444112,1444170..>1445015)
                     /locus_tag="TRUGW13939_07281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490422.1"
                     /db_xref="GeneID:55994774"
     CDS             join(<1433960..1436549,1436603..1437893,1437949..1437993,
                     1438460..1438666,1438747..1441749,1441817..1441839,
                     1442132..1442245,1442312..1442393,1442462..1443142,
                     1443354..1443369,1443735..1443780,1443831..1443934,
                     1443999..1444112,1444170..1445015)
                     /locus_tag="TRUGW13939_07281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346315.1"
                     /db_xref="GeneID:55994774"
                     /translation="IQTEQTQLVALAAAMSDNANSTNDPVSDRAMHAPKSTETPQYSG
                     TAISEADELPNAHVINPPTSQSMSSGHLPDTKRQSFSSLISWGSGIVHDAAPTKNSNE
                     DGVKSAQSDHALPNLSYTSQGPQPPRNDIPFEGWQGNRLSRPTRSSSKTPRRLSGSTA
                     ASSASEADPRPPVIGRIGVCALDVKARSKPSQNILTRLQLKGDFEVLVFGDKVILDEA
                     VENWPICDFLIAFFSDGFPLDKAIAYVKLRKPFCVNDLSMQKVLWDRRLCLKILDQMG
                     VPTPSRVEVNRDGGPVLISSDLAQHVYSLTGVKLEGPEDGMGGGAAKTQSVSLSEDGE
                     TLIVDGQTLRKPFVEKPVNGEDHNIHIYFPNDQQYGGGGRRLFRKVGNKSSEYDPELV
                     VPRSITEQNTSYLYEQFLRVDNAEDVKAYTVGPDFCHAETRKSPVVDGVVRRNTHGKE
                     LRYITNLTKEEAAMAAKISNGFGQRICGFDMLRVGDRSFVIDVNGWSFVKDNNDYYDK
                     CAKILKEMFLNEKRKRDRTFELSEPPSPDLMSLKKGNTSSHRSALRTILRSPSMSRLH
                     GSPNSNPTKSQSVSPEIPSNITSVPVSETTKPSLPQAVEETSAPASVTASSANSASVS
                     ISNEEEAAPPPPASKHSWKLKGMVAVIRHADRTPKQKFKFTFHSQPFVDLLKGHQEEV
                     VIKGEAALASVSHAVKVSIEQGLEDMDKLRLLRTSLDKKGGWPGTKVQIKPMFRRRKP
                     EEMGDVPPDSILSTSSRLKHGHPQDAVSPTQDPLSDSDNLSRSQTRSDSISGATFSRF
                     SAVENDLILDKLQLVIKWGGEPTHAARYQAQDLGSNMRDDLKLMNKEALHDVRIFTSS
                     ERRVSTSAQIWACAFLDEKELPEGFIQVRKDLLDDSNAAKDVMDKVKKKLKLLLREGS
                     APSQFAWPKENFPEPSVVLATVVELMNFHRIVMRHNFSRLAPAQSEQQQTTKTSEEYS
                     SFQSSKSTQNPTVTSIQGRWCTGEEAELFKERWEKLFAEFCDTEKVDPSKLSELYDSM
                     KFDALHNRQFLEWVFMPPEDFEVNEEGQVVQPGDADRTEEKADNNTRGHKVGLKQRAL
                     GLLESRHQFGTLEDAYDHYFKLQSGPSSKKKNTDERLTKLRELYKLAKVLFDYVTPQE
                     YGIKDSEKLEIGLLTSLPLLQEIVRDLEEVQASPDAKSFFYFTKESHIYTLLNCILEG
                     GIQTKITRSAIPELDYLSQICFELYESKDSDTDTFSYSIRISISPGCHTFDPLDVQLD
                     SRHAIGCAPRRSLTAHQDWKEVIETLKAKFDTVKLPKSFIAVNLSDNQQSASMLITPR
                     TYQLAQNTNQWDLARDQQYPARFRSLTGWKTDVADAQRAHKMLLVHQSGYVRVGEVIR
                     YTLTYTPSTDHVLPTPSELHVKVKNASAIPLRAAYLHGPYTLYASCYPLDFNPDNQYS
                     DGDRRGIPQFEPYLKAGGGWTAKIPIPEDTRAASFPQDGVQSDSSNKSVTWVIEIVSQ
                     VIFSSSAVVHFELLVGRDQKSTELGIAGALSSSGLPPPTHMQEHQNSRTKDTSSVIVT
                     KGVFSRSVSLVFDDTKSLWNSASFPSAEEKERHIQGVTVPDVGLSTDGPPGENVSDHS
                     ENNRVKPKRRRVHFVVLTHGLHSNLGADMLYLKESIDASSRAAKKDSEERKRLNKGIN
                     SRRASISKQGGCQSSDEPNTTTESYPKNDNMLLGNNGEREEQEEDDDEEEVIVRGFPG
                     NAVRTERGIQYLGKRLAKYVLLMTYPDQPYLPTKKKERKNPSRPFAKKTPSGQPHNNI
                     GADRNLENLGSEYQITSISFVGHSLGGLIQTYAIAYIQKHSPEFFDYIKPVNFVALAT
                     PFLGLSNENPVYVRFALDFGLVGRTGQDLGLSWTAPRRVRNGWDAVIGKLGGDTRQDK
                     MTAASKPLLRILPAGPAHQVLQKFRNRTIYSNVVNDGIVPLRTSCLLFLDWRGLERVQ
                     KARRGNGLVGTMAEWGWAELTGANSSSPARKHSGTDTSLVQDEQILQAGGDGTASENH
                     NSLAQLSLSPTPGQFLKKPLESEPGELSPTIPSSPSKEPISSPNPFNNLMSFFQSSES
                     KPPVNKKSTKIYKRSQTLISQSFSSHESEPSSSPRPRVRGNSVYDEELSAPPKTTIFE
                     SAGDVLRPPLPPTEFIIDPASRPRTIFHDRIYHPGDIPPPILKRRTTMFPGTRHSDSR
                     PLSDTGEGPSVSGLKVEEKIARAYHDGLSWRKVLVRLEPDAHNNIIVRRMFSNAYGWP
                     VVKHLVDTHFGYTYAANTDDALEPNTENAKPLGISATDTGEEVIRQTISPPPTLLQPL
                     TKSTSYDHTLDGSDRYLGVDGTQSNHDSPTSADRRSQKSSASKSESAQWTDRYFSDGE
                     SDSESGGEHGEHSLRSQADTMYNTPDLQEIHDFLVDIAAEAGKLITSSLPRIDSTGSK
                     KNSSDLVTEYDKAVESMVSQRLNAKYPTYDFHGEETYTPEKPLTDKPTFIVDPIDGTV
                     NFVHGFPSSCISLGFAVNRKPLVGVVYNPFTKTLYSAIQGRGAFVNRETRLPLKGDDN
                     LEPLQGLQNALIALEWGSERSGSNWETKIRTFESLGKTREAGGAMVHSIRSLGSAALN
                     ICAVATGSIDLYWEGGCWAWDVCAAWVILSEAGGIMAGGIQGDWDPAIDGRAYLAVRP
                     APNGQGQREIVEELWTHVKGSLAYYPMLIQLVEFLHHGNVQIRQIAAENLVGYSDSDV
                     PLFKRLDMEPMRDLKLLVRDYPPTAKNVLTMLINLSADGEILKYLADDDAFLEVLLAK
                     ITNPKEPNADDIAMLLANLAKADNFTRITSISRQAPEDVSTSKNVLDQLMDCFVKGAE
                     GALNKQANYDYLAYFFADLSKTEHGRSYFTTKQEYDSVVPITKLLVFTEHSSDIRRRG
                     VASTLKNVSFDVKSHAMLFDEDGADILPYILLPIMGPEEYPDDETSEMLPDLQLLPPD
                     KKREPDDQIILTHLETLLLLTTSREGRDKLRAVQVYAIIRECHLNVDNEEIREGCDRL
                     VQVLMRGEEGEKNQADSEAMAKARADALGLEAPQGRIIEDEGDDETIEEIL"
     gene            <1445507..>1447814
                     /locus_tag="TRUGW13939_07282"
                     /db_xref="GeneID:55994775"
     mRNA            join(<1445507..1446853,1446908..1447201,1447270..1447480,
                     1447558..>1447814)
                     /locus_tag="TRUGW13939_07282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490423.1"
                     /db_xref="GeneID:55994775"
     CDS             join(1445507..1446853,1446908..1447201,1447270..1447480,
                     1447558..1447814)
                     /locus_tag="TRUGW13939_07282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346316.1"
                     /db_xref="GeneID:55994775"
                     /translation="MSTPTDPNPVRTATGASAPPVMKIRRPKAADPLVRPKRRPPPGK
                     NIRPSGVANGTRPPPGAAQPKLNTIPEPPLSRLQRSKVREDLTTNGFSGAPLSNTVTD
                     YPLVTTKRALREGLKYHVAKLLSKKSMDPRDESQFTRPVRLQRRDPRFRPPEPDASKS
                     EDTKMLDVANSPGEAEREEFEAKKAAREKEREENLAQIAPSANNPQKRSNPTKPKTQQ
                     VMKADMTAEEIARARVKYEEALPWHLEDFDNKNTWVGNYEAALSETYAMFVLEPSGNM
                     RMVPIDKWYRFNAKNSFKSLTIEEAEKFMSKKVKDPRWFMEKQQEAVEKRELETFAKQ
                     RKVYRGKAVSGTGLDGDDMDFEEDRFADDEEVDAGLFEEDEDAKASEKRIKQDQLKAN
                     IFNLKEEKDYDEEETRERKEKEARKVIGKKVRKALQKREKNFDYSSGSDVNPYSDEES
                     SEEDSEAERQKEADKKLEEEKTAKDKEKESGASTKGTSTPSGRPKHTDALKKAAIGRK
                     RGGSPNLSDASGTDTSRKKPKHASTQPGRASPSPSSVLAATKKRSRIGGAVSGSDIEG
                     GALSGGDMSDNSKAKKLKLNLSLGGSRSGTPLSSRPGSPAPLRAGTPDGVKGPTRGST
                     PRPVAGAGAAGQPSFPTPAEIHAAIPASGILSRDLLKIFHPRIGESKENHRRFIAIVK
                     DVGVYGKEDRLLRPGVLKDA"
     gene            complement(<1448364..>1454699)
                     /locus_tag="TRUGW13939_07283"
                     /db_xref="GeneID:55994776"
     mRNA            complement(join(<1448364..1448846,1448904..>1454699))
                     /locus_tag="TRUGW13939_07283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490424.1"
                     /db_xref="GeneID:55994776"
     CDS             complement(join(1448364..1448846,1448904..1454699))
                     /locus_tag="TRUGW13939_07283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346317.1"
                     /db_xref="GeneID:55994776"
                     /translation="MYGPSTGPQTGINTPRSSQSLRPLTLTHGSLEFSFLIPTSLHFQ
                     AAQLKDTFKATLPQPTDELAQDDEPSSLVELVARYVGYVAYEVDEGDEDAHPTNLEVL
                     KVVLNEFERAFMRGNDVHAVVAGLSGISEKKISVVKSYYAARAAAGRATKPYDSALFR
                     AAAENDVNIYSVFGGQGNIEEYFDELREVYTTYSSFVEDLVSSSAELLQSLSREPEAA
                     KLYPKGLDVLQWLHDRDSQPDTDYLVSAPVSLPLIGLVQLAHYMVTCKVLGRQPGEFL
                     ERIGGTTGHSQGVVTAAAIAAAKTWEEFAKAAKQAIILLFWIGLRSQQAYPRTSLAPS
                     TLQDSIENGEGTPTPMLSIRDLPRAAVQEHIDATNQHLPTDRHIAISLVNSARNFVVT
                     GPPISLYGLNLRLRKVKAPTGLDQNRVPYTQRKTRFVNRFLPITAPFHSPYLAAAYDQ
                     ILEDVDGIEIPAKSLAIPVYDTQSGEDLRSIGGKNIVPELVRMITRDAVNWEQATVFP
                     KATHIIDFGPGGISGLGVLTNRNKDGTGVRVILGGAIDGTNAEVGYKPELFDRDEHAV
                     KFAVDWVRQHGPRLVKTSVGQTFVDTKMSRLLGVPPILVAGMTPTTVPWDFVAATMNA
                     GYQIELAGGGYYNAKTMTEAVNKIEKAIPPGRGITINLIYVNPRAMGWQIPLIGKLRA
                     DGVPIEGLTIGAGVPSIEVANEYIETLGIKHISFKPGSGDAIQQVINIAKANPSFPII
                     LQWTGGRGGGHHSFEDFHQPILLMYSRLRKCNNIVLVAGSGFGGAEDTYPYLTGTWSS
                     RFGYPPMPFDGCMFGSRMMTAKEAHTSTNAKKAIAAAPGVDDSQWENTYNKPTGGVIT
                     VLSEMGEPIHKLATRGVLFWSELDKKIFSLDKAKRVAELKKNREWIIKKLNDDFQKVW
                     FGRNSAGVTVDLEDMTYVEVVHRMVELMYVKHESRWIDNSLKKLTGDFIRRVEERFTT
                     AEGQASLLQTYSELDTPYPTVDTILASYPEASTQLINAQDVQYFLMLCQRRGQKPVPF
                     VPSLDENFEFWFKKDSLWQSEDLEAVYGQDVERTCILQGPMAVKYSNTVDEPVKDILD
                     NIHSDHINFLVRDVYGGKEANVPVIEYFGGQPLRTEDEEPEIDGLIVSEDATKTSYRL
                     SSSPTAVLPDVDSWLQLLAGNVHSWRHAFFTTEVFVQGQRFQTNPLRRLLAPTRGMYI
                     EILSASDPSKTVISVREPSQSAKLVKTLEIKLVAPKEVALTMFEGRTAEGGVIPLTFR
                     FTYHPETGYAPIREIMENRNDRIKEFYYRAWFGEKVVPLDSAITAIFDGGRETVTAQA
                     VADFVHAVGNTGEAFVNRPGQDMYAPMDFAIVVGWKAITKPIFPRRIDGDLLKLVHLS
                     NGFRMVPGAEPIKVGDVLDTTAQINAVINQDSGKMVEVCGTIKRDGQPIMQVTSQFLY
                     RGVYTDFENTFQRKDEVPMQLNLASSKDLAVLRSKEWFRLDESDVELLGQTLTFRLQT
                     LVRFKNNNVFSNVQTIGQVLVELPTKEVIQVGSVDYEAGVSHGNPVIDYLERNGSSIE
                     QPINFENPIPLSGKTPLELRAPASNENYARVSGDYNPIHVSRVFSSYANLPGTITHGM
                     YSSAAVRSLVETWAAENNIGRVRSFHVNLVGMVLPNDAITVKLEHIGMIAGRKIIKVE
                     VRNKETEDSVLLGEAEVEQPVSAYVFTGQGSQEQGMGMDLYGSSDVAKDVWDRADKHF
                     LENYGLSIIDIVKNNPKELTVHFGGPRGKAIRQNYMSMTFETVNADGTIKSEKIFKEV
                     DETTTSYTYRSPAGLLSATQFTQPALTLMEKASFEDMRAKGLVQRDSSFAGHSLGEYS
                     ALAALADVMPIESLVSVVFYRGLTMQVAVERDEQGRSNYSMCAVNPSRISNTFNEQAL
                     QYVVENISEVTGWLLEIVNYNVANMQYVAAGDLRALDTLTNLLNALKAQKIDIPTLME
                     EMSLEDVKAHLVQIIQGCVKLTEAKPTPIALERGFATIPLRGIDVPFHSTFLRSGVKP
                     FRSFLLKKINKTTIDPSKLIGKYIPNVTARPFEITKEYFEEVYKLTGSPRIANVLANW
                     EKYEDPKDAARAATTATA"
     gene            <1456138..>1461824
                     /locus_tag="TRUGW13939_07284"
                     /db_xref="GeneID:55994777"
     mRNA            join(<1456138..1456654,1456717..1461659,1461714..>1461824)
                     /locus_tag="TRUGW13939_07284"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490425.1"
                     /db_xref="GeneID:55994777"
     CDS             join(1456138..1456654,1456717..1461659,1461714..1461824)
                     /locus_tag="TRUGW13939_07284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346318.1"
                     /db_xref="GeneID:55994777"
                     /translation="MRPEIEQELAHTLLVELLAYQFASPVRWIETQDVILAEKRTERI
                     VEIGPADTLGGMARRTLASKYEAYDAATSVQRQILCYNKDADEIYYDVEPIEEEPEPT
                     QTAESSTSAPSGTPAAAAPVAAAPASAGPAAMVEDAPVTALDIVRTLVAQKLKKTLTE
                     IPISKAIKDLVGGKSTLQNEILGDLGKEFGSTPEKPEDTPLDELGASMQATFNGQLGK
                     QSSSLVARMVSSKMPGGFNITAVRKYLETRWGLGPGRQDGILLYALTSEPPSRLGSDA
                     DAKGYLDGIANKYAANAGINLSAPTSGGDSGAGGGGMMMDPAAIDALTKDQRALFKQQ
                     LESIASYLKVDLRAGDRAFVASIESQKALQAQLDLWQTEHGDVYASGIAPSFDSLKAR
                     IYDSSWNWARQDALSMYYDIIFGRLQVVDREIVSQCIRIMNRSNPLLLDFMQYHIDNC
                     PTERGETYQLAKELGQQLIENCKEVIEVPPAYKDVAVPTGPQTTVDARGNISYQEVPR
                     ASARKLEHYVKQMAEGGPISEYSNRTKVQNDLRSVYKLIRRQHRLSKSSQLQFNALYK
                     DVLRALAMNENQIMPQENGSAKKTGRQAKTSSPLRPGKVETVPFLHLKKKDERGWEYS
                     KKLTGIYLDGLESAARAGITFQGKNALMTGAGAGSIGADVLQGLISGGAKVVVTTSRF
                     SREVTEYYQSMYARYGARGSQLVVVPFNQGSQQDVEALVDYIYDTKQGLGWDLDYIVP
                     FAAIPENGREIDSIDSKSELAHRIMLTNLLRLLGAIKTQKAERGFVTRPAQAILPLSP
                     NHGTFGNDGLYSESKLALETLFNRWHSENWASYLTICGAVIGWTRGTGLMSPNNMIAE
                     GVEKLGVRTFSQQEMAFNLLGLMAPAIVDLCQTEPVFADLNGGLQFIPDLKDLMARLR
                     KEIMDTSALRQAVIKETSIENKIVNGEDSEALYKKVVTEPRANLKFPFPELPNWDDEI
                     KPLNESLRGMVNLDKVVVITGFAEVGPWGNSRTRWEMEAHGKFSLEGCVEMAWMMGLI
                     KNHNGPLKGKPYSGWVDSKTGEPVDDKDIKGKYEKYILEHSGIRLIEPELFKGYDPNK
                     KQLLQEVVIEADLEPFETSKETAEEFKREHGDKVEIFEIPDSGEYTVRIKKGANLWIP
                     KALQFDRLVAGQIPTGWDAKRYGVPDDIIDQVDPVTLYVLVCTAESLLSAGITDPYEF
                     YKYVHLSEVGNCIGSGVGGTTALRGMYKDRFLDKPIQKDILQESFVNTMAAWVNMLLL
                     SSTGPIKSPVGACATSVESLDIGYDTIVEGKARVCLVGGFDDFQEEGSYEFANMGATS
                     NAKDEFKRGRTPQEMSRPTSTTRNGFMESQGCGIQVLMTAQLALDMGVPIYGVVAATT
                     TATDKIGRSVPAPGQGVLTGARENPGQFPSPLLDIKYRRRQLEIRRQQIKQWQESELL
                     YLQEEVQAIKSQSSESFSEADYLQERAEHIHREAIRQEKEAQSSFGNEFWHRDSRIAP
                     LRGALATWGLTIDDLDVASFHGTSTVANDKNESDVICQQLKHLGRKKGNAVLGIFQKY
                     LTGHPKGAAGAWMLNGCLQVLNSGIIPGNRNADNVDKVMEKFDLIVYPSRTIKTDGVK
                     AFSVTSFGFGQKGAQAIGIHPRYLFAALDKAQFDSYKAKVEARQKKAYRYFHNGLINN
                     SIFQAKSKAPYEDKQQSEVFLNPDYRVTLDKKTSELTFPSVAPKSETDQTEKTRKMVE
                     SLAAATAMPNSRVGVDVEHVDAINIENEVFVERNFTEAEQEYCHKAPSPQASFAGRWS
                     AKEAVFKSLGVPSKGSGAPLKEIEITNDANGAPTVNLHGAAAEAAKLAGIKSVIVSIS
                     HSDSQAIAVAVSKY"
     gene            complement(<1462119..>1465200)
                     /locus_tag="TRUGW13939_07285"
                     /db_xref="GeneID:55994778"
     mRNA            complement(join(<1462119..1464399,1464803..>1465200))
                     /locus_tag="TRUGW13939_07285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490426.1"
                     /db_xref="GeneID:55994778"
     CDS             complement(join(1462119..1464399,1464803..1465200))
                     /locus_tag="TRUGW13939_07285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346319.1"
                     /db_xref="GeneID:55994778"
                     /translation="MARLLPVSHGSYLPYWVFMMSLLAFFNTYACYTISATDKDAHPN
                     IAYPLTNQLTPLAARFYGTWTAASGALRLVTAYRIKEKGLYIATCIGFVITCLNFLSE
                     VVVFETATWGSMGPGLVLDITTVVWMGSGLLKYALQKLTTLPLSAVKQPPHLALNAAR
                     TMVTEETTAAPPPAPTPTPTSVVDIDGKEYESVKEGLAYILKPVEKTARPEKPRGSGT
                     EQQASVFYNPIQQFNRDLSVIAINVFANHALALKKATAARAQRRGKGRKDKKRKREDD
                     GDGDGDSAKSNKKITTEEGQDGGEVSVENQEKQQEPPKPEAPPIRFQILDALSATGLR
                     ALRYAKEVPLATTIVSNDLSPSAVEAVKVNIKYNNVEEMVRPNVGDARVYMYGIQAEK
                     KDHIVGKFDVIDLDPYGTAGPFLDAAVQAVNDGGLLCVTCTDAGVFASTGYPEKAFSL
                     YGGIPTRLAHGHEVGLRLIVNSIATAAAKYGLAVEPLLSLSIDYYARVFVRVHKSPAE
                     VKFLAGKTMLLYNCDSGCGAWTTQYMTSTRTRANKVGDLFFHHALAQAPTSSEFCRHC
                     GFKTHLAGPMWGGPLHNAHFIQNVLDMLPDLDPETYPTMDRIEGMLTTALEEDLDFQP
                     QTKSKEVEQQQQQQQEEEGLPQKTNKPSSALIPRLDPQLKEKYPFFVCLSDLSRVLRS
                     YTVPINMFRGALHGLGYRTTRSHTRPNSVRTDAPWDVIWEVMREWQRQKTGDKQLPTL
                     PVGTPGAGIMKHSRITQYDEGDEKPLAALKRELSEVLVSGTDVRDLTTKIEAALYRKG
                     ASSSSATTTTTTAQPVSKPKDSNDESNGDENNNGADATATANAEEPAPPHALKIVFDE
                     SLAPQPTLPKGGKKKVVRYPMNPEANWGPMSRASGR"
     gene            complement(<1466099..>1467595)
                     /locus_tag="TRUGW13939_07286"
                     /db_xref="GeneID:55994779"
     mRNA            complement(<1466099..>1467595)
                     /locus_tag="TRUGW13939_07286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490427.1"
                     /db_xref="GeneID:55994779"
     CDS             complement(1466099..1467595)
                     /locus_tag="TRUGW13939_07286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346320.1"
                     /db_xref="GeneID:55994779"
                     /translation="MLVRHLLRLAALAATCQAIVPYRRQTTPSAVQINWDDVLITSKT
                     STTLQVVANPPLLADSSIRQNALDSLSLVSSNYVRYVPWFPYPRLAVPEIDAPIINDT
                     HCITYWDFTYADQLLLDFMNATPNVTHIINYSTTPDWMWVLDTPYTYPENVSTIDWNY
                     NNGTTLRDPTLKEISDYYSRLLSYYTQGGMTDECGVFHPGHNLTIEAWEILNESEAEH
                     SIVTGLYNQIYDAVTAAIHAVSPNTEFVGLAMAYRNVTRVQDFLQPANHQPGTPLDWI
                     SYHFYAGPTSSTTQDEATQSFQQANQFFEEVAAIEAVRKQIAPNTKTTINELGTMDPN
                     GVTTVVPGYVIPAEYWAWSGGVFAYIFSNLTTQGIDVVGESQLSGYPGQFPSVSMIDW
                     NTGLPTARLRVLQLLQSSFAPGDNVVATSSDETQLHAQAFDTVNGGKKVLLINKTDQN
                     VTVQVQGLQAESMDTVDVNTAGNPWRTEQVSGDSVNLTPYAVSVLSGE"
     gene            <1468397..>1470129
                     /locus_tag="TRUGW13939_07287"
                     /db_xref="GeneID:55994780"
     mRNA            join(<1468397..1468565,1468622..1469576,1469634..1469716,
                     1469776..1469861,1469932..>1470129)
                     /locus_tag="TRUGW13939_07287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490428.1"
                     /db_xref="GeneID:55994780"
     CDS             join(1468397..1468565,1468622..1469576,1469634..1469716,
                     1469776..1469861,1469932..1470129)
                     /locus_tag="TRUGW13939_07287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346321.1"
                     /db_xref="GeneID:55994780"
                     /translation="MGQHLHGRNLHWAVTAASCQAFLLLGYDQGVMSGLVGADNQFGT
                     QMGHPDANMQGILTSIYDIGCAVGCIASFFFGHKIGRKKMIMAGGTIMVIGTVLLGSS
                     YSRAQFIVGRIVTGFGNGINSATVPSYQSEMARPERRGRLLSAQGTVTIVGLCIAYWI
                     DYGLSFVDSPVQWRFPISFQAFFAVCLVLQMIPLPETPRWLCEQLARLQLEQPANQST
                     PEVIRLRRQIETSIEIESAGGPFKYSELLRGGRVQNLRRMILAALVNVQQQFTGSNMI
                     NYYAPIVYQNAMGLSRNLSLILGGCTSLAYLVGSIIPLWSMDVFGRRSSLMISASGLC
                     VCFVMTAALLSTGSTSCAYAATVFVFIFQIFLGFGYLPVPWFYPSEITTTRIRARGQA
                     FAGFVNWMCVFIVVQVTPTAIDNISWKTFIIFACFCAAWVPMVYFFFPETKGLELEDV
                     DHLFERGGLTGGVFETRGYPIQPGHHRSVNTERIGKDIEEEHMELA"
     gene            complement(<1470318..>1472283)
                     /locus_tag="TRUGW13939_07288"
                     /db_xref="GeneID:55994781"
     mRNA            complement(join(<1470318..1471093,1471191..1471498,
                     1472022..1472154,1472211..>1472283))
                     /locus_tag="TRUGW13939_07288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490429.1"
                     /db_xref="GeneID:55994781"
     CDS             complement(join(1470318..1471093,1471191..1471498,
                     1472022..1472154,1472211..1472283))
                     /locus_tag="TRUGW13939_07288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346322.1"
                     /db_xref="GeneID:55994781"
                     /translation="MKTSVLLALLASCLTLSASMPTPKHFEADPLLHIGGNEESSYSP
                     VKEKRLDSMAGPMLQIDSKQGKINSQRKPCHATPFAPSPLNKPNRIAQSSGTMVRPRG
                     DSSLSGVDTIETRSILSMRELDPSPVDDYPPDVENGEYFPDLHNTAATPEIRSVGISR
                     LGLKGHNWDYWLSAIQRYSTYPPTVFFALHAANTSLIPLVSRSVPSSEDFLLLTRPIY
                     QSPSLEPLMVALPIFAHIVSGISLRSIRARRRARLYGAESHSQRYMIKSWPMPSLQAK
                     LGYAMVPLLALHVGVNRAVPLQVDGGSSSVGLGYVAHGFARSPFFWNLFYFLFVATSV
                     WHLVGGLATWMGIRVTTARTERGQSHKTGILGETRHEQQKQRKNKWLVHGIAALAAAV
                     WLAGGLGVVGRGGIGSGWEAKNWDQLYKSVPVVGAWL"
     gene            <1473106..>1474058
                     /locus_tag="TRUGW13939_07289"
                     /db_xref="GeneID:55994782"
     mRNA            join(<1473106..1473373,1473430..>1474058)
                     /locus_tag="TRUGW13939_07289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490430.1"
                     /db_xref="GeneID:55994782"
     CDS             join(1473106..1473373,1473430..1474058)
                     /locus_tag="TRUGW13939_07289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346323.1"
                     /db_xref="GeneID:55994782"
                     /translation="MPTISDFYRRFPIFSAVNYSSELAEVLLSDEDDAGNSEKRSVRW
                     EAQHWHWIFHGVSVLITLYLGALIIGFNSEKNLTYLQCWERSHTYSPINDILSTTDYI
                     YDRFNGSLWYQSPFKGPPTPQVEAAWQSAMEYGMIAVSATDLERAQRLEDLDTAAKFP
                     ASFTKEKDKKDREEKKYITVAVGTHQLHCLHYLWQDHHAAFFPNTTQRKQKEVPELYE
                     RHYEHCVDYIRQSIMCNFDTSLLSYDWVREHQTPTPNSNVMHRCVDWGVVQGWFRERA
                     VNMPDGFVWSKPEGQASLDLNP"
     gene            complement(<1474152..>1475772)
                     /locus_tag="TRUGW13939_07290"
                     /db_xref="GeneID:55994783"
     mRNA            complement(join(<1474152..1474921,1474988..1475528,
                     1475591..1475673,1475730..>1475772))
                     /locus_tag="TRUGW13939_07290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490431.1"
                     /db_xref="GeneID:55994783"
     CDS             complement(join(1474152..1474921,1474988..1475528,
                     1475591..1475673,1475730..1475772))
                     /locus_tag="TRUGW13939_07290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346324.1"
                     /db_xref="GeneID:55994783"
                     /translation="MAVVAEYVPGKDGKGIHDAEKDANTTAARDESTTRLAHNWTSTR
                     KIFAASTIIYMNFNTTLGSSLPSGAGNALNDAFGVTSEKQKPLPVVVFLIGYIIGPVF
                     APLSESYGRRPIFLVSFAVYTAFTLGCALAPNWPAFLFFRFLQGCGAAAPQTVSNGLF
                     SDIYPDLKQRGRAVTVLGLTSNVGPLIGPIISGFSSSKNWKWQFWIALAMTAVNWLML
                     LFLQETYSPVLHARETGFQENEKKASFKDILLVLLRPIRITAEPLVFFTDLFILYQYI
                     IFFLYFGLYPLVFQDTYKMTSGVSALMFLGTGVGGVVAIFIFLAWERYHTRAEQQGRA
                     WALREEYRRLPLACLGGPLFAISEFWLGWSARPDIHWIVPALSGIPLGIGIDLTFMAL
                     NNYLTDAYGIYSASATASSVITRNTFASIIIPLSTYPLYNNLGAAWACTLLGGLCCLM
                     TPIPFVFLRWGTVMRARSPFCRQLNEGG"
     gene            complement(<1476491..>1477893)
                     /locus_tag="TRUGW13939_07291"
                     /db_xref="GeneID:55994784"
     mRNA            complement(join(<1476491..1476803,1476870..1476965,
                     1477020..1477402,1477456..1477560,1477614..1477633,
                     1477689..>1477893))
                     /locus_tag="TRUGW13939_07291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490432.1"
                     /db_xref="GeneID:55994784"
     CDS             complement(join(1476491..1476803,1476870..1476965,
                     1477020..1477402,1477456..1477560,1477614..1477633,
                     1477689..1477893))
                     /locus_tag="TRUGW13939_07291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346325.1"
                     /db_xref="GeneID:55994784"
                     /translation="MATTAEPRPTFTPALKPPPGVISNPENPASLAYESRLTIGIAVP
                     LVTIAFAARAYVRIIIKRSWIFEDWIAFVAWAGTVAYCGIMGATMSNHGGQHAWDITA
                     QQAHDAAYWFNVASIEYGVMICITKLAILWLYRRFFSPIRWSLFDILIVSLIVILIGF
                     YGITSFVKIFECSPRAKIFDKSIPGTCTDVSRLLNTSGMFNTITDYLILLLPVHAVWK
                     LQLTPIKKLYIVLIFTFGLCAPVFSTIGFIVRLRISGNPDTTWNQPEILLWGAAELTS
                     GNLVVCAPEVGTLLSRRARRRNPRRPTTSILEASAARVAEERASHRKKDLDSRYYELE
                     EGNMYDARVSPTGSEARIYRPETGAVQVRHEITVMSERP"
     gene            <1479736..>1483014
                     /locus_tag="TRUGW13939_07292"
                     /db_xref="GeneID:55994785"
     mRNA            join(<1479736..1479938,1479999..1480038,1480089..1481532,
                     1481598..1481853,1482188..1482317,1482385..>1483014)
                     /locus_tag="TRUGW13939_07292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490433.1"
                     /db_xref="GeneID:55994785"
     CDS             join(1479736..1479938,1479999..1480038,1480089..1481532,
                     1481598..1481853,1482188..1482317,1482385..1483014)
                     /locus_tag="TRUGW13939_07292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346326.1"
                     /db_xref="GeneID:55994785"
                     /translation="MLLRAGRANRVAAACVGQLPRASYYCLPKPGLSFTSPRHYSKTP
                     PFQYAFQDKPLIKSEVTAEMQPGQYTTAFALFEGLWEAGITTCFVNVGSDHPSIIEAI
                     IKGKRERPSNWPQFVTCPSEMTAISMADGYARITGKPQAVIVHVDVGTQAMAHGVHNA
                     SVGRVPVFIFAGLCPYTESGELTGSRTEYMHWLQEAPDQKAIVRQYCRYVGEVHVGLN
                     VKETVGRALQFASSAPKGPVYIAGAREVMAQAIEPYSISQEKWVPIGPSALPDDAVQT
                     ITQALVGAERPLVIAGYSGRDRRTPELLVQLADKIPGLRVHDTGGSDMCFPFTHPASL
                     GCRLGYDESTSDADVVLMLDCDVPWIPARNPPRKDAKFYHIDVDPLNQQIPVSFFPAH
                     GRWKSECYTALKQMLRYLDSEFSTELQSPKYATRKEALIVQHNERLDKLDKLPRLGDN
                     DTLDGHNIGRLLKECLPDDTTFVVEAVTCGHLIEDQIQPTRPGSWINCGGTGIGWSNG
                     AALGVRMALSDEKFPGIVCQVVGDGSFMCASPSSAVWVSYKHEIPILTVVLNNGGWNA
                     PRNSTQLVYPDGLNKGATDDELNISFEPSPNYSKLAEAAAAEAGWLKGMRGKTVKEMR
                     GQLVEALKHVQSGRGAVVEALMENPRRHLLDTQKQNATSKSPSRQNVNLILIDPSNLQ
                     RGFTNPAPKTESARSALNSFTCTLCNKSYSRHPEYEAHIGSYDHQHRKRLQDLKQLSR
                     DPNAAERARKAEKKADAEAGLKKLGTTAAGGSNNNNNNNNDNDAAAVRSSTGGGGGFK
                     KGGFKSSFTSVKGGAPAAPAGGRKNVLGDDEDEDAGFGETEKKTSSTAAPALTAPSGS
                     THRAGDVESDTDDDYGYQNDGDGAYYDPSKPTGCNASCPSLVPA"
     gene            complement(<1483367..>1485127)
                     /locus_tag="TRUGW13939_07293"
                     /db_xref="GeneID:55994786"
     mRNA            complement(join(<1483367..1483838,1483903..1484189,
                     1484258..1484381,1484454..1485024,1485109..>1485127))
                     /locus_tag="TRUGW13939_07293"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490434.1"
                     /db_xref="GeneID:55994786"
     CDS             complement(join(1483367..1483838,1483903..1484189,
                     1484258..1484381,1484454..1485024,1485109..1485127))
                     /locus_tag="TRUGW13939_07293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346327.1"
                     /db_xref="GeneID:55994786"
                     /translation="MRNCKSSAAYAKYGAGVSGADSQPAESAPNRPTRIAGPLAANYC
                     RALQQLTSSTLPNPVIAAKIFLLCPDPIIPVCVSLQFHFASFAFGVCCLLRGFVFIFW
                     TVSLVFLFLTSAMAAPRFLRPAGRLLQSRIASPIRPAFRVPACAPSVNYRRSYATESG
                     SKEVTVRDALNEALAEELESNDKVFVMGEEVAQYNGAYKVTRGLLDRFGPKRVIDTPI
                     TEAGFTGLAVGAALAGLHPVCEFMTFNFAMQSIDQIINSAAKTHYMSGGIQPCNITFR
                     GPNGFAAGVAAQHSQDYSAWYGAIPGLKVVAPYSAEDAKGLLKASIRDPNPVVFLENE
                     LLYGQAFPMSEAARKDDFVLPIGKAKIERPGKDLTIVTLSRCVGLSLDAAAQLKEKYG
                     VDAEVINLRSVKPLDVETIIKSLKKTGRLMAVESGFPMYGVGAELLAVSMEYGFDYLT
                     APAVRVTGADVPTPYALGLENMSFPQPDTIVSQAAKLLRV"
     gene            <1485377..>1487281
                     /locus_tag="TRUGW13939_07294"
                     /db_xref="GeneID:55994787"
     mRNA            join(<1485377..1485546,1485604..>1487281)
                     /locus_tag="TRUGW13939_07294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490435.1"
                     /db_xref="GeneID:55994787"
     CDS             join(1485377..1485546,1485604..1487281)
                     /locus_tag="TRUGW13939_07294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346328.1"
                     /db_xref="GeneID:55994787"
                     /translation="MISHLSTIILTIAPYCWAAQPGSASPVPAKIRDLQWGKLNFLHT
                     TDTHGWLGGHLQEPSYSADWGDYVSFVTHMRNKAEAEDRDLLVVDTGDRVEGNGLYDA
                     SDPKGQYLYDILKQQQIDVMSSGNHELYKQNTSEAEFLKTVPSFQDSYIASNIDIIDP
                     QSGDLVPLGPRFKKFTTKKQGIKIVAFGFLFDFTGNYNNTKVQLVEDTVREAWFQEAI
                     RDQDVDLFLVVGHVPVRSKEYEAVYKAIRNVHQEIPIQFFGGHLHIRDYARYDVKSSG
                     LASGRFMETVGFLSIDDVKSSTPVYTRRYIDNNLFSFYHHTGLDETSFTTDHGKNTSH
                     MIQEARHALDLDYVHGCAPKDLWVNRAPYPSADSVYSWLETEVFPGSLRDASRSNVSA
                     LAIVNTGAIRFDIFQGPFTQDTTFIVSPFTSGFRYIKDVPLSTAKRIAWLLNLQTKIM
                     TQSTESRVYCPLAPPEQCAYDLGMTVGNGRSARLESRNWGGQIVLSSDEDTSPKVLPG
                     YTTVDDAGHDGDDTVHSPILFYQVPNVIQALIEPSTSNLEEDTTAGSSTVDLVYVDFI
                     EPYISLAAKFAGLHVDLPRDSDVYMSGTSMTELILGWIKENWQCDETTF"
     gene            complement(<1487488..>1488782)
                     /locus_tag="TRUGW13939_07295"
                     /db_xref="GeneID:55994788"
     mRNA            complement(join(<1487488..1488520,1488574..>1488782))
                     /locus_tag="TRUGW13939_07295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490436.1"
                     /db_xref="GeneID:55994788"
     CDS             complement(join(1487488..1488520,1488574..1488782))
                     /locus_tag="TRUGW13939_07295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346329.1"
                     /db_xref="GeneID:55994788"
                     /translation="MFAPRIARPAVNRVAGCSASLYRSSVRGTTPSPCGLQSGISKPR
                     FISAYGYTQAKVLVYSKYGEPKDVLKLHKHSIAAPSETQVNLRLLATPMNPADINQIQ
                     GVYPSKPPFETTLGTTEPAAVAGNEGAFEVISTGSKVSNLSQGDWVVMKRTGQGTWRT
                     HAQMDESQLIKVDKEGLTPLQVGTVSVNPVTAYRMIKDFCEWDWLRSGEEWLIQNGAN
                     SGVGRAAIQLARVWGINTLNIIREREDAAETEALKQDLYSLGATAVITEAELLSKEFK
                     PMVNELTHKGKQPIRLGLNCVGGKNAAAIAKVLAPDSHLVTYGAMSKQPVALPSGLLI
                     FKNLVFDGFWVSRWGDKNPQLKENTIRDVFDLTRAGKFKDIPVQEVKWSWDRPDSELV
                     QEVQGTLSGFRSGKSIFVFEE"
     gene            <1489037..>1490746
                     /locus_tag="TRUGW13939_07296"
                     /db_xref="GeneID:55994789"
     mRNA            join(<1489037..1489175,1489235..1489559,1489610..1489785,
                     1489845..>1490746)
                     /locus_tag="TRUGW13939_07296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490437.1"
                     /db_xref="GeneID:55994789"
     CDS             join(1489037..1489175,1489235..1489559,1489610..1489785,
                     1489845..1490746)
                     /locus_tag="TRUGW13939_07296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346330.1"
                     /db_xref="GeneID:55994789"
                     /translation="MSLLREAERCIANHTRFLELNSVITPLQSSAAWVQRVRDADVRR
                     ENGSAKSPLDGRLIAIKDNICTKSLPTTCASAILDKFTSPFDATVVKALEHAGAIAGP
                     KTNLDEFGMGSHSTNSAFGPVKSNFRGNNGEPLSAGGSSGGSAVAVATEQCYAALGTD
                     TGGSVRLPAAYTGTVGFKPSYGRISRWGVVAYANSLDTVGIISRKTSVARDVFDVLND
                     HDSRDPTNLSPNSRSRISDLLSQPQFSSRLASRPLRIGVPLEYNIAELTPSLRRAWLS
                     ALTSLERQGHSLHPVSLPSTKHALSAYYILAPAEASSNLAKYDGIRYGTRASGPDSEE
                     GVTNGHLYARTRGTGFGAEVQRRILLGSFSLSADSMDNYFIQAQRIRRLVQRDFDSVF
                     AMRNPLGTGAGAGADAAVLADYENDKVDVIIGPTSSSPPPSLASVLNDAEGTFASLDS
                     YVTDALTVPASLAGLPAISVPVPILEDAGSGLNKVGIQIIGQYGDDNLVLRVGEVLEQ
                     AEFTD"
     gene            complement(<1490822..>1492714)
                     /locus_tag="TRUGW13939_07297"
                     /db_xref="GeneID:55994790"
     mRNA            complement(<1490822..>1492714)
                     /locus_tag="TRUGW13939_07297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490438.1"
                     /db_xref="GeneID:55994790"
     CDS             complement(1490822..1492714)
                     /locus_tag="TRUGW13939_07297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346331.1"
                     /db_xref="GeneID:55994790"
                     /translation="MSSLPPGSAPASSINSPVHTPTIASNPMTDAQAKASPAPSVPTA
                     AERSKRNKKDSRKKREAKGLDPDGSAAPPKKKAVVAAASGRPSALLSMLRPQLLAEPR
                     ISDMYPPQSKQLNFLYRKVSSVLNQAWDFHEVAEKLTNKNGFRYSYAISDPNFTNIKY
                     RQTDVAPYHTRFSFEDSPAAIAFTKDGLAVATSDAWHSARANVCAREGAYYYEARVIS
                     GIVKDSQSNTATPSRGHVRLGFARREAELDVNVGVDCYGYGIRDVNGEVINRMRCEHF
                     FEKGESINEGDVIGLLITLPPLSLHKQVVEGTYDPEKQHSSSSPPVLNFIRDRIPFHL
                     KSDFCWQQSNIYPSKQLRDYAFNLKETPTFGPPSPSNDEDASLRTLPGSSITIYKNGV
                     KMGTPFKDLFAFLPPASRLTNGTNNLGIGERENADDGMIGYFPTVSCYGGGAVECRFE
                     APWWFGPPVSVSSSIVKSEEDESANCNDNPIPVKPFGERFNDQIVEDIVADIVDDVEA
                     MILWGGDNNNNNNNTAAANRNTSTKPLPPAQQQQPPAISVIDTEFSTSSSPIVATANG
                     GGADIVQQGISAVYEAAASNDISTNPTTVIAGNNGNNNMDVSQNEVNQPSTADDNTNE
                     DVEMTT"
     gene            <1493584..>1495198
                     /locus_tag="TRUGW13939_07298"
                     /db_xref="GeneID:55994791"
     mRNA            join(<1493584..1493958,1494010..1494260,1494310..>1495198)
                     /locus_tag="TRUGW13939_07298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490439.1"
                     /db_xref="GeneID:55994791"
     CDS             join(1493584..1493958,1494010..1494260,1494310..1495198)
                     /locus_tag="TRUGW13939_07298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346332.1"
                     /db_xref="GeneID:55994791"
                     /translation="MPKATTPRSTARRHNPLAEDILSSGHLRTTSTSQSGKRKSRTDE
                     DEAAAGDKFIDAKASRKILQIGQDLADEDEAERRAALGEGIEPVNKAFDFSSRFDEDA
                     QISDDEDKFGEEQWADEDEVDDAEIDPNDLDMFNKFIPSGQQDPIFDPQEADANEDGS
                     GVNLADLILEKIAAYEAKQSGDDHPLIQGGGVPEDAVQIPAKALEVYEKVGLILSRYK
                     SGPLPKPFKILPTLPQWPTLLDITRPDAWTANAVYAGTRIFISAKPAIAQEYINTVLL
                     ERVRDEIHETRKLNVHVYNSMKKALYKPACFFKGLLFPLVGSGVCTLREAHIVSSVIS
                     RVSIPVLHSAAALLRLCEMAAEQTSSSLSSEGTGATNIFIRVFLEKKYALPYKVIDAL
                     VFHFLRFRNTENNEDEMVVDGKQAPPSAAAALNYKLPVLWHQSLLVFAQRYRNDITED
                     QREALLDLLLVRGHRDIGPEVRRELLAGRGRGVVVPTAESQAAAAAGDDTMDME"
     gene            <1496342..>1496809
                     /locus_tag="TRUGW13939_07299"
                     /db_xref="GeneID:55994792"
     mRNA            <1496342..>1496809
                     /locus_tag="TRUGW13939_07299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490440.1"
                     /db_xref="GeneID:55994792"
     CDS             1496342..1496809
                     /locus_tag="TRUGW13939_07299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346333.1"
                     /db_xref="GeneID:55994792"
                     /translation="MALTQTTAITNTHTAALTHSEPQEAVRFQALKTIASVRGESQKR
                     TIQPKIIPLKFQRFQRFQKTALTESKSQEAVRFQALKTVAGVRGESQKRTIQPKILPL
                     KFQRFQRLQQTALTESESQEAVEVKVLETVPRVREENRPREDTIPEDNPNRKQ"
     gene            complement(<1497192..>1499388)
                     /locus_tag="TRUGW13939_07300"
                     /db_xref="GeneID:55994793"
     mRNA            complement(join(<1497192..1498171,1498231..1498932,
                     1498986..>1499388))
                     /locus_tag="TRUGW13939_07300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490441.1"
                     /db_xref="GeneID:55994793"
     CDS             complement(join(1497192..1498171,1498231..1498932,
                     1498986..1499388))
                     /locus_tag="TRUGW13939_07300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346334.1"
                     /db_xref="GeneID:55994793"
                     /translation="MATEEQLKELEREAKSGIEAHYNELCERVKGMAKDRAWRSGEQH
                     LEAKFYRAVTEEEGKKRLFVCCDGTWQNASGTSAPLTNVARFARAVDRYGINNDFVSI
                     PIPQLIYYSSGIGSESVFRLPVDSLYSGATGKGLEEDILNAYCFLCNNYNFASNNDDI
                     VLVGYSRGAFTVRCLADLISQIGLLRRKNLPFLSVLFNRWMETRDTLERQQMKVHILG
                     IDNFSHPVRIKVLAEWDPVSAIGLLGWKKRFSFVQDTVPAAVDKAYVAVALDEKRFSF
                     KPMLWTRSADSKTEFEQCCFSGCHGDIGGGNIDAGLSTASLLWMVAKVRNASDASFDQ
                     EALLDMVQPPRSYRPWWFPFILKETKAHSLAWSEGKINETLTWWWLIPHALMYVFTCG
                     WSNGRRKRHLQKVKGLQTTNSDGSLTPHLKLHRTVKKSGYYQNFVQDDPTDYEKDLWN
                     TWKKQVDMWYPYSQHGINIEHWGTDYEGMKYWSDTLSRFQLETFHRDKWDFVEQAIQL
                     CRKIRCSSNSTESVRDLAAKCVRAAKEMQEASNRSFTNLDIAITGAQPPNATNLDTAI
                     AAPIVAELEATFRKVVQLISLSEHSNNDARELDEAARFKVVMLDLTKLQRATIREKEK
                     ISGLLGKAEEADMKIKEQYIDIDRTTPAAEVTRAAEAVLDAALEASAIWRVSEEDWKN
                     AFVIRKYQELGI"
     gene            <1501164..>1502385
                     /locus_tag="TRUGW13939_07301"
                     /db_xref="GeneID:55994794"
     mRNA            join(<1501164..1501259,1501343..1502138,1502192..>1502385)
                     /locus_tag="TRUGW13939_07301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490442.1"
                     /db_xref="GeneID:55994794"
     CDS             join(1501164..1501259,1501343..1502138,1502192..1502385)
                     /locus_tag="TRUGW13939_07301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346335.1"
                     /db_xref="GeneID:55994794"
                     /translation="MKSTTLLSVAATAAVVLAGDAPNNTKPYGTNPVAGNWYAIFGDN
                     LWCDTGVTDPDQDTSGFHGMVRDVGGLDHRQPSHGPVHAVERRYSCKAFQPGIPPPPP
                     LIFVVVYFQPIRTQVRPVQRRLGRDRRDRVRRHQPVRGRRRQQPAVLPGQPNDDGLVG
                     AGIAQVQLQNGGGGPTVVQRFGDSGYWWEVEHNPRYGDVAAYRDDNDAYIYGWGGAPT
                     VVTDSIDSQYLYQLRVATSGAWDQVQYEYWWGREQGWQVNNPLSNFTAETAVMWGVGQ
                     GSTYWSPKYQCYFYVHFAGADVAIRTAPKPEGPWSADVAVYTPTPIDGGFTYAPGVHP
                     YLDASGDTLTISYTNNNHIEVIKVTFS"
     gene            <1503410..>1504537
                     /locus_tag="TRUGW13939_07302"
                     /db_xref="GeneID:55994795"
     mRNA            join(<1503410..1503672,1503725..1504179,1504233..>1504537)
                     /locus_tag="TRUGW13939_07302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490443.1"
                     /db_xref="GeneID:55994795"
     CDS             join(1503410..1503672,1503725..1504179,1504233..1504537)
                     /locus_tag="TRUGW13939_07302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346336.1"
                     /db_xref="GeneID:55994795"
                     /translation="MENLLSPHVDSLDAPQLTISPADTSLSSPAPEVDLDVDLEVDAE
                     LEDIDGDIDIKDEDENKSDEKKPVKKRKSWGQELPTPKTNLPPRKRAKTEDEKEQRRI
                     ERVLRNRAAAQTSRERKRLEVEKLEGEKKRMEQQNQFLLQRLSQMETENNRLNRQVAQ
                     LSAEIRGSRGTTPKSVVSDLESPTLTPTLFKQERDELAMDKIPFPTPSLTDYSPSLKP
                     TDLAEASDMTQHPAAVLCDLQSANDLAAPLSDDDFRRLFNSDSPAASDSELYESGLPL
                     DFLDGGDMPTFAFDSLVDFDPEPVPLDSSVVGLSEESAQQTSGMQPSHGASTSRCDGQ
                     SIAASG"
     gene            <1504966..>1505654
                     /locus_tag="TRUGW13939_07303"
                     /db_xref="GeneID:55994796"
     mRNA            join(<1504966..1505010,1505061..>1505654)
                     /locus_tag="TRUGW13939_07303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490444.1"
                     /db_xref="GeneID:55994796"
     CDS             join(1504966..1505010,1505061..1505654)
                     /locus_tag="TRUGW13939_07303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346337.1"
                     /db_xref="GeneID:55994796"
                     /translation="MVLRDPIFEARTNVKLHSNRLKKEAARAEATFKSEKAKADKAMK
                     QHEFQIARIHAGSAVREKKRQVSLKAEAARADVIINELKAAQSTRDTSRTLALASRGL
                     DAASKSVNLEHLLAHANNFMARSEDFKIASSAISDVAQGVSQQEYGAEGESEVDKMME
                     QLADTAGVDMRLALESDAAPKEEVKEASAGKHVDAEVEDALGARLRALRAEG"
     gene            <1506212..>1507654
                     /locus_tag="TRUGW13939_07304"
                     /db_xref="GeneID:55994797"
     mRNA            <1506212..>1507654
                     /locus_tag="TRUGW13939_07304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490445.1"
                     /db_xref="GeneID:55994797"
     CDS             1506212..1507654
                     /locus_tag="TRUGW13939_07304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346338.1"
                     /db_xref="GeneID:55994797"
                     /translation="MASLSFLFFLSFWVSFTTAAPWIVTEYYEEIVTVVSDYYDVYTG
                     AAETYTQIQTISSPTGLAPLATATITQTGDSEYGYGEDSDPATIVQVLYPFQSFAAVS
                     SSYDYGYEDSVYTNYVLALAFTAPTQCSSSWTYTTDVSVYPPVAIKPTSISTSLYVDN
                     SQPFQPTTVTEVYAYVDPTQVPASSLSVLRENYSPYPSCYNPNPIDSASSSSSSSSSS
                     SSSSSSSEPYYCGYYYCSDGSWINDSYYYGISPLAIILITVLGWTFVIFIAGLFENYF
                     HFQRLMKGWQARRGLPITWWFWIFPVSWLVCLGFSRKGFQARTVEDAEVLREKWEETG
                     FWKKKGLWLRHGFGTGYPSMILLGGPAPPRVGRPSSKKPVATQPLLQISPPESAAAVS
                     AAPSEVRVGGEGGGTGVDQPEMSGVLPSPPTSATLQVPSRSVGTRSVETAHSQEPAES
                     AESTENAQPELQPRPSSEILPETRHDDARS"
     gene            <1508036..>1509118
                     /locus_tag="TRUGW13939_07305"
                     /db_xref="GeneID:55994798"
     mRNA            join(<1508036..1508595,1508659..1508818,1508876..>1509118)
                     /locus_tag="TRUGW13939_07305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490446.1"
                     /db_xref="GeneID:55994798"
     CDS             join(1508036..1508595,1508659..1508818,1508876..1509118)
                     /locus_tag="TRUGW13939_07305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346339.1"
                     /db_xref="GeneID:55994798"
                     /translation="MTTLDDLLAVNPAANDATLACLGTTRTNEQCGVSTKATSNPIIR
                     DNNQTQQRAKEKEKQKTAATWKKIQRNAQRRRKIVVGDDDLEYLARLSLCTRHRRSSQ
                     IKNLVRRIKDDITTHNQSLATRKPAATTTTTTTTTTTSEMDPSSFEEAGGYAVRRQAQ
                     ERAQHTLNVAVNVYRAVETGVDDSNPRSVTQGGQDQMNQSPEDNEPSDQDQEREQDSR
                     TTPIPLVEHSHIGEDIGPDLPPCFSRDRRQGRKPIAPNDECAICLERMGSKQDLAWCR
                     KQCGTNFHGPCIENWISIYERGIAKTCPACRVVWSARRDWGDLR"
     gene            <1509285..>1510894
                     /locus_tag="TRUGW13939_07306"
                     /db_xref="GeneID:55994799"
     mRNA            join(<1509285..1509643,1509701..1510234,1510282..1510423,
                     1510499..>1510894)
                     /locus_tag="TRUGW13939_07306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490447.1"
                     /db_xref="GeneID:55994799"
     CDS             join(1509285..1509643,1509701..1510234,1510282..1510423,
                     1510499..1510894)
                     /locus_tag="TRUGW13939_07306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346340.1"
                     /db_xref="GeneID:55994799"
                     /translation="MNFLDEIGLAPLWRSPLDTKLLCAQRFVRLFAYGCSTLVLASYL
                     SALGIPDDRIGLFMTLTLVGDVLISFFLTLFADAVGRKAVLLLGSAMMCVSGLVFALS
                     GNYWALLAAAVFGVISPSGNEIGPFRAVEESTIAHITSKENMSDILTWYLLFGSAGTS
                     LGMMVSGWTMTLLQETKGWEFVPACRVIFLIYAAVGAVKFLLTAGLSKSVEAAKKQKK
                     KQVSQPDPASNGRVSETEPLLGSSQEQLPETETEPQQEQPVGPRRSIPFLPGVEPQFV
                     GLVTSVILLFALDSFASGLASLTWITYFFRRKFNLPEGRLGSFFSGTSIIQALSMLVA
                     SSIAKRFGNVKTMVFTHLPSTFCLAMIPIPSSLPIAMVFVILRACTQNMDVAPRSTFL
                     ATALPPDQRTAIMGTINVAKTSAASLAPLLTGLLAARGMFWVAFVMAGALKAAYDIGM
                     LVTFGDTDRRLREEAAAEAAQRDEEA"
     gene            complement(<1512090..>1513675)
                     /locus_tag="TRUGW13939_07307"
                     /db_xref="GeneID:55994800"
     mRNA            complement(join(<1512090..1512650,1512715..1512993,
                     1513043..1513494,1513561..>1513675))
                     /locus_tag="TRUGW13939_07307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490448.1"
                     /db_xref="GeneID:55994800"
     CDS             complement(join(1512090..1512650,1512715..1512993,
                     1513043..1513494,1513561..1513675))
                     /locus_tag="TRUGW13939_07307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346341.1"
                     /db_xref="GeneID:55994800"
                     /translation="MADSDRDDKHDVEISQASETVVRKRLLRKTDFLVLPGLCIAYFT
                     NTLDRANLGNAKTDGLETDLGLVGNQYSLLLVLFYVPYALFNVPWTIAAKRFNPNVII
                     SLAIGVWGICTMASTAATNFGGIMATRIVMGAAEAAYKPCEVYYLTLFYTRREIGVRV
                     SIIGQMGFIAGAVSGLISWSVFRWTGGLHGWQYLFLIEGSITVAGAVILFFFAPRGVQ
                     ASKWYSRGEKDLAKKRLAEDTEEQDNRFRWNDAKAQLLHWPTWAYAFLALMYGVGVAS
                     SSNFLPTLIKRLTKDTVKANLYTIGPNLVASVIQISATWTSDRLQQRALVASSTIVVS
                     LLGWILLGTLDLESHPSVGYFLTFLITGFTFIPSNIIPVWLASNVPTTTGRAVALGLN
                     YMAMNIAGIFSSVSFRAQDAPVYVPALVTCGVTQGVFMLACLVLRQYYVHLNKKLDSG
                     ETPCAPGMEGRPDYRYAI"
     gene            <1514017..>1515579
                     /locus_tag="TRUGW13939_07308"
                     /db_xref="GeneID:55994801"
     mRNA            join(<1514017..1514469,1514520..1515191,1515250..>1515579)
                     /locus_tag="TRUGW13939_07308"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490449.1"
                     /db_xref="GeneID:55994801"
     CDS             join(1514017..1514469,1514520..1515191,1515250..1515579)
                     /locus_tag="TRUGW13939_07308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346342.1"
                     /db_xref="GeneID:55994801"
                     /translation="MPEAVPVSLSERLESVNEREDNNTALIVHPQRRQSWVWRALGVA
                     GLAVLVAPLISVASWLVPGEAPIDPTNYALRTRRVLQSTPLIDGHNDLPWLLRIELQN
                     RIYDGRFDPTQRLLGHTDINRMKQGLMGGQFWSVHVHCDKAQKHFEDPSWLVRDTLEQ
                     IDVAKRFIAEYPDIFTYCTTPSCVRKAFKSGKISSMLGIEGGHQLGGSIAAIRQAYDL
                     GVRYITTTHNCNNAWATSASTVAAGGEDPGLTAFGAAYVREMNRLGMMLDLSHVSHQT
                     MRDVLSLTQAPIIFSHSGAFSITPHLRNVPDDVLRGVRRNGGIVMAVFVNRFLNMKDP
                     SAVTIHDVVDHIWHLAEVAGWEHVGLGSDFSGTPHTPAGLEDVSKFPDLVELLMARGA
                     TDDQIRLLVGENLLRVWADIERRGQEVRAEGSRPVEDEWEGRKWHTHYRSSPYMYRST
                     RERAIREEWGEPNQFSVGKSGKHEQKVVKADEDI"
     gene            <1516065..>1517861
                     /locus_tag="TRUGW13939_07309"
                     /db_xref="GeneID:55994802"
     mRNA            join(<1516065..1516559,1516615..1516751,1516811..1517457,
                     1517527..>1517861)
                     /locus_tag="TRUGW13939_07309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490450.1"
                     /db_xref="GeneID:55994802"
     CDS             join(1516065..1516559,1516615..1516751,1516811..1517457,
                     1517527..1517861)
                     /locus_tag="TRUGW13939_07309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346343.1"
                     /db_xref="GeneID:55994802"
                     /translation="MGSNFLFAVVPGNSWQHYTQLALLAPAALLVLYIFYNELVRFQL
                     RVRKLPGPWGFPLVGSLPSLSGTITSDELRKWAGKYGDVFQVQLGNSTVVVVNTTAAA
                     EALFIRQREATNSRPIFYVLHKKVQRNGPVTSIGTSPWDDSCKRRRKVAASALNRVSV
                     ESYLPILNKESRAWLLDILRGCDGGKTALDVMFPARKFAINVSLTVSYGTRVEDIKEF
                     STNDVLKEIIYVEEEISRLRETSSNYDNYIPLLRPLNSIASALGLKDGSHLASVGKRR
                     HAYHAKLQERLREEIASGTDQPCIQGNVLRDPDSKGLSEGELLSISLSMMAGADTSKR
                     TLMWACLLLAHRPDLQERAYKAIQETDPTLLTNPDVAHSRVEYIEALIKEIGRYFIVL
                     RLALPKATHKEVLWNEAVIPAGTMVFLNSWACSRDPAVFPDPDTFAPERWLEGESQSH
                     QHQYAFGIGGRMCVASQLASKVLYTVFLHLFAHFKLLPADGDLGSDAADPLKGLLENE
                     NSRVTPRVRHVRFVPRDVDTTRRMLAEKP"
     gene            <1518871..>1522769
                     /locus_tag="TRUGW13939_07310"
                     /db_xref="GeneID:55994803"
     mRNA            join(<1518871..1519826,1519878..1520702,1520754..1522335,
                     1522419..>1522769)
                     /locus_tag="TRUGW13939_07310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490451.1"
                     /db_xref="GeneID:55994803"
     CDS             join(1518871..1519826,1519878..1520702,1520754..1522335,
                     1522419..1522769)
                     /locus_tag="TRUGW13939_07310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346344.1"
                     /db_xref="GeneID:55994803"
                     /translation="MSKKLNHENYAVGWICPLEVEQIAALSMLDEKHERLKQPPSDHN
                     VYNLGEIAGHNVVIAGLPITGNTSTAAVVTQMRNTFPNLKFGLLVGIGGGVPVKTDEG
                     MIRLGHVVVSKPTDGHSGAIQYDHGKAKVGEFERTGALAPPPAILLNAAQDLAVDRAM
                     SRKDPLDENIKRIDTSIRGLRKFKCPGTAHDHLYKPSYIHPKPGVPYHEAGCDHSQRV
                     ERPIDEDEESYIAVHRGTIASGEMVIKDATVRDLQATQYNLLCFETEAAGALVDFPCL
                     VVRGISDYCDSHKNDKWHGYAAAVAAAYARQLFFHMPVSEVKSYISEITEKNIHHVKL
                     RQDDKDRQNILNWLTEVDYGLQQSDCLSRRQPGTGRWLVETTQYQTWLDTDQGVLFCP
                     GIPGAGKTILTSIMIEELTRHFSDDPDIGIAYLYCDFRQQDQQQTQDLLAGLLKQLSQ
                     CRSSLPEKVNSLYNQHKQRQTRPLLHEISEALRSVIAIYSRVFIIIDAIDECQEARGN
                     RARFLKEIFNLRASCKANVFATSRFVPDIRDKFDGHPSLEIRASEEDIQRYLEGHMAE
                     LRPFVTRAENRKLLEEIVHVISHTVDGMFLLAQIYLGLLSDKTTTTKIRNALKQFQNQ
                     KLKFGDGQMLEALTDAYKQTMDRINSQKPDLRQLAIQVLSWITCAKRPLTKWELQHAL
                     AIEAGDPALDSDNMPQVEDILSVCAGLVTTDEESGIIRLVHYTTQEYFEETKSHWFPG
                     AETNITETCVTYLSFDNFGASFCSTKEHLWARLQSNILYDYAARNWGYHAREASTQAV
                     QRIISLLNDEVKISGCSHVMEDTNRGPKPRLFKNVVGLHLAAYFGLVQVSMILLETGH
                     DANAKDIYGWTPLSRAAERGNEEVVKLLLAKDKVDMESENTWLAKPLSISVDRGHEEV
                     VKLLLEHGADPNSGGWGLWRPLWYAAWRGHIAITKLLLDKGANPNFQIPSRSYGQRNP
                     LSLAIEGGHEDIVKLLLEAGADPNPKMNYYDRTSLPSALVKGYEPTVKLLLYRGPHID
                     NRHDYHKRTPLSYAAANGRKTMVKLLLETDGIDLDSEDSNGRTPLSYAAENGHESVVR
                     LLLTKKEVSPDKADTLNGRTPLHYAAENGRDRINKLLLATGKPNPDPTAGYQKRTPLS
                     FPAEKGHGRVVKLLLAQEKVDPDFKDRYNVYTPLYYAAENGHDMVVRLLLATGRVNLD
                     VKRSRGKIILECAEIMGHKVVVKLLLTADRPRS"
     gene            complement(<1522894..>1524381)
                     /locus_tag="TRUGW13939_07311"
                     /db_xref="GeneID:55994804"
     mRNA            complement(<1522894..>1524381)
                     /locus_tag="TRUGW13939_07311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490452.1"
                     /db_xref="GeneID:55994804"
     CDS             complement(1522894..1524381)
                     /locus_tag="TRUGW13939_07311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346345.1"
                     /db_xref="GeneID:55994804"
                     /translation="MYYRRVRRVKCGEEKPHCLKCASTGRGCVYSTAPRSKFTEQPQP
                     DTCITLFSGHGSRERRAFEYYFHKAGPLLSGVLDQDFWSGSVLQICRVEPVIWDAIIS
                     LSTLYERPPIHETMLWLLVNNTTDVRHEYHRDALVWYSRSLALLQQRINQGTVEPMVA
                     LISCILFITIELLQGNRKAAQILYKNGAQMMTDATSTTVVSAMFRRLGTSVLVANESL
                     EETRVLHLALPEGYFTSIQEARDVLYSLVAETKTLNNDSKAYMRRTAYGQLHKVSELL
                     ARQQRLKTRLAQWNHLFSHFKSMHGSNVNIDGAMAILLMIYTSVFIEAGTVLSFDQGI
                     YDTYEYEFAQIIDLAPAAVAWTRNSEGKQPLFMFEMGVFLPLFVTGLKCPFPQLRRQA
                     LRYIVDAPPAQGPFMCTPAAHIVALLIELEENPDTSLPGEISRFYDLLAKPGHIPPAQ
                     HRTCDFSVSSVLDVDGKSKRWLNYTNCRFDEEGRAFFIEKRVSIS"
     gene            complement(<1525825..>1530125)
                     /locus_tag="TRUGW13939_07312"
                     /db_xref="GeneID:55994805"
     mRNA            complement(join(<1525825..1527315,1527371..1528949,
                     1529001..1529037,1529129..>1530125))
                     /locus_tag="TRUGW13939_07312"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490453.1"
                     /db_xref="GeneID:55994805"
     CDS             complement(join(1525825..1527315,1527371..1528949,
                     1529001..1529037,1529129..1530125))
                     /locus_tag="TRUGW13939_07312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346346.1"
                     /db_xref="GeneID:55994805"
                     /translation="MSRSEQECPDSIDCYTVGWICALEEEYECACRMLDEEFSGPEID
                     DQDDNTYVYGRIANHHVVIGCLPAGRYGTNSAARVARDMVRSFPRLRFALMVGIGGGA
                     PTEDNNIRLGDVVVSQPRNGFGGVIQYDLGKRLQNGRFQKTGQLNAPPEKLLGVIPEI
                     RRLYNDKRKPDRIAEHLQRMDDMEDYQRPMLDQLYRTEYQHVGGKNCAQCAPNLIVER
                     PERRVHRTVAVHYGTIASGNTVMKDATLRDAYAKDPELNIICFEMEAAGLMNNLPCLV
                     IRGICDYCDTHKNDEWHKYAALTAAAYARELLLVLKSQRVQAMPPWAERVVGELRQVQ
                     QDMITIIDSQSTVQSRVDTIDWKIDWANLPAVEGAGFDSYMDQHEHECLPGTRTELLH
                     QITEWATSPQGKCVFWLNGMAGTGKSTISRTVAKCFTQSHLLGASFFFKSGEGDRGNA
                     KKFFPTIIRQLVAKIPPLISGVRKVIDDDPGIITKSLREQFEKLLLQPLQGLKQSDHQ
                     ASTIVIVVDALDECERSDDIRVILQLLPRVRILSSVYLRFFLTSRPELPLRLGFRDIA
                     DNHQDLVLHEVPKLVIEHDISLFLEHRLAQIRKERLLPSDWPGSTNIKTLAMMSVPLF
                     IFAATICRILEDPQWDAVESLTEILTHQSNESNLDRTYLPVLNRFLIKQNETKHKRLV
                     DEFREVVGVIILLENPLSVTSLSKLLGVSTRFINIRLGSLHSVLRMAEDGTQPVRLLH
                     LSFRDFLLDPTTRKKTPFWVDEKLVHHRITMRCLKIMDYGLKKNICNLPTDGTPRVEI
                     DAYSVSQYLPPELQYSCRYWAQHLVRSKDPVTELDNAFLFLEKHFLHWVEAMSLLDII
                     SEVVGTIDILYSVIKDKSSKIPQFLQDARRFLLKNIQIMDIAPLQSYSSGLIFAPRNS
                     IVRKMFIEELPSWICRLPDVEEYWSALQQTLEGHLGPVKSVAFSPDGRLLASGSSDKT
                     IKLWDPATGSLQHTLKGHLDAVLSVVFSPDNRLLASGSDDKTIKLWDTATGALKHTLE
                     GHSDLVWLVQFSSDGQLLLSSSGDQITKLWDPATGALQQTLDHLDMDDEADNAVEAVM
                     LSPDDRLLLKARRKTLESIDADWPLAFSPGGPQLASGSDDKTIKLWDTATKILQKTLE
                     SADKVWSLEFSPDGRLLASGSNDSTINLWDTATEALQQTLEGCFDAVQLLIFSPDHRL
                     LASGSLNSTIKLWDTVTGTLQHTFEGFDWYGPVAFSPDGQLLALGSDDRTVKLWDTAT
                     GALLKQTLPVEPIVTSLKFSEDSPYLNTDLGFLDIQSWYSDYTSYWSRTNGEEAFIRE
                     NPWVTIQGKNVLWLPFEYRPTFSTVKKDGTLILGHVSGRVSFIGFCT"
     gene            <1531054..>1532857
                     /locus_tag="TRUGW13939_07313"
                     /db_xref="GeneID:55994806"
     mRNA            join(<1531054..1531540,1531593..1531978,1532031..1532387,
                     1532444..>1532857)
                     /locus_tag="TRUGW13939_07313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490454.1"
                     /db_xref="GeneID:55994806"
     CDS             join(1531054..1531540,1531593..1531978,1532031..1532387,
                     1532444..1532857)
                     /locus_tag="TRUGW13939_07313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346347.1"
                     /db_xref="GeneID:55994806"
                     /translation="MKTFPLLLLAAAPLAASFVLPDEQQVLSVFSDTENTHTHHEHGQ
                     HAQVNEIGHLVLPDLPRLASHVAEGLQKFAAHGDHGHGPGHGPEGLRAKGKKCPHAKG
                     KKDKKEKKDREDEKVSAKHLQHHTGDVFDIRPHHKPGFFDKVKGQFKHFFGQSGHGKP
                     HADGHHHRVYNQTIYQLISSSNHTRILTRIINQFDEVVQHLNSTEANYTVFVPVDEAF
                     KHVHHKPENISKAAVLNWLKYHASPEVFTTHDFFDIQTVPTLLEDEFPQRISTQAGFK
                     GLLLNFHSRVIRADIFASNGVIHGINEFLIPPLAAADTIDLAPSIFSTLNLALVKTGL
                     IDEITAQKGTLFAPSNKAFERLGPKINAFLFSRAGEKYLKALLKYHVVPDHTVYSDAY
                     YHSAASVANQTFTHDSQHLDLPTLFHDKPVAIDIHHLHRFTDIVLNKHSHVGISNIPV
                     REGVVHVVLSVIVPPRPDELELEHEHKLDIDLEHEHEHEHEHEHEHEYEHEHEYEHKG
                     EYKHKREHKHKKEEKEEHEHDHDQLSVRDLMERLDRFIE"
     gene            complement(<1533174..>1536626)
                     /locus_tag="TRUGW13939_07314"
                     /db_xref="GeneID:55994807"
     mRNA            complement(join(<1533174..1534079,1534154..1534250,
                     1534545..1535076,1535130..1536540,1536597..>1536626))
                     /locus_tag="TRUGW13939_07314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490455.1"
                     /db_xref="GeneID:55994807"
     CDS             complement(join(1533174..1534079,1534154..1534250,
                     1534545..1535076,1535130..1536540,1536597..1536626))
                     /locus_tag="TRUGW13939_07314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346348.1"
                     /db_xref="GeneID:55994807"
                     /translation="MPPFKDEHILLIAPGSQTTLAQLGLPESFTPASHRFPTRMFPGE
                     KKGEFEPFKIRERRREVQPAVVSNSGADKADVEMGEAPKEEGDAAVEKAENGSTEQKQ
                     IGSGETAAAPEQEAEPKEEILLEEDIISDEGAVYPIQNGQIVDWPCFLALLEHIHNTL
                     SPPFHTPILVISEPAWTARDREILTQFVFEKFKPPAFSLMDSALAACYAYGTVTATVV
                     DVGHGKANVTAVVDSVIQEHGRGLALQGCGGETLTDRLEELLQGQGFTREMCEQLKRS
                     NIAEILPQGTPLPSSKGDSKQEPKNPAVAASTGLPEGNNASKVPRGPGRGTQTETTEG
                     AVGTNGEEEEGILDVAAIVTSGNTNEFLAKREKEKAEKAAKKAYEAANKPIRLPNAKR
                     DKAGFQFEEFVRIDNSAQYMRQRREIEVGLERFLLTTPGKERTERGSNGVLEDLAAQI
                     HHTILSVPEANKRSELWDNLIVIGNGSRIRGFVPALLSTITQKYIISPSTGIFTSELP
                     SNLSTPLATGGTNTPAYPGQTTPNPLNHPAAHGVNPLLVAATHANAPPATPNMQDPAY
                     MAIHRPSGYAQTPTSVRTVKPADYFPEWKDQGGSNAPGATGAGGTATSANPAAGSVRP
                     GMEEAVFLGAQIAAKIVFINDNQGQYKGYLPRLESSTMPRAEAGSTKAVANKMKARGL
                     TRLRWYCQVCEKANRDENGFKCHVQSESHVRRMQLVGEDSKKVIDDYSNEFMREFVNL
                     LKTSHGEKKVNLNHFYQEVIANRHHIHMNSTKWTSLTQFAGHLSREGICRLEETEKGI
                     FIGWIDNSPETLRRREAVMKKERQDKGDEEREQKQILEQVERARKAELAKIERSAPTK
                     SDEDDKEEDDATNKMLLERKDGDKVKLSFGGAKPAAAAVPTPAKETTTTSSESPSEGD
                     PAKPVEKLSMAFSSKPKNVFAAKKASNPLAANKKSAFVPQKQKVSQQELIMRKEMEQQ
                     KKRTASGNVFEGGKRMKIS"
     gene            complement(<1537067..>1538818)
                     /locus_tag="TRUGW13939_07315"
                     /db_xref="GeneID:55994808"
     mRNA            complement(<1537067..>1538818)
                     /locus_tag="TRUGW13939_07315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490456.1"
                     /db_xref="GeneID:55994808"
     CDS             complement(1537067..1538818)
                     /locus_tag="TRUGW13939_07315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346349.1"
                     /db_xref="GeneID:55994808"
                     /translation="MIQNCQVYTPVWTQQLHKANNFHKHTPPTMTLAATKPLQDFLSP
                     LRTGDSQLYDVACSFSNVFSDLASSSDDSLFSPVPVTYLPSGRESGRFLAVDVGITTL
                     KVAFIDLLGETATRSRSMSNMIRKARHSHVRRTLEKAWRIEDRLKYDQPHELFLWIGN
                     CIAEVVKDDLLSSNSTDDAPSHIETGIAFGLPIRQDSLEEATLMPTGKGFTIDSDLDL
                     RNSILQGYERHTQRGDDDGERSTKRQRHYALPKLKITALTNDAVATLLSLSYSIKSYP
                     NSRVAMGIVLDEGCNATIPMTLSDLHPSKSRPIATREPNAAQTLVSTEWTLHGAAAPL
                     HDHGIITKWDMQLDSQSARPGFQPLEYMTGGRYIGELVRIICHDYFTSILGISERSLP
                     INLVQPYKLRSDFLITMVSTYSSTTTLAECLNRDMPAPASSGWTWTGKTASVLREILQ
                     AVQARSAALVAAATVGLLASNHEISLRDPRTPPFSHSLLLSCSPSKSFHEMTFGSRPT
                     DWRGGPEELVVACIGGVIQQYPKYIENCQRYIDRLVIQCGPQEGGKSIFLREASDGVI
                     IGAGVLAGMVGQRTKLT"
     gene            complement(<1540597..>1541226)
                     /locus_tag="TRUGW13939_07316"
                     /db_xref="GeneID:55994809"
     mRNA            complement(join(<1540597..1540716,1540782..1541041,
                     1541124..1541150,1541205..>1541226))
                     /locus_tag="TRUGW13939_07316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490457.1"
                     /db_xref="GeneID:55994809"
     CDS             complement(join(1540597..1540716,1540782..1541041,
                     1541124..1541150,1541205..1541226))
                     /locus_tag="TRUGW13939_07316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346350.1"
                     /db_xref="GeneID:55994809"
                     /translation="MSDREFSSNDDLSLPKATVQKIITEILPPSSGQTFAKDARDLLM
                     ECCVEFITLISSEANDISEKEAKKTIACEHVERALKDLGFGDYIEDVLAVAEDHKEAL
                     KTREKKTSKMEQSGLSAEELLRQQQELFASAGQKFNGASE"
     gene            <1545010..>1546247
                     /locus_tag="TRUGW13939_07317"
                     /db_xref="GeneID:55994810"
     mRNA            join(<1545010..1545012,1545066..>1546247)
                     /locus_tag="TRUGW13939_07317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490458.1"
                     /db_xref="GeneID:55994810"
     CDS             join(1545010..1545012,1545066..1546247)
                     /locus_tag="TRUGW13939_07317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346351.1"
                     /db_xref="GeneID:55994810"
                     /translation="MGKRTTIADLPVELMLLILHHVSDTKSLLSLAFSSREIYNIYLM
                     ALKELHIGVLTRKYDETLLDINEAIAAVRSTDVGIKNNKEKAIALLDDWRRRQETATR
                     VKGSLKVEEIKELYKFHKEILFFLADFRANLKSPYFIKDKDWNEKYVPIRLTDPERRR
                     FVTALCRLVIHHNIFGRCKEAKEEDSTFYDNEWEQEISGVDAWRLFFGTMPPWVYHEM
                     VCIQWHLVDRWREVLANAEIRAQMMGMSWTIRLKFRTNGYTSFGPRFLFRVIDADPSD
                     RHNMLKLNHDRGSILPWIGFSNPIPRNLRLPLVYPADKYNVGSFDELWSKTSAADEPG
                     TIWRRAVLKLFAKNLDFQAAFVNEDISNNPYSHFQWIGWDCQMIIWDEEKVQEWEAYY
                     RH"
     gene            <1547090..>1547612
                     /locus_tag="TRUGW13939_07318"
                     /db_xref="GeneID:55994811"
     mRNA            join(<1547090..1547512,1547571..>1547612)
                     /locus_tag="TRUGW13939_07318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490459.1"
                     /db_xref="GeneID:55994811"
     CDS             join(1547090..1547512,1547571..1547612)
                     /locus_tag="TRUGW13939_07318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346352.1"
                     /db_xref="GeneID:55994811"
                     /translation="MPSTVEVVRKGLVGTWKLVSFVSKPVAENGTVGYPLGKDAQGYI
                     IYTAAGYMSAQIMALGSKPYTSEDIYHAKDDEAAEAARHYLAYSGPFDVISKGEDVYV
                     KHHMDVALVSNWIGNHQLRKCEWRGDEITLSPEHPWMVNGSLVNQYLTFKRL"
     gene            complement(<1548552..>1549525)
                     /locus_tag="TRUGW13939_07319"
                     /db_xref="GeneID:55994812"
     mRNA            complement(join(<1548552..1548588,1548661..1549031,
                     1549109..1549422,1549486..>1549525))
                     /locus_tag="TRUGW13939_07319"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490460.1"
                     /db_xref="GeneID:55994812"
     CDS             complement(join(1548552..1548588,1548661..1549031,
                     1549109..1549422,1549486..1549525))
                     /locus_tag="TRUGW13939_07319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346353.1"
                     /db_xref="GeneID:55994812"
                     /translation="MASKTIIVTGASRGLGLTISKYLLTTTPPNNVVILARSAEPLQA
                     LKTQYPDNVEYIAGDLSDHSLGEKAVALAQSRFGRLDGLVLNHGILGQVSTVANADVE
                     QWKKGFEVNFFSLVSFTKAALPALRESKGKIVFTSSGASTSAMGGWALYGATKAAMNH
                     FTLSLASEEPDITSISVRPGMVDTEMQREIREDHANNMPSDAVSKFIGAHRDGKLLKP
                     ELPGHVMAKLVLDAPNTLSGRFITWNDKDLEAFQE"
     gene            <1551516..>1552605
                     /locus_tag="TRUGW13939_07320"
                     /db_xref="GeneID:55994813"
     mRNA            join(<1551516..1551633,1551692..1552314,1552381..>1552605)
                     /locus_tag="TRUGW13939_07320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490461.1"
                     /db_xref="GeneID:55994813"
     CDS             join(1551516..1551633,1551692..1552314,1552381..1552605)
                     /locus_tag="TRUGW13939_07320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346354.1"
                     /db_xref="GeneID:55994813"
                     /translation="MDEDGYNDSNRAFLQAFMARSTMTFDEAKPVLAAIFSAHEGREV
                     LQEDISQADLNSYVAAANSAISPFDLEIRSVKRQVTLNSDGQGASPFVYALVNTTSDP
                     LTQLATTYTPDEIAFVKRLLDAMFETYNTRRCEALVVSSMQALQLAKVPADANRRESA
                     AVQANGNTTTQGGAAQSLSMTQAETMMSSLVDEGWLEKSAKGYYSLSPRGLMELRGWL
                     VDTYNDEDEEGHRARRVKFCAACKDILTVGQRCADRDCPGRLHDMCVRNFFRLQQSER
                     CPVCKIEWPGDRFVGERAIANTQQTAQARRRTMDMGNNEGSGDES"
     gene            <1553462..>1559163
                     /locus_tag="TRUGW13939_07321"
                     /db_xref="GeneID:55994814"
     mRNA            join(<1553462..1555486,1555545..1556620,1556766..1557304,
                     1557371..1557723,1557782..1557822,1557999..>1559163)
                     /locus_tag="TRUGW13939_07321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490462.1"
                     /db_xref="GeneID:55994814"
     CDS             join(<1553462..1555486,1555545..1556620,1556766..1557304,
                     1557371..1557723,1557782..1557822,1557999..1559163)
                     /locus_tag="TRUGW13939_07321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346355.1"
                     /db_xref="GeneID:55994814"
                     /translation="VAAMHAPELLVCLLGLSSAGAAALSHGARVNQVLCLDNTASSSS
                     SSYQTRFAGVTWDQRNWRLQSRVLDQGHYEARGSVANGYIGINVASAGPFFELDTPVD
                     GDVINGWPLFSRRQTFAGLAGFYDSQPTTNSTNYEWLNQYGEESVISGIPHWAGLVLD
                     LGGGDYLDATVDNSTISDYTTTYDYKAGVLSWDYKWTPRQNSSGSFRISYQLFANKLD
                     INQAVVQLSITPSKSGNASVVNVIDGYSAVRTDFVKSGSDDDAIYTAVRPVGIRNVTA
                     WVYAALDGDDAFDLSSAALVSGKPYIHQNDSSIAQSVNVEFSAGKTVTIAKFVGAAST
                     DAFSNPRETAKKAALDAKKKGFQDLLRSHVSEWAQVMPDGSVDDFTLENGTLPHDAFI
                     IESAVTAVVNPYYLLQNTVGKNALQRVNNAPVNDWSIPVGGLSSDSYAGMIFWDADVW
                     MQPGLVAAFPESAKRITNYRVAKYQQAIANVKTAYVSSQNETVFSPDAAIFPWTSGRY
                     GSCTGTGPCWDYEYHLNGDIAISLVNQWVVSGDMETFQNEHFPIYNSVATVYGDLLKK
                     NGSYYTLANMTDPDEYANNKDAGGYTMPLIANTLLNANAFRRQFGKDENATWNEMAAN
                     VLIIRENDVTLEYTTMNNSVAVKQADVVLRTFPLDYTANYSSSDALNDLDYYALKQSP
                     DGPGMTYAIFSIVANDVSRSGCSAYTYAQYSYEPYARAPFFQLSEQLVDDYTANGGTH
                     PAYPFLTGHGGANQVVLYGYLGLRLVPDDILHIDPNLPPQVPQVTYRTFYWRGWPIQA
                     ASNYTHTTISRATTVAPLDSAEKKYAKSAISVQVGQQSNSTTYKLPADGTPLTIANRR
                     VGSTNTIKGNIVQCQPVQSVDTYQPGQYPLAAVDGAASTKWQPEFAANVSSLTVSIPS
                     SSNKTTVSGFYFDWAQAPPSNVTVVLHNNSISNPTLSSFGGKGALVTNIDVKLSNPYN
                     PASNADEIVIQAGNTTNHTFPDPVPASRFATLFIQGNQGLDKVDVQNGNGTGATVAEW
                     AILEKSPTPSPTTVFSHHHCSSIESPPKKLVIILSNFKMPSVLITGCSDGGIGSALAH
                     AFHSAGLDVFATARSTQKMASLADLPRVTLLKLDVTDTKSIALAVDAVTAATASAGGL
                     DYLVNNAGQGYVMPMLDSSVADMQAMFEINVWGALRVAQAFAPLVVRAKGVIVNNSSI
                     AGCVALPYQGAYSASKAALDFISGNLKLELAPFGVRVVLLRTGNIATNWFDSVPECNL
                     PPGSLYKPVEEQVKTMAEGKHKFPTMKPNEYARRVVRDVLSARHSTVFWRGAQASTVK
                     WAVAWIPSWILEKLIVKGSGLDVLYSVAMHFRSLFFVLPLLGLAQACSSDDDCSLNGV
                     CHSVNTNSTCLCDAGWIGLDCGQLDLRPATRNTGYNRTAEGISSWGATILRDPSHQPD
                     VFHLIHAQFAFGCDLDYWTPYSIIVHSTSTTGPEGPYHFHTQLVGTFAHNPTVIYSAA
                     DAAYVLVHIGCPVNVSSTSCETVQFSCGPGNTNNGESGISAWSSRDLETWEFHGQVMP
                     GNANGTWDADTTNPSIFPLHAEGHDMLMAYRGCVENCGEGVEQIGVASAPSFTGPYSR
                     LSPKGPVFPENTEDPHVWRDKRGNWHMLVHSLEAGGGFGSGPKVGRHAYAREWDGEWT
                     FNNSTLAYSTHVAFTDGTAIDFSRRERPQVLFSEDGLMRPLFLSNGVQEVNSSLSYTI
                     VQPIGH"
     gene            complement(<1559278..>1560947)
                     /locus_tag="TRUGW13939_07322"
                     /db_xref="GeneID:55994815"
     mRNA            complement(join(<1559278..1559851,1559907..1560837,
                     1560899..>1560947))
                     /locus_tag="TRUGW13939_07322"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490463.1"
                     /db_xref="GeneID:55994815"
     CDS             complement(join(1559278..1559851,1559907..1560837,
                     1560899..1560947))
                     /locus_tag="TRUGW13939_07322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346356.1"
                     /db_xref="GeneID:55994815"
                     /translation="MDREQFRVAAHAAIDDIINHFDTLPDRPVLPTIEPGYLRPLIPE
                     NPPAEPQAWAEIQADIESKIQPGLTHWQSPNFMAFFPASVTYPSILGEMYSAAFTAPA
                     FNWICSPACTELETIIMDWVAKALALPECFLSTSANGGGGVIQGTASESVATMMIAAR
                     ERRARELTLAEGIKDGSAEYEDRICANRAKLVALSSDQAHSSIAKAALVAGNRYRSVP
                     TQLADNMEMTGPALRAVLEKVEADGLQPFFITFNMGTTNSCAVDRVAELKAVLAEKES
                     WQRIWVHVDAAYAGAALIADEYQHIAKDFAEGIDSFNVNMHKWLLVNFDASCLFVRNR
                     LDLTNALDITPTYLRNPYSEMGSVIDYRNWQISLGRRFRSLKIWFVMRSYGLNGMKAF
                     IRKGVQLGDFFAGKIRSRADLFEIVTTPAYGLTVFRVRNPAATAQTVVVTNGDSKTQV
                     AVDEKCNALTKEVYERINARGEVYLTSTAFAGVYAIRVVTGNMHSQEKYTQRVFDMLV
                     EAAEGVLKE"
     gene            complement(<1561891..1562623)
                     /locus_tag="TRUGW13939_07323"
                     /db_xref="GeneID:55994816"
     mRNA            complement(join(<1561891..1562569,1562619..1562623))
                     /locus_tag="TRUGW13939_07323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490464.1"
                     /db_xref="GeneID:55994816"
     CDS             complement(1561891..1562484)
                     /locus_tag="TRUGW13939_07323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346357.1"
                     /db_xref="GeneID:55994816"
                     /translation="MVDQGRKGFPRVHRYITTHNHDGEAVFLSSCQVPECAPFRSAGE
                     DGELALLYSTDTFPVQCQDELDVAVYDSSLHMPPGITPENGTVFRVIDMQPLKETPMH
                     RTVTVDYSVVLEGEVDLVLDSGEKRTLRQGDVAIQRGTAHSFRNRSSSNWCRLLFVFM
                     PMQQLTIGGKKMEEEWYDERYETKDEQEMKEQLGYHD"
     gene            complement(<1562649..>1564710)
                     /locus_tag="TRUGW13939_07324"
                     /db_xref="GeneID:55994817"
     mRNA            complement(join(<1562649..1563645,1563701..>1564710))
                     /locus_tag="TRUGW13939_07324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490465.1"
                     /db_xref="GeneID:55994817"
     CDS             complement(join(1562649..1563645,1563701..1564710))
                     /locus_tag="TRUGW13939_07324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346358.1"
                     /db_xref="GeneID:55994817"
                     /translation="MRKRARRQDPVSCQTCRAKKLKCNRQQPCSNCIARRIECVYAII
                     SAVQMPPPLHPTPSITFSGPPGPPGSPPRYHHHYEHQPVFAPSPQIERPFSISKSSEP
                     VKTEHRLRESSEHEQTADFLETIVMGSRIPGVLPMPLKDRLMPKSASLPTPLTAFLPR
                     ESEAMAMLNHYIDCMDFVYHVIIPNQTVSQFNGIYQSVHNQSTVNLNHLALLFSIVAA
                     SHYFRGVESTQPSKEAETRSREYSALVGAALTQGNYMTYPTIEGLQATIIISHCVSNI
                     GQDPSIRGYFINATIINQAMQMGLHRTDTIRNKEYRKRNGYDPVEVELKRRLWWQLTS
                     YDWLLGFLSGPQESTYFIHPAHMSVNLPANIRDEDIGQVEDGAAFPENTPTKKMSYAL
                     ERIKLSIVCREIVDETGHEHSEGTEIEYSKIMELDRKLDQVYKQIPDFFRLDSGNRRK
                     YAQLYKDCPQVSWQRLLLQQAFNVRICRLHRYYFIRGARDAAFSYSHVRCLQSARRVI
                     EVKRIMDIEIESMPASSLVWFVMHHVFMSAVFLMMDMCFNWDDILADKRREEVMDACR
                     MLDKAQQNSGIVREGINAMMDVLQRYWRPSSTEFEARAEGAETAFQPEFQSPADPLQI
                     TESDNYCLENTWSELLDSCAPMATNADDWMGLFTDLSDAAALVD"
     gene            <1565079..>1566584
                     /locus_tag="TRUGW13939_07325"
                     /db_xref="GeneID:55994818"
     mRNA            join(<1565079..1565173,1565225..1565441,1565493..1566230,
                     1566284..1566381,1566431..>1566584)
                     /locus_tag="TRUGW13939_07325"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490466.1"
                     /db_xref="GeneID:55994818"
     CDS             join(1565079..1565173,1565225..1565441,1565493..1566230,
                     1566284..1566381,1566431..1566584)
                     /locus_tag="TRUGW13939_07325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346359.1"
                     /db_xref="GeneID:55994818"
                     /translation="MDESKNTNNLDPVSEPSEKGDEVPSPVAGEFTTRATLALIGATG
                     ATFCTVGFQNAFGVFQTYYSEVLMPDESESSIGWIGAINIFILFSGSLVTGRILDLFG
                     PTAMFWLGSLINIFSMMMISLCRKYWELILAQGVLLGVGNAFLVCPALALVGQYFMKR
                     RAVAIGVTIAGSSLGGVVWPIVVHELIQKPNIGFPWTIRISGFIMLPILAVSSIIARP
                     PLVSKPTGDQAQKQSPPSPAWDWAIINKKEMLLTAFGFFFTYFGMFTPFFFVTSYAIQ
                     HGFSSNLAFYTISMINGASLFGRILPGMVADRYGKFNLCVLMIALSGIIALCWTTVTS
                     VAGLVIFSLAYGFCSGGILSLQPACAAQVATPKTIGTAIGFILASASLSALAGTPVSG
                     ALIDRYGYLSVSIYSGVSLLAGSSVLAMARLAQNRKLFAVV"
     gene            complement(<1566791..>1571232)
                     /locus_tag="TRUGW13939_07326"
                     /db_xref="GeneID:55994819"
     mRNA            complement(join(<1566791..1568150,1568215..1568429,
                     1568490..1568651,1569705..1570855,1570917..>1571232))
                     /locus_tag="TRUGW13939_07326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490467.1"
                     /db_xref="GeneID:55994819"
     CDS             complement(join(1566791..1568150,1568215..1568429,
                     1568490..1568651,1569705..1570855,1570917..1571232))
                     /locus_tag="TRUGW13939_07326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346360.1"
                     /db_xref="GeneID:55994819"
                     /translation="MVATYTLYHGTFIQVPRQVSTEGKHTLEINSGALWVLNQSGRIE
                     GFDWAVGSDDEDALHRMIERNGWTIVPPEVNGSIDATKQTVTIVKGGAGRERNGFFFP
                     GFIDTHIHASQYPNAGIFGSSTLLDWLQKYTFPMERSFGTEPPSDSAPPKAHTVYNRV
                     ISRTLSHGTTTASYYATIHVPATCLLASLCHQRGQRAFIGRVCMDNPAFCPEDYHDES
                     SEESLSATRQVIDYVQRLDPKGKLIAPIVTPRFAPTCSCDALTGLGRLAASYTPPLHI
                     QTHISENKNEVALVKELFKGSSYAQVYEDAGLLTPRTILAHAVHLTAEERSLVKARDA
                     KISHCPASNNALGSGLCPVRTLLDDGIVVGLGTDVSGGYSPSILESARQACLVSRLVA
                     SQSSETTGRENLSVEEALYLATRGGARVVDMADQIGGFEKGMFFDAQFIELGAGVVDN
                     DGDSIQDELNKDSGNVDLFGWENWEEKIAKWVWSGDDRNHVSAIGYLNSPRSRDLHLA
                     AALGLDADTVLSKPSHFHKTLEKSISESIPTRYVSIPIDHDNHTRGTYENRYWVSTRY
                     YKSGGPVFLYDVGESAAYSSAQAMLSGDSTFVGSLLKEFGGVGIVWEHRYYGDSFPTS
                     PVNVETPVDDFKYLTHHQAIADIPHFAKSFNTSDIPNQDLSPKGTPWVMLGGSYSGMR
                     SAFTRNEFPETIYAAYASSAPVQAQVDMGIYFEQVYRGMIGNGYEGCAHDLHAAMRYV
                     DSQLDQNGTASDAVKALFLGDGAKQNSDGDFTAALAYIYGTFQSYGMGGGDMGLGSLC
                     DWLEAVPNTSPRTAASVSKMRRSRVLGRRQDSNDTINPSSNGTLPESAPSSGWAPFIG
                     NKAVAERLAAWSHLVPLVNSYSGTDCSQSGSDSDSCDLGSRLNDPDGIGWMWQYCSQF
                     GFFQPNNVSPEPSHGLLSIHQTLAYNQEVCNRQFPGAIKSGALPECPATEQINKDTGG
                     WTIRPSNTYWSGGEFDPWRTLSPLSTEDFAPGFVTFRTEAPRCDRETAKRNLFGYVMK
                     NAVHCFDFNMRFEEGAKSRRFFTDALKQWLLCWKKAA"
     gene            complement(<1572010..>1575260)
                     /locus_tag="TRUGW13939_07327"
                     /db_xref="GeneID:55994820"
     mRNA            complement(join(<1572010..1572065,1572119..>1575260))
                     /locus_tag="TRUGW13939_07327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490468.1"
                     /db_xref="GeneID:55994820"
     CDS             complement(join(1572010..1572065,1572119..1575260))
                     /locus_tag="TRUGW13939_07327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346361.1"
                     /db_xref="GeneID:55994820"
                     /translation="MALSVTARAAGRHLSRPLRFRGIAALRTTTSQVSSFSTLNNCLR
                     TPPQQPTPSTRRAVSTSSLDDHGDPNPRDLFQPLDTFPRRHIGPSPDAAKEMLAALDP
                     PAASLDEFVKQVLPADILSKKDLSVTSPRAAPQLYRDPIDGGLGENDMLKLLDEYRQK
                     ISNAGKSYIGAGYYPTIVPPVILRNILENPAWYTSYTPYQAEISQGRLESLLNFQTLT
                     ADLTGLPVANASVLDEATAAAEAMTMSLATLPTSRQKKAGKSFLISNLCHEQTIAVMR
                     SRAEGFGINLVVGDVTADDFKLVKEQGDNLIGVLAQYPDTQGGILDFSALGEEIHKLG
                     GTFAVATDLLALTVLKAPGEFGADIAFGSAQRFGVPMGFGGPHAAFFACTNKHQRKIP
                     GRLVGVSKDRLGNRALRLALQTREQHIRREKATSNICTAQALLANMSAMYAVYHGPQG
                     LKVIAQRIMAMTALLREKIQELGFNVPVRSNTSDQGILFDTVTVELPDSSAAEALLAS
                     AKSSKIFFRLVDSNKVALSLDETVGRDELHSILQVFASQSSKGDVSVNTAISPVSIPA
                     SLERTSSYLTHPVFNSYHSETGMLRYIYHLQSKDLSLVHSMIPLGSCTMKLNATSEMI
                     PVSWPEFSQIHPFMPADTVEGYTQLISDTEQQLADITGMAEVTVQPNSGAQGEFAGLR
                     VIKKYQESVSGGNRNICLIPVSAHGTNPASAAMAGMKVVPIKCDTKTGNLDIEDLRVK
                     CEKHKDELAAIMVTYPSTYGVFEPGVKEVCNIVHKHGGQVYMDGANMNAQIGLCSPGE
                     IGADVCHLNLHKTFCIPHGGGGPGVGPIGVAEHLRPFLPSHPSSEALQARRSESASPP
                     ISAAPWGSASLLPITFNYINMMGSAGLTHSTKITLLNANYILARLKNHYPILYTNDNG
                     RCAHEFILDARHFKETCGIEAIDIAKRLQDYGFHAPTMSWPVSNTLMIEPTESENKAE
                     LDRFCDALISIRQEIAAVESGEQPREGNVLKNSPHTQRDLLATEWNRSYTREKAAYPL
                     PYLEEKKFWPSVTRVDDAFGDQNLFCTCGPVEDTT"
     gene            complement(<1576636..>1577751)
                     /locus_tag="TRUGW13939_07328"
                     /db_xref="GeneID:55994821"
     mRNA            complement(<1576636..>1577751)
                     /locus_tag="TRUGW13939_07328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490469.1"
                     /db_xref="GeneID:55994821"
     CDS             complement(1576636..1577751)
                     /locus_tag="TRUGW13939_07328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346362.1"
                     /db_xref="GeneID:55994821"
                     /translation="MATNGTSLRRSCQGCVKVKRRCDLLFPDCTRCLKKGVRCQYVNI
                     PLSSAQSTVVTENRITKSTHHARSEPHQAVTSIANNGNDIIVLRVTGSFSSAKCSNYF
                     SLSIPPSMEMEIRKPRTPDIIYMVASIVQQAPVLFAQGHSPFIHPCLYGKALPRPIRE
                     MRDLCNLCLADGRLSSSKLYQLLQRQTLSLLQAAKKAGNFEELLACVQGLVLAQCIQL
                     TNDKMNAQTVNKLNDIIVHLSRKLWSQVPQELPSTMTPWRAWLFAESVRRTIIYSHIA
                     SAAHSLMTLGYACRTPFVDALPFDSRTWLWEVQSEDHWAKLNSNVNLPMVSLYEYTTF
                     LEFGQSQPYSNFESVIVATCRGKEIPIQDPSTIIEAV"
     gene            complement(<1578224..>1579285)
                     /locus_tag="TRUGW13939_07329"
                     /db_xref="GeneID:55994822"
     mRNA            complement(join(<1578224..1578421,1578473..>1579285))
                     /locus_tag="TRUGW13939_07329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490470.1"
                     /db_xref="GeneID:55994822"
     CDS             complement(join(1578224..1578421,1578473..1579285))
                     /locus_tag="TRUGW13939_07329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346363.1"
                     /db_xref="GeneID:55994822"
                     /translation="MSSFPKARKSNITNVSVTPEKWDAYPEVSRSTLSDSTFINLSSA
                     TQISTSTIANSTLEDLPNEAKIKNNNVSHSQVQDSAIFSSQIDRSKLENCTVTDSVVN
                     KCTLKGCIVDPRNRVERTTASATKFMGAKVVNRSQLEDSDILSGSTVERCIVRNSVVA
                     EGAVCDRTKMDNVAVTRSRVDRSNLSNCDVMDCVMDRTTFGWMTLRYGIWKNGDLVGR
                     TSTTEEVVIKPRTKPMQKSADLSSSSTAEPLPVAQPLRAASPMRESGWKAAEAAGEQL
                     DDSDRINDSLSSEDEESTDDELIGAGSKSKPKAKPTAPTVHINRPASITDVHDPPPPY
                     EA"
     gene            complement(<1579764..>1581605)
                     /locus_tag="TRUGW13939_07330"
                     /db_xref="GeneID:55994823"
     mRNA            complement(join(<1579764..1580367,1580422..1580643,
                     1580696..1581032,1581090..1581349,1581424..>1581605))
                     /locus_tag="TRUGW13939_07330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490471.1"
                     /db_xref="GeneID:55994823"
     CDS             complement(join(1579764..1580367,1580422..1580643,
                     1580696..1581032,1581090..1581349,1581424..1581605))
                     /locus_tag="TRUGW13939_07330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346364.1"
                     /db_xref="GeneID:55994823"
                     /translation="MASHESVHDEPKGAAEPWVGEGSADGVELPKPNDVGALAFDEYT
                     QGGLGRHLGVVSTTFLVVGRIIGTGIFSTPASVTESLGSVGASLMFWVLGLFLAAAGL
                     CVWLEFACMIPRSGGEKVYLEAVYKRPQLLISIVFAVQAVALGFTASGCIIFASYIVV
                     AANRTASEWEERGIAIAVIISVTLLHTFLPNWGVRGMNVIGVIKIVILLFIVITGWVV
                     LGGGVSSVPDPHANFRNAFAGSATSGNLYATALFKVLNSYAGWSNAMYVLNEVKNPVR
                     TVKIAGPLGLMICGILYLLANIAYFAVATPEELANSGLTVAAFFMKRVFGTAAQRALS
                     VLVAISALGNVMTVTFAQSRVNQELAKEGVIPFPKFWASSWPFGSPSAGLLLHFIPSF
                     IVIVAIPFGDAYNFILDLEGYPGSVINFLVVLGLFWFRWKKPDTPRPFKVWWPIAAFF
                     MVAQAFQLVAPFLRPPGGKGDTSLPYYLYAVVGIALLAASVVYWFVWWVAAPAVGKYK
                     LEPRREYLKDGTAVVVYKRVATAYGR"
     gene            <1582738..>1584384
                     /locus_tag="TRUGW13939_07331"
                     /db_xref="GeneID:55994824"
     mRNA            join(<1582738..1582990,1583046..1583486,1583531..>1584384)
                     /locus_tag="TRUGW13939_07331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490472.1"
                     /db_xref="GeneID:55994824"
     CDS             join(1582738..1582990,1583046..1583486,1583531..1584384)
                     /locus_tag="TRUGW13939_07331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346365.1"
                     /db_xref="GeneID:55994824"
                     /translation="MASVTINAPGNGLMYNTFLNTQLSTPRLCITSEEDEFDTETIRN
                     WQNEGFDVSYVPLNNGGKDYLGRLNSLKEGLGVGEQYAIIAYGDAAAFCLDHFHKPTT
                     GARLTALIAYYPTSIPDTRTRFPPSLKVLVHLAGDTIKVVSTPQVLGLQSKKKRVVTR
                     TNDPGVGIGERKDMSYTAFTYEYVQPGFGENDMDEYNHTAAELAWSRSLDVLRRAFRK
                     DSDLERQWEINTESKFFNDNLPDTMSTYVTHKNAAVTLGPTLAGGVGAKALRRFYENE
                     FLSTKPPSMRLRLLSRTVGADRVVDEIYTTFDHTLEMPWMLPGVPATGKRVEVILVAI
                     VALKADKIFTEHLYWDQASVLMQVGLLDPKLVPQGVSGVTKLPVTGRESARRILSEHP
                     ARGNEYHQKLVANARERPASSSTSSKPKRSNRQSTSKKPEQRKTQANGVQGGESSKAS
                     DKVSDAEKSLNGLSINDKGKQQASTQDEDGKENANEGSNFADNESDTPSPERPAMAAH
                     VESEKVE"
     gene            <1586197..>1587342
                     /locus_tag="TRUGW13939_07332"
                     /db_xref="GeneID:55994825"
     mRNA            <1586197..>1587342
                     /locus_tag="TRUGW13939_07332"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490473.1"
                     /db_xref="GeneID:55994825"
     CDS             1586197..1587342
                     /locus_tag="TRUGW13939_07332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346366.1"
                     /db_xref="GeneID:55994825"
                     /translation="MDLLVPAPPPPTALGNLRVLSSTAAIHVSPLALGGMSIGQAWAE
                     GMGSMDKEASFKLLDYYFESGGNFIDTSNNYQNGESEEWIGEWMASRKNRDRMVIATK
                     YTTDYQGYAWGKGKASNHMGNHRRSLHMSVRDSLKKLQTDYIDILYVHWWDHLTSIEE
                     VMDSLHIFVQQGKVLYLGISDAPAWVTSAANYYARAQGKTPFSVYQGKWNVLLRDFER
                     EILPMARHFGMALCPWGVLGSGKFQSKKDIDERKANGESLRTLFSNGEQSDVEVKLSE
                     ALAKVAGEHNIDSLQAVALAYVRAKAPRVFPLVGGRKIEHLKGNIQALDINLTPQQVE
                     YLESVQQFEPGFPHNLIGADPRATGVVGGILGRGINLVMDKPDYQYA"
     gene            complement(<1587462..>1588907)
                     /locus_tag="TRUGW13939_07333"
                     /db_xref="GeneID:55994826"
     mRNA            complement(join(<1587462..1588511,1588567..1588707,
                     1588764..>1588907))
                     /locus_tag="TRUGW13939_07333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490474.1"
                     /db_xref="GeneID:55994826"
     CDS             complement(join(1587462..1588511,1588567..1588707,
                     1588764..1588907))
                     /locus_tag="TRUGW13939_07333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346367.1"
                     /db_xref="GeneID:55994826"
                     /translation="MAAVDIPLPALPQGWSAEKDFKVLSALSSATQRNVEPVGPHFLA
                     HARRLRHNRTFSEDDRIQAQKNVKKVDEDEDDEISEPEDPLMLQRDAKDWKNQDHYAV
                     LGLSKYRYKASPEQIKRAHRKKVLRHHPDKKAAAGQTDENDSFFKCIQKANEVLLDPT
                     KRRQFDSVDEAADVEPPTKKQTEKGKFFKLWGPVFKSEGRFSNKQPVPVIGDENSPEE
                     DVEEFYNFWYNFDSWRTFEYLDEDVPDDNENRDQKRHVERKNANARRKKKTEDTARLR
                     KLVDDALAGDERIKKFRQAKRAGKDKKRLEKEAEAKRLADEKEQARLEDERKKKEAEE
                     TAKVEREQNKKSKEAAKNAAKKNKRVLKASVKDVNYFVEGGDASAGQIDTVLGDVEAV
                     MGKINPEELAALASKLGSAGTDAGAVKAAYTEEAKRLISEGKMKESEVRVFV"
     gene            <1589197..>1589647
                     /locus_tag="TRUGW13939_07334"
                     /db_xref="GeneID:55994827"
     mRNA            join(<1589197..1589269,1589330..1589506,1589556..>1589647)
                     /locus_tag="TRUGW13939_07334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490475.1"
                     /db_xref="GeneID:55994827"
     CDS             join(1589197..1589269,1589330..1589506,1589556..1589647)
                     /locus_tag="TRUGW13939_07334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346368.1"
                     /db_xref="GeneID:55994827"
                     /translation="MATPSLSALSAYRQVLRATRLAFRDDFNVLIAARTEARKQFDQH
                     KRTGIDTPMQIQHALEAASILRHNIVQGARDAEDQNGKWELRIHDEIERGDNDSVKIG
                     GKNVKLHKPCS"
     gene            complement(<1589866..>1591065)
                     /locus_tag="TRUGW13939_07335"
                     /db_xref="GeneID:55994828"
     mRNA            complement(join(<1589866..1590864,1590928..>1591065))
                     /locus_tag="TRUGW13939_07335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490476.1"
                     /db_xref="GeneID:55994828"
     CDS             complement(join(1589866..1590864,1590928..1591065))
                     /locus_tag="TRUGW13939_07335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346369.1"
                     /db_xref="GeneID:55994828"
                     /translation="MPPQIKQDLNRSGWETTDFPSVCENCLPENPYVQMLKEDHGAEC
                     KICTRPFTIFRWKSDRTARTKRTNICLTCARLKNCCQCCMLDLSFGLPIVVRDAALKM
                     VAPGPQSGINREYYAQEHEKEIEEGRGAVEAYEKTDEKARELLKRLANSEPYYRKPRR
                     IEEPQEEESTSQQSEQAPRRSAYGNGPGPIRTSDTRRGGPTRGGRGGGRGGRAFPPTA
                     QLPPSEEDIRPPADPKVTSLFVTGVEDDLPEHEVRTFFGQFGQMRSLVCSHRAHCAFV
                     NYATRASAEAAAQQCQGKAVIKGCPLRVRWGKPKPLDSMADEERKRNAREGRQAAGPS
                     RGAHSGQRAIAAPGQTTEPAEKPTYKVAPPPGSGDVQYASMSGD"
     gene            <1591612..>1592800
                     /locus_tag="TRUGW13939_07336"
                     /db_xref="GeneID:55994829"
     mRNA            join(<1591612..1591850,1591906..>1592800)
                     /locus_tag="TRUGW13939_07336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490477.1"
                     /db_xref="GeneID:55994829"
     CDS             join(1591612..1591850,1591906..1592800)
                     /locus_tag="TRUGW13939_07336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346370.1"
                     /db_xref="GeneID:55994829"
                     /translation="MSASKLEQEDHARDAAFNKAMHGKSSGAQGGFAAMRNKDEKAHQ
                     LAVDEYFKHWDNKAAAVETEETREARRAEYATLTRHYYNLATDLYEYGWGSSFHFCRF
                     AYGEPFHQAIARHEHYLAHVMGLKEGMKVLDVGCGVGGPAREIVKFSGVNVVGFNNND
                     YQIERATRYAEREGLSDKLTFEKGDFMQMPFPDNSFDAVYAIEATVHAPKLEGVYSEI
                     RRVLKPGGIFGVYEWLMTDEYDNENQEHREIRLGIEQGDGISNMVKISEGLDAIKAAG
                     FELLHHEDLADRDDPVPWYYPLAGNFKQMQSVWDFPTIARMTWWGRGLVHRLVGALET
                     IHLMPRGTQKTADSLALAADCLVAGGEKKLFTPMYLMVGRNPE"
     gene            complement(<1593354..>1594043)
                     /locus_tag="TRUGW13939_07337"
                     /db_xref="GeneID:55994830"
     mRNA            complement(join(<1593354..1593688,1593752..1593811,
                     1593878..>1594043))
                     /locus_tag="TRUGW13939_07337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490478.1"
                     /db_xref="GeneID:55994830"
     CDS             complement(join(1593354..1593688,1593752..1593811,
                     1593878..1594043))
                     /locus_tag="TRUGW13939_07337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346371.1"
                     /db_xref="GeneID:55994830"
                     /translation="MKISPTLFGAFLLAKNAISQPVDGQDPVAKWVDAPLNSYDIPSS
                     KGRSVNLFYADGFAYYGDSSAWTGSVITNVTFSFSANPGALSANALTDGVTIPDNTLL
                     YVIPNATSPQPIGFTGSKTTPSGAVTDRWTFYETYASYEDSTGQLNQYFYIKETDVKG
                     VWQVYWDNADEVSGYTRITVRNHAPY"
     gene            <1600434..>1601131
                     /locus_tag="TRUGW13939_07338"
                     /db_xref="GeneID:55994831"
     mRNA            join(<1600434..1600680,1600734..>1601131)
                     /locus_tag="TRUGW13939_07338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490479.1"
                     /db_xref="GeneID:55994831"
     CDS             join(1600434..1600680,1600734..1601131)
                     /locus_tag="TRUGW13939_07338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346372.1"
                     /db_xref="GeneID:55994831"
                     /translation="MADKLQAPSKASKRPTNPVTCPDCGSTFSREPDLKRHIMHKVAC
                     PVENCHKSFRSDKGNEFMRHVEKEHPRLDYGSCHKYFQTQKDVSLPLPGLCIPGGPER
                     TTAELHVVQTPAPLFQSSVMPMHDGSVYGANLSYAHSPSRNKHNEALQSSGFHIPPSW
                     QNPMANVPSLNIEDPNFGAYMFDPSLAGTYHNQYPPSPADSTLHGAQVSQLNWL"
     gene            complement(<1601471..>1604276)
                     /locus_tag="TRUGW13939_07339"
                     /db_xref="GeneID:55994832"
     mRNA            complement(join(<1601471..1603105,1603156..1604095,
                     1604149..>1604276))
                     /locus_tag="TRUGW13939_07339"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490480.1"
                     /db_xref="GeneID:55994832"
     CDS             complement(join(1601471..1603105,1603156..1604095,
                     1604149..1604276))
                     /locus_tag="TRUGW13939_07339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346373.1"
                     /db_xref="GeneID:55994832"
                     /translation="MYIEWSWVAFASTAGATLLPFPLPEPTQLFASDQGLLDLPPKPI
                     SALAGAILPLIFPHTYQPTSTTTQPATSTTQPPAVPPVTSASPTPASPTQASPTPTPD
                     TKGGQSSNLDSQNGDAVTSSSSSSSSTAVSVTTSTTSTSGSPSTPGGNFCANPTPSQA
                     PAKYWLETQDHTGPGRGYAPFVQGNSAYPVHRNALDYGAKNDGSGNQTAALQNAINSD
                     GQGGSREGRGVTYMPAEVFLPGGVYTLGGTLDIRVGTIIVGDPLNRPVIKASSDFVGS
                     TLINGQDPAAGHPETTFMIALKDVILDTTSLDASATFTALQWGIAQGCALTNVDVNMP
                     QGSLGHIGIHINGGSTIAVTDVTINGGGIGIQNSNQQVNFKNITFKGCRTGFAGTGGF
                     TVVLQGATFDSCGLGIDMTKNSLGSMVILDSTSTNTGTLVKFHDSSNASGPRNSQIII
                     ENHTSEGTNPLAVTSNGTTVLGGQSHIDTWFFGNHIPGVFQAGGYLGTLRPTVLLGSD
                     GKYFTRKQPNYANAPASQVVNVKTVSEHPVHGDGKTDDSANLNAILRDNAANCRISYF
                     PFGVYILRDTLVVPPGSRIVGEGWSVLSGAGSAFTDSANPRPVVKVGNQGDVGVAEIQ
                     YMRFTVAEVLPGAIVVEVNMAGNQPGDVGIWNSLTTVGGTADTTISSSCTNQDARYCM
                     AAFMLMHITSSSSSYVENHWGWTADHNLDGGPSPIIVSTGRGILVESTKPTWLVGTSS
                     EHNWLYQYNFHSSSNVYAGMMQSETPYMQGLGAVETAAAPWGVSSQYNDPDFSWCGKT
                     DQLCRSALAANVDAGSNIMLYGSAAWAFFEGQWNGLYNTPCANGICQTNMMRVTNNPQ
                     NLVWYSISTKSSDVMVLDGKSNPREYNNPGGWSGLVQAYRQFAY"
     gene            <1605328..>1606183
                     /locus_tag="TRUGW13939_07340"
                     /db_xref="GeneID:55994833"
     mRNA            join(<1605328..1605560,1605619..>1606183)
                     /locus_tag="TRUGW13939_07340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490481.1"
                     /db_xref="GeneID:55994833"
     CDS             join(1605328..1605560,1605619..1606183)
                     /locus_tag="TRUGW13939_07340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346374.1"
                     /db_xref="GeneID:55994833"
                     /translation="MKKIFKKVTVSFLIGAALAAPISFGNSLNNRAIDAIASSLAATN
                     TLDDNDGVGNGVDTYTAYSGDGSTAAGWPSYSQWESFENMWTNNKPVISQSCTQFGQE
                     NPSEQEMNDLHDSIQQVATETKVDHRYILAIIMQESKGCVRVPTTNVVVSNPGLMQDH
                     GGTGTCAGMNPCPKDNIVQMIHDGAAGTAGGDGLASLLGDSVTSSLQDDVAQGYYRAA
                     RAYNSGSVASSGQLQDGIATHCYASDIANRLVGWVKAQHNCPFDNNS"
     gene            <1612891..>1615401
                     /locus_tag="TRUGW13939_07341"
                     /db_xref="GeneID:55994834"
     mRNA            <1612891..>1615401
                     /locus_tag="TRUGW13939_07341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490482.1"
                     /db_xref="GeneID:55994834"
     CDS             1612891..1615401
                     /locus_tag="TRUGW13939_07341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346375.1"
                     /db_xref="GeneID:55994834"
                     /translation="MSAEEHHEFPGNRQSVASVHSDETLRGEEQDAPTQDRPREPRVR
                     FRSLSSDQNGDDARTLVAERLEHTDHPRAPFHRPPTPTQDDSQRKSEDVTSANRAQPD
                     GDQDRPQKQRNVDGAADKYREEEVEEENQLEKEKEKQKKLFNFDKAKKLWNVEKAREI
                     ARKLGRPPMDGDGLTSSVPDTTWAGDGGIALSNMTDDHRKTDEQRARDQAHATSEAHR
                     LVRELTQHHKGPRSRPRPRQPAEAGAPSLATEEEAQEKARTSGGGILGNLLKLHQAQQ
                     GHDSRSNITGTDVDSEGAQTSGRSTPSSGAATPRKEKLKWYKKDQNKSTSSLVGAASN
                     MSATGAPNHSNQMLSAAARKRKQSGKPRLEDEIRVTVHIAEIISRQRYLMQLCRALMK
                     FGAPTHRLEEYMQMTARVLEVDAQFLYLPGCMIMSFDDSSTRTAEFKLIRVSQGVDLG
                     RLADTHSVYKNVVHDLIGVEEASKQLEDIMNRKPKFPTWFLVIMYGLASATVGPFAFN
                     ARPIDMPISFILGTMLGFMQLVMAPRSTLYSNVFEVFASVLTSFLARAFGSIRWGIVD
                     GKQEYLFCFSAISQAAIALILPGFLVLSSSLELQSHQLIAGSIRMVYAIIYSLFLGYG
                     ITVGVTIYGLMDGNANSNTSCPPSPITNPYLQRFPFVIAMSIWLVILNQGKFKQAPVM
                     MIIAFVGYAVNYLATKRIGSTSEVANTLGAFTIGVLGNLYSRLWHGHAATAILPGIFV
                     LVPSGLAATGSLISGVASADQIRGNVTGHKNESSGGSSAGGGGGGGGGGGGGMGNTSV
                     FNLGFGMIQVAIGITVGLFMAALLVYPYGKRRSGLFSF"
     gene            complement(<1615628..>1617695)
                     /locus_tag="TRUGW13939_07342"
                     /db_xref="GeneID:55994835"
     mRNA            complement(join(<1615628..1615971,1616033..1616469,
                     1616523..1616629,1616685..1616858,1616910..1617127,
                     1617182..>1617695))
                     /locus_tag="TRUGW13939_07342"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490483.1"
                     /db_xref="GeneID:55994835"
     CDS             complement(join(1615628..1615971,1616033..1616469,
                     1616523..1616629,1616685..1616858,1616910..1617127,
                     1617182..1617695))
                     /locus_tag="TRUGW13939_07342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346376.1"
                     /db_xref="GeneID:55994835"
                     /translation="MSTVLTGRVARATNRSYGTTDSPSPETSPDGNRITDKNPATLST
                     TSLSSDLAPLADPRGEQRFWLTRLFKKKQGGGDIPSFDLDSIATQPSVFDSPETAKDY
                     QPRADWENIHRFDPSFRWTWREEYALIRKIDVRILVFTCIMFMALELDRANIQQALTD
                     NFLGDLNMTTNDYNLGNTVFKLAFLCAELPSQLVSKWVGPDRWIPAQMVLWSIVACGQ
                     YWLNGRTAFLTCRALLAILQGGFIPDIILYLSYFYKHHELSIRLSFFWTAMSIADILA
                     SFLAFGLLHMRGVLGQSGWRWLFLIEGLITLVVGILASGLMPAAPTKTASWFRGKNGW
                     FNEREEKIMVNRCIREDPSKSSMHNREPITPKLLLKSLADYDLWPLYIIGVAFQIPMS
                     TPSNYLTLSLKGIGFNTFQTNLLTIPNSVLHIILMLILTYASEITGQLTLTAMIGQIW
                     ALPFVVYLYAVDINSVNKWLAWVIMMLLLSYPNAHPIQVGWNSRNSNTVRSRTVSAAA
                     YNMCVQAGGIIASNIYRADDAPRYKRGNRVLVILCSVNILIYLLTKAYYVWRNSSRDK
                     KWNGLSEQEKHIYLETTTDEGSKRLDFRFAH"
     gene            complement(<1619397..>1624267)
                     /locus_tag="TRUGW13939_07343"
                     /db_xref="GeneID:55994836"
     mRNA            complement(join(<1619397..1619477,1619527..1620365,
                     1620416..1620528,1620580..1620681,1620735..1621029,
                     1621076..1621149,1621198..1621205,1621260..1621318,
                     1621370..1621380,1621442..1621763,1621876..1621928,
                     1622030..1622447,1622507..1622973,1623028..1623207,
                     1623258..1623415,1623464..1623590,1623649..1623760,
                     1623825..1624099,1624251..>1624267))
                     /locus_tag="TRUGW13939_07343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490484.1"
                     /db_xref="GeneID:55994836"
     CDS             complement(join(1619397..1619477,1619527..1620365,
                     1620416..1620528,1620580..1620681,1620735..1621029,
                     1621076..1621149,1621198..1621205,1621260..1621318,
                     1621370..1621380,1621442..1621763,1621876..1621928,
                     1622030..1622447,1622507..1622973,1623028..1623207,
                     1623258..1623415,1623464..1623590,1623649..1623760,
                     1623825..1624099,1624251..1624267))
                     /locus_tag="TRUGW13939_07343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346377.1"
                     /db_xref="GeneID:55994836"
                     /translation="MPKPDKAAPVPLNPIGDEDLRGIFGQPSQELTMAAAHGELEENQ
                     GKNSNLIFNAFPESNHKTSVEDGVPGEDSPKDAFSAPLHRKLKSRHLQMIAIGGIIGP
                     GILVGSGNALNNGGPAGVLISFALVGIIVFFVMQALGEMATLIPVTGSFVEYAERFMD
                     DSVAFALGWAYWYLWVTVLANEYTSIGLVIGYWTDTVPLWGWILIFWFLFLGMSSLGV
                     LVYGEVEFWLALIKVISLIVFFILAICISSGGIGPQKIGFKYWHEPGAFADSINGVAK
                     TFVVAGTLYAGTEMVGITAGESSNPRRAVPRAIRQVFWRILVFYLGLMFFIGILIPYN
                     DPGLLSSGSKTASSPLTIALTEAGILPAAHLINALIAISVLSAGNSSLYVASRTILYM
                     ARNGKAPRFLGVTNKAGVPWAALIFTNVFACISFLDLSSSAGVLYSALITLSGVATFI
                     VWGSISIAHIRFRRALKAQNQDLSLLPYRSSFYPYGTYFSVGANIFLVFFQGYTAFLN
                     PFSAKDFVINYILIPVFLILVVGYKFWNKTKWVKLEEMDIWSGRREEVVQDVSRAQGT
                     KPIDKGKLWWKRLGDVFVGINTDGPSVFPDIPYLISSFCDSNLPNMADAVAEGVAKLQ
                     LDEETGEMVSKGELKKRIAKRAKKASKAQQTKAPAPKTENAPKPKQEEAPIDPDSMFK
                     EGFLAKVYEERPTGPDTVTRFPPEPNGFLHLGHAKAIAINFGFARYHGGKTNLRFDDT
                     NPEAEEEVYFSSIIEIVEWLGFKPHAITYSSDNFDRLYAHAEQLITLQKAYVCHCPDT
                     ELKLQRGGEKGTSPRYRCQHAEQDVETNLQKFRDMRDGKYKPQAAFLRFKQDIESGNP
                     QNWDIAAYRVLAKHHYRTGDKWVIYPTYDMTHGVTDSFEGITHSLCTTEFYQSRESYE
                     WLNKTLSIYEPMQREYGRFNITGTIMSKRGLKKLVDEKYVRAWDDPRLYTLIALRRRG
                     IPPGAILSFINDLGVTTANTLIRLTRFEQSIRRYLEMTVPRLMLVLNPLKVVLEDVDS
                     LEESVREANVPFSPKSPEFGSHKVPVTKTVYIDHSDFREVDSKDYFRLAPGKTVGLLN
                     MPYPITATSFSKDADGKITEVRAVFNKEGKKPKTYIQWVPEGSRNVEVRIHTALFKSD
                     DPSSVEGGFLNDISPNSEDIYPDALIEPGFEEVRRRAPWPEAEGEKEKHGPESVRFQA
                     LRIAYFAMDSDSTEDKVVLNRIVSLKEDIGKK"
     gene            complement(<1624918..>1625595)
                     /locus_tag="TRUGW13939_07344"
                     /db_xref="GeneID:55994837"
     mRNA            complement(<1624918..>1625595)
                     /locus_tag="TRUGW13939_07344"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490485.1"
                     /db_xref="GeneID:55994837"
     CDS             complement(1624918..1625595)
                     /locus_tag="TRUGW13939_07344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346378.1"
                     /db_xref="GeneID:55994837"
                     /translation="MAPIRFGIPLYPYQAIDVMGSLDVIAGSQINMLKICEDMGLISK
                     DAHKKGMELEFYHIQDSSTGIAPMKLDLENISVFGNTTCADCPPLDYLLLGGPMPDYK
                     MPDEMINFIKDRVAKKEIKTVFTTCTGSLVLAQTGLLDGRRAAVNHNGITLAEKLYPA
                     VNWVKRSDKLNWVVDGNIWTATTAVTGMDMFSHWLLDQCGLEITKISLDLLGHGLRGV
                     DGKPVEL"
     gene            <1626423..>1628480
                     /locus_tag="TRUGW13939_07345"
                     /db_xref="GeneID:55994838"
     mRNA            join(<1626423..1626499,1626557..1627072,1627134..1627307,
                     1627365..1627645,1627702..>1628480)
                     /locus_tag="TRUGW13939_07345"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490486.1"
                     /db_xref="GeneID:55994838"
     CDS             join(1626423..1626499,1626557..1627072,1627134..1627307,
                     1627365..1627645,1627702..1628480)
                     /locus_tag="TRUGW13939_07345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346379.1"
                     /db_xref="GeneID:55994838"
                     /translation="MKNNIQADAKVQDRYASTVIGNNQGLNKNPCSKPSLPQSERVFA
                     ETDCVLERLTPATLDVQYEDESEKVIQIHSNVFGRHAQEDPKCGAPPARHSDEAEKKP
                     KRPSLSMSQANQMVQSFRRRNECFPFVILPENTTVEELCQQRPFLLLAVLVVTSDITP
                     VLQKSLDERLRKVVATRVVMQGEKSLDYLQGLIIYLAWHPIHLRPTNNQIFQYTQLAI
                     AMTSDLGLERKMESPSESAEDRLTATNILLGCYYQSSNAGMAFKRPNNFTFKPSDELL
                     DSMLMHNNEPFTQVAAAATRLAKFIERIHYIDVDREMENLQVWIECPFQKLTQVYLQE
                     LSEIESAFSTSVDANIKIQVLRKFARVELYTIALVKEKYRSKWQRKKSNHILNHEINS
                     LSYLQIYSTCFTEINTFIEFMINTSSDDWRRLPFSEWAMLSIVIIYFSKLCQTKIAND
                     MDKSTAYDELFQTERDIWLSSIDRLCDRLEEVSTTTTTTQQENTCCRRTPDFFYLFNT
                     VLKIFKENFVRDFMTIQKAPLSSSQKDEEEEIEGSSCRRTSSRSQCPVMNGDLQHTDY
                     WDMLMDDTQNYLGDMGCFGAEADLDINDPAYFDLTSWVDISI"
     gene            complement(<1628578..>1632155)
                     /locus_tag="TRUGW13939_07346"
                     /db_xref="GeneID:55994839"
     mRNA            complement(join(<1628578..1628878,1628941..1630586,
                     1630635..1631146,1631200..1631739,1631800..1631873,
                     1631941..>1632155))
                     /locus_tag="TRUGW13939_07346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490487.1"
                     /db_xref="GeneID:55994839"
     CDS             complement(join(1628578..1628878,1628941..1630586,
                     1630635..1631146,1631200..1631739,1631800..1631873,
                     1631941..1632155))
                     /locus_tag="TRUGW13939_07346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346380.1"
                     /db_xref="GeneID:55994839"
                     /translation="MADEKPDKDETRIKWQAVDEETGNASSRQQQAAPRQQLTRTLSS
                     SSSFSIRSAGGRTTVDPGVTLPIHYRSVSFDIDDAKLQEQAETAKARNDITAELSNIE
                     WHNLSVVELQKRWEVDASLGLSSDQVQQRFNQYGKNVMSPIPRGWFGQIFGYFFKGFG
                     AILLVGCILVFVSWKPLGDPPAPANLALAIVLLAVFFIQAGFNGWQDWSSSRVMNSIT
                     AMLPESCIVLRDASQASVTAPDIVPGDIVYIKAGNKLPADVRFIEVSNDACFDRSILT
                     GESQPINGTVDSTEDNYLETHNIGLQGTHCVSGNAMAVVVSTGDSTVFGRIAKLASEP
                     KKGLTTLEQEVLRFVGLIVAIMVTMIIVVIIVWSTWLRKDHPDWINVSTLIVDCVSVA
                     IAFIPEGLPIGITASLTITANIMRKNQILCKSLKTVETLGAVNVICSDKTGTLTRNKM
                     FVTDCALSTTTYTPESARDEMVVKGKPSGIHQLRAMSGLCNAAEFDAAALNLPLHERP
                     IFGDATDQAILRLSETLGSVANLRQMWKKTYELAFNSKNKFMIRTFTLNESSGLGLAL
                     SPAESINFRPEDILFTIKGAPDILIGRCSQTIAADGSVQDLDPESLNAVKQLKDKWSS
                     EGKRVILLARKAIPAKDIMASPGSSDYESEVMKHSKSGLVLVGIVGIVDPPREEIPGV
                     VKTLRRAGIRIFMVTGDFGLTALAISKQCGIVSSSSRVDDITALQRTATGHEVVEKQQ
                     DSAIVISGPELMSLNNNQWDQLCKYPEIVFSRTTPEQKLRIVRELQARDQVVGMTGDG
                     VNDAPSLKAADIGIALGSGSDIAIEAADMVLLDSFSAIVEAVQYGRVVFDNLKKTIIY
                     LLPAGSFSEFWPVFTNVVFGLPQVLSSFLMIIICCFTDCAAATVLAYEKPEADVLLRP
                     PRNPKKDRLVDWKLMLQSYGVLGMIETLCSFSMSYWYLQRNGIPFSTLWFGFGAVPDG
                     VSEDYYTAKLNEASSIYFINLVVMQWFNLMAIRTRRLSIFSHPPAFNKETQNLLLFPA
                     IAFALCIAVLWLYIPQLQTVLDTSSVPAEHYFLPAAFGLGILLLDELRKAGVRRWPQG
                     VLAKCAW"
     gene            complement(<1633811..>1634686)
                     /locus_tag="TRUGW13939_07347"
                     /db_xref="GeneID:55994840"
     mRNA            complement(join(<1633811..1634272,1634330..>1634686))
                     /locus_tag="TRUGW13939_07347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490488.1"
                     /db_xref="GeneID:55994840"
     CDS             complement(join(1633811..1634272,1634330..1634686))
                     /locus_tag="TRUGW13939_07347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346381.1"
                     /db_xref="GeneID:55994840"
                     /translation="MAVATTTTLTRPSPKALQYLLNPVTLVLHDQLLAAQQHLSSQGQ
                     EGRPQGPAQNQNSNIDPAISGSAMLQAANSQGPPLGQVMPQIVSGVQEAAGVDRKQYG
                     KRELSTSKRAAQNRAAQRAFRQRKEGYIRQLEEKVGEYKVLSESYKALQSENYQLREY
                     IIGLQSRLIDSQNEVPALPENIDLNQPRPDPPTMTSPSHHPVPPGPPPGGSSSPNLPV
                     PPGQQGQPSAGRPNQTSDDINQLNRIAVAGLGIPKNDHEGYPGGEVSQFKHTRM"
     gene            complement(<1636558..>1638995)
                     /locus_tag="TRUGW13939_07348"
                     /db_xref="GeneID:55994841"
     mRNA            complement(join(<1636558..1636590,1636650..1638367,
                     1638421..1638741,1638803..>1638995))
                     /locus_tag="TRUGW13939_07348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490489.1"
                     /db_xref="GeneID:55994841"
     CDS             complement(join(1636558..1636590,1636650..1638367,
                     1638421..1638741,1638803..1638995))
                     /locus_tag="TRUGW13939_07348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346382.1"
                     /db_xref="GeneID:55994841"
                     /translation="MTITSQQIILPTRSTSAGDKNSPKPPPKIYNVKDFPFKGYQPPQ
                     PEGYQQSKASPSSSAIVIDNGSHTVKAGWSFDKNPRFVIPPVMSRFRDRKLNKACQFI
                     GYDAYVDATTRGQLKYAFDPGTSVVGNWEVMEGVLDYLFIKLGVDGSEGNVDRPIVMT
                     EPIANLAYPRKMMNEILFDCYGVPSVAYGVDSLFSYRYNGGKDGLILSSSHTSTHVIP
                     VLNSKALLSNASRLNWGGLQASEYLLKLMRLKYPSFPGRMTEYQMEDLIHKLCYVSLD
                     YNEEMTHFLDWTGLEDRDYVVQYPFTEHVVVEKTEEELARIAERKKESGRRLQEQAAK
                     MRLEKLMKKEQELEYYKDLQQKLAQQTKKEVRRILESEDMKDEAHLERTVRDLERSIK
                     KSRNKDLGNDENEENGEEATFPLLEIPDEELDEAGLKEKRHQRLMKSNVDARQRAKAE
                     KEQEKARIEEEQRLDDERRENDFESWIGERRTARQALLQKIKDRDRLKADLGNRKSLA
                     SQMRMKTLANLASDGPKKRRRGGDDDTFGADDADWGVYRTVATGDQSDDEEEEDMNGS
                     LKTLEEQLLKYDPDFTAEHTLDAQSDWTKSLVHAFLRGPWPFDPESQREAYQIHLNVE
                     RIRVPEVVIQPSIAGVDQAGVVEIAADILNQRFTVDEDRTRLLKDIFLTGGNTLFKGF
                     DERLRTELRGFVPVDAKMSLRRAADPVFDAWKGAAQWASGPGLGSVSITRADYEEKGS
                     EYLKEHDLGNVTSM"
     gene            complement(<1639411..>1639869)
                     /locus_tag="TRUGW13939_07349"
                     /db_xref="GeneID:55994842"
     mRNA            complement(join(<1639411..1639439,1639502..1639586,
                     1639650..1639694,1639745..1639801,1639867..>1639869))
                     /locus_tag="TRUGW13939_07349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490490.1"
                     /db_xref="GeneID:55994842"
     CDS             complement(join(1639411..1639439,1639502..1639586,
                     1639650..1639694,1639745..1639801,1639867..1639869))
                     /locus_tag="TRUGW13939_07349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346383.1"
                     /db_xref="GeneID:55994842"
                     /translation="MESPHEHQQSLLLSRIITNIEKLNEAVMVLNKGLQEVNVQNMNV
                     ELVAQMFKNYQSNVLFHLEATENLQEPS"
     gene            <1640243..>1641172
                     /locus_tag="TRUGW13939_07350"
                     /db_xref="GeneID:55994843"
     mRNA            <1640243..>1641172
                     /locus_tag="TRUGW13939_07350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490491.1"
                     /db_xref="GeneID:55994843"
     CDS             1640243..1641172
                     /locus_tag="TRUGW13939_07350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346384.1"
                     /db_xref="GeneID:55994843"
                     /translation="MEPFKITLSNEATLTGLVNAGSGPAILPNRLPLIVCLHGGTYTS
                     RYFHVDASHTASSVSNSLGVPLVAINRPGYADSTSFYPIPQGSSYPQEYGIWLHRYIL
                     PAIWAEFGEPRGCNCIVLHCHSLGSTGAIIAASMHAASEPIEATYPLAGLVISGFGSQ
                     PSGEAYKPQGDETTITFPPKVKDSIMLQQGCADSSIYQYTEELNHGMPVEEIGDVHTA
                     WFPRWKEWAGNVKAPVMAAVAQDDVMWKGTREHINDFGSAFTGSERVDTSVVIGAPHN
                     MEMSYWATGWYTRSFGFALECAASFAHKNQSST"
     gene            complement(<1641688..>1643916)
                     /locus_tag="TRUGW13939_07351"
                     /db_xref="GeneID:55994844"
     mRNA            complement(join(<1641688..1642491,1642895..1643570,
                     1643642..1643755,1643813..>1643916))
                     /locus_tag="TRUGW13939_07351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490492.1"
                     /db_xref="GeneID:55994844"
     CDS             complement(join(1641688..1642491,1642895..1643570,
                     1643642..1643755,1643813..1643916))
                     /locus_tag="TRUGW13939_07351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346385.1"
                     /db_xref="GeneID:55994844"
                     /translation="MKSATSSAPSRGKRSPDALREPRPRKREKYAKMACSLCKVRKVK
                     CSGNQPCNRCEELHSQCTYNEPFQPDGAETFDPQPVHQDPEFTVLRMNRIFDQMQQSM
                     SRFGLAPPRRSSCLQRRQENDELPQPNKPPTLTDPGHTLSLTQDAMRERGLLSPPHSQ
                     DTPHPVVQDQLKFPDALINLLQAERPLLELGHEKVTQFFTIFKDEVYPFYPCVNLDLG
                     HEAISNVFSTLKNNYHGVILNMDIIDVEVTKAVVAIALLLRDDSQSPLASDLESQLVW
                     TVDSCFDQEKPQVEDIVMAILLEPHESYISTMISLDRNLSETWTVVNSPSSLSKNNEE
                     RIEFLNFQLQKLVDKIPTSDFKSLEPTVAPPSWLQAGLKRFCHLRVHHIKILTQISTS
                     GSIRDLISNPTSNNNLVAAAAKSVDLHLEMVDAGEISPLVLPITIKLLLASLSLMMFA
                     VSHCPDEYGPLCSKPFETAIHILSDAQNYVKDPDLNIWGTLHVLEKVVETSQRPHSQR
                     SAPLIGRKEDMGNSVDPGEDFCEGSVFEELPTPSSEFFSMLGSMGATDVLHMDNIFG"
     gene            <1645397..>1647542
                     /locus_tag="TRUGW13939_07352"
                     /db_xref="GeneID:55994845"
     mRNA            join(<1645397..1645612,1645665..1645749,1645796..1645889,
                     1645940..1646046,1646104..1646702,1646758..1647132,
                     1647207..>1647542)
                     /locus_tag="TRUGW13939_07352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490493.1"
                     /db_xref="GeneID:55994845"
     CDS             join(1645397..1645612,1645665..1645749,1645796..1645889,
                     1645940..1646046,1646104..1646702,1646758..1647132,
                     1647207..1647542)
                     /locus_tag="TRUGW13939_07352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346386.1"
                     /db_xref="GeneID:55994845"
                     /translation="MVGPKLEFGGFPIPWTPTNRPEDETNMYPYRKQTRNTRKLPVGW
                     RFADGRRPIHQETIFDEVVEIPLRDGVKIYCDIFRPVTDIKIPAILAVSPYGKNGHVK
                     SLQGFRIFDNIPFRLGLPESATSGLEKFEGPDPAEWCPRGYAIINVDIRGTWDSEGDL
                     YIEGSQMGLDGYDTVEFIAAQSWCNGAVSMCGNSWLATEQWATAIEKPPSLKCIAPLE
                     GFTDKYRDLICRGGVPKYNFASFIFNKTIRGRNSREDIGEALNKWPLFNGYWEDKVYD
                     TSGLTLPIYALASYSSGNHGAGTVRGWSQAASKDKWIRFHPTQEWFDLYTPRYINDLQ
                     RFFDRYLKNIENGWEETPKARVSILTYGNRFEPGPVWDVPFANYPIPSTEYRKLYLQD
                     SGKLDTSPQVHENFVAHYADTYQAKPSEFLLTFDKATTLVGYSKAELWMSCKDKDDMD
                     VFVSIRKLSRSGEVLEHINVPWENLPEGVNTQHDVPMAQTVKYTGPTGILRASHRAQV
                     PERSTALIPYHPHDKEEKITPGEIVKLEISLWPMGIHFEAGDNLLLRIQGFIDTSSDF
                     PDHIDKKLDNLNEGRHTIHFGGKHESKIIVPVIALPT"
     gene            complement(<1648240..>1650129)
                     /locus_tag="TRUGW13939_07353"
                     /db_xref="GeneID:55994846"
     mRNA            complement(join(<1648240..1648454,1648519..1648623,
                     1648684..1649387,1649449..1649916,1649993..>1650129))
                     /locus_tag="TRUGW13939_07353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490494.1"
                     /db_xref="GeneID:55994846"
     CDS             complement(join(1648240..1648454,1648519..1648623,
                     1648684..1649387,1649449..1649916,1649993..1650129))
                     /locus_tag="TRUGW13939_07353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346387.1"
                     /db_xref="GeneID:55994846"
                     /translation="MTLKAPPSLIAIIPRKRLVTSDQDEVTGETLLVPQPSTDPNDPL
                     NWSKAFKIYVAFLTCVALTWINFFAGGPGAVLVEIAIDLFGVYLPKPNNPGTLSPASM
                     AAFSSAVSKTALLFSTASMSAGVSNLLWVPLAIKYGRRVVYTFSFLIFGLCCIWSARA
                     TSYGSLLASRIIAAWFSGSAECVAPMTIADIFFLHERGKMTAMYSAALSTGAAFGLLI
                     SGVMSISQNWRMFHYLCAALVLATTVLIFFTMPETAYQRHICGTEQVENEKVSNAAEV
                     EHIEVSNTPKKPFFQRMAFNRAPLTHESIWKIVLRPVLILFLPPVFWSTVSFGIGIGI
                     FVVLSTTGATAFSQVYGFTVWQLGLVWLAGIVGNILGIPFGGYFSDWVANRATSKNGG
                     VREPEMRLPAVSIAMVTYPGSLLLYGLGINYKTHWIVPALGIFLFSFGSSATIGITVV
                     YTIDCYRPISGEVVVSQVVFKSFITFLMSFYANPWVNRDGYAGVFGAMAGFSFVVLAL
                     WIPLYIWGKQIRHATLKWRVMRRIHWDLDRETGE"
     gene            <1650735..>1652354
                     /locus_tag="TRUGW13939_07354"
                     /db_xref="GeneID:55994847"
     mRNA            <1650735..>1652354
                     /locus_tag="TRUGW13939_07354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490495.1"
                     /db_xref="GeneID:55994847"
     CDS             1650735..1652354
                     /locus_tag="TRUGW13939_07354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346388.1"
                     /db_xref="GeneID:55994847"
                     /translation="MAALGPEAAQAGLIVPSEKSQHAKHFGLASPWEHYYHPTDTAPQ
                     GRFECEMDELVVFGDIPTEISGTWYRMLVDPHFCPQVGTPFVDGDGHVCAFRIQNGKI
                     SMKIKYIHTERWLLERKAGRRLFGRYRNPYDIHPCVRFANDSTGNTNIIYWGGNLLAL
                     AERGLPWAMDPDTLETRGADPYGGQVAAMTFTAHPKVDPHKNELVTWSYSAKGLSTPD
                     ICTYSINPNGRISNEHWFKQDKPGWPHDGWITEHWIILSNMPFGVNTDEVMKAGGDYW
                     RFMPDQLSEFLVTPRYANAPNHPDWKPGEFRKYTAPHGLIIHSGNAWEEEGGILKLES
                     HFVTFNVFDFFNPKEYEGPSGKPSGDWKRWTIDLAKPDGTALPPPDTLLDGIFDFPIF
                     DERKTGYKTKIVYLTAMIAPEGEERPRFNAIVKLNTETGEKSIFHAAKDGSVAEPAYI
                     PRGPDCEEGDGWVIFYLERDSSPKGELAILDTNDFSKPVAITQLPFQTRNQVHGNWVP
                     NPHPDTPLPMLTGPIKDVVPSTKHSQLNRLP"
     gene            <1653166..>1654856
                     /locus_tag="TRUGW13939_07355"
                     /db_xref="GeneID:55994848"
     mRNA            join(<1653166..1653382,1653431..1654383,1654457..1654591,
                     1654668..>1654856)
                     /locus_tag="TRUGW13939_07355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490496.1"
                     /db_xref="GeneID:55994848"
     CDS             join(1653166..1653382,1653431..1654383,1654457..1654591,
                     1654668..1654856)
                     /locus_tag="TRUGW13939_07355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346389.1"
                     /db_xref="GeneID:55994848"
                     /translation="MISQFAYLQYDVSMLITAASIVFILRYLSAALFSPLHDVQGPTL
                     ARYTRLWEVYKNWQGQLEHVTVAFHKQYGSIVRLAPNRYSISDPTAIRTIYGTGSKFS
                     KSDYYTPFGAPLDHKDVFSETSNEKHASERRKISNMYAMSSLVSYEPFVDKVNGVFMA
                     ALADHAQHRRAFDLFTWMQFYAFDVIGEITIGRSFGLLEAGHDKDGLLHAVHVGSISY
                     GSSVGLIPEIHQLYLWFQKVVPINSHWKITQRVILKEISARLQGVSTTDRKDFLAKCI
                     ELSKAGKLDQSTINNVLGTNIGAGSDTTGISMCAVIYFLMKHPNCLQKLRDEIEMADR
                     QGNLSSPVTFQEAQRLPYLQATIKEALRLHAAVDQILSRVVPDGGAQIAGRHFPQGAV
                     VGVNAWVIHNDESIWGKDVHEFRPERWLVDKEQLSFLEQNYLAFGAGSRTCIGKNISL
                     LEMTKLLPQIVRQFDFIPAGDSQWTTSSGWFVKQSIQVKVINRGREI"
     gene            complement(<1655723..>1657620)
                     /locus_tag="TRUGW13939_07356"
                     /db_xref="GeneID:55994849"
     mRNA            complement(join(<1655723..1655991,1656073..1657528,
                     1657600..>1657620))
                     /locus_tag="TRUGW13939_07356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490497.1"
                     /db_xref="GeneID:55994849"
     CDS             complement(join(1655723..1655991,1656073..1657528,
                     1657600..1657620))
                     /locus_tag="TRUGW13939_07356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346390.1"
                     /db_xref="GeneID:55994849"
                     /translation="MFEALWDAGVRYCFVNLGSDHPAIMEAMVKGQWERPDRFPKFIT
                     CPCEMVALSMADGYARVTGEPQAVIVHVDVGTQALGCAVHNASVGRAPVFIFAGLSPC
                     TLEGEYRGSRTEFIHWLQDVPDQKAIVSQYCRYTAELKKGQNIKQMVNRALSFAKSKP
                     RGPVYLQGTREVMEEVIKPYEIRQEFWSPVELGGLIPTQLNLVASALVSAREPLVVTG
                     YSGRDTAVVPLLIELANLIKGLRVLDTQGSDLSFPADHPGWLSVRYGSDEAIRTADVI
                     LVVDCDVPWINTQCKPADDARIFHFDVDPLKDQMPVFYIDAILRCRVNTKFALDQIVQ
                     HLKTDLSHEIRANNEHYKDRWSALQVSYKKKLSAISALAEPNPDGSLGCGFLISSLRK
                     ACPIDTIWVIEAVTNTFTVADQLQATLPGSVYSSGAGGLGWSGGAALGIKMATDCIHG
                     GKGKFVCQIIGDGCFHFSIPTSVYWVAQRYEIPVLTIVLNNDGWNAPRNSMLLVHPNG
                     LGSEVSNEELNISFDPNPDYATIAQGSSGGKCWAGRASTVDELVARLPEAVDAVQSGR
                     SALLDARIIKKRSML"
     gene            <1658163..>1659234
                     /locus_tag="TRUGW13939_07357"
                     /db_xref="GeneID:55994850"
     mRNA            join(<1658163..1658271,1658335..1658621,1658689..>1659234)
                     /locus_tag="TRUGW13939_07357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490498.1"
                     /db_xref="GeneID:55994850"
     CDS             join(1658163..1658271,1658335..1658621,1658689..1659234)
                     /locus_tag="TRUGW13939_07357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346391.1"
                     /db_xref="GeneID:55994850"
                     /translation="MASVDYVFKTVNYGAQTVNLTATVHLPKCATSVKAIALYFHGGG
                     YIVGGRAMLPATHIEALNESGFIAVSSDYRLGPTISVLDGPVSDSVAAYEWAQNVLPT
                     LLENEHGILVDGENIVTLGHSCGGGIALLMASRPNPPKAILDLFGFKYLRDPFYHTST
                     STQPQSNAPALPSAEFINQVFNEIPPPTAARPPFGPNGLDLSTPRQAYLVTSVRKGTQ
                     FDAIIAGDDYDRVDPEKLLESPNFPPTCFVQGTADVVVDAKFSQRAHAELQKNGIPSE
                     LYLAEGMAHGFDARLKRDDVAFSSIQKGVEFLAQYVG"
     gene            <1660418..>1661439
                     /locus_tag="TRUGW13939_07358"
                     /db_xref="GeneID:55994851"
     mRNA            join(<1660418..1660790,1660841..>1661439)
                     /locus_tag="TRUGW13939_07358"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490499.1"
                     /db_xref="GeneID:55994851"
     CDS             join(1660418..1660790,1660841..1661439)
                     /locus_tag="TRUGW13939_07358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346392.1"
                     /db_xref="GeneID:55994851"
                     /translation="MMRYYGVSKEGLWGNSWWESGAIMTALADISSLDSSYNGTYFST
                     YSTTFNKAPTNDSHPGFINSFYDDEGWWANAWVAVYDLTKNPEYLNMAISIYDDINTG
                     VDTPCGGLYWAKGKKYIASIANELHITLAASLANRVGSDQKQNYADAATAGWEWFFKS
                     GLVDADWLVVDGMNNDTCEPTGAKRSYNQGVILSAATELYKATGNSSYLELAGNIANA
                     TTALNSTITDANGLIKECDGGCDTQGSMFKGALFRGLHQLQLADPHDNWKSFITTNAK
                     ALWNNALNVTNGQCNTGSDFRGPMTSVNEVTQGAALDVLVAAWAVTS"
     gene            complement(<1661706..>1662928)
                     /locus_tag="TRUGW13939_07359"
                     /db_xref="GeneID:55994852"
     mRNA            complement(join(<1661706..1662020,1662080..1662156,
                     1662208..1662364,1662430..1662531,1662668..>1662928))
                     /locus_tag="TRUGW13939_07359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490500.1"
                     /db_xref="GeneID:55994852"
     CDS             complement(join(1661706..1662020,1662080..1662156,
                     1662208..1662364,1662430..1662531,1662668..1662928))
                     /locus_tag="TRUGW13939_07359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346393.1"
                     /db_xref="GeneID:55994852"
                     /translation="MAPSSLLLGIVLTAASPLLALGQKLDKPALTSNLDYLEQGNIDN
                     LNPTQSTNDQWGSGWIPSDCKDIANNEGKSPDDFEIYNVHYDDCDDAWVFCRHKDTPT
                     DLITTIDIFGRLPVAMRSWVRHVLTLPGDNYAYNSNGNVAFFGTTSSILDVAIHETGH
                     SLDLLGAYGDPLSSSQDWLDNYNQDSNVPDDYAQTNQVENVAQNTVVSVYDKVVPGGF
                     GSAQSNWNNIFHQYATLQGKAGDQIIPGGTCDRHLVNSETVSTGSSASTIMVDYSVNK
                     PNTSFKGNYTRVLKNHPKFSTKELCAF"
     gene            <1664477..>1665451
                     /locus_tag="TRUGW13939_07360"
                     /db_xref="GeneID:55994853"
     mRNA            <1664477..>1665451
                     /locus_tag="TRUGW13939_07360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490501.1"
                     /db_xref="GeneID:55994853"
     CDS             1664477..1665451
                     /locus_tag="TRUGW13939_07360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346394.1"
                     /db_xref="GeneID:55994853"
                     /translation="MASNLADQLAIEPLGLGKYQSKHFPPRGGNSAPIGYGGFTLAIA
                     LQAAIASVPAAFHLYSFMGNYLGPVSTKRKIICSVQETRSTRTFMTRRVQVLQEKDNG
                     QPTFICLDMLADFQIAEPALLTYSAPPRREYSHWKGCVSMDTRRQQMLDAGQITSTQS
                     RIFETTFGGLRDFKYESRICPESMTSQTLVGMNKDQPTTQDHLPLVERSSADWFRAIG
                     DLKTPVDNLAALSFIMDGMLSFLPLAHSRHFFDEVDACSSLDFAFRIFTPNVNLNNWH
                     LRECITHAGGFGRTFSEGRVWDEAGTLIASMTQQSILRPKAKKLKHNL"
     gene            <1666127..>1668178
                     /locus_tag="TRUGW13939_07361"
                     /db_xref="GeneID:55994854"
     mRNA            join(<1666127..1666494,1666933..1667039,1667095..1667192,
                     1667254..1667285,1667345..1667490,1667550..>1668178)
                     /locus_tag="TRUGW13939_07361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490502.1"
                     /db_xref="GeneID:55994854"
     CDS             join(1666127..1666494,1666933..1667039,1667095..1667192,
                     1667254..1667285,1667345..1667490,1667550..1668178)
                     /locus_tag="TRUGW13939_07361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346395.1"
                     /db_xref="GeneID:55994854"
                     /translation="MAPNYAYQPIITSEEGFPTARKRRAIYLRPFLLFWLNSLFAEVI
                     FLAVGVFIMTGTRDLIYKALWTLVFCPLGMGGAMGGVINYFIVDHYYGKKAAHFTGIL
                     SLLMLGTCNYLCYSLDRHFGWFRKTSTIQEREKVQAMNHTLSIWERIDAWLGWLSVGA
                     ELVYAAISGFFRGPSGTDSYQHHLIQAAVKKITRRFTPLQLQYIFKSYDQLYLDYCRS
                     AQIEPRFVANERGLKGFWIGCPTAKYVVINFHGGGFAMDATKSYLDFWPSVARALSDE
                     DITTDWFNITYTLTPHATYPTQFCEAVEALRYVIEDLGRSASEVVLVGDSAGANLCLA
                     LLSHLSHPSPAAPQLKITEPLKAIVLMSPWLSFRNDWSSMKINEDKDIDAREVTERWS
                     QDYLNGVSTDNYTEALRAPETWWEGALVKQSLVLARSDEVLLDPIKAWVRKFSVYHPP
                     NLRSTIRPS"
     gene            complement(<1668605..>1672506)
                     /locus_tag="TRUGW13939_07362"
                     /db_xref="GeneID:55994855"
     mRNA            complement(join(<1668605..1671527,1671580..1671826,
                     1671879..>1672506))
                     /locus_tag="TRUGW13939_07362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490503.1"
                     /db_xref="GeneID:55994855"
     CDS             complement(join(1668605..1671527,1671580..1671826,
                     1671879..1672506))
                     /locus_tag="TRUGW13939_07362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346396.1"
                     /db_xref="GeneID:55994855"
                     /translation="MHCVDRGGTFTDCLGIVEGVEENILVKILSQDPSNYPDAPIEGI
                     RRILEEATGKSFPRGQKIATSQFKDLTIRMGTTVATNALLERKGDRVALLITEGFDEA
                     LKIGLQSRPKLFDLHIKKPDVLYERVVEVSERVTVESYQQSPSYDEDVVDIEEATKTD
                     PNLVRGLNGQVIRVLKRLDKERVRADLRKLYDDGLRNICVCLAHSYTFQEHELQIQEI
                     ATEIGFSQITLSCLTLPMIKMISRGMSATADAYLTPVVQKYIKGFQSGFTDGLQSSNT
                     RCEFMQSDGGLVDVRKFSGLRAVLSGPAGGVVGHARTSYHPEENMPVIGFDMGGTSTD
                     VSRFDGSFDHTFENSTAGITIMAPQLDINTVAAGGGSILFWRHGLFAVGPDSAGAHPG
                     PACYRKGGPLTISDANAFTGRLLPEYFPKIFGKSEKEPFDVDITRTKFAELAKQISEE
                     TGQKKTAEEVAMGFIDVANETMAKPIRALTESRGFATSAHHLACFGGAGGQHACAIAA
                     SLSIQKVIIHRYSSILSAYGMVLADTVHEAQRPASGFYTSTDVVQPVIEELKAEVDRE
                     FQTDGFSESQVKHEVYLNLRYQGTDNNLMVLQPEDGDYLAEFTRQHYREYSFTFPEKK
                     VLIDDIRVRGIGKSTGKINESPYKELCSINQHDVTKSSEDGRSSVYFAQTGWDETPIY
                     RLESLNPGCNVKGPAIIIDNTQTIIVEPLVKATVLSRHVILELPSSQSQSRTLSETTV
                     DPISLSIFGHRFISIAEQMGRTFQKTAVSVNIKERLDFSCALFSPNGRLVANAPHVPV
                     HLGSMEYAVRYQNDKYRSQLKPGDVLCSNHPIAGGVHLPDITIMTPIWDKDEKEIIFW
                     VASRGHHSDVGGISPGSMPSNSKYLYQEGAAVESYKVVSGGRFDEERTRKFLWDEPAK
                     YDGCSGTRNYKENLSDMRAAIAANQKGANLIDRLIQEFSLPIVHLYMNAIAENAEVAV
                     RTFIRNLAKSRKTPVLAFEDCLDDGSILKLEIRLNGEDGTAVFDFTGTSEETLNCLNT
                     PKAITYSAVIYCLRCLINMDIPLNQGCLAPIEIIIPEGTILNPSPYAAVCAGNSVTSQ
                     RIADLILGAFGAIAASQGCVNVFGFGKGGKDSSGKEIPGFGYIETIAGGHGAGPTWAG
                     TSGVHVHMSNTRCADPEVYELRYPVILRRWTLRTGSGGHGKFNGGDGCIRDIEFRIPL
                     QVNMLSERRVLGPYGMAGGHSGAAGKNLYIKNEADGTTRTINIGGKMELNLSAGERVV
                     IHT"
     gene            <1673395..>1674744
                     /locus_tag="TRUGW13939_07363"
                     /db_xref="GeneID:55994856"
     mRNA            join(<1673395..1673610,1673668..>1674744)
                     /locus_tag="TRUGW13939_07363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490504.1"
                     /db_xref="GeneID:55994856"
     CDS             join(1673395..1673610,1673668..1674744)
                     /locus_tag="TRUGW13939_07363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346397.1"
                     /db_xref="GeneID:55994856"
                     /translation="MALESNERESVLILGAGCFGLATAYHLASKGYSQITVLDKADEI
                     PSHFSAGFDLNKVVRAEYPDPFYTSLSLKAIEKWRNDPLYAPHYHETGFLNVVSDAAN
                     QQTRDTIENYFASIQKQPAFDGQIQRVSGHAEVKKIVPAFQGLINGWSGYWNKMAGYC
                     HSANASAAVYCACVNLGVKFQLGKQDGEVESLLYASARVGTTCVGARSRGGRIYLADK
                     IILAMGPDVANLIPQIGKQVTGRCWGVVHIQLSPEEAATLRNIPVTNVRDMAFFFEPD
                     RETNKLKFCHMGGAFTNYAYSKDGLSLPFTELSESQFVPAEDEFYIRKLLKEVLPQFA
                     DRPLIDAHLCWFADTDDSNYIIDYVPETGSSLVVLSGDSGHGFKMLPIFGEFVQALLD
                     NGDQSETRWQWKGSQVKTGSAWRSGTSQELAGVTRAKL"
     gene            <1675530..>1677189
                     /locus_tag="TRUGW13939_07364"
                     /db_xref="GeneID:55994857"
     mRNA            join(<1675530..1676022,1676078..1676503,1676564..>1677189)
                     /locus_tag="TRUGW13939_07364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490505.1"
                     /db_xref="GeneID:55994857"
     CDS             join(1675530..1676022,1676078..1676503,1676564..1677189)
                     /locus_tag="TRUGW13939_07364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346398.1"
                     /db_xref="GeneID:55994857"
                     /translation="MAETEAKPPHPEDLKNVESQHQGELLALDSTPDVAARFLDNLSQ
                     DIKDQPITPEEARRLVWKIDLTIVPVLGFSVMLCAIDKVIISNAALYGMTTDTHLVGD
                     QYSWVGSIFYFGFLIAEWPGNILIQKLPIRSFYGATVLCWAIFTFLTGATSNFGGLAT
                     VRFLMGIFEAVVFPVCTLVTAMWWTVSEQPVRVAIWFNTLSSITTGLLAYGIGHTHTN
                     VAPWRLLFIVLGGITTIWAVIVYIYLPSTPVEAWWLSDREKYVCLERVRLSNTGIEDK
                     KIKWHQVKECLLDPRSWLLAIFACAINIPNGGLVTFAALIVNGLGFTPLQTTLLGIPT
                     GVVGTLWSIICNILASRLPGYRCALIFCAIMFTMVCAICLWKLPQTNKVALLGPYYAF
                     YSYWAPYTMATSLPMANTSGHSKKVTMNAMFFVGYCVGNLIGPQVFQAKDAPTYHNSY
                     IGLLASLVVGAASIALYGLLCKIENNRRNKLQGGGPVARTEEEERLEAFSDKTDKEKL
                     NFRYTY"
     gene            complement(<1677465..>1677983)
                     /locus_tag="TRUGW13939_07365"
                     /db_xref="GeneID:55994858"
     mRNA            complement(<1677465..>1677983)
                     /locus_tag="TRUGW13939_07365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490506.1"
                     /db_xref="GeneID:55994858"
     CDS             complement(1677465..1677983)
                     /locus_tag="TRUGW13939_07365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346399.1"
                     /db_xref="GeneID:55994858"
                     /translation="MSTSTTSGEKAIAKPLASYSAARVVSLSPTTHLFYISGTTARQP
                     DGQVPPFGHSYSESLANTPTATADHGLCSAAAIQTRIILSKITTVINDASPELLGLEA
                     LVELTIFAKSLRRDYAAINKVYDEQVGVLLRSKGIPLPARTCVEVNGMPPDERTLVEI
                     KAVAKLAKVHKY"
     gene            <1678655..>1682418
                     /locus_tag="TRUGW13939_07366"
                     /db_xref="GeneID:55994859"
     mRNA            join(<1678655..1679794,1680319..1680445,1680511..1681139,
                     1681217..1682095,1682164..>1682418)
                     /locus_tag="TRUGW13939_07366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490507.1"
                     /db_xref="GeneID:55994859"
     CDS             join(1678655..1679794,1680319..1680445,1680511..1681139,
                     1681217..1682095,1682164..1682418)
                     /locus_tag="TRUGW13939_07366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346400.1"
                     /db_xref="GeneID:55994859"
                     /translation="MADIQTCPSLSRASVEEAARRINGKVHRTPVLSSRYIDSVASTP
                     RTTDELIGTEWEGQELARPRMHILFKCENLQKIGAFKPRGAFNSTLRFLEEQEKSQQV
                     AASADQLPVRIISHSSGNHAQAVALAAGELGLAAHIVMPSVSMPAKIAATRGYGATIH
                     FSGSTPQERMAVVEKLISEPGFRNVFIPPYDHPDTILGQGTLGLELQEQAAELLAPNN
                     KLDGIMAPCGGGGMLSGVALSCQGTGINVFGSEPSFEGADDCRRGLLAGKRIEVVRST
                     TIADGLRTPVGEIPWSVISDKKNVQGLFAVTDDQIRDALELVLQRMKIMIEPSSAVPL
                     AVALYNEDFRRIIENECKNGRVYNLGVVVSGGNVDVRLLPQLLKPIRPGRDAVDARSW
                     VCLANMEFVFNGLRIPLLVASATDDSVNIPGTSRSKTPTFFMNTFSGDVLHYVQVTHP
                     RSQDCHAPHYIDVDILSEKSKFHEEDEFQSPCVARPKDSELGRHSLASSDKFGDIMQD
                     YRSRSSQQLNPASTIQFLDESDGYILQFYERVVCSKMSLLDNENHNPHRFLVMPMVFS
                     STNILSAVLTVGATKLSFIDTRFHQKALFHRQQTLINLADTLQHIGSGLANYLEALTS
                     TLLLCWSDISDSCRSSWTKHLMGLAGILNACPEQADHDPHASKLIRACRQYLVYHIIM
                     TKATFCDNSILPNSKSTLSNFLSYGELTSDCDGKYSQEMLFPEQGSWNTPEKPRLLSI
                     GALEDLDHIDTHQGFSNSLLLLVNDICDLVEYRDTRDPNHTAHVTQRVYQLENSLQNL
                     VQLQPEGMYGQIGSQNMTQDEKSSSTQSPQRRLQSIMATAEANRLAAFLFLHETCALH
                     FPEITPKFQASRSDYIQKILSLVEAICNEHVTAALPIWPVFMAGFCTGEENRVRILNI
                     LDKFQGQRLFGSIPPACAAIEHLWKQRDLSADENPRNHLPTLSSLALSQTMGPKRSRN
                     KQLKYLQTRAKNSGVVEMQYPWEQAISMLKGSILILT"
     gene            <1683976..>1684542
                     /locus_tag="TRUGW13939_07367"
                     /db_xref="GeneID:55994860"
     mRNA            <1683976..>1684542
                     /locus_tag="TRUGW13939_07367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490508.1"
                     /db_xref="GeneID:55994860"
     CDS             1683976..1684542
                     /locus_tag="TRUGW13939_07367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346401.1"
                     /db_xref="GeneID:55994860"
                     /translation="MAPQTPSSDEHQQLLDTLDIAAIPRPFRSSRWKPSIRRNKNVKQ
                     LLSESSRKEASSMATQSNSGATTPQLGTTTTDGSQTPAAGAASRAPNLAQASQNLSTL
                     VLEKNLRASMYTGGPTVTYTNIESAPSLSPAHQHRYCDITGLPAPYTDPKTRLRYHNR
                     EIFGVVRTLGQGVAENYLQARGAHVVLK"
     gene            <1685503..>1686165
                     /locus_tag="TRUGW13939_07368"
                     /db_xref="GeneID:55994861"
     mRNA            join(<1685503..1685533,1685604..1685630,1685696..1685744,
                     1685800..1685815,1685869..>1686165)
                     /locus_tag="TRUGW13939_07368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490509.1"
                     /db_xref="GeneID:55994861"
     CDS             join(1685503..1685533,1685604..1685630,1685696..1685744,
                     1685800..1685815,1685869..1686165)
                     /locus_tag="TRUGW13939_07368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346402.1"
                     /db_xref="GeneID:55994861"
                     /translation="MPTMWLSETQKIGAIFCTGGGLFLFGGVVMFFDRSMLAMGNILF
                     LIGLTLIIGFQKTLAFFSRPQKIKGTAAFAAGILLILFKWAFIGFFVELYGILILFGD
                     FLVTIGQFAANIPIIGPYIQQALVILAGQRRNAELPV"
     gene            complement(<1686777..>1690433)
                     /locus_tag="TRUGW13939_07369"
                     /db_xref="GeneID:55994862"
     mRNA            complement(join(<1686777..1688916,1689002..1689773,
                     1689827..1689915,1689964..>1690433))
                     /locus_tag="TRUGW13939_07369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490510.1"
                     /db_xref="GeneID:55994862"
     CDS             complement(join(1686777..1688916,1689002..1689773,
                     1689827..1689915,1689964..1690433))
                     /locus_tag="TRUGW13939_07369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346403.1"
                     /db_xref="GeneID:55994862"
                     /translation="MDPLSITASLIAVIQITTVVSSHCMQYVRSAKNTKSLILSLVQE
                     LGGLQIVLTTLRDLTDRDYCEPGDTDAESIDKTYLLPTLRKLVELEYVFKECLEKLEG
                     LKQEIAPKSEQHLSKREAFFRALNWPIKEAYTKNIMRDISEYISLFSLALTLDETTNV
                     LEIREKTFETNSIVKSLHAQRGDEIKRQHGSEIVQWLSAPDTSVDYTHALKRKTLNTG
                     TWLIEEHQYKEWKLHPGSLLCIYGTAGSGKTILSATIVEDVLSYSASNMNLAAAYFYF
                     KADDIAKRTSEGMLRSLLKQLFDRGNRSSEAVMRLFEEKNQQTPVSQLLSTFVDITFE
                     FKNVFIVLDALDECQDLGDLFDMIEEINERAGTNVHILFTSRDTKDIKEFADGMESKT
                     SSIKLSASVVKQDIRTYIRDRLRTDRALKRWRSHPKVQGQIEDSLIEKSDGMFQWVMC
                     QLEELTNCRGPADLRQALARMPKGLNDTYAHIISRISDDNHEVAMRMLYWLLFSVRPL
                     HIEELAELAVMDLNAEPFDELERFWEPEEVLAICPGLLTTVEEGSDGSGKEPKTLVRL
                     AHISIREYLLSDSILKGEVARFHVDEPAAHTSITECCLMYMRLTKSDFPDAVDDLPLA
                     LYAGQNWTYHYEMVPETAIKTHHLVLDFFQDRKEIYSKWITYISSLNPPRLNPNLVTS
                     AGLSPLEVASAYGFPETLKLMFDSEKIDTKSTLALQGALRAAYRGTTPPREDVRTRTV
                     RQLLQYGANFTGDGKFASTLHAASYYGFDEIVSKELDDGIDVNRQGGEFGTALRAAIA
                     GRYGCNFHKVMSTMSSSPDRVASFDGISLKAVQVLLERGADPNIHGERNGSALSESCS
                     NGDLLGVRLLLNYGADPNFVQKDDKKPHISCLSAAAASGNIQMVQLICDNGGRVDCSM
                     ALNAAASRGRIDMVRFLLEKGANPNTADRLRDETLLQHACSLYQPEIVKLLLQHGVNP
                     DEGGGRFGSPLQCTCAAYGSVETLKLLVSYGADVNQFCGAFGTALHAAAFYGDLEMVE
                     YLVSQGADIHAKGCMYTSVVRCAMQNGHGSILSFLLKLGADMDTDGGRYGETLQKTLA
                     TAPADETELWFRTFAKDDLLQLVTMTKKGNTWQDFENIELDDRSANGVHIDDSKWACI
                     LPLAVKTPAG"
     gene            complement(<1691179..>1691842)
                     /locus_tag="TRUGW13939_07370"
                     /db_xref="GeneID:55994863"
     mRNA            complement(join(<1691179..1691313,1691383..1691529,
                     1691588..1691672,1691724..1691739,1691827..>1691842))
                     /locus_tag="TRUGW13939_07370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490511.1"
                     /db_xref="GeneID:55994863"
     CDS             complement(join(1691179..1691313,1691383..1691529,
                     1691588..1691672,1691724..1691739,1691827..1691842))
                     /locus_tag="TRUGW13939_07370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346404.1"
                     /db_xref="GeneID:55994863"
                     /translation="MSAWDGYLTEHVVGSGHVDKALLIDQTGQAVWGKGSEVEMTPQE
                     MNSLAFAFNDASTAQKEGILVEGEKYILTTILDIDNIPIMHCPKGKQGIIAAKCTTSI
                     LVTHYNESTPAQSALSHVVGQAKHLIGYKL"
     gene            <1693935..>1695606
                     /locus_tag="TRUGW13939_07371"
                     /db_xref="GeneID:55994864"
     mRNA            join(<1693935..1694723,1694779..>1695606)
                     /locus_tag="TRUGW13939_07371"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490512.1"
                     /db_xref="GeneID:55994864"
     CDS             join(1693935..1694723,1694779..1695606)
                     /locus_tag="TRUGW13939_07371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346405.1"
                     /db_xref="GeneID:55994864"
                     /translation="MGIFGKWRGNPATEISQPTLTFTDAAPRDDLHRLGQLKSPDPKS
                     TDLKSPTTTKRMKEFQEAVQAFDFTVTEPPERLEAEDPFDDMKGGCMIGIALGSPSML
                     PQPLSPPRFKPVEWDTITSGLPTENPEPLGTLRRKPSKWKKLGGLFKSKQDDKRGVDE
                     PFYQLDMNIQEARQESRARTRDISQQTPFPKVENDMPYIEPNPHFIGSQQKTRNDSLL
                     EIDIPTVEMERYSVMFSGVLGKKPDTSLMARRNKALDDIRTQRTEDEYLKPHRPRRAT
                     SPGPASPTSFSLVLENANEPLSKDQNANSQPVLQSPRRSNTFPLEAPTTKNKSDTLAV
                     PDLTPALSTSTSTDLSPMDVSPTTMEVPLITHIVPNPAKSYVQEPTWEMITRKSDSTT
                     STAKPAHVPSTATPPKRPKYVTANTNPTYPVHAGPMFPPRSSSHENDILAERPHRSRA
                     QTMPTSPLDTDKPQPTAPKPNIVISTARSVSVSRRGPRAPPARPSVDRFESSKERFGE
                     HQKLTPTVVDIRRGSNHQHKKSENAVIESL"
     gene            complement(<1695898..>1701894)
                     /locus_tag="TRUGW13939_07372"
                     /db_xref="GeneID:55994865"
     mRNA            complement(<1695898..>1701894)
                     /locus_tag="TRUGW13939_07372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490513.1"
                     /db_xref="GeneID:55994865"
     CDS             complement(1695898..1701894)
                     /locus_tag="TRUGW13939_07372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346406.1"
                     /db_xref="GeneID:55994865"
                     /translation="MTDIASLQSQWLLQLSEMQQSIADLKLTERAKSFDLTSTAEIDL
                     DFEDDDYSSGTVDDIWDVISSDEESDDFDEINGVSLVSEADSYSYVWLETKCQQLASQ
                     GSGLDSGEIRDQITALLASDAGDDELQMSLAEIVGFDNLDLVIDLITHRHEILSSRTT
                     KSTVQTDGLIAGKLQSLAEREQALHRQDYQHKHTPLAAAQTREEPKYPHVYKIHDSRN
                     MLSLGGKKYGLPMGSEQSEQPKYTEISVPASRHASPVGPNQKLVQISSLDGLCRGTFK
                     GYKSLNRMQSLLYDVAYKTSENMLICAPTGAGKTDAAMLTILNAISKNIAPSPLEEPD
                     ATEFVVQLDDFKIVYVAPMKALAAEVTEKLGKRLAWLGIQVRELTGDMQLTKREIVET
                     QIIVTTPEKWDVVTRKSTGDTELVQKVRLLIIDEVHMLHDERGAVIESLVARTERQVE
                     STQSLIRIVGLSATLPNYIDVADFLRVNRMAGLFFFDQSFRPVPLEQHFLGVKGKAGS
                     KQSRENLDAVAFEKVRDMLERGHQVMVFVHSRKDTVLTARTFKQMAAEEQCEDLFTPE
                     QDTEGYSQAVKDLKSARARELRDLFAAGFGAHHAGLTRSDRNLMERMFAEGHIKVLCC
                     TATLAWGVNLPAAAVVIKGTQLYSAQEGKFVDLGILDVLQIFGRAGRPQFQDTGIGFI
                     CTTHDKLHHYLSAVTSQQPIESRFSGKLVDNLNAEISLGTVTTVAEAVQWLGYSYLFV
                     RMKREPRNYGIEWAEIRDDPMLVQRRRELIVNAARTLQKSQMIIFNERTEELRAKDVG
                     RIASQFYVLQTSIEIFNEMMRPRSGEADVLRMISMSGEFDNIQARENESKEIQRLRDE
                     VIQTEVEGGNDSPHAKTNILLQSYISRAKLEDFALVSDLAYVAQQSARICRSLFMIAL
                     NRRWGYQCQVLLSMCKSIEKQIWPFQHPFHQFDLPIPILKNLDDKLPTSSVESLRDME
                     PAEIGQLVHNHRMGNTLTKLLDNFPTLSVEAEIAPLNRDVLRIRLSLYPDFIWNDRHH
                     GASEGYWIWVENSDTSEIYHHEYFILSRKKLHDDHELNFTIPLSDPLPAQIYVRAISD
                     RWLGAESVTPVSFQHLIRPDTESVYTDLLDLQPLPISALKNPLLEEIYGQRFQYFNPM
                     QTQIFHTLYHTSANVLLGSPTGSGKTIACELAMWWAFREKPGSKVVYIAPMKALVRER
                     VQDWRKRLTAVMGLKLVELTGDNTPDTRTIRDADIIITTPEKWDGISRSWQTRGYVRQ
                     VSLVIIDEIHLLGGDRGPILEIIVSRMNYIASQSKGSVRLMGMSTACANATDLANWLG
                     VKEGLYNFRHSVRPVPLEIFIDGFPEQRGFCPLMQSMNRPTFLAIKNHSPEKPVIVFV
                     ASRRQTRLTAKDLINYCGMEDNPRRFVRMSEEDLQLNLSRVKDDALREALSFGIGLHH
                     AGLVESDRQLSEELFANNKIQILVATSTLAWGVNLPAHLVVVKGTQFFDAKIEGYRDM
                     DLTDVLQMLGRAGRPQFDNSGIARIFTQDSKKAFYKHFLHTGFPVESTLHKVLDNHLG
                     AEVSAGTIVTKQDALDYLTWTFFFRRIHKNPSYYGLEISADEHNSIAAQQIASDFMID
                     LVDKSLGELAESSCVILDSATGEVDSTPYGKIMSYYYLSHKTIRYLMSNAKRDPTFQE
                     ALAWMCSATEFDELPVRHNEDLINAELARNLPLSPEPMGDLPMWDPHIKAFLLLQAYM
                     SRVDLPISDYVGDQTSVLDQGIRIIQASIDVLAELGYLPACRMMMTLLQCIKSARWPE
                     DHPLSILPSIEPDTIKPKTGLPDTLVALTSTRAPALIQKLNTISPRLSISQVDKIIST
                     LPRISISLADISPTGMSLTLTRQNPSSTPDFKIYAPRFPKPQTEGYFLIITGETNGEL
                     IALKRVSWSSKNNGGNNNRNRNVSKKSHGPVVMARATVKFQDDPAYASGSVRKVNVRV
                     ISDAYVGMEWTLNGIEVPIVDVAGPSSGAKTVEVDAQVEK"
     gene            <1702256..>1703435
                     /locus_tag="TRUGW13939_07373"
                     /db_xref="GeneID:55994866"
     mRNA            join(<1702256..1702276,1702333..1702391,1702443..1702484,
                     1702541..1702563,1702614..1702661,1702726..1702784,
                     1702833..1702867,1702923..1703096,1703152..1703183,
                     1703233..1703304,1703355..1703372,1703419..>1703435)
                     /locus_tag="TRUGW13939_07373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490514.1"
                     /db_xref="GeneID:55994866"
     CDS             join(1702256..1702276,1702333..1702391,1702443..1702484,
                     1702541..1702563,1702614..1702661,1702726..1702784,
                     1702833..1702867,1702923..1703096,1703152..1703183,
                     1703233..1703304,1703355..1703372,1703419..1703435)
                     /locus_tag="TRUGW13939_07373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346407.1"
                     /db_xref="GeneID:55994866"
                     /translation="MKIFYMGILRNEPSPALELASEKDLTSFSRFTRQNYEEFMMLFT
                     KTVAERTKSGQRQTIEEKSYTFHSMSRDGVAGVIVSDSEYPPLVAQQILSKITDEFLS
                     KHPRSEYANPSLPQRGLPLPQLSEYIKKYQDPSQADSIMKIQQELDQTKIVLHKTIES
                     VLERGEKIDSLVAKSDGLSSQSKMFYTQAKKQNSCCVVM"
     gene            complement(<1703677..>1704298)
                     /locus_tag="TRUGW13939_07374"
                     /db_xref="GeneID:55994867"
     mRNA            complement(join(<1703677..1703869,1703928..1704099,
                     1704184..>1704298))
                     /locus_tag="TRUGW13939_07374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490515.1"
                     /db_xref="GeneID:55994867"
     CDS             complement(join(1703677..1703869,1703928..1704099,
                     1704184..1704298))
                     /locus_tag="TRUGW13939_07374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346408.1"
                     /db_xref="GeneID:55994867"
                     /translation="MPRTDEAEHWFNAVYEAIQEVPLGSVTTYGHIAALLGYPKRARQ
                     VGVCLKHLPSNRTNAADQDDEHDERGEIYHHFHDDNVPWQRVVNSKGTISHRGPGSAQ
                     RQADALRHEGVEVSQDAMGDYYIDMHRYGWFPRRLPSEEGETDSEGEGEGEDGELFV"
     gene            <1704659..>1705702
                     /locus_tag="TRUGW13939_07375"
                     /db_xref="GeneID:55994868"
     mRNA            <1704659..>1705702
                     /locus_tag="TRUGW13939_07375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490516.1"
                     /db_xref="GeneID:55994868"
     CDS             1704659..1705702
                     /locus_tag="TRUGW13939_07375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346409.1"
                     /db_xref="GeneID:55994868"
                     /translation="MSLADYLAKNYLTADPQPNDSQRPKKKRKKTKHVAEETGGGGLI
                     IADDDPPSLRASAADINLLDDDENSPFVLGSGASRISTEFRKKKKSGWKVVGDGGGGA
                     GEDEADAILASAAAESAERQRADQMDDAPTIEDDDDDDKNGGLRMESGVRAGLQTAAQ
                     TAAMVAVQERKKRAELAAFQTALAKEGGAAQETIYRDASGRIINVAMKRAEARRAEEE
                     AKEKEERAKEALMGDVQRQQRESRRQELAEARAMPLARTVEDEDLNEELRAQDRWNDP
                     AAQFLTSKKSATSKTGKPLYKGGFAPNRYGIRPGHRWDGVDRANGFEKEWFQARARKE
                     RRGNLEYEWQMDE"
     gene            complement(<1706199..>1708190)
                     /locus_tag="TRUGW13939_07376"
                     /db_xref="GeneID:55994869"
     mRNA            complement(join(<1706199..1706636,1706696..1706930,
                     1706984..1707083,1707133..1707944,1708000..>1708190))
                     /locus_tag="TRUGW13939_07376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035490517.1"
                     /db_xref="GeneID:55994869"
     CDS             complement(join(1706199..1706636,1706696..1706930,
                     1706984..1707083,1707133..1707944,1708000..1708190))
                     /locus_tag="TRUGW13939_07376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035346410.1"
                     /db_xref="GeneID:55994869"
                     /translation="MNGGDIKQAVINKGKQMASVASAAANGNGGKKRRKGTDLKPIVT
                     NEAQDATANSSSNPAAPAQGSVASPLSHQKMPLSSRSGSSSSGEEQDATADEEDSEDY
                     CKGGYHPVHVGETYNNGRYVVVRKLGWGHFSTVWLSRDTTNGKHVALKVVRSAAHYTE
                     TAIDEIKLLTKIVQANPAHPGRKHVVSLLDSFEHKGPNGVHVCMVFEVLGENLLGLIK