GenomeNet

Database: RefSeq
Entry: NC_049565
LinkDB: NC_049565
Original site: NC_049565 
LOCUS       NC_049565            5343016 bp    DNA     linear   CON 05-AUG-2020
DEFINITION  Talaromyces rugulosus chromosome V, complete sequence.
ACCESSION   NC_049565
VERSION     NC_049565.1
DBLINK      BioProject: PRJNA645155
            BioSample: SAMN15229550
            Assembly: GCF_013368755.1
KEYWORDS    RefSeq.
SOURCE      Talaromyces rugulosus
  ORGANISM  Talaromyces rugulosus
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae;
            Talaromyces; Talaromyces sect. Islandici.
REFERENCE   1  (bases 1 to 5343016)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     A chromosome-scale genome assembly of Talaromyces rugulosus W13939
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5343016)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-AUG-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5343016)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JUN-2020) Faculty of Electronic and Information
            Engineering, Xi'an Jiaotong University, Xi'an, Xi'an, Shaanxi
            7120000, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP055902.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: NextDenovo v. 2.0
            Genome Representation  :: Full
            Expected Final Version :: No
            Genome Coverage        :: 526.0x
            Sequencing Technology  :: PacBio RSII
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5343016
                     /organism="Talaromyces rugulosus"
                     /mol_type="genomic DNA"
                     /strain="W13939"
                     /isolation_source="air"
                     /db_xref="taxon:121627"
                     /chromosome="V"
                     /country="China:Beijing"
                     /collection_date="2015-07-23"
                     /collected_by="Long Wang"
     gene            complement(<2161..>7146)
                     /locus_tag="TRUGW13939_08564"
                     /db_xref="GeneID:55996052"
     mRNA            complement(<2161..>7146)
                     /locus_tag="TRUGW13939_08564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491697.1"
                     /db_xref="GeneID:55996052"
     CDS             complement(2161..7146)
                     /locus_tag="TRUGW13939_08564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347590.1"
                     /db_xref="GeneID:55996052"
                     /translation="MYNTFFEQLEEFPIVVCRECRHAVWPSQIETHLRRAHRYVSTTM
                     RVTLADDVRTWPNIAHDPIELNIPATRTTAIQQLVAPVDGYRCQLSSHSCQYICTTMP
                     TMRQHWIKHHQWSRTRKIGQPTHMEQKQIQHEQDQACRPVQCQRLFPVKANSQYFAII
                     PETDEAVAPDGDACETLIQNMQAHWRSVQEAADRKIQAGQVDEANPWLRRTEWVKYLG
                     EFDIPDLIQSVSPPPADIDGQPSIEPEAHAIWTAMARLATISQLSVIHQIGVFVRLEA
                     IRTEQHQTRYTPLEAYQDEESIVKQVRPWQEMLMFFWRTQQPHEWTSPPYRFTRRQRM
                     AWERLVDAVRIPPTRQVSKGKVITRSGATRAPWVEEEEEEEGEEEEEEEEERDTMSID
                     SLSVDSNEPDFFNDRSDGIEKTMEETAMGRTVDVDAIFDIERPPENEEEASNITVPPL
                     SPVERACLDFCIELLNQRITRREYDSALVCAAAVLGVREGGFRTPEDYPPILSRVIKV
                     ARFMVVKKAVELSDEPEEEDAAELPSSMDHTDWDSAYGGSPPPSSPGRKGCLQWVTQM
                     MDRFMVRGSQGPTQWMLDLRTYGLKIHYNTTSAGHVQWQNGDELCYKDRQFTMNEFRG
                     MVHAVVQDARRILIDDILGCPSDAVPAIPWDRLYDDPSNNQARWSFLQDTRTQWPVDG
                     EHWMWHRIRQDPAVRRRFIQADGQGFHPARWMAYQNRITAFLEKLLVAIQFTWGQPAR
                     APELLSIRHENSPMGGIRNMFIEDGMVVLVAQYHKGYQLSGDVKIIHRYLPREVGELL
                     VWYLWLVQPFERVVSGNIYQRDQVSSHIWTAHPHQAKWNSERLRHILQRESAMGLRGQ
                     SLHIASYREVAIAISRRYLRNKYRFAADDGDDPEAMDEVQLLADAADRQAGHDPHTAG
                     GIYARESRELFGAMASMRERYRGSSQDWHTWLGFASCQPPSDPDADPFSAPPASSTSW
                     FTDEAQRSREERWQRMQRMDVDQALRDMMGPDAAFRGPQKQIVQAVIQGQSPVIGVMP
                     TGGGKSLLFMLPAWMARGGTTVVIIPLVSLRDDLQRRCAELDIQCVAWNNRQPADGAS
                     IVLITPESAVRDETFSTFLNRKQFTGQLDRIVIDECHIALHDQYDFRKSMTQLGQLVR
                     YRAPMLLLTATMPREDEERLCQRMYFPPSTVHWIRARTSRHNIAYRVVRIARPQEHGR
                     RGDVGAAIMAWIEQEIPRYSPGKVVVYANSRHQTEQVAEALGCGAYHSHTIDRAGMLS
                     TFRQTPSGVIVATSALGMGIDIPDIRCVIHVGRPRSLLDYAQESGRAGRDGQGSTAVM
                     VLDGSGGGWGDPVTDRDAGSLRALEQVQRYIDQPCRRGVFDPYLDGEVDGYQRQQCEE
                     GEAACDGCCAAAIPVETQATSPTTQSETPAISPARRVQVQARSPVPAPARSPKRKLSE
                     AFTMVTMPHARRRGYNEPWEQLRSHIEREARTVDSIREHFDRWVGRCRICAMHEAPSE
                     HFTYQCPRAEGQQAAAWIEETIRKVTGNQREDGRNGYEDYAVCFQCHSPQWICPRWVR
                     VDHGGYQRTKEACRYLETAAHTMAQLLHGPMREVIQPAWERRLAQMPGGGVPHENQAA
                     LIRHFQRKFGKRGEERSGLVEEMTWMCSWVDDTMQVDVESSEDSNSIISHM"
     gene            complement(<7689..>8312)
                     /locus_tag="TRUGW13939_08565"
                     /db_xref="GeneID:55996053"
     mRNA            complement(join(<7689..7862,8019..>8312))
                     /locus_tag="TRUGW13939_08565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491698.1"
                     /db_xref="GeneID:55996053"
     CDS             complement(join(7689..7862,8019..8312))
                     /locus_tag="TRUGW13939_08565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347591.1"
                     /db_xref="GeneID:55996053"
                     /translation="MRSGATRAPWVEEEEEEEGEEEEEEEEERDTMLIDSLSVDSNEP
                     DFFNDRSDGIEKTMEETAMGRTVDVDAIFDIERPPENEEEASNITVPPLSPVERVARF
                     MVVKKAVELSDEPEEEDVAELPSSMDYTDWDSVYGGSPLPSSPGRKGCLQWVT"
     gene            complement(<31404..>31766)
                     /locus_tag="TRUGW13939_08566"
                     /db_xref="GeneID:55996054"
     mRNA            complement(<31404..>31766)
                     /locus_tag="TRUGW13939_08566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491699.1"
                     /db_xref="GeneID:55996054"
     CDS             complement(31404..31766)
                     /locus_tag="TRUGW13939_08566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347592.1"
                     /db_xref="GeneID:55996054"
                     /translation="MITQSRATRAPWVEEEEEEEEEEEEEEEKEEEEKERDTMSINSL
                     SMDSNEPDFFNDRNNRIEKTIEEIAIERTVDVDTIFDIKRPPENKEEASNITILPLSP
                     MERAYLDFYIKLLNQHII"
     gene            complement(<46063..>48016)
                     /locus_tag="TRUGW13939_08567"
                     /db_xref="GeneID:55996055"
     mRNA            complement(join(<46063..46109,46172..46300,47032..>48016))
                     /locus_tag="TRUGW13939_08567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491700.1"
                     /db_xref="GeneID:55996055"
     CDS             complement(join(46063..46109,46172..46300,47032..48016))
                     /locus_tag="TRUGW13939_08567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347593.1"
                     /db_xref="GeneID:55996055"
                     /translation="MVRPVSMGEDRQGPVQEAQADPMGANESSEAPGRRLTFGLEDLE
                     LDEHLSPTQMNEQEFLSLCRTDPQRLFDRMYEQQDKSAQQAEDLRIQNEKEQQSLMVE
                     VANLKQTIRDQTAAMRELIEERDTAQDRADRTGWGTPAPEGKHTKSTKLPDGQVLVDG
                     KDPKFESWLIDVEGKLEANADHYPTAQARMAYVKSMCKGEAANHLLARMRKDSPDRYH
                     DVDDIFDHLRTLYQDANRVINAKMELRRLMMRDTKFQPFLSQFVLLAQDAGLATSEWK
                     EDLFYKLSFELQRAMIKESNDPRVSYQEFVKECSTTANRLEQINTSEKRARPHLFIPK
                     AILSRPKKVSTEHQKDADRRDGLFNEEIRQEATGEALSRGVGKDEPTVEQRA"
     gene            complement(<54715..>57328)
                     /locus_tag="TRUGW13939_08568"
                     /db_xref="GeneID:55996056"
     mRNA            complement(join(<54715..55247,55300..56743,56801..>57328))
                     /locus_tag="TRUGW13939_08568"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491701.1"
                     /db_xref="GeneID:55996056"
     CDS             complement(join(54715..55247,55300..56743,56801..57328))
                     /locus_tag="TRUGW13939_08568"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347594.1"
                     /db_xref="GeneID:55996056"
                     /translation="MSQSQLSDFTSSLYSGDIDDLPSLSTQQITPSASHHTIDSGFHR
                     PDDLLVPPSLIRVGPDRRNRFVLYDKMSHNEFIDWWLQTDYGRKRKINWDSHRHTVIW
                     NSYNQVAEGVDGTPKVMCKRCGKILEHPYSLSLNSSGKAQYHGTSTIQKHLKTAGCLR
                     SEKGKKAEITKFLQKEGEISADIPFLQEDWEDDILQFLTLNRLPFHLIEHPSFKRIIY
                     KARSALVAPVIPSADTIRRRLGSLVKDRQQRVLRTLPAGSKISIALDCWTSPFSQAFM
                     AITGYFIDSDWVYREVLLGFKPLHGTHTGSYLSGVLMETLVENNIEDRVFGLTTDNAS
                     NNKALAASLQQALSDGVIITRIPCLAHVIQLSLNQLLVRIKAVPSNESAETKWTESQS
                     RLVQENAKQCQISSTLNKVRYLAIYINASPQRRETFYNLQTTNVKIVPIQDVKTRWNS
                     TFLMLRRAKRLRAIFSLFCAEYDCEEMLLSEHEWRQIDYLLCITEPFFDYTTQLSKTR
                     DVTAHYVFKIYNRLFDHLERSQTQLQRKRVPWKKQMLDALDAGRTKLDEYYAQTDTIR
                     GHIYAVSTMLAPVNKFRFFLSSDWDQKWRDIYRNAFQQALIPYQAQVKSQSQDAYSSH
                     TAAQPSSRLEEMLDGKDIQPRAMTDEISQYLDSDTVSVGPLIFWKEHQYRFLAIAALA
                     RDALSFPATGAGVERLFNTARDVCHYRRGRMKTETIEELMMFLCTSKFDIEAQEAKLL
                     EKFFSQDELEAAKEEREEKLNKDEINPISDTEEQEDELENGPENEMEDIGLDTTSLSA
                     AEPDSPGSPSLPPTCTQTRVSGRKRKSREDDIFEYH"
     gene            <59797..>60564
                     /locus_tag="TRUGW13939_08569"
                     /db_xref="GeneID:55996057"
     mRNA            <59797..>60564
                     /locus_tag="TRUGW13939_08569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491702.1"
                     /db_xref="GeneID:55996057"
     CDS             59797..60564
                     /locus_tag="TRUGW13939_08569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347595.1"
                     /db_xref="GeneID:55996057"
                     /translation="MANFYADLYSQTAIPKNKTALQTHVRNTNGCPPSAKQGDGNDCW
                     NLGVDYTMPYVQNYTESDVVNPKDVVTAANANATDLLGQIGDILGAMKAGLFQGDFTD
                     VVDSISIPIMMINSSIAEMATIEHVADEITNEKRMEIIMAFFGAILFLVPIAGELIGS
                     VTELAEIGEIVSAVGAVGNTAFDIYSVASDPHNAPLAIMSAIFEPLALLDIAKVAKAA
                     SIRRGMSDVDVAKLGNQVKPVLDTIFAIKSGSRCVRK"
     gene            complement(<62155..>62523)
                     /locus_tag="TRUGW13939_08570"
                     /db_xref="GeneID:55996058"
     mRNA            complement(<62155..>62523)
                     /locus_tag="TRUGW13939_08570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491703.1"
                     /db_xref="GeneID:55996058"
     CDS             complement(62155..62523)
                     /locus_tag="TRUGW13939_08570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347596.1"
                     /db_xref="GeneID:55996058"
                     /translation="MYAPKTLAAVLAVLASVASATPAANTTAPITNFSLVNINTTHGG
                     GCALEIETEFDGGCKGSAVVDAGPYCSEIGAYRAGESSVCNGTVNADFSKSPPKVEFV
                     VWEEYVAYCFVGDGSKCTSK"
     gene            <66030..>67042
                     /locus_tag="TRUGW13939_08571"
                     /db_xref="GeneID:55996059"
     mRNA            join(<66030..66164,66209..66218,66312..66530,
                     66759..>67042)
                     /locus_tag="TRUGW13939_08571"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491704.1"
                     /db_xref="GeneID:55996059"
     CDS             join(66030..66164,66209..66218,66312..66530,66759..67042)
                     /locus_tag="TRUGW13939_08571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347597.1"
                     /db_xref="GeneID:55996059"
                     /translation="MVVGGPSHGVGIAGEYIQGGGHSLLSAIAGMAFDNELKFTVGTA
                     DLLQVTVQAFDELPFISFSLAGFASFGAEGYWKAVERFHVFLPKFSLADGSMYYWLMP
                     DLEDSSFGHVSEMTASGGFVTVALRSLRIYSGNTVQGQNVVQGLVVAGPAVWANADKI
                     DSALHPIWRKALLQIVLALEWNDGTSIADQREIQKNLIEVEIPILKKPVRTAART"
     gene            complement(<67496..>69271)
                     /locus_tag="TRUGW13939_08572"
                     /db_xref="GeneID:55996060"
     mRNA            complement(<67496..>69271)
                     /locus_tag="TRUGW13939_08572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491705.1"
                     /db_xref="GeneID:55996060"
     CDS             complement(67496..69271)
                     /locus_tag="TRUGW13939_08572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347598.1"
                     /db_xref="GeneID:55996060"
                     /translation="MTTTQVVGESPDISSTDLPVHTGKKQPAEYDLGQCIAAIKGEKV
                     PSDVTSFWHRRAVIRGIRDSLQFATSPAIIELCSGEDSQAHQFSRARNARLIMSNIIP
                     NMQHPATEPYCIWYPEPASEETYRELARRYPSMRYQVGRACAAAWYTNLYKELDLLPD
                     VSIAEEARNAAEDADIYKIIMSAPQRWAVMDDFTRSVNLESPQAPAFLNGNMKPRRAL
                     ARRVLPPKNLPDTTADDIDIEEDGFIGLKEKASKVDRDAKLGPGDSEHLWMPLPSDLP
                     VLDKRLPTQMAAWEGNVDRYARLMHPRRLRTETEYSCILRGIYHHTSFARWWTNQLET
                     NPRRIILPGKLLSEGNERECREILTAINARKIMNNDISDLEDDSECLPWLIWWPVRPH
                     EDTLRELASKCPSMRHQIAITAILCDYKSLFRSLRPPPRESFFEAAKQSRTPFYLKYL
                     EEFVRERSIGNREISEFGPYDTTVEASLQPDLEPRDSFAHSSIQFSDMVVPRGQHPRD
                     EWGSPGIYGGQPADPGIVERYMWLSTETAQKIEDESSGIYNDSADTSYLYIEDDDSDN
                     ELWLKLSRPLKRMTSFEMKDSEDES"
     gene            <73655..>74212
                     /locus_tag="TRUGW13939_08573"
                     /db_xref="GeneID:55996061"
     mRNA            <73655..>74212
                     /locus_tag="TRUGW13939_08573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491706.1"
                     /db_xref="GeneID:55996061"
     CDS             73655..74212
                     /locus_tag="TRUGW13939_08573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347599.1"
                     /db_xref="GeneID:55996061"
                     /translation="MTAPATRQEVERVVAALSPQVGEIASLFPEKMVKWGIYDMYDHP
                     APKFAQGLVCIARDADHASSPHQGAGACIGAEDALILCEVLNTAQTSMTLNSGLDEQE
                     HEQERVIFCRSTVERALNAYSETRKERSQWLVRSSREMGEMYQWRYGPTGRDYQRCHE
                     KLEQASRVCPGEHLDVESVDAWVRL"
     gene            <75382..>77135
                     /locus_tag="TRUGW13939_08574"
                     /db_xref="GeneID:55996062"
     mRNA            join(<75382..75385,75436..75919,75965..76554,
                     76615..>77135)
                     /locus_tag="TRUGW13939_08574"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491707.1"
                     /db_xref="GeneID:55996062"
     CDS             join(75382..75385,75436..75919,75965..76554,76615..77135)
                     /locus_tag="TRUGW13939_08574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347600.1"
                     /db_xref="GeneID:55996062"
                     /translation="MAVTLATAHLGLFRWLNERRVDQTIDQPYVTALSLVFVNGFRMF
                     LAASLGISFIQIVWKILRHKPMRLSDLDRLLSILGNPLQLGCVNLISRTPIPFLCALV
                     FWCLPIAMIFPPSALTVESRMFTTVSEQLVPMVDPGFIGNNTYQGMLANALWASDNLG
                     NYGSPSNKASRVARQAILAGSYITSPSPCGQNCSYSIDISGPSFQCNDTVSPDLATWV
                     NGTYPQYDAFEYVYLASQNSHVLTYPSWEFIFELQWSSANTRGYQNLSCTAYEALYSF
                     QIRYLNGEQTVTMTNVQHITKLNASHFYGDYGLQPVDGGPKFLVNSSSVSLEGGNITD
                     INRRMNIAAIQDTLVDAFSGYIDRLILHTQQPANTIIELSELYSGPATAPVFDISAAT
                     MQNLLQNITISMLSLNQTTIRTNVTQSTGVNVYSFSDQARLVLPYFIVLLISLLFIIG
                     GGFALVSNGISASTGGLFQTLCTTRGSDRLGDLAAKGCLGGRENVPDDLKDLKVMFGV
                     LKNRSRMAGLGTQEEVVPLIKGGF"
     gene            <78749..>80129
                     /locus_tag="TRUGW13939_08575"
                     /db_xref="GeneID:55996063"
     mRNA            join(<78749..79016,79078..79201,79274..79716,
                     79816..>80129)
                     /locus_tag="TRUGW13939_08575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491708.1"
                     /db_xref="GeneID:55996063"
     CDS             join(78749..79016,79078..79201,79274..79716,79816..80129)
                     /locus_tag="TRUGW13939_08575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347601.1"
                     /db_xref="GeneID:55996063"
                     /translation="MDALVDHVRSVAKTSSDSQRKEILNQLRTLAHSLETSDDTIQRL
                     TFSWLELAVVYIGIDLKLFSHLIESASPLSVAQLSEKTEASPALLARILRYLASIDAI
                     QETDKDTFAANNITDTLSTIAAEAAIHHYFESMNPAIAELPGLLKDLKYADPEDNTNT
                     GIQRAFKTDLPAFLWLQGDAEKVSYFQTYMATVRFGDKPTFLDKYPVEEKITNLSPDR
                     PLFVDVGGGFGSQAVAFKQKYPNLPGRIIFQDLPQTVEQVATPPGVEGVPYDFFQPQG
                     IKGAKFYYLRNIFHDFPDDKSRLILKNLIDALADDSLILIDDMVLPNKGAHWHTTQID
                     LLMMATLASRERTEEHWHKLLGSVGLKISNVYTYTDPFRDSIIEVIRA"
     gene            complement(<82663..>84140)
                     /locus_tag="TRUGW13939_08576"
                     /db_xref="GeneID:55996064"
     mRNA            complement(join(<82663..82905,82958..83321,83391..83447,
                     83501..83655,83710..83754,83810..83816,83888..83938,
                     83993..84030,84087..>84140))
                     /locus_tag="TRUGW13939_08576"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491709.1"
                     /db_xref="GeneID:55996064"
     CDS             complement(join(82663..82905,82958..83321,83391..83447,
                     83501..83655,83710..83754,83810..83816,83888..83938,
                     83993..84030,84087..84140))
                     /locus_tag="TRUGW13939_08576"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347602.1"
                     /db_xref="GeneID:55996064"
                     /translation="MFPGGSDDSVTDPFLDVQNAESDGDSAFEEGDINSLTTSISSSV
                     FAYVYENGRRYHQLREGNYIFPNDEKEQDRLDMLHHVYRLVQGGRLHVAPISNPQRVL
                     DMGTGTGLWALDFADEFPEAEVMGLDVTPIQPQWAPPNCRFIIDNLEEDWDYPESQHF
                     DYIHQRSMAGSIGSWPRLYQQALQNLNPNGWIEIQEFDVWFYSQVSGGLPEDSPITKW
                     QKMIDQGSQSLGRRLNYASKLAKHLEDAGFVDVQIQVVKTPIGTWPKDPKLRELGAFL
                     QVQMNEALEAVTLGYFTRVLGWSDLETQVMLAHVKKEFNDRSKLLYTFCRFITGRKPG
                     KSI"
     gene            <84543..>87311
                     /locus_tag="TRUGW13939_08577"
                     /db_xref="GeneID:55996065"
     mRNA            join(<84543..84610,84774..85177,85225..85436,85505..86177,
                     87122..87228,87282..>87311)
                     /locus_tag="TRUGW13939_08577"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491710.1"
                     /db_xref="GeneID:55996065"
     CDS             join(84543..84610,84774..85177,85225..85436,85505..86177,
                     87122..87228,87282..87311)
                     /locus_tag="TRUGW13939_08577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347603.1"
                     /db_xref="GeneID:55996065"
                     /translation="MVFLLAKTEGDSLVDFSPKWLSLYEFYYDVIKAGQYIWKIRQLH
                     DQYGPIIRINPEEVHIQDANFYDEVYTGATHKRNKWSFFTNQSGLTSSAFATNDHDLH
                     RMRRGALNPYFSKQKVRQLQPRIEKSLKNLLGRVDDFRISGEPLMVGLAYAALANDIV
                     MDYALGRSENRLLAPDFDPSFKEAGEAGAKLGHLVKQLPWLLQIMKILPDNMQVILNP
                     VMASFIKLNQDVIRHVARIYSHRHDPHNQYNSQTTVFHEILQSDLPEHEKMPTRLWQD
                     GQVTVIAGTLTTAAALSEITFHLLDQPMHLRKLKTELDTVTSGSGQLPEMAKLEQLPY
                     LTAVIKEGLRLSSGISTRLQRIATEETLVFTARYPGGIDGNTIEKKYTLRPGIPLSMT
                     GLLIHHSPTYFEDPMTFWPQRWLEDKSLDKYLVPFSRGTRSCVGINLAYAELYLTIAT
                     VFGFRFKDGRKGTADWGARSHFTKADGYLKMDFYQVYLDSAATARAK"
     gene            <90488..>92492
                     /locus_tag="TRUGW13939_08578"
                     /db_xref="GeneID:55996066"
     mRNA            join(<90488..90796,90880..91292,91376..92106,
                     92194..>92492)
                     /locus_tag="TRUGW13939_08578"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491711.1"
                     /db_xref="GeneID:55996066"
     CDS             join(90488..90796,90880..91292,91376..92106,92194..92492)
                     /locus_tag="TRUGW13939_08578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347604.1"
                     /db_xref="GeneID:55996066"
                     /translation="MSRSTPPPPLPEDGKIERTGEKKYQVGPEKEKHTDVDSNEISTV
                     TSSTANGVEKLHIPEDDGPATEEKGVEEPQKAVEYPKGLEMFFIMLALVLSITLCSLD
                     QTIVATAIPKITDQFGRLQDISWYGSAYFLTLGGFQSLWGKVYKFFPLKTSFLVSILI
                     FEVGSLISAVAKNSTTVIVGRSIAGLGASGVAPGVYTISAFAAEPAKRATYTGFIGMS
                     YGIAAVAGPLIGGALTDEATWRWCFYINLPTGGLAALVILLTFKAPATAKRVDATLKE
                     KLLQMDFLGTALIIGASLALLLALQYGGVTHPWNSSVVIGLFVGFGVMVIALIIIEIW
                     QGERAMLTPRLMRQRTVWVNSVWGFFFAGAYFVTLYYLPIYFQSIDNRSPIASGVRNI
                     PLISLFSVSTFASGRAITKTGTAAPYLVTSSVVVTISAGLLYTLDIGTSTGKWVGFQI
                     LAGFGYGMGLQIPVIIAQAFAAPTDIALVTAIIIFARSIGSTFLIAAAQAAFDNQLVH
                     KIASTAPSVDPSLLTTTGATTLRQVFSGAELDGVLRAYAWSIKVVFAITIASCGITAI
                     TSLCTKWTNINAKKPSA"
     gene            complement(<93008..>94661)
                     /locus_tag="TRUGW13939_08579"
                     /db_xref="GeneID:55996067"
     mRNA            complement(join(<93008..93672,93727..93915,93986..94550,
                     94602..>94661))
                     /locus_tag="TRUGW13939_08579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491712.1"
                     /db_xref="GeneID:55996067"
     CDS             complement(join(93008..93672,93727..93915,93986..94550,
                     94602..94661))
                     /locus_tag="TRUGW13939_08579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347605.1"
                     /db_xref="GeneID:55996067"
                     /translation="MDVLNAALSRFSPTAAPCFLKNQATGQIWPTNPIQVAAVDFLYR
                     MVKAVKAQKNYEFWRDNIFGTSGRWTVEARILNERTIFTADPGNIKAMLATQFSDHGK
                     GPDYHAMWKDFLGNSIFATDGEMWSASRKLVRPQFTRDRLSDLECFEAHMQTLFRVLD
                     AADSLLGSKHAEGIPMSEEKVIDIRDLFYRFTFDVQPTSYLDRTSNRSQFAHAFDEVQ
                     RMQTIFVRSRQFSKFISKKTFRVSLNLMNGFIYNYVRRALSLSPQEAQQKSQSVLRDQ
                     IVGVLLAGRDTTAATLSWALYELSRQPEAVALLRSEILQTVGSDAPTYDQLKNMPYLK
                     ALLNETLRIYPAVPYNVRVALEDTTLPYGGGSDGSEPIAILKNTKIAYSTLILHRRRD
                     LYPATSEKFADPTIFSPDRWQHWHPNPHDYIPFNAGPRICVGQQFALTEMPYVLCRLF
                     QRFEKVESHMQQIDGGDPTLKADIILSPGDGVWVSLNTPRQR"
     gene            complement(<95253..>98181)
                     /locus_tag="TRUGW13939_08580"
                     /db_xref="GeneID:55996068"
     mRNA            complement(join(<95253..95557,95618..95710,95789..96464,
                     96760..97281,97336..97694,98145..>98181))
                     /locus_tag="TRUGW13939_08580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491713.1"
                     /db_xref="GeneID:55996068"
     CDS             complement(join(95253..95557,95618..95710,95789..96464,
                     96760..97281,97336..97694,98145..98181))
                     /locus_tag="TRUGW13939_08580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347606.1"
                     /db_xref="GeneID:55996068"
                     /translation="MNYWINTHLYLKLSQVDTKLVGPYVIPNAVAGFDFAGTVDELGP
                     EATKCGLKVGDRVCSAVVGMNPADPTIGAFAQYTAAVEWILLKLPHSLTFEEGATLGI
                     SFLTSGLALFKRLGIIGRPLELAPKPLCVLAGHVPITTCSPNNFELVKSYGAVEAFDY
                     NNPDSIDQIKKYTKNGLRYVLDCISTTSSMQYCYKAIGRPGGKYTSLEPFFAAVAQTR
                     KVISPDWVMGPSLLGQEVAWPEPHYRKQDDELAQFGAYWTARLNLLLEKGLIKPHPIQ
                     VRDKGLENIQQGLEELRAKKVSGAKLVYPLCALLFSTLMTGAISVPTTTQSTAMPPCL
                     PCRCQEAPTPVFGYLYQIVELGVMRLFIEKSVFDEIPDHGISITDLSVKTGIEFNLLE
                     RLVNFLISSRIFTSSPPGYIHNTPTSKYFTEKRAQLWYPHIFNVFLASAVKWPDYFAI
                     NGMREPQCSSKSPFGFSSGYPDKSVYEIFDLMPKRSSDFNATMALSLGEMPILGMYNF
                     SWIGEYGKRPDAQDRTLFVDVSGEKVIDEAKLATGTLETVRKVPIDLFQEQPVKGALV
                     YYIRRVLNDWSDAEVVRILRNIRNACVSDSKALISENLLPDEPPLKLAAIDVWMLNVG
                     GKRRNGRNFEELAARVGFKLSSIAEDDKTKSAVLELVVV"
     gene            <99457..>99936
                     /locus_tag="TRUGW13939_08581"
                     /db_xref="GeneID:55996069"
     mRNA            <99457..>99936
                     /locus_tag="TRUGW13939_08581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491714.1"
                     /db_xref="GeneID:55996069"
     CDS             99457..99936
                     /locus_tag="TRUGW13939_08581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347607.1"
                     /db_xref="GeneID:55996069"
                     /translation="MSSAPENRQHSLRSACERCRLHKLRCTVPPQQDPQLPAQCTRCT
                     RAKAKCDFKHRAPPKHRTSAIDRPFACDSTKPAAATMQSDSMSYMSSRRVELPPSAHS
                     FKTSSVWETLLDKTTPQEPRADFNSLFRPAVLFDLQSINQDEVDLSASALSTTELDF"
     gene            complement(<100976..>103474)
                     /locus_tag="TRUGW13939_08582"
                     /db_xref="GeneID:55996070"
     mRNA            complement(<100976..>103474)
                     /locus_tag="TRUGW13939_08582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491715.1"
                     /db_xref="GeneID:55996070"
     CDS             complement(100976..103474)
                     /locus_tag="TRUGW13939_08582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347608.1"
                     /db_xref="GeneID:55996070"
                     /translation="MRVLFFFATLSLVSAENGLDGWLRYAPLPYNDQKLPAHIVVLNT
                     TEASPVYVAGAELQNGLKGIYGTHAEVSHEQCENSSSAAIVGTVEQYQIACGSLNGVP
                     ELDEDGFWLSTWGNKVQILGQNERGALYGAFEYLSMLAQGNFSEVSYASNPSAAIRWV
                     NQWDNMDGSIERGYGGSSIFFKNGAVVDDLSRVTQYARLLASARINAAVVNNVNANAT
                     LLDQENMKGLGRIADALRPYGVQIGISLNFASPETLGGLDTFDPLDSSVIKWWSNITD
                     QIYQRVPDMAGYLVKANSEGQPGPLTYNRTLAQGANLFAKALHPYGGIVMFRAFVYNQ
                     LNESNWKADRAKAAMEFKYLDGEFEENVVLQIKYGPIDFQVREPTSPLFANLFNTSTA
                     IELEVTQEYLGQQSHLVYLPPLWKTVLDFDLRVDHKPSLVRDIITGRRFNRKLGGSAA
                     VVNVGSNTTWLGGHLSMSNLYAYGRLAWDPADDSQSILQDWIRLTFGLDRTVLDTITQ
                     MSMESWPAYENYTGNLGIQTLTDILYTHYGPNPASQDNNGWGQWTRADHTTIGMDRTV
                     SNGTGFSGQYPTEIAAMYENIDTTPDNLLLWFHHVNYTHRLHSGKTVIQHFYDAHYSG
                     VETAQTFLVQWDSLKGKIDDERHKAVRRQLDYQTGHSIIWRDAINDFYYNLSGIPDAL
                     NRVGHHPWRIEAESMLLDGYKQYTVNPFETAAKSIAIVTISNDTVGTATTRLNFPSET
                     YDLVVNYYDLYGGQSRWQIYLNGKQVGEWLGNSENTFSHTPSIYLDGHSATRIKFRGV
                     KINKGDTLKIVGTPDGVEPAPLDYVAFLPQGVID"
     gene            complement(<104677..>105360)
                     /locus_tag="TRUGW13939_08583"
                     /db_xref="GeneID:55996071"
     mRNA            complement(<104677..>105360)
                     /locus_tag="TRUGW13939_08583"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491716.1"
                     /db_xref="GeneID:55996071"
     CDS             complement(104677..105360)
                     /locus_tag="TRUGW13939_08583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347609.1"
                     /db_xref="GeneID:55996071"
                     /translation="MIYKAIICFERIELDADFQKHSVDPVRGVWLQHNPPVNLLALLA
                     VSRQVYDEARRVLYTFNSFVFHGKKALCVFLFGIGSHNASLLRSVKWKSDNGQYENHV
                     DTIKEYMTQRQKSAQESHSKRNKLNIWNDDNQFVEFLKIIRSPGPDEWGHTHRLLRRD
                     SEDVLTTDYFSRYIFNIHCFEGKESMRNARAAYELCSRVVKRGDPVSSAALRALGDED
                     VYRRDRERL"
     gene            <106960..>107505
                     /locus_tag="TRUGW13939_08584"
                     /db_xref="GeneID:55996072"
     mRNA            <106960..>107505
                     /locus_tag="TRUGW13939_08584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491717.1"
                     /db_xref="GeneID:55996072"
     CDS             106960..107505
                     /locus_tag="TRUGW13939_08584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347610.1"
                     /db_xref="GeneID:55996072"
                     /translation="MKLSLNTSAVLLSALLQAVSASSAHNHTKPLPSSYYHNNMNGSV
                     VGYNSCDDCGCPDDEYFVQGSCGLFTDENYKGLPDIWAISVPAAWAEEFGPIGRDNPL
                     CGSVMHVTAPNGQTVKAAIANAGDGFIGKRNSDKSPEDYGYWTVCFDLIEQLGGDINT
                     GDIDVTWTLIANETVGNKTLS"
     gene            complement(<107923..>109517)
                     /locus_tag="TRUGW13939_08585"
                     /db_xref="GeneID:55996073"
     mRNA            complement(join(<107923..108081,108210..108357,
                     108430..108756,108815..109361,109421..>109517))
                     /locus_tag="TRUGW13939_08585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491718.1"
                     /db_xref="GeneID:55996073"
     CDS             complement(join(107923..108081,108210..108357,
                     108430..108756,108815..109361,109421..109517))
                     /locus_tag="TRUGW13939_08585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347611.1"
                     /db_xref="GeneID:55996073"
                     /translation="MRTLLQVIIWSTRIFNELPSANSHISDSIKPADSVLGLETLGPN
                     NVKDAIIERLGQITPEDVASEYTKSLHPWFPVLPHAFQGQLPLSWNDASLDFTILALC
                     IIMLTCAPPSASQKENPSTFKCLYTYAKSWISLIEGFGINSIEVVQARTCMALFEAAH
                     GFYPAASISIGAASRAADALNVDPISHMTSFRSSDDAAKRKETAFLWCAIHILDRYIA
                     VESEPRVSFSRWHTNNFHEALKEELYPALLEEDLTGPVCQISRLFEASTILDKLHVIV
                     KGSTAEHIFKLDEIMLLLDTSQNLQTILLGEAEDGHEVYSGALGLSNIGLLLLYENGT
                     KVPTADEVTSACNSIAITSLNSLITTVTNTVEPFVIGTQGLFDDVERKVVVLRYFTQD
                     VLSSMFADKIGTERYLELLNEDTTRRILKSIQQ"
     gene            <109973..>110922
                     /locus_tag="TRUGW13939_08586"
                     /db_xref="GeneID:55996074"
     mRNA            join(<109973..110005,110056..>110922)
                     /locus_tag="TRUGW13939_08586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491719.1"
                     /db_xref="GeneID:55996074"
     CDS             join(109973..110005,110056..110922)
                     /locus_tag="TRUGW13939_08586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347612.1"
                     /db_xref="GeneID:55996074"
                     /translation="MPKIKKVAIAGASGALGPHVFKALADAGFEVTVLTRSKKPGAYD
                     LAIEVLEVDFTSMDSLTSALKDIDAVVSTVGGTAVDGQTVLIDAAVAAGVKRFIPSDF
                     GSVSTNPKLDKLPLYSSMANIREHLQKKAAVGELSWTVLACGAFLEFVLNMPTVIDFK
                     NHTATILDDGDNRVTSTSMPLVGTAIAAILKNFEATKNQILHISEVIWTQNQLLGFAK
                     ELQPGIKWETNKTQTSVLLKESLEQIGAGDLSMPVILKLLKATALAGDTYGGAYDVTD
                     NELLGIKELTADGLKTLVASHLA"
     gene            <113315..>115038
                     /locus_tag="TRUGW13939_08587"
                     /db_xref="GeneID:55996075"
     mRNA            join(<113315..113821,113896..>115038)
                     /locus_tag="TRUGW13939_08587"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491720.1"
                     /db_xref="GeneID:55996075"
     CDS             join(113315..113821,113896..115038)
                     /locus_tag="TRUGW13939_08587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347613.1"
                     /db_xref="GeneID:55996075"
                     /translation="MDPNIDSRKPPRPIKEGPFAEHDETAAAIQGTVDHVLDPVSYGP
                     GGLRGIYHSPYVFGTALLASLGGFSMGYDMGVISVINTMEQFHAVFPRAESGFGEGLM
                     TGMLLLGSFVGCLFMPYMADKISRKWALTVVVVIFDIGAILQTAAVNYAMLVVGRFIG
                     GIGVGTLAMGAPLYISEIAPANIRGTLLVLESVAITLGVVVAFWISFATKSMVGEVSF
                     RLPFGLQMVTATALGAGIHFFPYSPRWLALVNRLDECRSSLSKLRGLPETDERIKEEY
                     RGIVSEIQFQKFVMQKRHPGAMGIKLEIVSWLDLFSDRMWKRTAVACGVGFFQQFSGI
                     NAFIYYAPTLFSSLGQSSEKSLILSGVFDILQFIASLVCSVAVDHAGRRFLAIAGGFG
                     CSIAYIIIAVLSGLYSDDWSANVSAGWACVAMAFIFILIYGVSYSPLGWALPAEVYPN
                     TSRSKGVALATCVIWISDFIVGVVTPTMMNDIGYGTYIFFGAMCFLAGVWAFFLVPET
                     SGKTLEEIDELFGDSSGQEETQIIRENILAAAGNENISKTV"
     gene            <116317..>117248
                     /locus_tag="TRUGW13939_08588"
                     /db_xref="GeneID:55996076"
     mRNA            join(<116317..116495,116572..116849,116902..>117248)
                     /locus_tag="TRUGW13939_08588"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491721.1"
                     /db_xref="GeneID:55996076"
     CDS             join(116317..116495,116572..116849,116902..117248)
                     /locus_tag="TRUGW13939_08588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347614.1"
                     /db_xref="GeneID:55996076"
                     /translation="MSNKTSGRPEMIMANKVSDYGSMSSANVTIPHFVVIAGIFTKNL
                     ASRQRQHNFTAFKKVNTDSATVLRTAYGYTIETHTPDPLAESGDKMMIEFSMAAVPMA
                     WAVDIIPILQYLPICFPSPKFQKTARIWRKSIQSSACIPYRFVKTQMATSIITGVAKK
                     TKVLLSGQLLVFTGLPRTPSNHPHHIHLGGDQIQTCAVQGSRRNLSCYGKRPPAEDRE
                     KWPYINALVKGITRWWSIAPMGFPHTTTEDVEYNGVHIRKDAFLLPAVW"
     gene            complement(<118362..>118759)
                     /locus_tag="TRUGW13939_08589"
                     /db_xref="GeneID:55996077"
     mRNA            complement(join(<118362..118583,118676..>118759))
                     /locus_tag="TRUGW13939_08589"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491722.1"
                     /db_xref="GeneID:55996077"
     CDS             complement(join(118362..118583,118676..118759))
                     /locus_tag="TRUGW13939_08589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347615.1"
                     /db_xref="GeneID:55996077"
                     /translation="MAPLRQLLLDRKIDEAMIEDLEANLDVLLEIKEQIGKYEKGKPL
                     PKPSISLSEEQQKKYDMIETWDQYEPDRFESNIKAVEDGISKAKKRLQKTKDALACC"
     gene            complement(<120017..>121662)
                     /locus_tag="TRUGW13939_08590"
                     /db_xref="GeneID:55996078"
     mRNA            complement(join(<120017..120346,120408..121332,
                     121517..>121662))
                     /locus_tag="TRUGW13939_08590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491723.1"
                     /db_xref="GeneID:55996078"
     CDS             complement(join(120017..120346,120408..121332,
                     121517..121662))
                     /locus_tag="TRUGW13939_08590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347616.1"
                     /db_xref="GeneID:55996078"
                     /translation="MHRFKENFPTVVESSSATGWLTSILQLGGIVGSLTAGVFGEVFS
                     RKYTIPLYNAELSSPELRGLLVSFYQFATILGIMLSFWCGYGSNNIGGTGDTQSDLAW
                     RIPSIIQGIPAAILALGIWWLPFSPRWLIKHGREEAAIKTLAYLRKLPINHELIQIEA
                     KEIKAEYLFEQRVFAKKFPMLGAGEKTSVWMRELVQYWNIFRTWDNFKRVAIAWFVMF
                     FQQWSGIDSIIYYASNVFVSLGLTGGTQSLLATGVTGVVFFVCTIPAMAIIDRVGRKP
                     MLLFGSIVMWVCMVLTSIIVAKFQHDWQHHANAGWTAVAFIWIYVGAFGATWGPVSWT
                     LVSEIFPVSIRAKGASIGASSNWVNNFAVAFFVPPMFAAWEWGTYLFFAVFLTGGIVW
                     VWFYLPETKGTTLEEMDRIFESHSGEADARMLADARKDVGLDQDMVDRAVSAAATAVK
                     RKPEAKHYLKPLRLFE"
     gene            complement(<125094..>126790)
                     /locus_tag="TRUGW13939_08591"
                     /db_xref="GeneID:55996079"
     mRNA            complement(join(<125094..125993,126053..126155,
                     126408..126512,126582..>126790))
                     /locus_tag="TRUGW13939_08591"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491724.1"
                     /db_xref="GeneID:55996079"
     CDS             complement(join(125094..125993,126053..126155,
                     126408..126512,126582..126790))
                     /locus_tag="TRUGW13939_08591"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347617.1"
                     /db_xref="GeneID:55996079"
                     /translation="MYNDVTNSTRPLGVAIPGTVHLVDLDHTVQSRHAQTRQDIVLDP
                     TPSSDPNDPLNWSPRRKLVSLICQNLYTWFAGISVSTVYSVLVPLSEATGVSTDTLNQ
                     GTGAYVKSNRAWIAKCILQGFFVAPIEALPELSVTDLYFTHERGTYMGIYAFTLAGSN
                     YFAPVICGFIAEYQGWKWVFYWPAVFLGAALIFLLLFMEETNYSRGVTVTPGLPVMHS
                     AAQEKVPLATPAPQTVDVAEASTVSKTYFQKLSVWNFNPSQNMIRHAIQSVSFLGWPV
                     IFYAGFSYGSYLVLFNVLNATASIILSAEPYNFASSMVGLSYLSCCIGVIIAAFVSGR
                     ISDWLTIKLARHNGGIMESEQRLWPFAICIITVPGSLILWGVGAQHGIHWFGLIFGMG
                     SLAFTSTMGITLSVNYLVDSYHDISSDALVTVILVRNTMSFAIGYG"
     gene            <127540..>128578
                     /locus_tag="TRUGW13939_08592"
                     /db_xref="GeneID:55996080"
     mRNA            join(<127540..127697,127768..>128578)
                     /locus_tag="TRUGW13939_08592"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491725.1"
                     /db_xref="GeneID:55996080"
     CDS             join(127540..127697,127768..128578)
                     /locus_tag="TRUGW13939_08592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347618.1"
                     /db_xref="GeneID:55996080"
                     /translation="MSKLVRVGAVQSEPVWLDLNGSVDKTISLIEEAAAKGVNVLGFP
                     EVWIPGYPWSMWTSAVIENSHIIHEYMNNSMRKDSPEMKRIQAAVKKAGMVVVLGYSE
                     REGGSLYMAQSFISPSGDIVHHRRKIKPTHIERTIWGEGQAESLTCVVDSPFGKIGGL
                     NCWEHLQPLLRYYEYSQGVQIHVASWPAEFEMPDPEKIAWLYHETGEASYRASQFFAI
                     EGQAFVLVASQVLTEKNLHKNNLIGNPVTTTPGGGFSMIFGPDGKPLCEPVDAGSEVI
                     LTADIDLRDIDKPKAFIDVVGHYARPDLLSLLVNPTEDKHVTAMKK"
     gene            <131605..>134036
                     /locus_tag="TRUGW13939_08593"
                     /db_xref="GeneID:55996081"
     mRNA            join(<131605..131994,132055..132232,132295..133389,
                     133441..>134036)
                     /locus_tag="TRUGW13939_08593"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491726.1"
                     /db_xref="GeneID:55996081"
     CDS             join(131605..131994,132055..132232,132295..133389,
                     133441..134036)
                     /locus_tag="TRUGW13939_08593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347619.1"
                     /db_xref="GeneID:55996081"
                     /translation="MAYDWALPQLRRVLPLDDGELLQILAHAADLPDAKAAEYLQSIL
                     GKSPESIEFILLFAGRRAELSDPQARNLGDISSSTACKDTIHGVTDARHAQLLDNRSP
                     SRSGSRMLATSHYTNAVIEAGKWRARDEQEMQQRLQDLRYQYRIYNSDIEPEHEADYW
                     CSCPIHQYQQRKWSRRGVQELWSKAVMYPGERHYNDLQNGFGFFSNPYTFRVVSPYGY
                     GQQGFWAMQRPVPFYHARAIRETISLNAQLNAEAQSKVDSQEPKHSIWEEDAISDAMA
                     DMGFIDKPPVNVEKKTSIEKAAAQAPEKKRHGRFPSSKSFNLGLKNLKRAVSIKSSEQ
                     KAIENAMGLREAIIAEEYGRWPDEQWRLIVRAYQEKVGMATKIADLRAHRPLQYLHLL
                     RAGYFEPIPAAWANQASNPLKFNIEAASGWRGITPTWRGFEDIAEERLYWVLNHRDGS
                     AGVRMKPDFISEMNMAQARMANAVEPPPLYYSATDTCRLQHTSESYSKQVMPAPFRPH
                     DSPEMPTDDTMILLDVSGSMVFDPVRPVYDQYLITNYVRSSQPKNGDVAKAIIRRFAD
                     AMANHDHQYDGYDLVTFANESHHIGKISNKNFDAMWCNNVCFGGGTRVMTGWQKVKEL
                     HFQKHSQSATHHPIYGWQAGPSTPILRLLLLLDGEATDMDEFELDLLGLSWAHITIFL
                     IGVDGCPHHHRHANELQRISDFNHHVSFVDAQGNCPERFVTHELLKRHLGYDMSMKEF
                     ERMEDLPPYSEQ"
     gene            <135273..>136355
                     /locus_tag="TRUGW13939_08594"
                     /db_xref="GeneID:55996082"
     mRNA            <135273..>136355
                     /locus_tag="TRUGW13939_08594"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491727.1"
                     /db_xref="GeneID:55996082"
     CDS             135273..136355
                     /locus_tag="TRUGW13939_08594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347620.1"
                     /db_xref="GeneID:55996082"
                     /translation="MPVSEFYAGEPPLKYSFMDDYSEGAHPQILDSLLRNNRTQQTSY
                     GKDDFCEQARKSIRQHLGCSESEVSIHFVPSGTSANLISISSCLRPFEAVIAVDSGHI
                     VSKEAGAIEATGHKIIQVPAVNGKMTPETLEKGFRQNQFAPHMAKPRLVYISNASEIG
                     TVYTKSELCQISETCRKLGLLLFMDGARIGAALSSHKNDMAWRDIVDFTDIFWIGGTK
                     LGALLGEAIVIKNTQIAQDFIYHLKQHGALLAKGRVIGIQFLELFGSNLFLELGSHAN
                     AMALRISTLLTELGFMLSAETETNQVFVKLPLALVDHLQSRFHFYIWEETGDGHAVVR
                     FVTSWATEAMQVDKLNAYIKQGLVLM"
     gene            <137889..>139123
                     /locus_tag="TRUGW13939_08595"
                     /db_xref="GeneID:55996083"
     mRNA            join(<137889..138217,138292..138664,138731..>139123)
                     /locus_tag="TRUGW13939_08595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491728.1"
                     /db_xref="GeneID:55996083"
     CDS             join(137889..138217,138292..138664,138731..139123)
                     /locus_tag="TRUGW13939_08595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347621.1"
                     /db_xref="GeneID:55996083"
                     /translation="MPKNMTLQHFGASFLTIDHGLAIVARGFDIFVRILRYANVNRRA
                     HVLSSFSPSFSNSPVDSTWQSLKDELDEWRNIQDTTVRFPDTSVQAHVAFGYGELFTY
                     VNLIFFMSVLFLHRDRLLSDLRRFSEAHADNRNNTTVDSEDRVRNDDDATLVCIFEAA
                     KNIGVILSAVENSQAPVITPYSGFSVFVAVHVNMYATIAPHKYPGGLKSAEDEKKKNL
                     LYLERLTQFWPVGHQWWHTVQEAEKFYGAAKRSESIDAASTSRPSHLALASTLDEYGD
                     IRHQSSVHRVSREGEPLQGNDRYSRTEEHQRTARQSNIPRESMSLDGNTMLGDNESNN
                     MLFHSLEAELMQWPFIDETWSTGIESGWLN"
     gene            <139381..>140503
                     /locus_tag="TRUGW13939_08596"
                     /db_xref="GeneID:55996084"
     mRNA            join(<139381..139579,139662..>140503)
                     /locus_tag="TRUGW13939_08596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491729.1"
                     /db_xref="GeneID:55996084"
     CDS             join(139381..139579,139662..140503)
                     /locus_tag="TRUGW13939_08596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347622.1"
                     /db_xref="GeneID:55996084"
                     /translation="MAENRARVLIIGGGSVGIMAAYALYAGGNADVTVVMRSNFAQVE
                     KTGISIDSIDHGHDIKGWRPDTILDSVPDVVREKLPLFDFVVVTTKNIPDVSPTAEEI
                     VTPAIVNEKTVIVLLQNGLNIEKPMIRRFPSNPILSSVSYISATQLSHGKILHTDPDY
                     QRIGPFSSSLVSPEVAEDAARRYLTVYNPHNALNVVFDDNVTRTRWSKLVYNASYNSV
                     AAILRMDTARMRMSQHIIDDLIRPIMLEVIAAANACGITDLPKDLPDRAIRADSTDTG
                     FRPSMCQDADNGNLMEIEYIVGEPLREGQSRGVQMPALKTIYYLLKGLQLHAKEARGM
                     WEPKFCSNNPYK"
     gene            complement(<140906..>143114)
                     /locus_tag="TRUGW13939_08597"
                     /db_xref="GeneID:55996085"
     mRNA            complement(join(<140906..141756,141813..141955,
                     142018..142335,142403..142689,142753..142832,
                     142886..>143114))
                     /locus_tag="TRUGW13939_08597"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491730.1"
                     /db_xref="GeneID:55996085"
     CDS             complement(join(140906..141756,141813..141955,
                     142018..142335,142403..142689,142753..142832,
                     142886..143114))
                     /locus_tag="TRUGW13939_08597"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347623.1"
                     /db_xref="GeneID:55996085"
                     /translation="MANSTECETADVIICGCGPTGAMLSAYLGQMSVKNVVLEREPEI
                     TTDPRGIALDEDGIRLLQGLGIYNEIYTEIGTCMQLFKFVDGPAPNLDKEAFLEMDYG
                     TTEGGTGHVGFICHKQPVLEKYLRKSMVANGFSDLRPGCSVVGLAEDQSWTYCEYTNA
                     EGHIKRIRSRFFVGADGKTGYTRKKYLEPMGVHMDRAHNSFYEETWVALNWEISLPRP
                     QTHPDFPLWVLGYTPEEVFDLFFPVDFRFLCNPIRPAVCGRFGLHIDRLWRFEFVVLE
                     GEDGEEMAKPEMVKKIVFPYITHSGKRYGLSHDVQYPEDCIKVLRSRPFMFSARSCNK
                     WSKDRVILCGDAAHVFPPFGGQGIASGFRDAASLAWRLALLCKHSTQDLLSHNDVLTA
                     WYTERKQQLERSLASTIENGMFVTESDRLKIFFRNWSLWLIGFVPSWHHQLRLGRRKD
                     GMIRYQHESGMPFIPSMNGGLCITQVYCKPVGLDADKIYFTDDVIFNGKTGFFQILVY
                     LKRTKEISSACADLYDIGSISQGNIRDEDVTFIVEEGIDQLIKQDYPTLKSPVYTLAS
                     AKEFSSSSLCLGRPKPINYDPYRLGKELNGERYTILRPDRFIFASCSTKKQLSQAVTS
                     LASYLTRGELD"
     gene            <143993..>144897
                     /locus_tag="TRUGW13939_08598"
                     /db_xref="GeneID:55996086"
     mRNA            join(<143993..144036,144129..144360,144418..>144897)
                     /locus_tag="TRUGW13939_08598"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491731.1"
                     /db_xref="GeneID:55996086"
     CDS             join(143993..144036,144129..144360,144418..144897)
                     /locus_tag="TRUGW13939_08598"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347624.1"
                     /db_xref="GeneID:55996086"
                     /translation="MLAKVPKSFWVELFKAPKLPTAEEIQELKDAPGGGYILTLTDPQ
                     GFPLNLIFGQTLAKTRDYPPKITVNYEVEKPSALKFQRFTTGPAAVHKVRHFGLCVEN
                     FRDMVDFYTTNFNLVPSDFLYVEKEGEEKNVALFAHIDRGDELVDHHTLFFTANGTIH
                     VHHTSFEVHDYDTQNLGHQWLANKGYISVWGVGRHILGSQLFDYWWDTTGNTIEHYAD
                     GDLVNGKPPIAYGPAGDESLAFWGPDVLATFLN"
     gene            complement(<145248..>146296)
                     /locus_tag="TRUGW13939_08599"
                     /db_xref="GeneID:55996087"
     mRNA            complement(join(<145248..145552,145610..145904,
                     145971..146045,146108..>146296))
                     /locus_tag="TRUGW13939_08599"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491732.1"
                     /db_xref="GeneID:55996087"
     CDS             complement(join(145248..145552,145610..145904,
                     145971..146045,146108..146296))
                     /locus_tag="TRUGW13939_08599"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347625.1"
                     /db_xref="GeneID:55996087"
                     /translation="MSSWTHLVRFIAVEGSQEHLGQLVDTARDVGKDSFEGIQIVVYL
                     IDGTMFDGRVTEQILHVKTLLSPVSKDDCNFIKYLGLNYMDHAKEANLPLPKAPILFA
                     KPRHALTGPFPAAINIPKCAQDETSDYEAGLCVVIGKSGKKIRQEDALDFVLDFTASN
                     DVSARTLQMVTPQWPYSKGLDGSCPIGPVLVAPSIIGDPQTLSIKAIHNQDIVQDGNA
                     RDMIFDIKKQISYLSQVTTLEAGSILLTGTPAGIGYFRQPRRVLRDGDEISVYIGNIG
                     TLVNKVCYESW"
     gene            <147109..>149791
                     /locus_tag="TRUGW13939_08600"
                     /db_xref="GeneID:55996088"
     mRNA            join(<147109..147257,147317..148094,148679..>149791)
                     /locus_tag="TRUGW13939_08600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491733.1"
                     /db_xref="GeneID:55996088"
     CDS             join(147109..147257,147317..148094,148679..149791)
                     /locus_tag="TRUGW13939_08600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347626.1"
                     /db_xref="GeneID:55996088"
                     /translation="MPNRRARKERVCSWCSQSFTKDEHLARHVRSHTKEKPFSCSSCG
                     KSFTRHDSLLRHARSHVDGQRLPTPLYQSTQKDVPETAENSVSTLLNSPAMDTAINKS
                     SNRSRLNAARAESLPHSSPSMYNSHTAHPLPCDYSTLGLTGMSDWVESTLSHSIEGSS
                     SVENAPGLGRLETARIDPSTPWMISPSQQIPGWLVGDDFDMNALNAQIFPSSFSMDSF
                     EWSNDGFLPGALTPHVNDVVVQRPKASDLAEPRDEYIRRHWFTHLGTDKSGYITPDPM
                     NEPTAVDERYRENLSRELQQRVVNEPLPSTDFLWARRQNMFQQKTPDTYPGNLVEPDM
                     ESLWRRWIHNEEKRRYLAQALLSYGCSSDFLMSSVAVGLRIHDAELAELLMVEPYLRG
                     TSSQRPKIEHDIIWTAPTANDWTCAIKEHGYSNSPNSTYQVSSIDQRPRDNTRNNPSR
                     PPPPFAIYALLEENISRIMESSDVPSLKDNSEEFIQPLIHIYNEQLSKKMDGDPFSLK
                     ALWHSVFISLYSDMNMLECAVGRDGFDEAQAQNRHAISWASSADGHRCATHAALILRH
                     LQRIPVGEEPAIHVPRLLYRVSIVWYAYTRFGRDDSRSLSPVELDFIELNKIGIDGQR
                     TLFAANGFKKARPTTSESSTLFQAIDLLERLGHWGISQKIASMISILVHGKQNNE"
     gene            <150271..>151313
                     /locus_tag="TRUGW13939_08601"
                     /db_xref="GeneID:55996089"
     mRNA            join(<150271..150381,150435..>151313)
                     /locus_tag="TRUGW13939_08601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491734.1"
                     /db_xref="GeneID:55996089"
     CDS             join(150271..150381,150435..151313)
                     /locus_tag="TRUGW13939_08601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347627.1"
                     /db_xref="GeneID:55996089"
                     /translation="MAFEQRIDTHAHFLPPFYRQACIDANFTQPDGMPKLPEWHLEGH
                     IALMDKLNIARSILSISSPGTYLIEGKKEDARNLTRACNDYAAGLVLKHPSRLALWAS
                     LPLPDIEGSLVELSHVLDGLNANGITLETNHHGFYLGDSIFDPIFDELNRRHAKVFIH
                     PTTACVRQGQDQCISVPATPLTNFPNPVFEFLFDTARAVINLFVSGTISRCPNITFVI
                     PHAGGALPPLIERFTSFGPIIGAGSHLTSLFVKETFSKQFYFDLAGFPFPDQIHGLLK
                     YVKPERLLYGTDYPFTPEGVVMNLASIMRTEMALIWSEPEREAILYKNATRLL"
     gene            <151996..>153255
                     /locus_tag="TRUGW13939_08602"
                     /db_xref="GeneID:55996090"
     mRNA            <151996..>153255
                     /locus_tag="TRUGW13939_08602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491735.1"
                     /db_xref="GeneID:55996090"
     CDS             151996..153255
                     /locus_tag="TRUGW13939_08602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347628.1"
                     /db_xref="GeneID:55996090"
                     /translation="MAVHLLLAFSVALSPRESIISGPSTPMPPSKDPWYSTPDNFEQA
                     APGTILRIRHAPGNLPSIVGSNCSAAYNILYRTTDSQYKPSWSVTTLFAPSIQPGSTN
                     RPGSSVLSYQFPYNSVDVDSSPSYAVYSTPWHDLTYALGHGWFVNVPDFEGPLASDVA
                     AIEEAHAVLDSFRAIMEAGVGVAPDARLALWGYSGGSIASEWALEFQEQYAPELNIIG
                     AALGGLVPNTTYVFDTVGDTEFASHGMAGLLGVTSQYPAAYSYIISQLKTSGPYNKTG
                     FLSIRNMSYEQAHATFANQNMYDYFVGGRAVMQAPLVKRALQLNTIMTYHGVPQTPLF
                     IYKAIHDEVTPVNQTDDYVHRSCSLGVNILYERNTVGGHEDEFVNGEGRALAWLETVL
                     DGSYEQHPISGCEIRNVSVSSVNTGIY"
     gene            <153836..>154939
                     /locus_tag="TRUGW13939_08603"
                     /db_xref="GeneID:55996091"
     mRNA            <153836..>154939
                     /locus_tag="TRUGW13939_08603"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491736.1"
                     /db_xref="GeneID:55996091"
     CDS             153836..154939
                     /locus_tag="TRUGW13939_08603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347629.1"
                     /db_xref="GeneID:55996091"
                     /translation="MTLLLLPNELLLSITEVLQCDKDINALVQTNARLYHLLNTYMYR
                     RNVRTSESSALFWAAKHDKVTTCQKLLSEGANASAITTCSGRQWTPLALAAEAGSGNV
                     ADLLLRENGVNPDLKDECGHTPLSWAAGNGHTLVASILLEEGKANCNTRDLNGRTPLS
                     LAAENGHEDMVQYLLSHDTTHPQASDGNGWTPLSWAALNGHTKVVMILLAQPDVDADE
                     TSSSGRTALSWAAWNGHTEVVDLLLRIPQVNPDSKSKFGRTPLSWAAANGHYEVVRLL
                     LSTGKVNPNSRDDYYRRIPLSWAAENGHDKVVEVLLVHSGIVFDSHCIWGLTPLSYAT
                     AKNRWTTINLLAAAFTDESAYTQKSRNDCISRK"
     gene            complement(<155157..>156829)
                     /locus_tag="TRUGW13939_08604"
                     /db_xref="GeneID:55996092"
     mRNA            complement(join(<155157..156144,156201..156303,
                     156367..>156829))
                     /locus_tag="TRUGW13939_08604"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491737.1"
                     /db_xref="GeneID:55996092"
     CDS             complement(join(155157..156144,156201..156303,
                     156367..156829))
                     /locus_tag="TRUGW13939_08604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347630.1"
                     /db_xref="GeneID:55996092"
                     /translation="MRWISKPALLRELNPRLLFVGCFVSLGSMGFGFDNGWWGGALGL
                     APFARKYGAYNEATGTYDIPSEKQSAGTGTGSAGIILGCLIAPWLCQNLGRKPTLLVM
                     ASLLVVGIVLEASAITSFWQLVVGRVIVYSGIGLASNVVPMYQSECAPANIRGAFLTA
                     YSFWNTFGGFLAALVIFLSQSLTTQWAYVTVILCQLFVPIGVLLSYPCLPESPRWLVY
                     RGRFEEAEVVIKDLYGPDYNATEEVQLLRLQIEEQRELNKATSILDCFRGQNLRRTII
                     AVMVQVLQQAQGVSFINNYIVTFMEQLGFENSLRWNVIVTVCGLAANFISFYTFDKIG
                     RRVSLFFGAFLMAAMMMGVAGATIQGTSSITASTKNGCVAMLILWYCIFGLSWGPGVW
                     ILGGEVGTGQLRERTLLLSSLGSFVTSVPINFVNPYVQAAIGGQVTFIYGSFSVAAMV
                     FVHFCLPETKDRSLEELDEMFQNGVPTRKFASHICTGLGSQIRKLEKEGDGDLKQKES
                     VISHVEVAV"
     gene            <157325..>158891
                     /locus_tag="TRUGW13939_08605"
                     /db_xref="GeneID:55996093"
     mRNA            join(<157325..157636,157701..>158891)
                     /locus_tag="TRUGW13939_08605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491738.1"
                     /db_xref="GeneID:55996093"
     CDS             join(157325..157636,157701..158891)
                     /locus_tag="TRUGW13939_08605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347631.1"
                     /db_xref="GeneID:55996093"
                     /translation="MPSSRDRLQTFPNKPRVFILSDISNEPDDAESLVRYLLYANQFE
                     TEGLVACTSTWMKTKVCPQDMHKILDSYEKVVQNLDAHAHPNDPYPAAKHLKSLVKKG
                     AETYGMSAVSADVLLSEGGQLLLDRIQTPSDRPLWVLCWGGTNVLASVLLEIERTRSA
                     SEAVKLRSKLRVYTISDQDDTGVWIRNKFPEIFYICSVHGWCQYGLATWSGISGEHWY
                     GFDEGGPDPTKISKDWIRTHIQIGPLGSGYPEFMFIPEGDTPTFLYLIQNGLGIPECP
                     EYGSWGGRYIRTDASGSGLANGHYSDTADEVVGLDGHKHKSNQATIWRWRDAFQNDFA
                     ARMQWTLPADLGNFNHHPIISVNGDQGLKPLFLESEAGSTIQLDASATYDPDPADSIA
                     FKWYQYKDPSATQWSTHHEVGRLEIHPLNPAKSIVKVALPPPDRCCVELISRKAVSKG
                     QLLHLILEVTDSGSPPLTSYRRVLIQTTNKQLVGGGGGADAIGDTMKNVV"
     gene            <159225..>160884
                     /locus_tag="TRUGW13939_08606"
                     /db_xref="GeneID:55996094"
     mRNA            join(<159225..159283,159369..>160884)
                     /locus_tag="TRUGW13939_08606"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491739.1"
                     /db_xref="GeneID:55996094"
     CDS             join(159225..159283,159369..160884)
                     /locus_tag="TRUGW13939_08606"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347632.1"
                     /db_xref="GeneID:55996094"
                     /translation="MHRRAGRPKSHTGCNTCKSVVRHVKCDEQKPACRQCAVSGRKCD
                     GYEVNLSQRELRERIITSYQRPTRAPESCIILSQGTRQERQYVHLFCTQTSPALSGFF
                     FSQLWNRLVPQLSQTESIVRYAVAAVGAAHYKNSKTNDPGFVEMFIWQQYNKAIRNLT
                     LHLSTLPSEQQKDTQADLTLITCSLFVCLEMLMGNHEQAFNHLEAGVNLVYRRSQVSA
                     YQSTDSQTISSELSDLFSRFRIELDLSERSTRLCTWAAMSHKDSMLSSDFTDIAHARR
                     SLSIVGMNSIGMIRGSSIHQIPCAGDSQDPHWQEVGNQLRAKLEPIKQELDLWAVKFE
                     IFMLSRKGRSADQRAALALRLDHRINLIMSLSLLHRSEIEFDRFNDDFIYIVRTATEL
                     LRLDAEQSENNSLQSPFRLEAGVIRTLHWTALKCRDPLTRREAIRLMSMYRRKEGVWD
                     WRRSVKITERIVALEEAGLSFLPIEKRVPDDQHRIYATAYLDDSFSEQTQVKICWKPD
                     GQKGTLQQRMETVKWA"
     gene            <161505..>162836
                     /locus_tag="TRUGW13939_08607"
                     /db_xref="GeneID:55996095"
     mRNA            <161505..>162836
                     /locus_tag="TRUGW13939_08607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491740.1"
                     /db_xref="GeneID:55996095"
     CDS             161505..162836
                     /locus_tag="TRUGW13939_08607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347633.1"
                     /db_xref="GeneID:55996095"
                     /translation="MLISLGTLSLLTQTRYVVHLSDGKRLVLFRLPAIDTSTRKANET
                     YNGWSYYAMEAECPHAGGPMAESSVDIEDSAYVVSCPWHAYDFNVETGESSVGIKACT
                     FPIKIRGEEVMLEYPSETINTIKIARIEPVSEKVELKRYASSASILENTPGARYLDDN
                     ASVCEWAAHILNTANPEQKIDLTTRLFSLFVAREASPSPMNLGRGIATPPDQPPRESL
                     VEVQPWDAPKTGRAGSAKSRIAMLHALANIELWAIDLAIDICVRFAMFRTEGNKKELP
                     RAFFHDWLKVASDEAKHFSLLRTRIEQMGSYFGALPVHHGLWLSATETAYNLRSRISI
                     IALVHEARGLDVNPMTIEKFRKAGDKQSVPVLEIIHNDEITHVTTGHRWLTWICEQEG
                     TDPVQVFRNNVQKHFRGPIRGPFNEEARMQAGMDRRWYDNHGAHGDMAVAS"
     gene            <163855..>165479
                     /locus_tag="TRUGW13939_08608"
                     /db_xref="GeneID:55996096"
     mRNA            join(<163855..164222,164279..>165479)
                     /locus_tag="TRUGW13939_08608"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491741.1"
                     /db_xref="GeneID:55996096"
     CDS             join(163855..164222,164279..165479)
                     /locus_tag="TRUGW13939_08608"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347634.1"
                     /db_xref="GeneID:55996096"
                     /translation="MEFFQSPTFASDVKDLMKQHHVPGLAIAIIQDGKIDSTGYGYAC
                     LDPRRPCTADTLFDIASSSKSLTAAAVGLLVNDNENFPEVQYDAVMSTLLSEDFVMSG
                     VGYTEGVTVEDILSHRSGLPGHNDSYMSVRAARPDNARSITRNLRNLSVAAPIRSKYI
                     YCNMMYTVATHLVEVKSGRDFGAFLEERIFKPLNMSSTSLQPSSARLRGFESSMATGY
                     LWNKADFIYRDLESPDCPEGQGAGSIITSVNDFIKWVKALLNREDPINQKVYEGLTRM
                     RAFVNPNATRRKRYTSPVAYAAGLDIYYYRGHMVVGHNGVTSGWGSRFFFLPDFEFGS
                     VIVGNSEGANSVASILVRRLVDNFLGVEDDTTHHNTTKTKTKTPAPCRSINVQPKSKV
                     NHAVKKNEEHHKSKENGQNSQSTAPQPQEMSLSAYIGSYWNPGYHDLVVQIKDGVLFV
                     DATDRSMGFTLKFEHVSNGTQYNAHLSDRLDGGDDLVKAEFVIENGRVMKLGLHLEAA
                     LKDMIWFERKDISG"
     gene            complement(<167199..>169322)
                     /locus_tag="TRUGW13939_08609"
                     /db_xref="GeneID:55996097"
     mRNA            complement(join(<167199..168086,168143..168558,
                     168629..>169322))
                     /locus_tag="TRUGW13939_08609"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491742.1"
                     /db_xref="GeneID:55996097"
     CDS             complement(join(167199..168086,168143..168558,
                     168629..169322))
                     /locus_tag="TRUGW13939_08609"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347635.1"
                     /db_xref="GeneID:55996097"
                     /translation="MLANKGALSLSLFSSFVFSTQIPYSEYILAPSSRLLTAGEIYMI
                     NGTVQNAACLTSDGSACGGAVFVGVNSSVTLDFGKNIAGTVQFNVDSVNGSNEFLGFS
                     FTESSEWISPYECDATQNSGRDAPLWFPIGSSGSYGADKYHQRGGFRYMSVWHNSSGT
                     LSLSDLKVNWTASPSAEDPKSYLGYFHSSSEKLNRVWYAGAYTNQLCTISTDTGSALS
                     LSLDDWYYNATLTNGAETLVDGAKRDRLIWPGDVVISQPSLFVSTNSLDSTKTAIDAL
                     LANQQSNGQLPYYVGPPIDLGSSFTWSFTYHLHSLNDIHDYYIYTGDIDYLKSVWSNY
                     TLGMNYIVGTVDNSGLANVTSSNDWLRSGMGGHNIEANAIFYYNLGLGVRLALAVGDT
                     TYVQNWTTTASTIQSAANSLLWDSSQNLFKDNEESTLYPQDGNSWAVFSGLVSSASQA
                     SSISDSLMARWNEYGAPAPEAGATVSPFSSSFELKAHYAAGHADRAVNLTEFMWHDFM
                     LEDPRMTNSSFIEGYSTNGSLHYEPYSNDPRVSHAHGWSTGPTSILTFNGAGIQLTSG
                     GGQNWTIVPSLGGLSSIEAGFESPLGIFSASWTQNSGGLDGDFETPQGSTGTLVLPAS
                     QGNTVTISGPGGNTVQGPSFNGSTVTVNNLTGGNYTVRWSS"
     gene            complement(<170435..>170947)
                     /locus_tag="TRUGW13939_08610"
                     /db_xref="GeneID:55996098"
     mRNA            complement(join(<170435..170638,170697..170784,
                     170841..>170947))
                     /locus_tag="TRUGW13939_08610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491743.1"
                     /db_xref="GeneID:55996098"
     CDS             complement(join(170435..170638,170697..170784,
                     170841..170947))
                     /locus_tag="TRUGW13939_08610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347636.1"
                     /db_xref="GeneID:55996098"
                     /translation="MQLITALGSAIVIIAYGIQQCSAPPLILETVVTGAVAAGTVGGI
                     SAFLGTLHKRDYVHIDKRDDDTFAGFPQPAGGLCKSQLSSSHILFSSLETGTLRIDNL
                     PPACMTLSTVLGGQNPNSPAPIPLGTPPQP"
     gene            complement(<173145..>175950)
                     /locus_tag="TRUGW13939_08611"
                     /db_xref="GeneID:55996099"
     mRNA            complement(join(<173145..173329,173397..173914,
                     173986..174210,174268..174473,174550..175131,
                     175183..175263,175317..175812,175904..>175950))
                     /locus_tag="TRUGW13939_08611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491744.1"
                     /db_xref="GeneID:55996099"
     CDS             complement(join(173145..173329,173397..173914,
                     173986..174210,174268..174473,174550..175131,
                     175183..175263,175317..175812,175904..175950))
                     /locus_tag="TRUGW13939_08611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347637.1"
                     /db_xref="GeneID:55996099"
                     /translation="MDGRDDCTLRSKVSDRTKTTPQTANNNALNKELAPDKLTVTATD
                     FAHMDNAPFIDELEAPSFPDNTARDMPMMDMFDTMYNRDFDSNASDGNVIYSSYAFLD
                     VGHLSSLPKDDVEFLILKRCLHVPRKDALDEFVKQYFTVVHPFVPLMNEAEFWRLYMG
                     SGNSKKISLFVFQAMLFSCCAFMPLETLQRCGFDDKRAARRELYKRAKTLFDLDAEDR
                     CLAKAQGALLLSHHTSAQDPQAASIWLATAIRIAMTLESYPMLPSDEIDKPMTKRLWW
                     AIMLRDRSLSLGLRRHPQVTATNFMADENRLHESEFEDEIRNSRVFSRDVKRQLFAAL
                     QEQCRLAVLLNDGLVIVFPPPGPLTQSHSTKEVKETRIVLQMVKKQLAQWKKQSSFFP
                     SETSPKLHDTPDNSTSSAQISIAHYEALLVENTDRTAEKDYAIQIQEIAKDLRIAIDG
                     LTSTIEYFTAQNATGMLPLSVLAYAGMPLILSAINLKLSPSYSQMLVRRNRLNTFAEV
                     IRQSRLLYDVTEIVAAGTNRILQLAYAITKELFLRRKISRYTNLSACPSLEPRATSWD
                     EAYLRYPRAYLYISKSVEYSLSVGRLPTEVALPEQVRHVPSIVLGTRLPWTISSLPAQ
                     ALTEKPYDEVRKSKEKESEVVFGLDLISEEQCLAETWESQNIHEDHGPSSVSETFNPS
                     SLILPRVHENQYYAGENINLDYFDVEPVLGGSDQFLASPGQEEEGLVSSTDDSMEADR
                     PSSSISSPLSVHSSNQEPSFESFFQLLRDEMSYKSPIEL"
     gene            complement(<177205..>178098)
                     /locus_tag="TRUGW13939_08612"
                     /db_xref="GeneID:55996100"
     mRNA            complement(<177205..>178098)
                     /locus_tag="TRUGW13939_08612"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491745.1"
                     /db_xref="GeneID:55996100"
     CDS             complement(177205..178098)
                     /locus_tag="TRUGW13939_08612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347638.1"
                     /db_xref="GeneID:55996100"
                     /translation="MSAVIEKSQNVSSSPGWDEKTVNEASESTKIDQELLDALDKPKE
                     ILKIVQEGLLLAGGAVAILLQVANPGVAKGVDQHSNFSYRPLDRLRTTMTYVYCMAFG
                     SQSEKAIIIDMVHKAHAPVQGADYSADDPGLQTWVAATLYAVGVDMYQRIFGELDRET
                     AETIYKEYAILAVSLRVPPEMWPKDRAAFWEYWNEQIETVEISQHAKNVAKDLLYNKN
                     APLHVWASLPLVRLITAEMLPKRIRDEYGLKTTKARRATYKFALGFAKMTYPALPKFI
                     RTYPKRYYMKDMRRRMQKATS"
     gene            <178731..>180192
                     /locus_tag="TRUGW13939_08613"
                     /db_xref="GeneID:55996101"
     mRNA            join(<178731..179017,179085..179509,179569..179690,
                     179749..>180192)
                     /locus_tag="TRUGW13939_08613"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491746.1"
                     /db_xref="GeneID:55996101"
     CDS             join(178731..179017,179085..179509,179569..179690,
                     179749..180192)
                     /locus_tag="TRUGW13939_08613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347639.1"
                     /db_xref="GeneID:55996101"
                     /translation="MSSFLEKNADSSKKWIKEHKYVVGFSSMPQYPAATLAAKGSKNK
                     GIDIEHVETVEKPSEKENKKSRVQKVKRHYRRFWCCYLVGGIIFLAIFLPLFFIYVFP
                     AIAQLMVDNATLPIYSAIIMTPQPDNVTVSLQAGLTVPAGISVALDPITLYLFNRNVT
                     PIQPYVAVSLPEQHLKGNAHIDISNQTVTILDKNQFIAFLTNAVYGEKFTLSARGSTK
                     AHLGALKASLTLDKDVELNGLDSLSGFSIESAKLVPKESDGTNLRGVAVLPNHSIVTF
                     ALGNVTLNLNVGDLLIGQGLIENVVLTPGNNTVDIKGSLSIATVIDNLASILSTEKSA
                     ISNGDLQLSASGNTTIYEGTHISYYEEILNHLVLTTQIPILDVISDTLKGLLDSNTTL
                     SGLLNGTNETLESDISGKLANISDLFDASDLMS"
     gene            complement(<180458..>182339)
                     /locus_tag="TRUGW13939_08614"
                     /db_xref="GeneID:55996102"
     mRNA            complement(join(<180458..181016,181074..181498,
                     181572..182006,182060..182197,182250..>182339))
                     /locus_tag="TRUGW13939_08614"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491747.1"
                     /db_xref="GeneID:55996102"
     CDS             complement(join(180458..181016,181074..181498,
                     181572..182006,182060..182197,182250..182339))
                     /locus_tag="TRUGW13939_08614"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347640.1"
                     /db_xref="GeneID:55996102"
                     /translation="MFQADRQWDLPNKDILSYIFDKPAYNQDKPIYVDVHKPSRSISC
                     NQARRIIRQLIAGLRAAGVKQGDCVALHSFNDIYYCMLVLAIIGVGGVFTGTNPSYTA
                     AELSHHMKTSQSKFLISEPEILAPVLIAAKENGITDSNIWIFDTQGQKLPEGRRSWKD
                     LFNHGEEDWVRFDDRNVSQKVHAARLFSSGTTGLPKAVTITHLNLIAQHEMTHGAHAP
                     PYDISRVIAIPIFHAAAAPSTHVGALAGGDVVYMMRRFDLELFLQTTEKYHVTEMTMV
                     PPIVLAVVMSPFTRTRPFLKSVRYAGCGAAPLDKDLQARLLQLMNDDASFTQVWGMTE
                     SSCIATMFPHTERDDTGSVGRLIPNLEIKLVDDDGHDISQYGVRGELCIRGPTVTPGY
                     FGNVKANAESFDSDGFFKTGDIGFCDKATRKWYIVDRKKELIKVRGFQVAPPELEAVL
                     LSHPQIIDAAVIGVSIPGADGELPRAYVVRRPGPEGAKLTEDEVKKYLASRLAKYKAL
                     TGGVKFIDSIEKNASGKILKRILREDSKKDLANGQITAKL"
     gene            <183137..>184970
                     /locus_tag="TRUGW13939_08615"
                     /db_xref="GeneID:55996103"
     mRNA            join(<183137..184142,184216..184300,184359..184417,
                     184474..>184970)
                     /locus_tag="TRUGW13939_08615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491748.1"
                     /db_xref="GeneID:55996103"
     CDS             join(183137..184142,184216..184300,184359..184417,
                     184474..184970)
                     /locus_tag="TRUGW13939_08615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347641.1"
                     /db_xref="GeneID:55996103"
                     /translation="MAFAYTTDEEVDSAYRTLRATFSVGKTKSIAWRKWQLKQLWWLV
                     TDNKDRLLDALHADLNKHRYESSFTEYAAVVTDILDHLEHIDDWTAPKRPEGASFSTA
                     YLMGATVRSEPRGLVLIIGPWNFPIHLMLLPLVAAVTAGCTVLLKPSELATATQACLA
                     DLIPQYMDTEAIRVVTGGPTETERLLQKQFDHIFFTGSPSIARHVSIAAAKHLTPTVL
                     ELGGQGPSVVTASADIDFAAKSIAATKHINAGQICLAVNHVLAHPSIADKLIERMQFH
                     LKDFSVDGSESMAKIINRKNFDRLKTVMDTTNGSIAYGGVTNHDTLEIQPTILTDIKP
                     NDPSMKEEIFGPICPVLVATTEEAIQLIKSKPHPLAIYIFSQNQKEIDHIISSTISGG
                     VTINDTLVHSTVPGAPFGGVGESGYGAYHGVYGFQAFSHMRNIAQPGAMLRAYFGLRF
                     PPYSRQDPSKVEIKKRLGFKRGETIADQEVGALRALWNNSGQLFQWTIVFATLVLADK
                     GAGGWLGLWWLTVRVGRLARPLILAVEVLLRRNLPGLVSS"
     gene            <185698..>187135
                     /locus_tag="TRUGW13939_08616"
                     /db_xref="GeneID:55996104"
     mRNA            join(<185698..186105,186172..186200,186249..186975,
                     187031..>187135)
                     /locus_tag="TRUGW13939_08616"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491749.1"
                     /db_xref="GeneID:55996104"
     CDS             join(185698..186105,186172..186200,186249..186975,
                     187031..187135)
                     /locus_tag="TRUGW13939_08616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347642.1"
                     /db_xref="GeneID:55996104"
                     /translation="MESKGGYTDPNMRRCWDYDFRWTPHHLTADQMEPLRHQMDSLAS
                     DCVEPLSELAAAAAEKAEGATISDTSEKQPSTGKPDLLKTDMYALLRDNHSKNKALEA
                     LWKQVTTIPDWVDWEQIDRGQRVYYRYGQPMTIALTFQSLLGGMGAGKIVETLSRTGG
                     FSAKVVRHRLLETFQHTLQVSQSLESIRPGGAGHASTIRVRLLHAAVRNRILKLSSKR
                     PTYYDVEKLGIPINDLDCIGTICSFAPTVIWIGLPRQGIYLSEQETTDYIALWRLVAW
                     YIGTPTEWFESPEKARGIMESILVAEVHPTRMSGVLARNIILGLEKTPPLYASRGVLE
                     AMTRQLIGTELANALGIGHPSPFAWAFAAWVFLYGILWSFICRAMPFVDSTHIKSSRT
                     QFWKVLMDVKTGLGKETSFDFKYIPQDEKK"
     gene            complement(<187479..>188909)
                     /locus_tag="TRUGW13939_08617"
                     /db_xref="GeneID:55996105"
     mRNA            complement(join(<187479..187875,187929..188527,
                     188589..>188909))
                     /locus_tag="TRUGW13939_08617"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491750.1"
                     /db_xref="GeneID:55996105"
     CDS             complement(join(187479..187875,187929..188527,
                     188589..188909))
                     /locus_tag="TRUGW13939_08617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347643.1"
                     /db_xref="GeneID:55996105"
                     /translation="MSKVQIVQLKDIDVKQLASQLVGYLRKSKNISFKQYVSYGLPAL
                     FLYLLIQGRLRYSRARYLKNKYPYTRDTFWRMTDHDAWEIQKNILQLEFPFISLKALQ
                     FALFRTYGIPTISSLLAKTTQFSDTATSFKRYADTAVLIGEFMAFEPSSLRTHEAIAR
                     TKFLHTGYRKSGKILEDDMLYTLSLFALEPIRFIETYEWRNLTDLEKCAIGTYWKSLG
                     DALAISYEGLPSGAKEGPSGFRDGLHWLEELNAWSQAYEITNMKPSAANKEVADKTTD
                     VLVFALPRFLEPVGIAFVSFIMDDRLRKAMMYDSPNKIYSTIFSSILQTRKYFLRYLA
                     LPRPFYMRYDVFTAEPDERGRNFIKIWDAVPYYVKPTLWNRWGPASWLKRVSGLPLPG
                     DEGDKYRPEGYQTSSVGPRYFEGKGVTQMEETKANLRRGRTGGCPF"
     gene            <190699..>192525
                     /locus_tag="TRUGW13939_08618"
                     /db_xref="GeneID:55996106"
     mRNA            join(<190699..190907,190977..>192525)
                     /locus_tag="TRUGW13939_08618"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491751.1"
                     /db_xref="GeneID:55996106"
     CDS             join(190699..190907,190977..192525)
                     /locus_tag="TRUGW13939_08618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347644.1"
                     /db_xref="GeneID:55996106"
                     /translation="MRRFRLRTSDVPVADVPSALAADEEKTAIESKVETDDASPVDSQ
                     VQHGVRGAQAVTQVWTRNQLLFAYANIWVIEFVLAYSSGITSTLTPYVTSSFEAHSLT
                     ALTSVISSLVAGLFKLPYAKLIDIWGRPQGFALVVSCMVIGFIMMASCNNVKTYCAAQ
                     VFYMTGYNCVDFSLTIFVADTSSLRNRALIIAFIASPWIATVWAYGPTAQSLLGTIGF
                     RWGFGIWAIVLPVVCSPLFGLFYYNQRKAEKQGLLNTEPSGRTFAQNVIYYGREFDVI
                     GILLIAAGLALFLLAFNIYTYQPDQWRSPLIICFIIFGGLLIIFFAVYERYLAPVTFI
                     PWALMKDRTVFFTFSMIASLYTAWYIWDSYFYSMLIVVFNQSVSHATYIQNIYTVGST
                     FWSLVMGVIIRYNGRLKWQALYFGVPITILGVGLMIKFRHPDVDIGYIVMCQIFVAFG
                     GGTLVICEQMTVMAVTTQALIPSILSMEGMMTSVGNAIGSTIAGAMWTGVFPKKLAEY
                     LPADAQKDLASIYGSITVQSSYPVGSPVRDGINHAYGDTQKLMLIAATCLYSVTLASV
                     FFWRDINVKKIKQVKGLIF"
     gene            complement(<192705..>195392)
                     /locus_tag="TRUGW13939_08619"
                     /db_xref="GeneID:55996107"
     mRNA            complement(join(<192705..193923,194089..194552,
                     194617..194701,194761..>195392))
                     /locus_tag="TRUGW13939_08619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491752.1"
                     /db_xref="GeneID:55996107"
     CDS             complement(join(192705..193923,194089..194552,
                     194617..194701,194761..195392))
                     /locus_tag="TRUGW13939_08619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347645.1"
                     /db_xref="GeneID:55996107"
                     /translation="MVSEIPLSRTALVKVSPGQAVITTQPMPALRPGYMLVQTKAVAL
                     NPADWTDIDYIGPPDIPNEAVSLSQSRYEGCTIGLDYAGIVVKVEPFVNVTGKLKPRT
                     FQPGDRVFGSSHGCNAFNIEHGAFADYIVVKSDLQMHIPDHMNFEDAASLGVGVLSAG
                     MGLFHASGQGIPSDLSSEAIVPGGKINDKGWILVYGGSTATGSIAIQLAKLAGYKVVT
                     TCSPRNFDLAQRLGADAVFDYKSPNVSSLISKATSNTLRFAFDTVATDPTAAICANSF
                     APPLKGDSGEVDMNPALYVCLLYPQLPQNTPFAVEKRFFLGYSCWGYEYYFEGEILPA
                     SAADHDFGVEITHIVERLLQKKVLKNHPVSVNENDTQKGGLEGVLIGLDKLRKGEVSG
                     RKRLSIRTGGPRQNQLLHTATSIFSILSANSCNLFEPILDKTLDMANTFKGWVAHSAT
                     SPLTFTTFQPKPFTPTDIEIAVSHCGICGTDLHTLRSGWGQTDYPCVLGHEIIGSVIQ
                     MGSAVSHSSKFSLGDRVGIGAQSGACLRADCEACADGQENYCSRIVGTYNGRYADRSR
                     SCGGYATRWRGPAHFVFKIPDALPSAAAAPLLCGGVTVFAPLRKYGAGPGKSVGIVGI
                     GGLGHLGILLAKAMRCSRVVAISRTGKKRKDALDEKTGLGADSFIATDEEDKWGRVHA
                     RTLDLIICTVDGYEMPLGQYLRLLKVGGTFVQVGAPEGPLPQLHAWSLIQKGIQLTGS
                     NIGSPEDIRQMLQLAAEKRVLPWVEQRPMHDVNNALADMHAGKARFRYVLVNDADSAK
                     L"
     gene            complement(<195789..>197239)
                     /locus_tag="TRUGW13939_08620"
                     /db_xref="GeneID:55996108"
     mRNA            complement(join(<195789..196107,196167..196526,
                     196578..>197239))
                     /locus_tag="TRUGW13939_08620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491753.1"
                     /db_xref="GeneID:55996108"
     CDS             complement(join(195789..196107,196167..196526,
                     196578..197239))
                     /locus_tag="TRUGW13939_08620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347646.1"
                     /db_xref="GeneID:55996108"
                     /translation="MSSTSHPQSLQFHQKPLPAFQNALVRSSLLLSNALSNVLLPEPT
                     NAHSTLYFQVLQIVQTTGRSVEDVIASYFCGVHAFIPIISRPGFRDEITNHAAPPSGP
                     FSVLLLSICLITYHPALAPYAPQSLDRETLFLATKTIFAQAQAIFPPSLPLIQAGIII
                     AVYEYAHCKLNDAITSICVCARMGQAARIHIEEPAQQGKYCNRQHVEDEYNTWWQIII
                     LERTLICELDDFKLPLVTQIPDMSVQLPKEGHEANPKSQGNSETSTVCGIESDATEYG
                     GFASTAQAAWYLDQVFRALHVDDLDKRLVQLDGLDHALRTFLNIIMDSDGRILRRYCT
                     PIVLAIRTLYILHLHILSQVPQIKESHKRTPSELRRQSSAVLNTLITMTEDITTVHSD
                     VSLPLMDSLPPSFAFIISTTIKNMKYSEFQNDRLDAAKKKLDLSLQKFRQRWGA"
     gene            complement(197677..197775)
                     /locus_tag="TRUGW13939_08621"
                     /db_xref="GeneID:55996109"
     tRNA            complement(197677..197775)
                     /locus_tag="TRUGW13939_08621"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:55996109"
     gene            198516..198595
                     /locus_tag="TRUGW13939_08622"
                     /db_xref="GeneID:55996110"
     tRNA            198516..198595
                     /locus_tag="TRUGW13939_08622"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:55996110"
     gene            198690..198788
                     /locus_tag="TRUGW13939_08623"
                     /db_xref="GeneID:55996111"
     tRNA            198690..198788
                     /locus_tag="TRUGW13939_08623"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:55996111"
     gene            <199278..>203079
                     /locus_tag="TRUGW13939_08624"
                     /db_xref="GeneID:55996112"
     mRNA            join(<199278..199402,199447..200034,200086..200185,
                     201358..201437,201501..>203079)
                     /locus_tag="TRUGW13939_08624"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491754.1"
                     /db_xref="GeneID:55996112"
     CDS             join(<199278..199402,199447..200034,200086..200185,
                     201358..201437,201501..203079)
                     /locus_tag="TRUGW13939_08624"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347647.1"
                     /db_xref="GeneID:55996112"
                     /translation="SMAIVKDDSPPPEGGVQGWLCVAGSFLALFATFGFLNAYGLLIG
                     VFQTTYEQTILRQYSSSDISWIFAVQLCLMWALGPLYGRILDTYGPAPVLYPCSLLCV
                     LSLCMTSLAKEYYQIFLAQGLGFGIGAGGVFTTSIVCVGQWFVRKRGLAVGIATCGSS
                     LGGVIFPIFLNRVIGSVGFFGAVRYTALFVGVLLAASCLMVRARLPRKKWNSKLPWLD
                     VTLFKQKQFALYTFGSFLVMWGLWGPFDYISSMAQEKGFSPTLSLYLISLIKYIAKTM
                     AERTIKRRMMLSRTRTGCQTCKTRRVKCDEAKPICQRCVKANRVCSGYSIAEAKDKNP
                     KTLKITYYVPNIFSDTKIIGGKRISMGSAQDQHALDYFFQWCLKCFPSDLMVHSQYYE
                     NLHEPAIKHAMAAMGLYFEIYRHDITGTAQTQRSMAAMQHYGKAISSLLQQPTKETER
                     GTSSTLVRACFLFVCIETSQGNYKSALSHLQSGFRLFQEGKEKMQQKANETRNTQEEN
                     IFHSLFGRLLCQLTNFDAADCARFFGLTDWSKSERMAEFTNLDNARWALLTIIERLIQ
                     IRSLWASHNAYSSFLPDTANAYPSAETILDHLAQEIHRLDQWILALNIYLSHGVPVFQ
                     VCDAYVLGLCGFFLKFRITMDRASIGSDDCPHLDFSHIISLGETLLRGYEMLPPKASC
                     APEETAHGDNEEAKCPVHGLFIDENRSQLRLDAKMSEGSSSGQQKLFLFLAVFCSLCV
                     ASVYCSDPETRHKAHDTVLSVCRCGAGWDMDLTNYIAHLLSPHMKSSNNEAKTPPSDY
                     DASFKFDKLLSHETHVLLAQLRLLR"
     gene            complement(<203183..>204247)
                     /locus_tag="TRUGW13939_08625"
                     /db_xref="GeneID:55996113"
     mRNA            complement(<203183..>204247)
                     /locus_tag="TRUGW13939_08625"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491755.1"
                     /db_xref="GeneID:55996113"
     CDS             complement(203183..204247)
                     /locus_tag="TRUGW13939_08625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347648.1"
                     /db_xref="GeneID:55996113"
                     /translation="MESKRQTVLVTGANGYIGNAVAKAFNRAGWKTYGLIRRDEDAPD
                     LRQNEIYPVIGTPKDIVLESSLQDLVFDVVVSNTEDWSNYEAHFEDVKSMLVELGKRK
                     LDQTGKRLLVLFSSGCKDYGMTERHGDPSLVAHTESSPLNVLRILEPRAVNVASLLEE
                     TTARESKLPFDMTALRPTNVYGYGSSFYGALFSFMEKGAAENDALKVFADPNNIMHSA
                     HVDDCADAYVALAEHPQRDEVSGQAFNISNARYETAGEILQVLAKSYGATIEYQPQTR
                     GSSMSGVIEALLQYTQWVSSEKIRRVTGWKEKRPLFVDGIEEYRLAYEAAVAAKHQGT
                     LKIRSTLDGPSDLFNRWSKE"
     gene            complement(<205044..>209044)
                     /locus_tag="TRUGW13939_08626"
                     /db_xref="GeneID:55996114"
     mRNA            complement(join(<205044..205493,205561..206208,
                     206268..206706,206791..207002,207191..207257,
                     207763..208846,208915..>209044))
                     /locus_tag="TRUGW13939_08626"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491756.1"
                     /db_xref="GeneID:55996114"
     CDS             complement(join(205044..205493,205561..206208,
                     206268..206706,206791..207002,207191..207257,
                     207763..208846,208915..209044))
                     /locus_tag="TRUGW13939_08626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347649.1"
                     /db_xref="GeneID:55996114"
                     /translation="MERNLHSVLESATHGTTYNVKKRYKRVMTPARKAQNRAAQKAYR
                     QRQKEVQEQQLNERKARKASKKTPELRPHPAPTELGSRGTVISTAEKQPVQPFALPVE
                     SLSAEFGFLQDESMHMTSQPHLNTNQAIGDDFLSRVPSIPLDIIDTIYMGKPDTLMLS
                     LGVSAEFGHDDIQNTAELTSMELIQNTGKDDLQYMAALASEHGIGPADLEKLFPRHNK
                     PLGHADPYANNLEFPQVSLLRICLSNARCLGIDIDALFGWNCMSLCSPFYRPTTTTEA
                     DPKELLASVSSPSIPKHLQPTLPQILFPHHPILDLIPFPGLRACAITLAATSPPFLSP
                     LELKKDIICGGLVCWGTRKNPGGQPWDMRSWEAAPWFLTKWRLLIDGKDGELSRQSTW
                     WRGMRGDCDSSKGVTTSGSGKTQAVQVGNSPIGGRARGTARVGQADVRSKTRFLFKTT
                     IKVPGPEARFAIRRESCCASSTMPLLEIPELNTRTGTLRAYHLAAIVFISSFLAGYDS
                     GVAGGVLTYKSFQADFKFKSSTESEVSSLTIGLEQLGSFLSCFFVYPLTNKYGRKYVI
                     AASALVFVVGAVIQTIKTGSLAGWYVGRIVAGIGMGGLSIVVPMYTAEMTPKEIRGRC
                     GSFYQWMYTWGVFAAYWIDYGVAASGSIAGTSREWQIPVGLQIVSSGILFLGMFSLPE
                     SVRWLLSNHRSDEAWKSLTWIRGDEGEKTLAEFNETQFGLKAEKSATDNFTIRELWHP
                     SNRLRFIIGPSMFIFQNTTGSSALAVFAPQYFKLIVGNSGNRDLLLTGLFGAVKVIGC
                     TFFIWVLAERFSRRGLLMGGASLMALCMLIITLIVKYIPTQSTGSVTNAGRATVAMIY
                     LDIIIYNCSWGPVPWAYVPEIFPTRIRALGLAFSMLAHWASSFCFSFSSPYMISNIGE
                     YTFLIFMGFDLLATVFTYFFAQETRGKNLEAAAGTEWEVAEKDVAPEGTAELGEAVVA
                     GTGDTILAEGEGRVVTVVAAHDTFGSGLKGIGLKHRS"
     gene            <209567..>210565
                     /locus_tag="TRUGW13939_08627"
                     /db_xref="GeneID:55996115"
     mRNA            <209567..>210565
                     /locus_tag="TRUGW13939_08627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491757.1"
                     /db_xref="GeneID:55996115"
     CDS             209567..210565
                     /locus_tag="TRUGW13939_08627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347650.1"
                     /db_xref="GeneID:55996115"
                     /translation="MAAKKTIVVVGATGNQGSSVAHTFLTRPNWNVRCVTRNPSSAAA
                     QDLASLGASVVQADLSDIDSLRTAFDGAHAIFVNTDFWGPYRADGKRTLGDSDAAFNM
                     EVDHGKNAAIVAAALPSLERFIYSALGPMKKHSKGKYPHSYHWDSKATIVEYIESEQS
                     NLAKKTSYIYIGAFNTNPLFMPNINPETGRHQFTNPLKKEQIMPMIDPVESTGPFVQA
                     LIETEEPGVRLLAYDSLLTMGEISNLWSKVSGKPADYVEVTVEYMNQQFGIPLEVLDA
                     VGYLPEYGYMGGVEGSIEPDQLKVKPQTASFEDWLKKQDWESILKSGEKLIGSVKE"
     gene            complement(<210911..>212620)
                     /locus_tag="TRUGW13939_08628"
                     /db_xref="GeneID:55996116"
     mRNA            complement(join(<210911..212253,212317..>212620))
                     /locus_tag="TRUGW13939_08628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491758.1"
                     /db_xref="GeneID:55996116"
     CDS             complement(join(210911..212253,212317..212620))
                     /locus_tag="TRUGW13939_08628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347651.1"
                     /db_xref="GeneID:55996116"
                     /translation="MSSVEVQEAKPAVAKGWDSLLPELHLAIFREFLALGEHVDHHYP
                     DSCREILETPSDWDLSTRRSWHMYRRRNVIAPLDTPIDQNTSKCDVCVDINSALTVCR
                     SWNILLKDQILRRLSLELIIYRGSSSLAESALLRWTVRAVKLSDGDDAPLPWILDSGT
                     DLLAVAVRRGLPDCIGPLADLFPSKEVMSLFGGDWVGCRCYAHVAAANGNVDVLRLLK
                     LHGFNLHQEDTRGRTPVCIAIRCNNMRAVEYLLSIENAKRRFDREALSYAVYFSPVTT
                     VELVAQHILERCRSWEERVKAYTTALSWSLRRHDLSTNDEAARYLVEALPDKHLVGMG
                     PKYIITAIHHGACVNLIKHLIDKGADVNASSPSHLEVPLETTISRGDEEIIRLLLDSR
                     AKCTPQALCRASTSTEEILDLVFGYYVYRDIDLYQCVTIGNSVVVQRLLAFGRNPNPS
                     TGSANALQMAVLRGSLEISTMLLEAGANPNHFVDNFMEGAWGTPLYIATIHSNIPLVK
                     LLLRHGADSTCSPHWRRKPVLHVNVGQGPMPLIKVLVEYD"
     gene            complement(<213134..>214611)
                     /locus_tag="TRUGW13939_08629"
                     /db_xref="GeneID:55996117"
     mRNA            complement(join(<213134..213345,213405..213564,
                     213620..213915,213963..>214611))
                     /locus_tag="TRUGW13939_08629"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491759.1"
                     /db_xref="GeneID:55996117"
     CDS             complement(join(213134..213345,213405..213564,
                     213620..213915,213963..214611))
                     /locus_tag="TRUGW13939_08629"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347652.1"
                     /db_xref="GeneID:55996117"
                     /translation="MFALRLACRRKCAVDLSRLSTHLLLTTRQKATAAATEASKTSRS
                     LKSPVYGFSETKSTEKIEEETITINELEDYYPVYIGEVIKSRYQIVAKQGYGVGSTVW
                     LCRDLIDNCHLTLKVCVRRTKQLSHELMVSEHLKKRNGSHHPGQKLVQVVLDSFEIDG
                     PHGQHFCLLYEPLGMKLTELITHMPNGMIPVDELQKVTQFVLIALDHIHRRDVIHTDI
                     CMNNVLQSIDDKSVFTRIEEDEFYRPIRYKKLHDRHIYYSRSPPVSTGPPILCDFGGA
                     RLDGANQEGDIMFRAYKPPEVILDMKWDHKVDIWGLGLMVWRMFEGVHLFPPRESGTL
                     DEEQHLAEMVSLLGPPPAEFLLRSPKCFKFWDEKGIWKGVIPLTNWSLEKKEKRLSGK
                     DHDLFLNFMRRILCWLPENRPAAADLVYDDFLMQAVLASVAGIPRA"
     gene            <217623..>218384
                     /locus_tag="TRUGW13939_08630"
                     /db_xref="GeneID:55996118"
     mRNA            <217623..>218384
                     /locus_tag="TRUGW13939_08630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491760.1"
                     /db_xref="GeneID:55996118"
     CDS             217623..218384
                     /locus_tag="TRUGW13939_08630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347653.1"
                     /db_xref="GeneID:55996118"
                     /translation="MHFSKIAVAIAPLIGFSAARPAQPSGSVPPFPSGTPPPLPSISL
                     PLPSFSIPLPSGSGFPWPSGFPWDKRDEEHHRHGSSSSVPFPSSSFPHPSVTPTPAAF
                     PWDKRAEEYPRYGSSSGVPSPSSSVPHPSSSFPHPSVTPTPAAFPWDKRAEEHHHHPS
                     GSGFPFPSGSGIPFPSGSPFPSGFPFPSGFPWDKRADDHHHRPHPSGSGFPFPSGSGI
                     PSPSSSFPHPSGTPPPKPTGGIPPAGFNLGFGFPF"
     gene            <219670..>221073
                     /locus_tag="TRUGW13939_08631"
                     /db_xref="GeneID:55996119"
     mRNA            join(<219670..219752,219824..220107,220164..220191,
                     220257..>221073)
                     /locus_tag="TRUGW13939_08631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491761.1"
                     /db_xref="GeneID:55996119"
     CDS             join(219670..219752,219824..220107,220164..220191,
                     220257..221073)
                     /locus_tag="TRUGW13939_08631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347654.1"
                     /db_xref="GeneID:55996119"
                     /translation="MCLPRIILCLITLLRLASSKRCVMYLTGQHDVVPDLSLVSDVTH
                     VALAFMSSSIFNTPDASTWPLFTSVERVREKFPVDTAVMVAIGGWGNTDGFSAAAASD
                     ESRKLFASNIQRMVNQTGADGVDIDWEYPGGNGEDYKQISNSKKKWEIDAYPKLVAEI
                     RTALGPDKLISAAVPGLRRDMIAFTNENIAALSDSLNFFNIMTYDLMNRRDNITKHHT
                     GIQLSLDAIDAYLENGLAPEMANLGLAFYVKWFKTSPDGGCSKNPIGCKTILMEDPTT
                     GADLGQAGAFSWHDSVPLELKDSFDRALGNGRYDPRGGGHYFWDKTENIFWTWDTPDA
                     IAEKVPSLVGRKQLGGVFAWGLGEDAPDFKNLQALTTGYQSIYEEPGQGATVHPPEKP
                     STPGGQSRDEL"
     gene            complement(<221534..>222130)
                     /locus_tag="TRUGW13939_08632"
                     /db_xref="GeneID:55996120"
     mRNA            complement(join(<221534..221942,222036..>222130))
                     /locus_tag="TRUGW13939_08632"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491762.1"
                     /db_xref="GeneID:55996120"
     CDS             complement(join(221534..221942,222036..222130))
                     /locus_tag="TRUGW13939_08632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347655.1"
                     /db_xref="GeneID:55996120"
                     /translation="MKVSSVISLIGLGAFAMADPATTSADSAITNAAEFLSAFGITAS
                     LPGAKATSLAQALYSLNEAQMTRSEANALAEAFATAVPSSLQDSIGEGGYTFQLDAST
                     TSEPSWFTYLPDSAQSELLLQESQILSVENEYLATTTSSGVASQQTIAAAGGVLAAGF
                     VGVVALL"
     gene            complement(<222924..>225280)
                     /locus_tag="TRUGW13939_08633"
                     /db_xref="GeneID:55996121"
     mRNA            complement(join(<222924..222954,223005..223186,
                     223239..223549,223617..223690,223752..223841,
                     223900..224074,224133..224786,224844..225091,
                     225144..>225280))
                     /locus_tag="TRUGW13939_08633"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491763.1"
                     /db_xref="GeneID:55996121"
     CDS             complement(join(222924..222954,223005..223186,
                     223239..223549,223617..223690,223752..223841,
                     223900..224074,224133..224786,224844..225091,
                     225144..225280))
                     /locus_tag="TRUGW13939_08633"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347656.1"
                     /db_xref="GeneID:55996121"
                     /translation="MFLSQFILKIIIALYLSSFPFSYAAVVTYNWDIGWITVNPDGEF
                     TRPVIAINNEWPSPTLRANINDTVIVNVHNSLGNQSMTLHWHGIFQRDNNANDGAPMA
                     SQCPIIPGASYTYKFKVDQPGTYWYHSHSPSQYVDGLRGPLIIHDPNNPYDYDEEIVM
                     TITDWYHGILECGSYLGEITLTKNTEQAADLHVEYLCNISRFLFCFDVFSVDELMKIA
                     VAKNPWGGASPVPIRALINDSPSTEFFVQSNRTYFLRVINMSALSSFLLYLEDHNFTV
                     IEADGVYTKPFTVDNLFFGSAQRYGVLLKTQPTSAKNYAMLAAMNVVDLDSRAIPNTG
                     FQPNASIPIVYNASNPIIKTAPYVYTFEIWDDNDLTPYDEAPLLGQGGVDQQFVLNLS
                     FFQQTTPGNEQYRSGFNNITYIPQQVPTLYTALSADYDAVNADVYGKYTNSLVLGGSN
                     IVELVINNLDETPHPIHVHGHNVQLAARGAGVYTHSNVKTDGPAIGNFGNAISEWDSF
                     GNQFNKSEDQVIFNSTPMRRDTWFINPLSFYIVRFRADNPGIWLLHCHMEWHMDAGLM
                     LTIVEDPLRLQDTQSSIPEQMQHICRKQSIPLEGNAAGNSDNYLDLTGQITIASLTYG
                     SAYPPTPIE"
     gene            <227304..>229707
                     /locus_tag="TRUGW13939_08634"
                     /db_xref="GeneID:55996122"
     mRNA            join(<227304..227683,227739..228490,228554..228980,
                     229035..>229707)
                     /locus_tag="TRUGW13939_08634"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491764.1"
                     /db_xref="GeneID:55996122"
     CDS             join(227304..227683,227739..228490,228554..228980,
                     229035..229707)
                     /locus_tag="TRUGW13939_08634"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347657.1"
                     /db_xref="GeneID:55996122"
                     /translation="MIGAVTPSSEIRDVANFSPLHFISRRNCASQSDCTPSGHRDMFP
                     SAIMRRNGKPQSCEPCRKSKLRCDHTRPVCGRCTARNMAQRCFYHPSPMTKRPASDSR
                     VSSSTQDTSYRSDGRYRAHKIISPSGSNASSPGMGVHLAPTASSRLQLAASPGYLGST
                     SYSAVLAEHQKEIPIDSEAPVGTMPNAIDPDSAQAGFRVLALLYNLTFLDGLIVRSYR
                     GKWYRIFPTSIIEKIVSVTRRLYDHFEASETEARLSDLSIQVFRNSFRPMPRSKDMTV
                     DEYVDTFTGENTRWETIALLLAIAGNAVLSCYEQDPVFAELRGYSDGQKENFQVKDQL
                     LSQLSDAASTCLTFCDHTAASNEILAYAQYTDVVVKTQQYGDSSYQAWRRLGDLSATV
                     YASGLHKVDGPADENCPFFLKQLRRCCFAAAFFVDKSVATFVGRPPLINFRYCSLALP
                     YDLDDDMLLVPGVAEQDVLKQVDVNGWDKDGIKRRTSIVRIRFLLSICRDEILEMALG
                     DGYQRDIPRKAEAILERAHKAWEQCPAHLRYDHLSQEELNNQLHWQHMAVTLLYMDYL
                     HSHFLLHRAVVKYTDAGQKPLFDTARSLLSTVLRLCNEREVTTDRSKQVSWVVLYYGL
                     PSACVLAFEILRQTHNPGPLHPSDVHLPRSEIIRNLSVFVSCLAWAASPSPSHGNYAV
                     CREVEKKLAHILDQILDPPPRVTAPPEDFSFVQNFASGLEGYLDWNQFNNGYDFNSDY
                     FAF"
     gene            complement(<229777..>230418)
                     /locus_tag="TRUGW13939_08635"
                     /db_xref="GeneID:55996123"
     mRNA            complement(join(<229777..229960,230016..230195,
                     230270..>230418))
                     /locus_tag="TRUGW13939_08635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491765.1"
                     /db_xref="GeneID:55996123"
     CDS             complement(join(229777..229960,230016..230195,
                     230270..230418))
                     /locus_tag="TRUGW13939_08635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347658.1"
                     /db_xref="GeneID:55996123"
                     /translation="MGSLRYAGLFATLVERDNNQTDNNDNNNNSSPGSQSVTALLGAV
                     LGIALLLAVYFNRRSRKDTEDPGGKSSLERLKRLEAVSPTRTLGEWWPTVKESLGLSQ
                     SVDSHFVCVICFDQVELSHGIHELKCMHVFHKQCLEKWYLRSHYTCPMCHQQFFHERS
                     RPAHDYIWMV"
     gene            complement(<234033..>235080)
                     /locus_tag="TRUGW13939_08636"
                     /db_xref="GeneID:55996124"
     mRNA            complement(join(<234033..234432,234488..>235080))
                     /locus_tag="TRUGW13939_08636"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491766.1"
                     /db_xref="GeneID:55996124"
     CDS             complement(join(234033..234432,234488..235080))
                     /locus_tag="TRUGW13939_08636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347659.1"
                     /db_xref="GeneID:55996124"
                     /translation="MPSLGNFFHTQLIAKIPVPTSSFASKTVIITGANTGLGKEATRH
                     IARLGASKLIIACRNTSKGNSAKLEIEASVNCKPDVIEVWELDIESPASVQKFVERAN
                     KLPRLDVLINNAGIQTINYQVVYGTERTLAVNNIGTFLLALQLIPKLKETANKYEVTP
                     HLTFTGSALYDVAKFPENYGDNIFDWYGDESHSNRMNQYNLSKLILLYAIIKLASIVN
                     SDATNPIVVNTLDPCFCKTGLPGELHGALKVFMRVFEALFARTSEEGSRLVVIAASAG
                     KETNGKYMRAGAVQEYAPFITDKAGVEKSNTIWEQLGQRLEKLQPGILQNVNSF"
     gene            <235394..>237835
                     /locus_tag="TRUGW13939_08637"
                     /db_xref="GeneID:55996125"
     mRNA            join(<235394..235473,235533..235896,235983..236208,
                     236270..236301,236367..237725,237779..>237835)
                     /locus_tag="TRUGW13939_08637"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491767.1"
                     /db_xref="GeneID:55996125"
     CDS             join(235394..235473,235533..235896,235983..236208,
                     236270..236301,236367..237725,237779..237835)
                     /locus_tag="TRUGW13939_08637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347660.1"
                     /db_xref="GeneID:55996125"
                     /translation="MAAVAQLHKAGRRNRIPLSCDPCRSRKLKCNREQPCQNCTARDE
                     LSACKYKGSRNVSTPIAHHEAHGDPMQQRIDHLEGLVKKLIETQRKDSTVGGSDVGNP
                     HPRSKHASLDVASDASDVGHSTGTTVIDSTHSVYRGADDWFDVLQEINQLKKFWNQSQ
                     DDQASYHDVQPNLSHMVDGSSLLFGHVKPVEKMEILATLPLKSEVDRMIPWFFDHENF
                     PIIVPPILHEATFMSEYGEHWKNPSKTNIIWLGLLFSILGITMLAYRQVGEPPEYEGL
                     SESLFQLYRIRTAQCLLVGDIAKCLPYTLETLRFNATAELNRKDDNSRGLWIMTGVIV
                     RVAINMGYHRDPSQLSSISALQGEFRRRIWLSVASMDDMSSFGGGFPRMIPAIYSDTM
                     EPRNLHDWELSFDENTTNLPPSRPLMEYTPVSYMIVKGRVFRALGRIADFNNNPTLNS
                     SYETVLEIDKALSEAHIQIPPYMRIHLEQDSDECPFDQTSKLAFSSLSVECMYHKGMC
                     TLHRKFIAKARFNSRFDLSRERCITSALALLSCQRFLVPSWYQFSQSRQMLVLAAMVL
                     FLELELRRRDSTDMQASSSILHALEKSCGFWKEARSSCEEASRIHQTLARMLSSFRDG
                     PTNSSATAVTTTSPYHAMITPESFEDFPRPMLTSSPSQPTYDEKGFSLERDLFTMPND
                     MEIDWATWDSFIEGNGFEDGALY"
     gene            complement(<238611..>239658)
                     /locus_tag="TRUGW13939_08638"
                     /db_xref="GeneID:55996126"
     mRNA            complement(join(<238611..238831,238897..239494,
                     239557..>239658))
                     /locus_tag="TRUGW13939_08638"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491768.1"
                     /db_xref="GeneID:55996126"
     CDS             complement(join(238611..238831,238897..239494,
                     239557..239658))
                     /locus_tag="TRUGW13939_08638"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347661.1"
                     /db_xref="GeneID:55996126"
                     /translation="MIKIALAGTSGLSQYIAHYISTQTSHQFFFLSRTPNPGLTAKGW
                     QVLPVNYDNLDDVRYKLVGVDTIISTVTGPAQLSLIEAAAEVHVRRFVPSEFEGPLLQ
                     RPATNDPLDRGQKSAMSLLSEKRDQYGMQFSAFSCGVFYERFYPGGMAALQLGAGTYI
                     CGEGDYVVNVQQRTAIIPFHSSSDVCISMTSAEDVARYVVAALDLPTWPDEFLLAAER
                     MKVDDIVTAIEYFVCGVEFQRQYVSEEFLTSAISYAQSTGNTSETWRLRHLMATLQGR
                     YDFPGASLEQLIHDPPKQFVDWLVAAWCAA"
     gene            <241759..>243671
                     /locus_tag="TRUGW13939_08639"
                     /db_xref="GeneID:55996127"
     mRNA            join(<241759..241949,242011..242122,242193..>243671)
                     /locus_tag="TRUGW13939_08639"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491769.1"
                     /db_xref="GeneID:55996127"
     CDS             join(241759..241949,242011..242122,242193..243671)
                     /locus_tag="TRUGW13939_08639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347662.1"
                     /db_xref="GeneID:55996127"
                     /translation="MPTLEDSTSSSIAANSSSPPQAYASEPANLNYAFLVHSQKTLTQ
                     NLPPRVDNKLLARQKRRRTSPEDHAVLEAEYKKNPKPDKAARTSIVSRVALGEKEVQI
                     WFQNRRQNDRRKSKPLEPHELVGPRASGSAADAPPSSQNTGLSQLGFLFGSDDQERNE
                     DEDTKAEAEPDEGDVVPSVCNNSSDVDLPSSQLNGEIPSSQTTHPLSETANQEKAVEK
                     PESIAGLGIDVMSRKRAFSEVDAVPPPADAQSTQVEFKSPPSLRISMSFDGKALVRQK
                     GEKTPSPQKPRASARISMSSDGEALIRTEDEPSPSKNRMRMVPSRTRRQSGLRRSTSA
                     VAFGGLRPAIADREGEPKPFGRSRDARMWELYCDTDARSALSTPASSQGTTGARTPGL
                     YRSGSHRSLARTSSFSRSTFSARPELDSHRAAVEFSGEKRRKLGRTVSSLGRLESVQR
                     VGLADRYPGKAQQVAGKASSKDQTEELEQDAGDSDKENWLPGTQERAAPRRHRRVASH
                     APRAVLKENGLRKNTTVDDLALAAGGKKSRATRGLRGSNKENEFSHPGKIDAEVAAFM
                     SKTGSSSREEDLDCIQGLLSLSQGAWR"
     gene            complement(<244240..>246260)
                     /locus_tag="TRUGW13939_08640"
                     /db_xref="GeneID:55996128"
     mRNA            complement(join(<244240..244269,244331..244600,
                     245194..245702,245774..>246260))
                     /locus_tag="TRUGW13939_08640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491770.1"
                     /db_xref="GeneID:55996128"
     CDS             complement(join(244240..244269,244331..244600,
                     245194..245702,245774..246260))
                     /locus_tag="TRUGW13939_08640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347663.1"
                     /db_xref="GeneID:55996128"
                     /translation="MAQDNRPFLFPKRERLPTIHEDCCTTPQPSPKRSSYFHFFSCTG
                     LVICLLLMGRKLTTHTSIFNNKNIYPGLCNTTLSKLELVLSTTRGSNISWIHDHLSSW
                     PANIYRLDDPHTLSPSVPSTKGGQAMAYLTFIIDRYRTLPDVTVFLRDKRYIWSNDNP
                     LYDNVISVVDLQTSFVQSAGYVNLRCALQWGCPAQLEPAQLTREKTINTLKPAELEYP
                     FEFINLFPGVELPEVVGVPTGNQFAVSRDKILERPREDYIKYRQWLMNTPLEDEVANE
                     ILEYSWHSKLSLLKYLFKEQRSDSNTVIFGKPPQYCLNPQECYCQTFGRCDLRESDHP
                     KTPPQVKGKQDAANGFSRASAKFCESRRISLQIQDDLDKQVHGRNTVKAESPPPMLAN
                     ASKDEKELQLDVLLSIDHNLDRIAKTLEELVESIPLVAK"
     gene            complement(<247041..>250795)
                     /locus_tag="TRUGW13939_08641"
                     /db_xref="GeneID:55996129"
     mRNA            complement(join(<247041..247159,247231..248287,
                     248346..248816,248903..249879,250009..250300,
                     250355..>250795))
                     /locus_tag="TRUGW13939_08641"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491771.1"
                     /db_xref="GeneID:55996129"
     CDS             complement(join(247041..247159,247231..248287,
                     248346..248816,248903..249879,250009..250300,
                     250355..250795))
                     /locus_tag="TRUGW13939_08641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347664.1"
                     /db_xref="GeneID:55996129"
                     /translation="METIVHDSELLTHHVAAVAVPDSRRFIAVRDENGLLMLFSIGTD
                     DKIHISKITLSGQRLVLDFGLMLGLDDQYCAHAIDVVQDAASSTLYIAVATSMPAGSG
                     SAVYILRPFTPREADLGSPSTRLTSFLMPETGSPAQPPRIFSIYMGVSRAGARFPPLL
                     LAYQTEIHKSQDLVRVEVVDDQSGTAQWEWARKDDIALPENAAKIFAVQPVTFRLGSS
                     KVLRGFVTLYEIQGRILDPLWLPRADHARDIATLQGAEGYTDLVVGGAGLYAFKGTEL
                     AAPKMKLIATDGVFAAVKTLQVTQSPVGISIWAENTAQGIGYLETDLALAPLKLPVQV
                     IPDGAGGYFCPLKATVSDPEKFISASPDGHLLLLEHDSVSGLWTATPLVTPALTKIID
                     VTAYMTQLMPLSAAGVPVLSSPVTLRASGEVSIIVNGRPVVATPGGVTVMTDQAGYVT
                     LVIPTDDISSFTFTVSAVGSDPQLGVTVDPSSPVHERLSKALEQDLEDVTLPDGTRLM
                     QDSPLDKEQIDAAADALKAALKQRQYLVAGVADANRPWEAPVGYRVDEICSTPPEGIK
                     DMFWDGWHWLEHQADKVMSYVIDGAQFLVKIAGQTYRWVMKTLTQIAKAISWLIKKAL
                     ELGKKLIQWLGFVFDWKDIKAAQQSIVNIANDGIDWAAGNVSKLRDKVDTFFAQMEHS
                     LGQKERPSSSDVDAVNGMADDASASKDADKDISRRSVTANWTRYQFEHGGARDGAVVY
                     YPGDPDGAWDAQLQGFHSQFEGQVVPLQTNLVDDYGPTGKRSLSTKSAFERILADFLA
                     QVVGGVKGLTKSVLNGVETLFGKLKDFLNAKIDIPVFSALYKLVTGDDLSVLNVMALI
                     IAIPATVIAKLVSNAALPTFQAGDYHSMMDQVVRGTVAEQGLLPFNKFANIAGLAAMG
                     ISTLFAVVSFGGLHSGGRPPSTSPSAPLAALAAAAAAAGNGNAFNWGVLIDTGLLFYH
                     LFSVPSNEKLPAHVLRLASWLVSMLSSLVAFLLHLSAKFIGELKDKIRAVVDVVIEVI
                     TYALEITIRVKETQTIWEGKDDVWSMVDCAGHTFLLVGISGGALKTLSPGLAAQCIGL
                     GGGIGILGVHGITSFAKEKFCDPPKYVGSA"
     gene            <252187..>254079
                     /locus_tag="TRUGW13939_08642"
                     /db_xref="GeneID:55996130"
     mRNA            join(<252187..252222,252289..252506,252564..252727,
                     252780..253505,253558..253678,253731..>254079)
                     /locus_tag="TRUGW13939_08642"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491772.1"
                     /db_xref="GeneID:55996130"
     CDS             join(252187..252222,252289..252506,252564..252727,
                     252780..253505,253558..253678,253731..254079)
                     /locus_tag="TRUGW13939_08642"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347665.1"
                     /db_xref="GeneID:55996130"
                     /translation="MSLPRLDAATSGIIAVSQEAVNDALYYLFDKHEELRTIHSSSKY
                     GELQADMDTAEVSLLVKKAFDTVMFYCNFRSGTFRLKVGNRQPRNTSIDVTGWRFAFE
                     VKYGKLVVTDTSEIDEVKSKIGQPGEYSIERMFLDFTTNKIIYFDKDHSDFKGHVWDE
                     DDLDIFLGVMRRWGDGKEGTMKDPKLSSFGYCIETQAPETVNIPAPSFPPTALRHQTY
                     PYIGPGKHEPDEGLVTGKANMLLYVEMTQHKEFPTNVPVPYTGNFVEPGMKATACVSS
                     QVFWDSYLLRDPSSTLPCLLQDFNRQLFPWHNSLRAKSDQNDFYLHWNFGFGGSDATS
                     QLARANMDFGWQKLSPTSWGWDCAPEPESGEDSTWWPVYMGMKGTGTGFMKNRIYIEP
                     ANNKIILEGSSVLSLDGAYYFTKLHTGTLNKHLIIKWYTEIEMKSVHDGGIEMKMNPA
                     TLEEIFKATYNDGTIPCGGEKEPDLPGVPEDWADAFNHINFNSIIDSLTTALRSTSRF
                     VLSGGDVFFYKNPIFNNHGDLLVEATYKG"
     gene            <255977..>257932
                     /locus_tag="TRUGW13939_08643"
                     /db_xref="GeneID:55996131"
     mRNA            join(<255977..256243,256297..256334,256390..256778,
                     256830..>257932)
                     /locus_tag="TRUGW13939_08643"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491773.1"
                     /db_xref="GeneID:55996131"
     CDS             join(255977..256243,256297..256334,256390..256778,
                     256830..257932)
                     /locus_tag="TRUGW13939_08643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347666.1"
                     /db_xref="GeneID:55996131"
                     /translation="MECKANYLSQLALRLDYSTSRKRRTGPHPASVGRKLPLSANVYY
                     LALMGKTPHVGVIGAGVSGLRCADILGQNGVKVTILEARDRIGGRITQADVGGYSVDL
                     GANWIHGTEGNPVDQISRISGTTTCEWDGEETVFDTSGKLLDEATTLKIAEWMWTTVD
                     KGFDFSTRSKDTIPPEMSLFDFCCQQLEQTDFTAEEKAACKEFAKFWGAYVGEPVERQ
                     SMKFFCLEECIEGTNLFVASTYKNILSHISQLALQRADLCLNSPVVSIQAAKRDLTRD
                     RQITVTTAGGQKYHFDDVIVTCPLGWLKKNKSVFNPTLPPRLSSAIDSISYGRLEKIY
                     VSFPRAFWNIPTKHTPNGGGEMTVVNGSDITLNVNTGHHPPVHTQWLQPDYVKAPSTE
                     GSWNMQCVSLAALPENCAHPTLLFYIYGPCAAHVVSNIKDLDEASPAYYEFLDDFVRP
                     FYSLLPGYSNSTNCKPTDFLASKWISDDYAGNGSYSNFQVGLEAGDKDIETMRIGVGP
                     DRGIWFAGEHTAPFVGLGTTTGAYWSGERAAGQICDLYSLGQLGLGVRKDDSLPMGTN
                     PGVSSGNTMFHKGNNASPRASTTILATAVESQ"
     gene            complement(<258156..>258773)
                     /locus_tag="TRUGW13939_08644"
                     /db_xref="GeneID:55996132"
     mRNA            complement(<258156..>258773)
                     /locus_tag="TRUGW13939_08644"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491774.1"
                     /db_xref="GeneID:55996132"
     CDS             complement(258156..258773)
                     /locus_tag="TRUGW13939_08644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347667.1"
                     /db_xref="GeneID:55996132"
                     /translation="MADSDFPPTFSIPTEHLHISYFQPDDPAHAAFLVQLWNTDDFIQ
                     SCGKTGIDNTEKAAKFLRNQVQAGYKRNGHHQFLVSLKPHVGATLSESKPIGIASLMK
                     GEPPNAYSRPDIGYTILPDQSGKGYATEAAASLLEYAQKSLGIDGVFGFCGKDNKRSA
                     RVLEKIGLEYRGQRKLKLFGGSESAVYALKGMDQDLKVYGVDDDE"
     gene            complement(<259175..>260845)
                     /locus_tag="TRUGW13939_08645"
                     /db_xref="GeneID:55996133"
     mRNA            complement(<259175..>260845)
                     /locus_tag="TRUGW13939_08645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491775.1"
                     /db_xref="GeneID:55996133"
     CDS             complement(259175..260845)
                     /locus_tag="TRUGW13939_08645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347668.1"
                     /db_xref="GeneID:55996133"
                     /translation="MTAPVIIVGGGLAGLVAATELAKKQVHVVIVDQENEANLGGQAF
                     WSLGGIFCVNSSNQRFLGIKDSRELAMQDWFNSARFDREDDFWPKKWAEAFVNFATDH
                     METYVKNAGISFANVGWAERGDGSATGHGNSVPRFHLTWGTGPAVLEAFEKPVREAAK
                     KGIVDFKFRHRVDELIVDESTGAAIGVRGHILEPSDTARGVASSRETIDTFELYGSNI
                     VITSGGIGGNVDMVKKNWPVDRLGPHVPKSFVVGVPAHVDGRMIDIAQEAGANVINSD
                     RMWHYTEGLHNWNSIWPQHGIRVLPGPSSLWLDATGSRLPAFLFPGCDTLATLKHICS
                     TGYDYTWFILDQTIISREFGLSGSEQNPDVTNKSILGMLWRIFGSSPTGPVQAFMKHG
                     EDFVVESSLSDLVAGMNRLAKERDGPQLDVEDVRREINLRDMQFENQYSKDAQVMLIQ
                     NARNYPTEKRGRVAKPHKILDPKHGPLIAVRMNLLTRKSLGGLQTDLDSNVLRPDGTP
                     FPNLYAAGEVAGFGGGGVHGYSSLEGTFLGGCIFSGRAAGLKVAEQVG"
     gene            complement(<261747..>262730)
                     /locus_tag="TRUGW13939_08646"
                     /db_xref="GeneID:55996134"
     mRNA            complement(<261747..>262730)
                     /locus_tag="TRUGW13939_08646"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491776.1"
                     /db_xref="GeneID:55996134"
     CDS             complement(261747..262730)
                     /locus_tag="TRUGW13939_08646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347669.1"
                     /db_xref="GeneID:55996134"
                     /translation="MTESLVPPEQIRLPPSPSPSPSRSSSRDNNPMASDKATSDAFLS
                     LPIRPPSNSFLVPPRNRSPLSRTHARSRSLASTLPHGMTRAHSSPGLDSRGRYEQPPN
                     IPRPESPMERAMRRHSPLRGLDDIRPLGSGSLNISETISEHAELELSQNPWPASPEIP
                     TSPPLPPPMHNTFSRGARRPYTAPLHTSFVSVTSNPASSSPSSSHSSPVMLPTKFNEP
                     FPAIPASSGSSMPSTPTSLRSRSPSISSLETIPDIPDEEAEAVEAEEIARLKAAADNA
                     DADSMRRRSNLENPPSGTTRGYGPRADKRKRWSVCGAERRQDLDLETIWED"
     gene            complement(<263616..>265593)
                     /locus_tag="TRUGW13939_08647"
                     /db_xref="GeneID:55996135"
     mRNA            complement(join(<263616..265409,265477..>265593))
                     /locus_tag="TRUGW13939_08647"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491777.1"
                     /db_xref="GeneID:55996135"
     CDS             complement(join(263616..265409,265477..265593))
                     /locus_tag="TRUGW13939_08647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347670.1"
                     /db_xref="GeneID:55996135"
                     /translation="MEPLIGPQPPPKVFVLCFDGTGNKFSGDESDSNVLKIFRMLDRS
                     RGTQFHYYQPGIGTYVTSTSLSSTGIVHRIRSAYLKAKDSAVGSSFDQHVMGGYKFLM
                     RYYVPGDDIYFFGFSRGSYIARFLAEMLDYIGLLEAGNEELIRFAWKTFAKWQQRRGH
                     TEDDEEEKKRLFNYMKAFRETFSRPISRIRFMGLFDTVNSVPRFESAWMQRSKFPYTA
                     RSSARVIRHAVGIDERRAKFRQDLISEGKPWHERRKHREHYLRRHIHLHHEKPEEVPK
                     ITLNNDAEGVKVGNAEEEPEKATHRRGREDGDSVYRTPRGSSAGSSRNLDRYRAPSPA
                     RNVSQNLIVPDRNASAEDVSSVHSDTASLQVPHLELLGPQDEEDQDIREVWFPGGHAD
                     IGGGWKLEKEEHWPLSHAPLVWMVQEAIKAGLSFDAKKLKQFECSEDYVGQYSPIREL
                     EEEPEWCLDESHEPSQNGVEEVTIKLPEDHTEGDRKANKSVHRFRSALEYSSTKGKLH
                     DCLQYGEGLPWSSVLSWRIMEYLPFRRMDLQPDGSWKPIRWPLPCGEVRDIPTGAEIH
                     ISAIRRLKYDPTYRPGNLIIGGGGRGTRRATAEHGIGKWLPNSHEGDVVRATYIRQIE
                     TKQAENGTEKER"
     gene            <269297..>273222
                     /locus_tag="TRUGW13939_08648"
                     /db_xref="GeneID:55996136"
     mRNA            join(<269297..269793,269845..270086,270134..270338,
                     270396..270536,270588..270678,270731..271061,
                     271118..271461,271514..272049,272106..272520,
                     272583..273102,273164..>273222)
                     /locus_tag="TRUGW13939_08648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491778.1"
                     /db_xref="GeneID:55996136"
     CDS             join(269297..269793,269845..270086,270134..270338,
                     270396..270536,270588..270678,270731..271061,
                     271118..271461,271514..272049,272106..272520,
                     272583..273102,273164..273222)
                     /locus_tag="TRUGW13939_08648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347671.1"
                     /db_xref="GeneID:55996136"
                     /translation="MMRRLSTAFKKKDESKPKENGVSNGKANGKRQSKVFAKSATAEV
                     EEDHSAARDDVLHIFERHAQVIHASRRPLPTQSGDGTYLEHGHDHTSSLFQDLRTLGF
                     KDYSTLVDVMKNKASGELVDDKTYLMERIIQLVSGLPSNSKHRTELTNAFLDELWENL
                     PHPPLSYVGPKYEYRSADGSYNNPTLPWLGAANTEYARSIAPLTIQPGGLPDAGLVFD
                     SVMARQKFTPHPNKVSSVFFAWASLIIHDLFQTDHRNPHLSQTSSYLDLSILYGDNQE
                     DQNMIRTFKEGKLKPDSFSEPRLQAFPAMCCVLLVMLNRFHNHVVEQLALINENGRFT
                     KPRADLPAEQAEKAWKKYDEDLFQTGRLVTCGLYINITLYDYLRTIVNLNSTSSTWCL
                     DPRARMSSAHTTPSGLGNQCSVEFNLAYRWHSATSANDELWTENVYKELFGKPADEVT
                     MPELLMGLHKYEQALNPDPFQRTFGHLERQEDGTFKDDDLVNILTSAVDDVAGSFGAR
                     NVPKAMRSIEILGIEQARKWNCGSLNEFRKFFGLKAYETFEDINSDPSVADSLRHLYE
                     HPDYVELYPGIVAEEAKEPMVPGVGIAPTYTISRAVLSDAVALVRGDRFYTTDQNPKN
                     LTNWGWQESNHDLNINQGCVFYKLAFRAFPNHFKADSIYAHYPMTIPEKNKEIMKNLG
                     READYSWDKPSYTRPRVELTSHEAAKRVLEDPRNFRVTWGDATASVFGEKTGTDHMLS
                     GDTPFHSQQRELLEKALYSPGWEKQLKEFYEEMTLQLLHEKSCTIAGKKQVDITRDVG
                     NLAPVHFAAHVFGLPLKTKGNPRGLFTEHELYMSMSVIFQAIFFDYDLMRSYPLRQAA
                     KAVAAKVGDVVEANVKSIGSTGIISHFIDGLRKHDNPLSGYGVELIKKLLDGGLNAHE
                     ATWTQILPTVVSMVPKLGQVFTQIIDFYLSEEGKAHLPEINRLAKQDTPESDDVLAHY
                     ALEGIRLNGTYGAYREAQRDVTINDWGKEVNITKGEKVFVSFVGAARDPNVFPEPEKV
                     RLDRPLESYIHYGEGPHTCLGRDASRIALTAMLRVVGRLDNLRRVSGQQGVLKKIPRA
                     GGFYVYLREDAGSYSIFPTTFKVHYDSELPELKRRGTW"
     gene            <274686..>281411
                     /locus_tag="TRUGW13939_08649"
                     /db_xref="GeneID:55996137"
     mRNA            <274686..>281411
                     /locus_tag="TRUGW13939_08649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491779.1"
                     /db_xref="GeneID:55996137"
     CDS             274686..281411
                     /locus_tag="TRUGW13939_08649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347672.1"
                     /db_xref="GeneID:55996137"
                     /translation="METWRDRGFVPDSDEEEEYDSQDYAKVAPLQDEDKALETAGLPV
                     TQEDSKAPAEARVPDDREEAHWHERSQQSVELVSDDELHQTSLSQKAQYTRRTFRRNS
                     PFIDPKPFAQNDHSLDNDSPSSSEDELQVVDVPRRKPAFNAAPKTPATPAQQLDLILQ
                     DDESLSSLSPPPSTIVSPQQSQRESQGNVVLPPIPQPPSEHSVMGDTNNARRELTLNE
                     LKDIFPSLDIPADILQELSQPMQRSLRQRNPIQLHPYLLEDAKYRGLLKGTGLRPIRV
                     PLANPDAPRPQNQDESQGSDLGPAAPPSSSPSADFVPPPSSPPDPYSPLRPREQHRTP
                     ISLPRNLPSDSHATKRRKLFHNGGEKNDRSKQLSMQIVIDNTDLSLDNETLTVDALLS
                     PPHSGSLSSAGTVRPDGFRFPRGFIPPKTAPTTTIDLTPSGADDMAELDEMEIDEPVE
                     DVEDAPAPGDDDTYEEMTQLAKDREVKKLQRRIKGVLPASWLRLDLKQKATQAAHEKR
                     QRDLQTTQAEPARGVARKIAKAKRTDVDPSERRRPLELSVETSSSEDEPAPLAQSLDA
                     LADFAGFDDPFQEFGRNEDNGDIPEDNRIDDTFPSIPRSSYGPRKPRSNKPKTHGPKE
                     TGQLNPATTRRHIPRQRQTRLDDNIHRPRSHPKPRPRAPRLSILDAPDVATRSKTEQP
                     QFLRIAARQARSRRDQGRSSPSRKVFKMVDRNDTEDTNKILREWKSGAMKQTALLAPR
                     IQKKVRESSKGVLKINRKSSKEHPASVARTPQQQVTKKARTRVLESLSSESENEMRAH
                     HAASLAAKRAEHTDKRKPTRLGDKWVVPRAFGISSLKRNAPRTAEFEVGLENNRPSDA
                     SFKTSLDALNRTYGRDYGRREFGQSITLDRFLAQASPLSQRNLNKKTAQKLPLPQTVP
                     FESRDQGKKRPAKKRPPTRLAMDDDVDDALQIPSFFESNGTSVNTADGFQQPKALYHL
                     KNSATLSVDFKMMPLRVGTFFHDSTFIGRTEFSRSLDLKSRDLDQSAGFSVIRIGDQM
                     FRWGAWNDAVSSEFGSVVELIMKDTNTHDPQTEATPTQHDNLQAFVSLIRYVTEKLHF
                     MDSVDRKAFVGRAIHISAQLRDYVTLTAPLGDGKWKQCIRLASLNLVFANQARQIADH
                     SLVDPSKLDNAVRVVKDLCRQVLSLVFNKLGLAEVRRFYEDNKIADRREAGIHDNFPS
                     VEAYVVVFQLLQSSDIFQKWFQDITLSLANDASAFADVQPLEDTWKAIFTTIPLNEVD
                     KFGIARPGLRFQCKHDNWPVVQRLINTVLDAYDPESKSQLSYINYCRVLFHRCFVLMA
                     SWGWRDCKPILDTLFDFFAKHTLYNLKNEQSFGSPSFLDYLDKNPSLEVQPGDSCFHI
                     FLKIVGSGLRYLSGIYGKKKIMNFAWRLLPNHGRVYPKEKMLHHEDLDSLRNHHDLLC
                     TLYWAVPDGCRPRVETIRDLVDPATSHFETCNLSIRSWRRLSQFKLSTDEDVSGLKPF
                     ADWYEYFVSELVRQHTLARTEVEAQANSGGSFSKQLIESTIAQNQRQIESLISSTLGG
                     MKSSIDTARSMDQAYHIMTGVPFGKLLGLFNPTQARVNGVIKETLQVIIGFIEKEDTA
                     SISKPAAPIANDDSQEYGDWSAIEEIYDAGRDVPESSETILYLKNKVQPDVSQLVSNC
                     FGEDRSPEDSLLLKTTECWACLAQVLVKHGLHSWDSYINPYGRLSWTALRTTSQTKKF
                     TPQFLASCIAKNNSLITECRTQVLAMWMTCLVERMSMLKFQHRLTEAVMNEDRESPLL
                     QNLPFHLDRKDNLYHITLSELTERRISLISCLLSNMREHLQNLEDSAAQGLTTKREEY
                     KELIMTLMSSMKANYQELGQQGNTVQGKYVEFVQRIVGFLQQHSQTICPIDKFFTDPT
                     SFPLPADDPTYIVARLKSYGVRLSSTKIAKQLVMFLQSVAERTAVDGQQGYLIEQLCT
                     CTSETYETGDSNKPTLRSFLLQCVFPAYIECSFNKAGAWIFVWPILQATSRILSEMIY
                     DIDINDTSCMSSVASMIEAVFYSIRYAIRLTVDHPGLLEESPVLVTMQAFVGIMTSSL
                     QILDYMKRAAVISDVIVSLFDLLRKNILFAATMLLDPSMAVNPELGDSLLETTGQLSP
                     ALHSESRTFATNQLQTWLRTSWSVHDGKYFLRRGQQTIEIDCGVVKIKEVQTLENAKA
                     GFLNATEVFLTRVNILDLLDERALEPTKRVNKTTKMHDYDDLTDEMDALLL"
     gene            complement(<281610..>282071)
                     /locus_tag="TRUGW13939_08650"
                     /db_xref="GeneID:55996138"
     mRNA            complement(join(<281610..281647,281723..>282071))
                     /locus_tag="TRUGW13939_08650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491780.1"
                     /db_xref="GeneID:55996138"
     CDS             complement(join(281610..281647,281723..282071))
                     /locus_tag="TRUGW13939_08650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347673.1"
                     /db_xref="GeneID:55996138"
                     /translation="MPLPYRTIITINNQLDTDLYDFDPKIQTGSISGVLPDFIRAGTE
                     QSVCVRAPSSFAGSSGAILCKTYNHDKKRDERLAFEFKCVNEEANFVKFSNSMPELIG
                     VKIDPYTPTDHPLYATYTITQENPAD"
     gene            complement(<282385..>282954)
                     /locus_tag="TRUGW13939_08651"
                     /db_xref="GeneID:55996139"
     mRNA            complement(join(<282385..282458,282527..282709,
                     282786..>282954))
                     /locus_tag="TRUGW13939_08651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491781.1"
                     /db_xref="GeneID:55996139"
     CDS             complement(join(282385..282458,282527..282709,
                     282786..282954))
                     /locus_tag="TRUGW13939_08651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347674.1"
                     /db_xref="GeneID:55996139"
                     /translation="MPTSYNTVISVTNNLKTDLRDGRLAISKGSTSQNIPTLIAGGNT
                     REIVVEGTDIENEIHGSEGTLSYLAQAGDADERIAFNFKCNNSEDNRVEMDCKKDDYF
                     NVRIDPFAPNDRPLHASYTISKPGFVEDAVKPRGFDYSD"
     gene            complement(<283350..>284440)
                     /locus_tag="TRUGW13939_08652"
                     /db_xref="GeneID:55996140"
     mRNA            complement(join(<283350..284067,284139..>284440))
                     /locus_tag="TRUGW13939_08652"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491782.1"
                     /db_xref="GeneID:55996140"
     CDS             complement(join(283350..284067,284139..284440))
                     /locus_tag="TRUGW13939_08652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347675.1"
                     /db_xref="GeneID:55996140"
                     /translation="MLGKIALEEAFALPRFHERTRWWASLFAVDPEKHALEITDITTQ
                     RIKYMDEHGVGYTILSYTAPGVQDIWDPAEAHALATEINDYIAPIVKQHPDRFGAFAT
                     LSMHDPQQAADELRRTVTQHGFKGALVNDTQRAGPDGDDMIFYDGPEWDVFWSTVTEL
                     DVPFYLHPRNPTGTIHDKLWAKRKWLIGPPLSFAQGVSLHLLGMVTNGVFDRHPKLQI
                     VIGHLGEHLPFDLWRINHWFEDVKKPLGLKETCEKTIREYFAQNIWITTSGHFSTPTL
                     QFCINEVGADRILFSIDYPFENFADGCVWFDKNLELNEIDYRKIGKDNARKLFKVGDY
                     KDAEA"
     gene            <284866..>287198
                     /locus_tag="TRUGW13939_08653"
                     /db_xref="GeneID:55996141"
     mRNA            join(<284866..285268,285320..285519,285572..285969,
                     286019..286615,286676..>287198)
                     /locus_tag="TRUGW13939_08653"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491783.1"
                     /db_xref="GeneID:55996141"
     CDS             join(284866..285268,285320..285519,285572..285969,
                     286019..286615,286676..287198)
                     /locus_tag="TRUGW13939_08653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347676.1"
                     /db_xref="GeneID:55996141"
                     /translation="MPRPKVRPEDRQRSSKACLPCQASKIRCDSQSPCMSCVRRERAA
                     ACTYIESNSRRRSHRHLRDRPIRFVSRMNPEGAAASSTPTRASRSVANNVNRNDDGQV
                     KPLLANGLPSTSVVESPECTESRVLLSSKGERVYIGETSALSFLQFLRGIMKQYMGPS
                     SFTENGPLNIMLEADENEDRTVVLEESIEDKRELIQAYFEASSGFLDLFKKSDIYKVL
                     QTENSSHKKRLTKEDLAILYLVIAIGGQCRGANPTDHQYAVNYFSRGQQLGFDGMLKH
                     PSIHMVRIFVLMAFYMLGACHRNAAYMYLGVASKAAATLGLHIKRQYQGLSEEEYYIR
                     WRVFRSLRVFDLVVSTPLGRPVSSLPLDHDGSPLPDRMQNTDGEAVSAAFAGSKLLDE
                     IVQKLKTMDNNLDSETAEHFLHRLRLWINNLPPEFRHLAADNDTVPLVREKAIGSIHV
                     SCIYYFAIILTTRSFLISHLMTRLKELSILTPGPAGSPSTQGNTSTKIPQLANVCTQA
                     GAYMANMCEKAMLSGLLLRNMCIVKAWVFAAGLILGSSLFVYDDTETRGETESAFQSA
                     RHVLRNLANLSPQAKHYDEILTSFAEAIVKHRQHVVSERQKAAKQYIDCIFDIDITPT
                     AGRGERCEIDDGDGEDVDYFYPVFDESIPGAVFGGLDNFPGVESSNLDNTSVDLDGFS
                     GFSFQDGANWSIDHEPFGLLFEGM"
     gene            complement(<287391..>289453)
                     /locus_tag="TRUGW13939_08654"
                     /db_xref="GeneID:55996142"
     mRNA            complement(join(<287391..287639,287698..287804,
                     287863..288650,289251..>289453))
                     /locus_tag="TRUGW13939_08654"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491784.1"
                     /db_xref="GeneID:55996142"
     CDS             complement(join(287391..287639,287698..287804,
                     287863..288650,289251..289453))
                     /locus_tag="TRUGW13939_08654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347677.1"
                     /db_xref="GeneID:55996142"
                     /translation="MALLRGRRRRPHEDSDEPTPTALYHQRQRLSSDDHHDDSDSDSE
                     SDHWQPDPRRPAAPTKSRLPPGSSPLTGTGRSTANGIRRSGRLTRGTAAAAPASSVTV
                     SRSPPSVKTGSPGAIHLTVKMSSSKLRQVTNSRSSRGTASNRHNIFTEEPVVQGKRSS
                     RNTRNLREVSDDDDDDDDDELDEEEEDDEIDDSEDGAGEDDDELDADGDLEMEDDTPQ
                     PPVSKRSTRPAAVAAKVKNKAVKSVEEKEMELSRDDEEDEELSDLDSDAEGEPDDTML
                     QDEEMGEGVEEGEEDVEGDEEDALGSDDSSSPDPNKLTKRQRGTLGKDFLQLPMEPQI
                     KKHLTAEEHAMRRAEMARRRKNLSEKRNEEEKMDTINRLLKKQAPKRRGRIPAAETAG
                     EATPDVPVEVEKPDPTMIRWINGREGYKALVPDEMLGAPAGRPFGSLPGRKLIEEV"
     gene            <290143..>291411
                     /locus_tag="TRUGW13939_08655"
                     /db_xref="GeneID:55996143"
     mRNA            <290143..>291411
                     /locus_tag="TRUGW13939_08655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491785.1"
                     /db_xref="GeneID:55996143"
     CDS             290143..291411
                     /locus_tag="TRUGW13939_08655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347678.1"
                     /db_xref="GeneID:55996143"
                     /translation="MAGDSKPVIPEWQRKATPSPPAHASAAITADDASDNASPESSPP
                     EDRSALLEQARNFLSEPSISDAPTSRKIEFLESKGLTNGEIQALLGVSRNEDASSPSS
                     ETTNDSDKTTATENNAPAETQTTVSTLSNNNAAATASSTTTTTTTTNNTTPQRDVPPI
                     ITYPEFLVNASAQNNKPPLISFQGVLYSLYAAAGLGATLYGSSEYLVKPMLKTLTEAR
                     HDFAETALNNLTTLNEKLEQNVSKIPANIIPKPTSEEEDDDEETESITSDPTELFHRD
                     VATQTSPDLLSDSPPSEEKNADSESSAIKAIDTHTERLSTLTSHLKEFVTDHTSSRKV
                     DDSARDKISDLQSYLDGLTYSSSNNYLGNNAMYNIYGSSSGDMGRNRSGSTDRKEQDA
                     VTTFKAEIRGVKGALLSARNFPAGKAGVAR"
     gene            complement(<291655..>295820)
                     /locus_tag="TRUGW13939_08656"
                     /db_xref="GeneID:55996144"
     mRNA            complement(join(<291655..291699,291758..292056,
                     292110..294786,294837..294923,294976..295209,
                     295261..295366,295421..295537,295606..>295820))
                     /locus_tag="TRUGW13939_08656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491786.1"
                     /db_xref="GeneID:55996144"
     CDS             complement(join(291655..291699,291758..292056,
                     292110..294786,294837..294923,294976..295209,
                     295261..295366,295421..295537,295606..295820))
                     /locus_tag="TRUGW13939_08656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347679.1"
                     /db_xref="GeneID:55996144"
                     /translation="MVRIREIPRTATFAWSPGAQVPLLATGTRAGAVDFDFSNETNLE
                     LWDLGLNNKTADSGSDLQPLVKIPTESGFNDIAWAPYDDNNRGIIAGALDNGSLKLWD
                     ADKLLSGASESLTASPQKHTGAIKSLQFNPKHSNLLATGGAKGELFITDLNNVESPFR
                     LGNTAARADDIECLDWNKKVPHILVTGSSAGFVTVWDVKTKKESLTLNNMGRKPVSAV
                     AWDPEKPTKLVTSIPLESDPVILVWDLRNSHAPERVLRGHESGVLSLAWCAQDPDLLL
                     SSGKDNRTICWNPQTGENYGEFPIVTNWTFQTRWNPHNPNFFATASFDGRISVQTIQN
                     TSKEAAQDTTTQNQALDGEDFFAKAQTQPQASTFSLSKTPKWLERPVSASFGFGGRVV
                     SVALNDTTQRSSKIRITPFQIDSAVGSATEQFEKDLQQGNLKNICENRIDNASSEEEK
                     SDWKVIETLLSENPRKGLAAYLGFDDATDEAADGLAKLDLKEETNGEASKPAPDSKKK
                     KHKRLQSIFDTSGESDVFLTDLAASKGARTNDPFNIFTGSESESDKKITRSLLLGQFE
                     RAVDIALQEDRLSDAFMIAVCGGDKCVEKVQEAYFSKQNGGPNYIRLLASIVGKNLWD
                     VVHNADLSNWKEVMATLCTFADEKEFPDLCEALGDRLEEQYQGTSDKAVRKDASFCYL
                     AGSKLEKVVGIWLDEFKANEEQGIDEAEEGSTFSVHVRALQGFIEKVTIFRQVTNYQD
                     VDRQKEADWKLSVLYDKYVEYADVAATHGRLDVADRYLSLVPEKHDEAEVARNRIRLA
                     TRKAPSVKTSAHVPQARAPSVPQPSLFQPPQPTFSPTPPVNNLYAPPANISSPAAPPQ
                     PANPYASFGAAPNPYQPTGGYQPSQQTKPAVGPPPQQFGAPPSSGPGGVPPPPRGYNQ
                     SPSGPQVSTYTTRTDLPAWNDLPEGFAAQKQTSRRGTPAAMASPFPGQQNPVGPPTSP
                     PVGPPVAAQRAPPPPPPKAGSVPTAPIVSPPVGGPPRPPSVTSNPPGAINPYAPAATQ
                     PPPTVPGLAMPPPIPRGPSPYNAPPSGPPPTNRYAPNPAAQPAAPQMPPPSGPYAAQQ
                     PAAAVPNPYAPIAGAVPPPPGGPPQAGPPPGGPPPAAGSRPGTAQSQQKAAPPPPKYP
                     PGDRSHIPADAAPIYEYLSSDMQRVKSRAPSSFKAQVDDAERRLNILFDHLNNEDLLK
                     PNTVADMVELSKALQGRDYETAKNIHLDILTNRTDECGNWMVGVKRLISMSRATP"
     gene            <296257..>296793
                     /locus_tag="TRUGW13939_08657"
                     /db_xref="GeneID:55996145"
     mRNA            join(<296257..296577,296653..>296793)
                     /locus_tag="TRUGW13939_08657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491787.1"
                     /db_xref="GeneID:55996145"
     CDS             join(296257..296577,296653..296793)
                     /locus_tag="TRUGW13939_08657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347680.1"
                     /db_xref="GeneID:55996145"
                     /translation="MSESTRLKSTVYVGSLDQAVTAQTLTEAFLPFGEVVDISLPKPD
                     LPSSTDNHRGFGYVEFEVPQDAKEAIDNMDQSELYGRIIKVAAAKPQRDANEGLGSKT
                     AIWEQEGYLAKHAVSEEDRNGAEEASLVTNGRPEDPMQGLEGLDVAGPKPE"
     gene            complement(<297052..>297569)
                     /locus_tag="TRUGW13939_08658"
                     /db_xref="GeneID:55996146"
     mRNA            complement(join(<297052..297151,297226..297238,
                     297296..297358,297425..297440,297513..>297569))
                     /locus_tag="TRUGW13939_08658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491788.1"
                     /db_xref="GeneID:55996146"
     CDS             complement(join(297052..297151,297226..297238,
                     297296..297358,297425..297440,297513..297569))
                     /locus_tag="TRUGW13939_08658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347681.1"
                     /db_xref="GeneID:55996146"
                     /translation="MFPTRPLGMRATRPLMSVPKENMSAHTISQRIRQLKKVPPELIP
                     IGVVLGVAIGAAIYSCTHKLFADKTLRLSRNKPEDRAH"
     gene            <297907..>298536
                     /locus_tag="TRUGW13939_08659"
                     /db_xref="GeneID:55996147"
     mRNA            join(<297907..297962,298047..298196,298254..298335,
                     298389..298452,298505..>298536)
                     /locus_tag="TRUGW13939_08659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491789.1"
                     /db_xref="GeneID:55996147"
     CDS             join(297907..297962,298047..298196,298254..298335,
                     298389..298452,298505..298536)
                     /locus_tag="TRUGW13939_08659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347682.1"
                     /db_xref="GeneID:55996147"
                     /translation="MSAIPEADPDEPIETKPFNWYVHSGTRFFPAGLDKSPIRPCHAR
                     CPRLPESTDRGYHIGYDARFPYQNQTKHCWQNYVDYHKCILAKGEDFRPCRQFFLAYR
                     SMCPKSWTDRWDDQREAGNFPTRLE"
     gene            complement(<299107..>300217)
                     /locus_tag="TRUGW13939_08660"
                     /db_xref="GeneID:55996148"
     mRNA            complement(join(<299107..299787,299848..299969,
                     300076..>300217))
                     /locus_tag="TRUGW13939_08660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491790.1"
                     /db_xref="GeneID:55996148"
     CDS             complement(join(299107..299787,299848..299969,
                     300076..300217))
                     /locus_tag="TRUGW13939_08660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347683.1"
                     /db_xref="GeneID:55996148"
                     /translation="MSVDTSVKTKVAPVVAEPRPIKKIHYPFWFGGSASCFAAAVTHP
                     LDLANQTVSEKVRLQTRAPGAPTSMLGTFVHVFKNNGALGLYSGLSAAILRQMTYSTA
                     RFGIYEELKSRFTGPSAPPSLPNLLWMGCVSGFLGGIAGNPADVLNVRMQSDAALPPD
                     QRRNYKHAVDGLIRMTRTEGVTSLFRGVWPNSTRAVLMTASQLVTYDIFKQICTAQLG
                     MPDSILTHFTASIAAGFVATTVCSPVDVIKTRVMSASSAESKSSITHLLKDIYRKEGI
                     SWMFRGWVPAFVRLGPHTIATFLFLEEHKKLYRKIKGL"
     gene            <302688..>304223
                     /locus_tag="TRUGW13939_08661"
                     /db_xref="GeneID:55996149"
     mRNA            join(<302688..302973,303028..>304223)
                     /locus_tag="TRUGW13939_08661"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491791.1"
                     /db_xref="GeneID:55996149"
     CDS             join(302688..302973,303028..304223)
                     /locus_tag="TRUGW13939_08661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347684.1"
                     /db_xref="GeneID:55996149"
                     /translation="MPSDTYDYVIVGGGTAGCVLASRLHHGDPSLSIVVIEAGSDVSK
                     RADVLDGSQWAPLLGTELNWDYKTVPQKHLGDRSIANAAGKALGGSTAINAGAWTRGD
                     RQNYNHWGHVVKDSRWSYDGLLPYFRKIETFHDPHGSANSHGFDGPIKQITPSARGYP
                     LRNPLQAAWAAAGVGFIPDMNSGEPLGVAEMIEDRLDGQRIVAPFVYPLDGVDVLTNT
                     LVKRVIIKDINGKKVATAVELADNETVIAARREVIVSAGAYRSPQVLMLSGLGPRDEL
                     EKHGIDVLVDTPDVGLHLHDHLSVLQWWKLKTPEKGLSIGSPFFINSDYFKGNPVDFF
                     TTQSVPKQGLLDALAVDGNFDNAEVASQRSHHETWIMYVAQNAENPAIIPDGTHITTS
                     VICMLPTSRGSIKIADADPSSAPLIDPNYMATEADRYTLREGMRKLYQVFRETDAGRE
                     VVESETVGEGTKAVSPEVSNEDLNEKIRRHPQYVYSFSSLCMC"
     gene            complement(<305107..>306911)
                     /locus_tag="TRUGW13939_08662"
                     /db_xref="GeneID:55996150"
     mRNA            complement(join(<305107..305142,305201..306449,
                     306538..306688,306740..>306911))
                     /locus_tag="TRUGW13939_08662"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491792.1"
                     /db_xref="GeneID:55996150"
     CDS             complement(join(305107..305142,305201..306449,
                     306538..306688,306740..306911))
                     /locus_tag="TRUGW13939_08662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347685.1"
                     /db_xref="GeneID:55996150"
                     /translation="MATMNESLVAPLDKNATSFAHRGNFRWIDGLLLSYQSGWNGWQL
                     AATVLIILVAYDQLIYIVRKGSIAGPMFKIPFMGPFIQAIYPKFESYLSQWASGPLSC
                     VSVFHKFVVLASDRDIAHKVFKSPAYARPCLVPIATEIMRPTAWVFLTGKAHAEFRRG
                     LSGLFTNQALSTYLPIQERVFADYFNKFVAASEANGGKPIEFMGLSREINCALSCRTF
                     FGDYISQDAVKRIADDFYRVTAALELVNIPYSTYIPFTKCWHGKRIASAVQAEFARCA
                     AACKANMASGAEPTCIVDQWVLNMMESKKYNDKLATGDMEAEKPKNMIREFTNDEIGQ
                     TMFTFLFASQDASSSSTTWIFQVLAQRPDVLDRLREENLAVRGGDRQRPLDLAMFESL
                     TYTNAVVKELLRYRPPVIFVPYLATQAFPVTPDYTVPKGAMIVPSCYPALHDPEAYPN
                     PEIFDPERWITGDANSKTKNWLVFGAGPHDCLARKYVPLTMAAMIGKASLEIDWVHHA
                     TDRSEDIRVFATLFPMDGCPLVFSKRN"
     gene            complement(<307399..>309071)
                     /locus_tag="TRUGW13939_08663"
                     /db_xref="GeneID:55996151"
     mRNA            complement(join(<307399..308074,308129..308253,
                     308315..308629,308988..>309071))
                     /locus_tag="TRUGW13939_08663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491793.1"
                     /db_xref="GeneID:55996151"
     CDS             complement(join(307399..308074,308129..308253,
                     308315..308629,308988..309071))
                     /locus_tag="TRUGW13939_08663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347686.1"
                     /db_xref="GeneID:55996151"
                     /translation="MLSHQHHSPWNGIIDVLYEQRDSCARRFPFRLTPLIKLVLSNIA
                     VRYWPLELNLGLNPFVVQWWPLALADSALFHVSLQTASLDEELRAQKGFPISELLMID
                     SVSLLRRKLEDPSLAFQDETLDSVVTLAAIEHGKRNFENSTAHINAVKQMVNVRGGIG
                     ELKRTSPLTARMISWVAMLVTVTPQFEAQDDSGHGTGIAPIPQWQLALAGPDHQQLIF
                     DNIEVDHTINNILLRLRNIFHHERISSLTSTDLHDLICFVLHKLLLLPPLSPENPEQS
                     AVFECFRYAIALYLLTIHGTTYYSHDDLANNMILQLKSHLETLLLTNYIHSSAGIWLL
                     SVGLAATAGTPYRKWFISQACTAATVLGLNTWEEVLVRLQTIFWIPQQDEPVQQKWEV
                     IFNLLSD"
     gene            complement(311732..311854)
                     /locus_tag="TRUGW13939_08664"
                     /db_xref="GeneID:55996152"
     tRNA            complement(311732..311854)
                     /locus_tag="TRUGW13939_08664"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:55996152"
     gene            complement(<313399..>314931)
                     /locus_tag="TRUGW13939_08665"
                     /db_xref="GeneID:55996153"
     mRNA            complement(<313399..>314931)
                     /locus_tag="TRUGW13939_08665"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491794.1"
                     /db_xref="GeneID:55996153"
     CDS             complement(313399..314931)
                     /locus_tag="TRUGW13939_08665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347687.1"
                     /db_xref="GeneID:55996153"
                     /translation="MRLIATGRALRLGRTRWSIGLISNGSRATYNLFTPVHRERLSFR
                     SITTTKTTLQEANTATKSTIDAKSPQEEKVTNVEGKAYPTDHWTNAPPNILSHVQRRI
                     YLQENHPLHLTRKLIESQFPAPTYGNYTESFPVVSTEQNFDSLGFPPDHPGRSRTDTY
                     YLNEKTVLRTHTSAHQADYFRRMNNDANKEEGYTVVADVYRRDAIDRSHYPVFHQMEG
                     ARLWERPEGMTATESAARIWKDFEKLPSHGVEVEDPNPVTHPVRNPLQSKYHSQEEVE
                     ALVAHLKRTLENVFVKIFSEASKAANTPQDPLKLRWVEAYFPFTSPSLELEVFWQGDW
                     LEVLGCGVIKQDLLNNSGVPGRIGWAFGLGLERIAMLLFNIPDIRLFWSTDARFISQF
                     SDGKIVQFQPFSKYPECYKDVAFWLSSASTSGTGASAAGGAVPFHDNDMMEIVRNCAK
                     DIVEDVKLVDEFVHPKTGRKSLCYRINYRSLEHTLTNKEVNDVHEKVRTSLKESMGVE
                     LR"
     gene            complement(<315644..>316519)
                     /locus_tag="TRUGW13939_08666"
                     /db_xref="GeneID:55996154"
     mRNA            complement(join(<315644..315676,315739..316164,
                     316229..>316519))
                     /locus_tag="TRUGW13939_08666"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491795.1"
                     /db_xref="GeneID:55996154"
     CDS             complement(join(315644..315676,315739..316164,
                     316229..316519))
                     /locus_tag="TRUGW13939_08666"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347688.1"
                     /db_xref="GeneID:55996154"
                     /translation="MLQRTILRQRRAVQSAVSRSSTFSSQSPFRQASRLPQLSQRQSA
                     FNVAVPRFYSTQNDAATKDDVKEASKENGETESPEETFTKELEAKNKEVAEMKDKYLR
                     SVADFRNLQERTKRDMDGARAFAIQKFAVDLLESIDNFDRALSVVPADKLTAEQAEAN
                     KELQDLHQGLKMTENILMNTLQKHGLQRFDPGELVDGKAQKFDANRHEATFMAKAADK
                     ENGEIMHVQSKGYSLNGRILRAAKVGVVKND"
     gene            complement(<316961..>318856)
                     /locus_tag="TRUGW13939_08667"
                     /db_xref="GeneID:55996155"
     mRNA            complement(join(<316961..317491,317555..318378,
                     318430..318718,318776..>318856))
                     /locus_tag="TRUGW13939_08667"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491796.1"
                     /db_xref="GeneID:55996155"
     CDS             complement(join(316961..317491,317555..318378,
                     318430..318718,318776..318856))
                     /locus_tag="TRUGW13939_08667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347689.1"
                     /db_xref="GeneID:55996155"
                     /translation="MALSEDFASSYASVGLNNIIARETRVEAQPVDSQSPVDSLTSQR
                     FRLYNPWPVLKKTVSQGSLVKGAGMTRKTSEDNQNISFPFSTFQCSTSKLRPSLAKRE
                     IGFPRFARGIMSTIHHPRMDSPTIPGIFPLQERAYSVPNDADTSFLSVKTAPVSEPSI
                     LLPGRDEDLQAAAAAINDRLNATARTSSSPDVSQWPPRQSSYGDNEEKPPVPPKSPSL
                     TLRLATVQQARLIASKYNPSSSKTSLKLDTNVNTNNRGHITDQKRRPGNHSRASTALG
                     IFPPVPRTSQSHQRSESAYSHFSSTKPSLHRKPVAREGKVTGSSIINRGRPNKPRNNQ
                     LGTLLKQPTAVEQGLVAPLPSGFDVADAKEQFPSSEVDILQRQARSQAQRFKVLKYSD
                     VRLLSLELRVFDERYEYLRNTHKTLRLGRSHLHERMIAFLRSPRATTNFRDIILRQEK
                     ALAELDHTIDEWYLKLEQVENRRSRVRQKLLEHIAGSLMMTAPYPSSSSPSAQLQQQT
                     TPPQSPTIPDSEIARESIKIYAESGVYADADIEDLLAEIERQMEEMNSSREQSPCTDN
                     SLAAWASI"
     gene            <322932..>326246
                     /locus_tag="TRUGW13939_08668"
                     /db_xref="GeneID:55996156"
     mRNA            join(<322932..323216,323272..323533,323585..323784,
                     323830..325791,325848..>326246)
                     /locus_tag="TRUGW13939_08668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491797.1"
                     /db_xref="GeneID:55996156"
     CDS             join(322932..323216,323272..323533,323585..323784,
                     323830..325791,325848..326246)
                     /locus_tag="TRUGW13939_08668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347690.1"
                     /db_xref="GeneID:55996156"
                     /translation="MGSSTLRKKILCHVVDEIAYRDPEKLFCIHPISSDITQGWRRVT
                     LANLADAVNYTAQWIVRTVGPASEDEHLAYMGANDIRYAAFTLACMKTGHSVLLLSPR
                     NSTAGSLRVLHATKSFKFIYSVERRKLVEALQQTDKSLHLWEIPSLWDIFNKKVDPYP
                     CNTQYTNAEDKAAVIIHSSGTTGFPKPVPLTNGFLSAIDNMPQLPIPSGRRSSLISMV
                     KPGALFFTMAPFFHLMGYFTFLESIYHGTPFISDETNPVNALLTPSILEDFGSSEAGL
                     NLLRRFETIFFGGAPLSPDIGNKLCQDTNLQALIGSSEAGFISSLVPADMKDWEWFDW
                     NPFNDVDMQYVEDGLFEMVLRRKETRDFSGIFHTFPDIDTYRTKDLYAPHPTRPGLWR
                     YRGRFDDVIVLSNGEKFNPIEMEKIIEGHPYVSKALVVGQKRFQPALLIEPNWQELPA
                     EEHDDANGWLIDRIWPTVEKSNEIAPGHGQLLKAKIGMASKSKPFKTTPKGTVQRQLV
                     LADYADEIDEIYNRISDDEEGISNLPLELTLQNVTQYVQQVLSHLLKVDKQVPETADI
                     FSLGLDSLQTLQLSKILQGAVGSLRPDHAGPVIIPAQKLYSYSSVASISQYVYGLANG
                     GDASVEVDGHHDSTRSQRIAALIEKYTEDLPEKQVGHFHRLGKYAVILSGSTGSLGNY
                     ILNELILDPEISKIYCLNRSEDAEKRQIRSFEEKGLGHLSSRVEFLRAKFGAEKLGLS
                     DHKYEELKDSVDTIIHNAWKVNFNHKLETFEDTHIEGVRRLIDFSLDSTHSAHIHFIS
                     SISTVGGWTAAHGPSVPEVPLEDPQVALEQGYGESKFVSERISAIASARSGVPTSLFR
                     VGQIGGPTTEKGVWNRQEWLPAMIATSKTLQKIPTEIGSMPVDWIPVDSLAKIIVDVT
                     RSRRITDTTERTAAFNLVNPIATPWMSLVPPIQARYSVEPVEFGAWLDAVEAFSNPTQ
                     ADFQDKPALKILEFFRGLHEGHGDGKLSPPMQTARTQAASKTMRTLSSVDATLMENWL
                     RQWNF"
     gene            complement(<326594..>331701)
                     /locus_tag="TRUGW13939_08669"
                     /db_xref="GeneID:55996157"
     mRNA            complement(join(<326594..327059,327122..327585,
                     327651..328267,328331..328643,328731..329082,
                     329143..329738,329805..330048,330111..330454,
                     330502..330953,331011..331093,331157..>331701))
                     /locus_tag="TRUGW13939_08669"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491798.1"
                     /db_xref="GeneID:55996157"
     CDS             complement(join(326594..327059,327122..327585,
                     327651..328267,328331..328643,328731..329082,
                     329143..329738,329805..330048,330111..330454,
                     330502..330953,331011..331093,331157..331701))
                     /locus_tag="TRUGW13939_08669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347691.1"
                     /db_xref="GeneID:55996157"
                     /translation="MPDDRNPEDRLSLQHVDDREETVFNSTDASVLTSVSKEELDMEV
                     EPTVTSLARQFTSQSNQFPRTVTEIDNNPFLSSHIPALDPKSPEFSPVKWTKALLHAT
                     SRDSENVPPKTLGVSHRNLSAYGYGSDVNYQADVFSVYSRLIDLAMSALGRQQKKVQI
                     LRNFDGLVRTGEMLLVLGRPGSGVSTYLKTLAGETYGFYLDPESHFNYQGISYDTVHS
                     RFRGEVIYQAETEIHFPQMSVGDTLRFAALARTPENRLPGVSRQLYAEHLTDVVMAML
                     GLSHTVNTKVGDDFVRGVSGGERKRVSIAEVLLSRSPMQCWDNSTRGLDSATALEFVR
                     TLKLATDLGRTATVVAIYQASQAAYDEFDIVTVLYDGRQIYFGPATSAKKYFTDMGYL
                     CPDRQTTADFLTSLTNPEERVVQPGFEKKVPRTADEFAAAWMRSQDRAQLLAEISSFE
                     GDHPIGGKQLEQFKTSQKAQKAQFVRSKSPFTISIPMQISLCIKRGFQRLRGDMSFFF
                     ATIFGNLMISLVLGSVFYKLPPTSDSVDSRCIMLFFIILFNALSSALEVLTLYAQRAI
                     VEKHAKYALYHPFSEAAASMICDLPCKIISTICFNIPVYFMSDLRQEVGAFFSFLLFC
                     FTCTLTMSCIFRTIGQSSRTIAQALTPSALFVLVLVIYTGFIIPTSAMQGWLRWINYL
                     TPIAYAYESLVVNEFHNRHFPCTQFLPTGPGYENLMDKQRVCATPGSLPGQDYLAGDL
                     YISGSFGYEHSHLWRNFGILIAYIIFFGFAYFLVTEYVPSTRSKGEILVFRHGRKAIT
                     RASTQPDDIENSNSGITSRSLKSQENANSIAIQAQTAVFHWRDCCYEVQIKGETRRIL
                     DHVDGWIKPGTLTALMGATGAGKTTLLNVLASRVTVGVITGDIFVNGLPRDNSFQRKT
                     GYVQQQDVHLEVSTVREALNFSALLRQPAKYSKKEKLEYVDEVIRLLEMEPYADAIVG
                     VLGEGLNVEQRKRLSIGVELAARPELLLFLDEPTSGLDSQTAWSVTSLIKTLSDNGQA
                     VLCTIHQPSAMLFQQFDCLLLLAKGGRTVYFGDIGHNAQKLTGYFEKHGSQPCGKDEN
                     PAEWMLRVIGAAPGAVADQDWVNTWRNSSECADVLKELTRLENEKQSDDSNDEISTSY
                     AASMHDQLMLCTIRAFEQYWRTPSYIYSKLILCFGTSLFIGLSFYNTENTVQGLQDQM
                     FAVFMLIVIFAFLTYQIMPNFITQRDLYETRERPSKTYSWYVFMLSNIVVELPWNTFA
                     SLLIYFPFYYLVGLYRNAEPTQTVTERGGLMFLFTWSFMVMAGTFSHMVVAGLPTAEV
                     GAIVALVLFAMCLIFCGVLATPAALPGFWIFMYRVSPFTYLIGGLLSTGIANAEVHCA
                     SFEIRTIRQPPSGQTCGQYLKEYISFSGSALYNPNASENCEICSLSNTDQFLATIDVF
                     YNQRWRNFGLMWVYIIFNVFGAVVLYWALRVPKKGSTSTLRNLTSSLVKPFKRSS"
     gene            <332316..>335294
                     /locus_tag="TRUGW13939_08670"
                     /db_xref="GeneID:55996158"
     mRNA            join(<332316..332388,332459..332499,332569..332638,
                     332710..332945,333021..333258,333328..333593,
                     333667..333681,333738..333935,334008..334486,
                     334559..>335294)
                     /locus_tag="TRUGW13939_08670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491799.1"
                     /db_xref="GeneID:55996158"
     CDS             join(332316..332388,332459..332499,332569..332638,
                     332710..332945,333021..333258,333328..333593,
                     333667..333681,333738..333935,334008..334486,
                     334559..335294)
                     /locus_tag="TRUGW13939_08670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347692.1"
                     /db_xref="GeneID:55996158"
                     /translation="MSGVISQKIARTCDSCKVRKVRCIRSKGENSAPCDNCTARNILC
                     HFSYLKQPRKRKLDPDAGLNGEPHRPSILPKINEAPSIRLSQTPCEPAASQLGTSLPS
                     ISNPNNGQDQPLPQLYIDLLLSDRRAPAAHGNDTSSTKLTEMFGHSSNVSLFSNSRIR
                     SLNSRLGHTKLNQLMQLIDSVLSSRLNKSPSQMTQLYNLRQRNKAPPAIPCTLTASYI
                     RSFFEQVHPVYPFLDRRLFEKRALEPSSQSLARVDEVWLALYYTVLAIGCQYNDGGSF
                     DRACGPAWKLFEMGLSYFPDIIMMKGSLVAVQGLTAMAIFSANISAYQFESLLVVEAA
                     KMCQSLGYNKTTSNIPNANENERRRTFWVVYCLEKTSCFITGRTSIIMDSDIGCPIPY
                     VPESTFGDYDWFLSLARYSRLVSRICSSLFSVSSGENTTGSTYHGSIHQLINELEAWK
                     LSIPEKYRPGERFSGRGLPGTLEISIAVNTQYLYFNALLTLLRISLYAGAGNVAPAPD
                     QQETKKKLMRTACLILDLTKYIEVEAYTSLWVLALMPMSALFILFDLVVHNPTHPETN
                     NNLALLDVASGHFGRLEYISGGILPGSLVSEFAHIAREYVRDVQRGVINRNDNSTQSN
                     NMTASSSVPLDNTNAVMLNEHSSEPNMPPISSSSSSSSSSQGQNPSSPSHRPGVSRSK
                     TTAKFQPSMSLGRSPEQQKQRLQAQQAPVTCPATQSPLATQHEPVRTDLSTESIFFPL
                     VDDPTYLLSGNEEEMQQLFGIDVMDLFDFTNTSAGGFDRPCIG"
     gene            <336404..>337483
                     /locus_tag="TRUGW13939_08671"
                     /db_xref="GeneID:55996159"
     mRNA            <336404..>337483
                     /locus_tag="TRUGW13939_08671"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491800.1"
                     /db_xref="GeneID:55996159"
     CDS             336404..337483
                     /locus_tag="TRUGW13939_08671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347693.1"
                     /db_xref="GeneID:55996159"
                     /translation="MTVATTLLFSRPNTITTTSTNSHSHSPHGKSLKTTQSSLNYTSS
                     TKLSISRDAAAMEPDHTSSSPHLSRSTSTSTTSTSSSRSRPSLSLDMSKLPALLQPTS
                     PSNTLIITELHNLLLFQPASLAAIREAITSIAQLNSFSPLPSFRRIVCSFLSTEDAVK
                     VRQYLERSTTTVFDNSGVRARIYFGERTPIENSEEAKRKKLLEAPQAQKLFFISPPPS
                     PPHGWVMRNEDPPNKEVHASDLADALARLGTSATQNDMGNNNNNDNNYNNDPVSPVSA
                     SSDKEVARTSSWPAVSGSGGAGRSRSSTLIYHPSEHGGSPNLPAVMVVDTSIVDEDED
                     MMDLDGEPGQKIMAHTARPPVELMQ"
     gene            complement(<337727..>339624)
                     /locus_tag="TRUGW13939_08672"
                     /db_xref="GeneID:55996160"
     mRNA            complement(join(<337727..338232,338291..338388,
                     338442..338675,338734..338895,338951..339073,
                     339131..339268,339455..>339624))
                     /locus_tag="TRUGW13939_08672"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491801.1"
                     /db_xref="GeneID:55996160"
     CDS             complement(join(337727..338232,338291..338388,
                     338442..338675,338734..338895,338951..339073,
                     339131..339268,339455..339624))
                     /locus_tag="TRUGW13939_08672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347694.1"
                     /db_xref="GeneID:55996160"
                     /translation="MSAAVDAETARSLSLFRPLGAFVLPLCLFQQHQHFISPDRAGQS
                     EFGTAPRAASTGLAAYYASSVSVRPEHYETLLCQGWRRSGTLYYKQNLRRSCCPHYTM
                     RLQAADFKPRRDQRKALNRWNKYVLGQEYIRKAAMLAPKTREEKKKRQQGFDLAQEVH
                     ASEYANLPRPIDPKTKKPIEPAHKFEVTIEGDSLSQRKYEVFLKYQAAIHNESADRWK
                     SADFKRFLCTGLTRNSPKEGSGEKKIGSWHQCYRLDGRLIAVAVLDLLPEGVSSVYLF
                     YDPEFGDWGFGKLSALREIVLAREENYQHYYMGYYIHSCQKMRYKALYRPQYILGKLF
                     PPKTSSTHTTNQPDPESKTWDPLDGELSQKLDKRKYVSLSHDRANPSSSEEEETVPEL
                     ANEEELSLFDIHMPGVLTADQVLSQLDLDHWLLLVHGSFVHMSDLVGWEDADLHSAQS
                     IKGIVGELAAVLGVDVVRKSACVLFD"
     gene            <340984..>341631
                     /locus_tag="TRUGW13939_08673"
                     /db_xref="GeneID:55996161"
     mRNA            join(<340984..341035,341204..>341631)
                     /locus_tag="TRUGW13939_08673"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491802.1"
                     /db_xref="GeneID:55996161"
     CDS             join(340984..341035,341204..341631)
                     /locus_tag="TRUGW13939_08673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347695.1"
                     /db_xref="GeneID:55996161"
                     /translation="MAATTHSMESRVGRTNQRYGTKGERLVAGIVPLSPDKTKVLMIQ
                     SAGPGGWVLPKGGWETDEPTAQQAALREAWEEAGVVCTVLRDLGLIPDMRPYSLLTTH
                     APKASYQFFEAIVNREEAQWPESHKRRRQWVSYTQAASALANRPELLEALNRSSLRR"
     gene            <342476..>343645
                     /locus_tag="TRUGW13939_08674"
                     /db_xref="GeneID:55996162"
     mRNA            join(<342476..342529,342584..343155,343210..>343645)
                     /locus_tag="TRUGW13939_08674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491803.1"
                     /db_xref="GeneID:55996162"
     CDS             join(342476..342529,342584..343155,343210..343645)
                     /locus_tag="TRUGW13939_08674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347696.1"
                     /db_xref="GeneID:55996162"
                     /translation="MDYEMDIEATGPQVTVREAEPYRVDFKLSSVDLSLANALRRTML
                     AEVPTVAIDIVEVESNTSVLPDEFLAHRLGLVPLNSKNCDQDMEYNRDCTCESFCSRC
                     SVRLTLHARCNQSDEVMKVYSRDLMVSGDRANEWVGNPVITDPEGKGPLIAKLIKGQE
                     LKLSCIARKGIAKEHAKWAPTSAIGFEYDPHNNLKHSDYWYEEDPIKEWPVSENAKWE
                     TPNPPDQPFDYDAQPTTFYMDVESIGNLEPDAIVQQGIYTLQTKLATIMDTLTNPSGS
                     GAQVNGLGGADDDDMALGGGVRSPDAYEPPEIDAGLGGGGFTAYGQAANGGNRSAWGG
                     GATPYGTTPYGGATNYGGY"
     gene            complement(<344097..>345983)
                     /locus_tag="TRUGW13939_08675"
                     /db_xref="GeneID:55996163"
     mRNA            complement(join(<344097..345388,345449..>345983))
                     /locus_tag="TRUGW13939_08675"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491804.1"
                     /db_xref="GeneID:55996163"
     CDS             complement(join(344097..345388,345449..345983))
                     /locus_tag="TRUGW13939_08675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347697.1"
                     /db_xref="GeneID:55996163"
                     /translation="MTTASAEQRAAMEDEMDALFDDHPSLSASLEDFEASNRRSPMFD
                     LPSQHSGFRSEDSEDAQSEPPQERWSPPALRRPDSLAGSHWYRHAPYDMKPTLQNSSP
                     QQSREPSPQYEDAREAPPLPSPQRKPTDWPDITLAANVPLPPGTDSPVKGRSVSPEPK
                     DRRLAVVQNITHEEANSNYVRFRMSAEVAQREPLQAAWTALRLPLDRMFSSKASAFFS
                     VLVAFLAMVLVRILTLPQGSQSIPNLVKLCAFARNFEPLIYYSENGVQHISNLQETGI
                     AVWDLGESVRGSNMTSAPIIVTQLDELSGSLKDLSLELTRFFANVDSDIDSILLVMDW
                     TRRELTALHAQPPSSLPSIVIDNIYGMISQVATLEQRSHQQSILPGESSAASTPTILG
                     TVVTSVLGPTSTQRTSAALMRTFTEFLNVLEESINSELTHSTALIGLFESIDRQFLNL
                     QRVVVRESDTQEREEGEMLSSLWTRLLGGNKDAIRKYEKNRKLLADVRRRTVSNKHQL
                     MDHQARLLNLKASLETLRRRLVSPLVRQNESRLSTASSSSVDSTNNVLGAIEGQIKGV
                     DDTYEYLRGLRESQKAKLMDLVYGAGRTQSSQGYLGLDETGE"
     gene            complement(<347095..>347917)
                     /locus_tag="TRUGW13939_08676"
                     /db_xref="GeneID:55996164"
     mRNA            complement(join(<347095..347119,347174..347268,
                     347319..347477,347530..347561,347884..>347917))
                     /locus_tag="TRUGW13939_08676"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491805.1"
                     /db_xref="GeneID:55996164"
     CDS             complement(join(347095..347119,347174..347268,
                     347319..347477,347530..347561,347884..347917))
                     /locus_tag="TRUGW13939_08676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347698.1"
                     /db_xref="GeneID:55996164"
                     /translation="MAPKEAAKFAPGDASKGANLFKTRCAQCHTTEAGGANKIGPNLH
                     GLFGRQTGSVDGYSYTDANRQAGVTWDESTLFSYLENPKKYIPGTKMAFGGLKKPKDR
                     NDLITWLKESTA"
     gene            complement(<348496..>350964)
                     /locus_tag="TRUGW13939_08677"
                     /db_xref="GeneID:55996165"
     mRNA            complement(join(<348496..348933,349005..349493,
                     350085..350339,350437..>350964))
                     /locus_tag="TRUGW13939_08677"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491806.1"
                     /db_xref="GeneID:55996165"
     CDS             complement(join(348496..348933,349005..349493,
                     350085..350339,350437..350964))
                     /locus_tag="TRUGW13939_08677"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347699.1"
                     /db_xref="GeneID:55996165"
                     /translation="MPPPQQTSASQTPHISPAELSYLYTSLSQPDGPIRPDGRSPTQF
                     RPLTAETGIVPGANGSARIGFADGSEAIVGVKAEIERTLATDALDLRQLQELEQQNDG
                     YSGADNVDGGDATREGSHAVAGQSSWVQMSIEIPGFRDDDALPVFLSEMMRESLVGAG
                     NDGEGNTSGGGLKSRLILLLSPPQSYPLPLLSLTTHLALLSTRLPKLKSQGEEDPFFE
                     DDWNLAEYIYTQQNAKHARPPVTLLVISTGKNVIFDPTREEIAKNKTELRITKPCSSA
                     ETTTTTGAKMAAMQNIPQFLLPRGISSRTLRYAATAQAPATAAARRGFSLSAPQRKQS
                     AGNNASKEKKARTLAQPDKFRPPSHPQRRVMQTRDGKAVVREPFNYPGPALSAKEKEE
                     QQTKRYPNMFPPEGTVMHKFLTTRWIHAWIALGVLTSLATFTFMENFKRTSPFAHLMP
                     GWSGLLSHPINTIAQVVSVWKMHVQHTSVLAREKRHKRIDDAEKRRQYRVAHGLEAPA
                     VADTAAAAAAVEDDQSPVAAGASDTMVAPVKVEVDAEAVKDEEYREFGGQKRPVKKWL
                     GIW"
     gene            complement(<352018..>354480)
                     /locus_tag="TRUGW13939_08678"
                     /db_xref="GeneID:55996166"
     mRNA            complement(join(<352018..353460,353519..354262,
                     354316..>354480))
                     /locus_tag="TRUGW13939_08678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491807.1"
                     /db_xref="GeneID:55996166"
     CDS             complement(join(352018..353460,353519..354262,
                     354316..354480))
                     /locus_tag="TRUGW13939_08678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347700.1"
                     /db_xref="GeneID:55996166"
                     /translation="MAISHEYSLRGTSQSMVALEDRFEVMKEIGDGSFGSVVLARTRT
                     AGANVARRGTMVAIKTMKKTFESFAPCLELREVIFLRTLPHHVHLVPALDIFLDPLSK
                     KLHICMEYMDGNLYQLMKARDHKFLEGKHVKSILYQILSGLDHIHAHNFFHRDIKPEN
                     ILVSTSAPVDSAFTRYSNLVTPPSTPPTYTVKIADFGLARETHSRSPYTTYVSTRWYR
                     APEVLLRAGEYSAPVDIWAVGAMAVEIATLKPLFPGGNEVDQVWRICEIMGSPGNWYT
                     KSGAKVGGGEWRDGNRLAQKLGFTFPKMAPHSMESILQPPHWPQSLSNFVTSCLMWDP
                     RNRPTSTQALNHEYFTDAVDPLLRPKSSTARLMGRKMSEKNIRPAAKDGSESPALSTK
                     PSWFRRSLVVRSDSPAPVVEPEPVRPAPVTQTTTAEMQAAKGRSAAKRATWANGAPMP
                     ILPSIRPVSPLSNAVTAQANSAVAHHNHQVSAMQQQADAAKSKKIGRQLSVNSHGNHY
                     SDAHRQEAERALNGIGNGTNSAAQKESFFSHLRKRARRLSGRNQAAAVNYDVEANAGC
                     SPWPNRSSVALDANMVEAKNVEFAELDKAVQDIKYGIESANPPPQLTSVPNHVLSKRQ
                     SVPGGPLRSMTESPSPVGGPVSSRTRRALQMSSHPVHRYETPEEEDELLDEVLHSASK
                     AARRLAQRYDEDSSSSLYKEDSHVSDLANDSSRTLNPYPTPSPSAKRDGVSFGLNDST
                     PVKQRESKVNGENSNRQWPTPPYSDQEWAAAVANTILSESTYR"
     gene            <355288..>355671
                     /locus_tag="TRUGW13939_08679"
                     /db_xref="GeneID:55996167"
     mRNA            <355288..>355671
                     /locus_tag="TRUGW13939_08679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491808.1"
                     /db_xref="GeneID:55996167"
     CDS             355288..355671
                     /locus_tag="TRUGW13939_08679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347701.1"
                     /db_xref="GeneID:55996167"
                     /translation="MGKRAWDSARVRDWHEQDANGEESEGWLASTMMAQRVGRDDSIG
                     RATAHMTKGTITQQQQQSVAVAVWVSARRASSSTKAPPSNKRMYGELANEKRGQKSVG
                     STCCQKGGESSTRQDEDEERSGLVS"
     gene            <359396..>360624
                     /locus_tag="TRUGW13939_08680"
                     /db_xref="GeneID:55996168"
     mRNA            join(<359396..359430,359488..359514,359565..359802,
                     359875..359994,360056..360445,360505..>360624)
                     /locus_tag="TRUGW13939_08680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491809.1"
                     /db_xref="GeneID:55996168"
     CDS             join(359396..359430,359488..359514,359565..359802,
                     359875..359994,360056..360445,360505..360624)
                     /locus_tag="TRUGW13939_08680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347702.1"
                     /db_xref="GeneID:55996168"
                     /translation="MAGGWSEEKVNRVKNLQLPQMLKCMGCHKTRSHTAYSGGQLQRL
                     RQSVVSRGQGALVNPQVRCRICTGGEAPVEITCIRCDKRKFVEDFFKAQRQNLDTATC
                     INCVSDGQMARPWDGNEGTGDSDNEYLHGDDDCSTVVGSTLGGVSLRIGDVGDEANET
                     SSMNSRPSIPSLTGSRRGNGDDYDDGDTDSSDGDGFLEDPSQPDTSSIVNSSWTNSSA
                     MSSSAINEDSQASALSRLRDTRGDYDWKMQEPRSSRYRPPTSSKPSKWAKTRAHDPTR
                     DARNMRIPEPSEVAEEDDRRSEVGTSVPPESYL"
     gene            <361665..>363717
                     /locus_tag="TRUGW13939_08681"
                     /db_xref="GeneID:55996169"
     mRNA            join(<361665..362384,362441..362543,362594..>363717)
                     /locus_tag="TRUGW13939_08681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491810.1"
                     /db_xref="GeneID:55996169"
     CDS             join(361665..362384,362441..362543,362594..363717)
                     /locus_tag="TRUGW13939_08681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347703.1"
                     /db_xref="GeneID:55996169"
                     /translation="MTYNSYHDPAGPYEQQPSAPPPPGDERFSDERPYPGSPSFNPPY
                     PSQYMSDQVQMPQPRMPSPSFQAQPPPSSGGRFDDAVASAVHQADTSNHFSPDLISQV
                     TATVIQQLQAYGLGSPQQQQQQQPQQQPPPPPPQAPPVLDTTYYEPPPAPRYRGTESP
                     EAREAKSTYSIPIETRDGSRRPSPGKVSDVGSESRPTMSERMPTSSDEMTTLEKVWGR
                     MFEDGKPTPRLGQLLRGIAVHLIEDHHPENTLVVIPEKMQKYYSVTKVSMDTYPWHDI
                     FDDQISSVSRIYRDIEAEHHLVQDPLNLNARPDKPGLTPRGFERWFTLMIQSNPDREF
                     ARLQKTVLDMPISNPDDKKERFPKELPRRLFPSSADLDTLEKLEASIVTHSGLDLPRN
                     LPHERSRSPARRAPVEKSPSRAGTERAPPPVQEREPKPYSSTPSSAVVEDEEDETIPP
                     RPIERERKPYSAQPGGGKFYDDSNEQAPKTETSKGKEFLSSPTTTTSHRQSHSYSQEP
                     PHVRSSQGTGPTSGYNGHTHHGSISSKPGRARSSSVGVNGGPGDYRHSEPDLNSFDAD
                     YGTSYKTSSATGDGYDEGRRYRDYDRDDSRDYEVLRERERDRERRYHDNLSSRNTWSE
                     EDYYRGLLGGQGAGPIGGTDYRYR"
     gene            complement(<363867..>364843)
                     /locus_tag="TRUGW13939_08682"
                     /db_xref="GeneID:55996170"
     mRNA            complement(join(<363867..364594,364672..>364843))
                     /locus_tag="TRUGW13939_08682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491811.1"
                     /db_xref="GeneID:55996170"
     CDS             complement(join(363867..364594,364672..364843))
                     /locus_tag="TRUGW13939_08682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347704.1"
                     /db_xref="GeneID:55996170"
                     /translation="MAKDASSARTTITTTRDPAEAHPFYPAFCFPASPTHFAWVKLSI
                     ADIHRLRPKDGFEDDFAGQNVYFYNNHPIQFVCLAGVVVTRDEYERRTVLNIDDSSGA
                     TIEVVILKATATSQPNTTTTTTTTTTTSSGSDGGTTINVTSTARSPIDTAALRVGAVV
                     KIKGTLSKFRATMMMHVVLERFWVLRETNAEVKFWNERARFLVGVLSVPWSLTPEIVE
                     ALRRRARDEETDVARDRRRVVEKQRRLEEREGKDYRRIMKRWDKEEKLREKEAEWITE
                     SNKRLEARLAKKKAAPNVNSLLD"
     gene            complement(<365468..>367050)
                     /locus_tag="TRUGW13939_08683"
                     /db_xref="GeneID:55996171"
     mRNA            complement(join(<365468..366339,366398..366512,
                     366565..>367050))
                     /locus_tag="TRUGW13939_08683"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491812.1"
                     /db_xref="GeneID:55996171"
     CDS             complement(join(365468..366339,366398..366512,
                     366565..367050))
                     /locus_tag="TRUGW13939_08683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347705.1"
                     /db_xref="GeneID:55996171"
                     /translation="MQVNSLVDTVHDVQDLLWVDKVAGALQTGRLCPWVSTFHPDKLP
                     CQVDGSFYNGAYNAGLKVVFSDGTAWMVRFPRGGMVSTEHADEKVAMEVTALTLIRDK
                     TTIPVPKVQAWGLAASNLLGLGPFIMMDFIEGVSLSKILNDPTAEKPTRLMREDISDK
                     DIILTGLAVCHGRGAEAQSPVRPLTYKAHNILHVGGVDTFGDRSQGFATTTEYFQHVF
                     GQDWKQLVQQPNSVFGLYDGKNNYKEFKRLQVLIPDLVNAKYNSCKFKLICDDLGLAN
                     LIVRSEEDLTVVGVVDLEWSYIGPAQLFGSPWWLLQDRPINPEWDCHLGDDPPKMAPR
                     YFKYLEIFLRILEEEEAKMPGNEERELSSLIKWSQDSGAMWLHMILSNGFNDHRTFPF
                     THLRQHFGDDAWVKRTVDFSNSEEPEAFAVQKLSELDKHDKAVDKLEADKALVDSGDM
                     KKEDFIARYLVDSDLTSLCSPFAVKTEIKNDEVLSEEVAV"
     gene            <368636..>370219
                     /locus_tag="TRUGW13939_08684"
                     /db_xref="GeneID:55996172"
     mRNA            join(<368636..369109,369161..>370219)
                     /locus_tag="TRUGW13939_08684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491813.1"
                     /db_xref="GeneID:55996172"
     CDS             join(368636..369109,369161..370219)
                     /locus_tag="TRUGW13939_08684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347706.1"
                     /db_xref="GeneID:55996172"
                     /translation="MFLQNAQGHTLQYGITAACGAGFLLFGYDQGVFGGLLDNEPFLK
                     TFGYPGTTIQGQIVATYDIGCIIGTLISMYAGDMLGRRRSILIGCVILIIGAVIQTAS
                     YSLAQMIVGRVVAGVGNGMNTIAIPIWQAETARPKDRGKLIVFQLVTNIFGIVITNWM
                     NYGFTFIPNSPVSWRFPLAFQCFFAIVTIMLVLVTPESPRWLIMKNRVSEAQHILARL
                     LMKPEDDPVVVSEIQNSVASVHHEAEVQQSVALKEIFTRNSKQQTLRRMILGAGTAFF
                     QQVGGTNVIAYYLPVVLTRSVGLSSRMALVLSAVDSMSLMFWGSIAALLIDRVGRKKL
                     MLIGVAASSVCFALVAVGLRYGGPDNKGMSVMAIVFIFAYYVFYGISLLSIPYIYPAE
                     INSQKMRNIGTSFATAVNWIFVYVVVVVTPTAIQNIQWRYYMLYAIFNFCFIPLIHYF
                     YVETATLSLEQVDRLFEIKHDAGKNMSWADATRIARTESDDLQMTVEKDVADAEHCET
                     AP"
     gene            <370658..>371826
                     /locus_tag="TRUGW13939_08685"
                     /db_xref="GeneID:55996173"
     mRNA            join(<370658..370706,370756..371027,371089..>371826)
                     /locus_tag="TRUGW13939_08685"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491814.1"
                     /db_xref="GeneID:55996173"
     CDS             join(370658..370706,370756..371027,371089..371826)
                     /locus_tag="TRUGW13939_08685"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347707.1"
                     /db_xref="GeneID:55996173"
                     /translation="MAPQKLRVGIAGLGRMGKRHANNFHELTPRANVVAASTPDAVER
                     DWAAENLHGIQIFKDYDDMLENADLEAVVVASVTAVHAEQALKAIRKGLHVLCEKPLS
                     IDVNIARSVLSEYEQSLKKHPQQKVMCGFSRRFDASYREAYERVEKNEFGPPVLFRSQ
                     TADMHDSSGFFVEYAKTSGGIFVDCSIHDIDLMLWFLGEKRQVKSLQAVGVVSVHPGL
                     ELSNDRDNAIATVEFEGGKIAALYCSRMMAAGQEDTSEIICEKGSVRVNMQVRKNHVE
                     IHDSLGARRELPRHYYERFREAFITEANEFTACCLDDTQPPISLQSSVKAVFLGQQLQ
                     RSLISGEKIYFGERSIKI"
     gene            complement(<372424..>373402)
                     /locus_tag="TRUGW13939_08686"
                     /db_xref="GeneID:55996174"
     mRNA            complement(join(<372424..372480,372536..>373402))
                     /locus_tag="TRUGW13939_08686"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491815.1"
                     /db_xref="GeneID:55996174"
     CDS             complement(join(372424..372480,372536..373402))
                     /locus_tag="TRUGW13939_08686"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347708.1"
                     /db_xref="GeneID:55996174"
                     /translation="MVSTILQPASANLEATSDNIDVVNVLKANAKQAGKDIYDDAEFD
                     KAKDKTTFRQFDDACDQVKNFYAQQHTLQTVSFNLKARNDFHNKTRAHMTVWEAMEKL
                     NTFIDECDPDTQESQVTHLLQSAEAIRKEGKPRWMQLVGLIHDLGKLLFFFGAQGQWD
                     VVGDTFPVGCAFDNKIIFGTESFRKNEDFENPIYSTKFGIYSPGCGLENVMLSWGHDE
                     YLYHIVKDQSTIPDEGLAMIRYHSFYPWHRENAYHELMNEHDKKMLEAVRAFNPYDLY
                     SKSDDVPNVEELKPYYLELIDEYFPTKVLRW"
     gene            <374192..>375196
                     /locus_tag="TRUGW13939_08687"
                     /db_xref="GeneID:55996175"
     mRNA            <374192..>375196
                     /locus_tag="TRUGW13939_08687"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491816.1"
                     /db_xref="GeneID:55996175"
     CDS             374192..375196
                     /locus_tag="TRUGW13939_08687"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347709.1"
                     /db_xref="GeneID:55996175"
                     /translation="MLSNKLAIASLSLGQHPSHCLDQKIKVAAEAGYKGIEIVYFELE
                     AFSKSQAISIFEGAEKIRALCQGLNLGIVSLAPFENYEGDPSPLSDRLSKATHWVGVA
                     RALRATYIQIPSNFKSDAIGDRNIVISELQQLADIGSAEQPVISIAYEYLSWGTHCST
                     WETALQYVNQVDRPNFGLCLDTFHEATKLWGDPFAPSGRFPNSDEVLRNSLDRFLANC
                     PVEKIFFIQLSDGERFEPPFSKDHPWYVEGEAPQFTWSKHARPFPFEHDKGAYLPVYE
                     ISEAWIRATGFKGWVSLEIFDRRMRDDDSRLETAAKRGIESWKTLLEKVRANSLKAHL
                     "
     gene            complement(<375659..>377328)
                     /locus_tag="TRUGW13939_08688"
                     /db_xref="GeneID:55996176"
     mRNA            complement(join(<375659..376474,376552..376648,
                     376705..376945,377004..>377328))
                     /locus_tag="TRUGW13939_08688"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491817.1"
                     /db_xref="GeneID:55996176"
     CDS             complement(join(375659..376474,376552..376648,
                     376705..376945,377004..377328))
                     /locus_tag="TRUGW13939_08688"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347710.1"
                     /db_xref="GeneID:55996176"
                     /translation="MEEPVKASSSLELENVESGVLRASHREFLLDRHGTLDLVPLPSE
                     FPEDPLNWPSWQKNTNLFLVSFHAMMCLIMGAGIIPAYSGMAEEMGASLQAATYFTSM
                     QIAMLGVAPLVWKPISTRIGMRPMWLIGTFCAAVCNVGCARSKSYGAMSISRLLVAFF
                     IAPAMALGTKVVTQMFFSHQRGQKMGIWTLMVTLGPSLGPFLMGFVTFHIGWRWIYWI
                     FAIINLAQFILYFFLSPETNFEATLVSSRQRFSFQARYFGLRRFSQKPLRAVDLVLPL
                     AVARHHVVWITTAAYAVVFNFAFVLLTVEIPQIFGEKFHFNTQQIGLQFLGMIIGGII
                     GEQAAGPLGDFAMAAYTRRHQGQNPRPEFRLWLAYIGYATMIAGFLVWGFRTADLPPN
                     VYDVSPVVGIGISTFGAQIITTSVFTYMVDCYPTESADIGIFANVVRQIWGFIGPFWF
                     PSMFESAGIKDSAGIMVGVSVIASLIPIIAVQYFGARLKQSR"
     gene            complement(<377880..>378608)
                     /locus_tag="TRUGW13939_08689"
                     /db_xref="GeneID:55996177"
     mRNA            complement(<377880..>378608)
                     /locus_tag="TRUGW13939_08689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491818.1"
                     /db_xref="GeneID:55996177"
     CDS             complement(377880..378608)
                     /locus_tag="TRUGW13939_08689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347711.1"
                     /db_xref="GeneID:55996177"
                     /translation="MTTFAATPSQSLDPSSPSSPPESTHLKYLRKCLTLAEKSPARPT
                     NFRVGALLVLRDDTPNATADDKLLSTGYTLELPGNTHAEQSCLLNYAATHKVYEENVA
                     DAFPAKEGKKILLYVTMEPCGVRLSGNTPCVKRIIQTRQNSTDVNNGIDKVYFGVKEP
                     GTFVGESQGCKMLTAAGIQWEFVPGLENEILAVATEGHKQANKKQEADERGRNVDEVS
                     KEERERQEHMPRNPKKRMMDTGMP"
     gene            <379532..>381079
                     /locus_tag="TRUGW13939_08690"
                     /db_xref="GeneID:55996178"
     mRNA            <379532..>381079
                     /locus_tag="TRUGW13939_08690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491819.1"
                     /db_xref="GeneID:55996178"
     CDS             379532..381079
                     /locus_tag="TRUGW13939_08690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347712.1"
                     /db_xref="GeneID:55996178"
                     /translation="MDKTRLFPSSSPHLPTVSTPLSILDATVARFSATGAVWLFEHIP
                     EDINETEFIDRLCSSFVDALGDFEHWAGQLQWAPVRPGGSHTQRFNRPIIIYGDYNDP
                     GVEWSVVRHPSIPVQSLAPSASERALGKGVWIGDDFAQSLFLSDTPLPLHDLREFEDL
                     PAMQIQLNLFNDGGYGIGIKMAHSLADAQSLMVFVHHWAAKSRKLFSSTDTSSLMDAP
                     IFDPRLLDTHAAGDIDGPAADPALVSIARQLPLHRFDWWRIDDPGYSDFSIPATENSK
                     PSPEILSQVEISPSTPGPWTTWDISRPVRYTQLHYHGTELDRLKEQARADGRPDISRL
                     DALLAHMWAVINRARGHGDSTEDVFLNITLGARARVSPPLPESFIGSPVFNTHIKASG
                     ASVCDSSVGQTASQIRDTMLQFTPDAMGAMLHDAAHEVSPQRLWQAFLGTQHTLATSW
                     LRLKVYQVDFVGSKQQPRYVHAVMPKMDGCLQVMDSGVDDGGIDIALYLDAEAMENLL
                     VDKKLHV"
     gene            complement(<381355..>382572)
                     /locus_tag="TRUGW13939_08691"
                     /db_xref="GeneID:55996179"
     mRNA            complement(<381355..>382572)
                     /locus_tag="TRUGW13939_08691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491820.1"
                     /db_xref="GeneID:55996179"
     CDS             complement(381355..382572)
                     /locus_tag="TRUGW13939_08691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347713.1"
                     /db_xref="GeneID:55996179"
                     /translation="MADDIETSFQAAIDAGKINGAVICAIDAEGRFVYDKALGERTLL
                     SGEKYPQQTDDVLFLASATKLVASIAALQCVEDGLLTLTGDLSAIAPELSDKGVITGF
                     NDDGEPQIEPVAGPITLEMLLTHSSGLCYHFMDPLIARWREKFAGTRHEDNRRLVEEL
                     FAYPLGFQPGTGWMYGSGLDWAGRIVERVTGVSLCERMQQRIFDPLGISDAEFYPVTR
                     EDLHPRLVDLNPQDPEAQGRAVLGGGGEMNKVTRGDFGGHGLFMSGASYVKILHSLLA
                     NNSKLLKPATVDDMFQHHLSPAATASQQAELAGPKGVFFRVGIDPTTKMGHGLGGLLT
                     LEDVEGWYGERTLTWGGGLTLAWFIDRTNGLCGVGAVQAALPLDMQEIEVLKQTFRKD
                     VYRKRSAWRAQQG"
     gene            complement(<383318..>384702)
                     /locus_tag="TRUGW13939_08692"
                     /db_xref="GeneID:55996180"
     mRNA            complement(join(<383318..383449,383513..383836,
                     383899..>384702))
                     /locus_tag="TRUGW13939_08692"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491821.1"
                     /db_xref="GeneID:55996180"
     CDS             complement(join(383318..383449,383513..383836,
                     383899..384702))
                     /locus_tag="TRUGW13939_08692"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347714.1"
                     /db_xref="GeneID:55996180"
                     /translation="MSNDKLRFGLKCATILFPFALQLLSQRLLALAHRWTYRTVPSPK
                     EIVVIGGSFTGLQVAQRLTETIPTGYRVTMIERKSHFNYLFNFPRYSVLAGHEEYAFI
                     PYDMLENAAPKGSFRRIRDIVTSIKDGRVYLESGEAIEFSYLVIATGSRQGLPSKGIA
                     TEKKDGCRELQTVQENIQTANRIAVVGGGAVGVELATDIKYFHPDKDVTIVHSRERLL
                     QRFGPRLHDHVAGKMREMGIHVRLGERPEIVTEENVLLFPSGKRQEYDLIIPCAGQTP
                     NSAIVQDLAAGIISPSTKEIRVQPTLQIIADSKEDTAALSNIFAIGDVAETGSPKMGR
                     AGFFQAEIVIQNILAMIQGREVSSVYQSRPDIEGSIKLSLGKDDAVMYMEEEDGNDFL
                     IPIKAGNEDLEIKNAWSRLGGRFPGTT"
     gene            complement(<385537..>386184)
                     /locus_tag="TRUGW13939_08693"
                     /db_xref="GeneID:55996181"
     mRNA            complement(<385537..>386184)
                     /locus_tag="TRUGW13939_08693"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491822.1"
                     /db_xref="GeneID:55996181"
     CDS             complement(385537..386184)
                     /locus_tag="TRUGW13939_08693"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347715.1"
                     /db_xref="GeneID:55996181"
                     /translation="MSSFFYSTTYARKEYYPIPETLDADLVLGILHDHCTVAHILWTP
                     GLVKAAEEIQASPRATKFDIRSETGRLQSSLTTESDGLVCKEEMPLGFQITVKYRVVH
                     GQTTAGQNEGKADDILNTVQPSSVINNSSNMATSISMLDPSRLYLEEERSITALKPIS
                     KLLKYKEGPTVKTQNLLRAFEDLARNTGDMASALNRLKDSVTAKSTPGLGKTKED"
     gene            <386749..>387701
                     /locus_tag="TRUGW13939_08694"
                     /db_xref="GeneID:55996182"
     mRNA            join(<386749..386881,386938..>387701)
                     /locus_tag="TRUGW13939_08694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491823.1"
                     /db_xref="GeneID:55996182"
     CDS             join(386749..386881,386938..387701)
                     /locus_tag="TRUGW13939_08694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347716.1"
                     /db_xref="GeneID:55996182"
                     /translation="MSTDDELGDPPASINPYEVLEIDEKASADEVKSAYRKKALRHHP
                     DKASPETRDKAKEKFQQIAFAYAILSDERRRRRYDLTGNTSESLDLEDDNFDWTQFYQ
                     EQFSGMVDSSAIDKIKKEYQDSEEERADLLAAFEQFKGDLDRVYEVVMLSSVLDDDER
                     FRTIIDKAIADREVKGWKNYTEESENKRKKRLKRAQEEAAEAEEAAKELEEKGTAKKK
                     GKKKKATKEDDNTLAALIQQRQQSRAANFFDDLEAKYAPKGKGKKRSAADEPPDEAFA
                     AVGARKASGKDGGKTRGKRSKA"
     gene            <389265..>391531
                     /locus_tag="TRUGW13939_08695"
                     /db_xref="GeneID:55996183"
     mRNA            join(<389265..389745,389850..390329,390385..391190,
                     391251..391312,391369..>391531)
                     /locus_tag="TRUGW13939_08695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491824.1"
                     /db_xref="GeneID:55996183"
     CDS             join(389265..389745,389850..390329,390385..391190,
                     391251..391312,391369..391531)
                     /locus_tag="TRUGW13939_08695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347717.1"
                     /db_xref="GeneID:55996183"
                     /translation="MSLAQALEQDRKEILKFLDEQKASKASYAEAGTSPTSAGRSRAD
                     SSSSPAAGRFGPITGNGVSKAAPVASGGRRASLSSPLASSSPWTNTLLSEWDDGLYET
                     DTEEPEQERRSSDSVTAFPPKRRQRALKEKDIDIDAGYLFTMQGSGTHIASGRHTTIG
                     APTRDFTTSKTEDTKFTRPNRRKSTNMERDSKERLDVAHASEESLSTSFKSDQSAAGD
                     DDKNERLAKDTVEGVDENSDSAESSGEADDTSSDDEAFDIRKGPAKSRGRSKEKTELS
                     PGASPAPSPMPPGGWTGKRGPGPLPPGSSHVGGALSLFNELEEERELNGPLVTHRGAN
                     GRRTVLSPGPRRNASSPGARRSGVHPHTSFDYNGSGMSTPVGSDDEADLSDLKQAQNL
                     SVHLSSVDTSIPDRAIRTIIRGDFPRLQQEAEKKSRRQRKYLVATDLSEESVYALEWT
                     IGTILRDGDTLFAVYAVADENASGLGLNTCVQIGDGATVIKHTADVVGKQTEKTALKY
                     QGSSSLLPNALAAYFGNDSKTTSRNNSVDSRALSRSEQDRSRAIEDISDTCVRLLRKT
                     MLQVRVAVEVIHCRSPKHLLTEAIDGLEPTLVVLGSRGRSALKGVLLGSFSNYLVTKS
                     SVPVMVARKKLRKQSKKTTRIRLSNNLTISKGLAGAKID"
     gene            complement(<391999..>393942)
                     /locus_tag="TRUGW13939_08696"
                     /db_xref="GeneID:55996184"
     mRNA            complement(join(<391999..392315,392373..392866,
                     392920..393236,393290..393451,393505..393540,
                     393604..393623,393694..393778,393838..>393942))
                     /locus_tag="TRUGW13939_08696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491825.1"
                     /db_xref="GeneID:55996184"
     CDS             complement(join(391999..392315,392373..392866,
                     392920..393236,393290..393451,393505..393540,
                     393604..393623,393694..393778,393838..393942))
                     /locus_tag="TRUGW13939_08696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347718.1"
                     /db_xref="GeneID:55996184"
                     /translation="MAPTDFVDPRMTSIKPRIRYNTIGGVNGPLVILDNVKFPRYNEI
                     VSLTLPDGTERSGQVLEARGNRAVVQVFEGTTGIDVKKTTVEFTGHSLKLGVSEDMLG
                     RVFDGSGRAIDKGPKVLAEDYLDINGSPINPYSRVYPEEMISTGISAIDTMNSIARGQ
                     KIPIFSASGLPHNEIAAQICRQAGLVNKPTKDVHDGHEENFSIVFAAMGVNMETSRFF
                     TRDFEENGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSA
                     YCDALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEGRNGSITQIPILTMPNDD
                     ITHPIPDLTGYITEGQIFIDRQLDNKGIYPPINVLPSLSRLMKSAIGEGRTRKDHGDV
                     SNQLYAKYAIGRDAAAMKAVVGDEALSPEDKLSLEFLEKFERTFIAQSPYESRSIHDS
                     LDIAWNLLRIYPKDLLNRIPKKVIDEFYARSGKGRKPAAATGNKDTRDNTAAPQEENL
                     IDA"
     gene            complement(<394397..>396708)
                     /locus_tag="TRUGW13939_08697"
                     /db_xref="GeneID:55996185"
     mRNA            complement(join(<394397..396146,396201..396504,
                     396573..>396708))
                     /locus_tag="TRUGW13939_08697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491826.1"
                     /db_xref="GeneID:55996185"
     CDS             complement(join(394397..396146,396201..396504,
                     396573..396708))
                     /locus_tag="TRUGW13939_08697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347719.1"
                     /db_xref="GeneID:55996185"
                     /translation="MEGIKQTFAKCKAEKRSALVTYVTAGYPTVDETVDILLGLENGG
                     ADIIELGLPFTDPIADGPTIQTANTQALLNGVTIPMVLDMVRTARKRGLQAPVLFMGY
                     YNPLLQYGEERMLKDTKEAGANGFIMVDLPPEEAVRFRDLCASNGLSYVPLIAPSTSE
                     SRMKLLCKIADSFIYVVSRMGVTGATGTLSTGLPDLLKRVHKYSGNIPAALGFGVSTR
                     EHFLAVQKDAEGVVIGSQIISVIGKAPQGQRAQTVEDYATSITGRKLERDSNGKIVNV
                     KTVLEVVEKQIPEAGEAQPTAIITEGEVGAGSGSQPGLADQLDALNNKTDDPAALPSR
                     FGQFGGQYVPESLMDCLAELEKGFNEARNDPKFWEEFRSYYPYMGRPSKLHLADRLTD
                     HVGGANIWLKREDLNHTGSHKINNAIGQILIARRLGKTRIIAETGAGQHGVATATVCA
                     KFGMKCVVYMGAEDVRRQALNVFRMRLLGAEVVAVHAGSKTLRDAVNEAMRAWVVDLD
                     TTHYILGSAIGPHPFPMIVRTFQSVIGDETKEQMKELIGGLPDAVVACVGGGSNAVGM
                     FYPFSNDPSVKLVGVEAGGDGVETGRHAATLSGGSLGVLHGVRTYILQDEHGQVSETH
                     SVSAGLDYPGVGPELSNWKESQRAKFVAATDAEAFQGFRLLSQLEGIIPALESSHAVF
                     GAIELAKSMKKGENIVLNLSGRGDKDVQSVAEELPRLGPKIGWDLRF"
     gene            complement(<397801..>400486)
                     /locus_tag="TRUGW13939_08698"
                     /db_xref="GeneID:55996186"
     mRNA            complement(join(<397801..398187,398240..399672,
                     399726..399885,400382..>400486))
                     /locus_tag="TRUGW13939_08698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491827.1"
                     /db_xref="GeneID:55996186"
     CDS             complement(join(397801..398187,398240..399672,
                     399726..399885,400382..400486))
                     /locus_tag="TRUGW13939_08698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347720.1"
                     /db_xref="GeneID:55996186"
                     /translation="MNTRALHRPALHPLSERVPQQSRLRVNLVLILVAKFNSDFQTPL
                     IFDESADYSDPEDSRFAGAFSDGLLAKADFSMSGFDKTPYRASGDFNDPMQALSDNAF
                     YSQASYLPELYAPSQEDLGSPDTDNLHYVPPQGYAGSSFGDAHSPLMDSAVISTPEVV
                     SFSPQRGSENGEVCVRVLSPFDLHSTARAIFLSFGSRQCECSVNVLSTQSSSFDYAFT
                     AKVPTFALTMSSSFDVSLHLVIDIPAASPIMLQVGVFTYEQYLQLPIDDSRKRSLSSF
                     ESTALRPAKRHSAHEVETKPEYPTHARSASYSPFMHTPVTTGTFPAQYKPGHSPSVSY
                     DFLAPPSGVPYTSLQPSSPVNPSWSPSASVASTAASAVAISSHSQNPTLIRTSTLQQG
                     HGMTPSPAFNPYAMYPTKAVLKLNGDLDSMATGWSDDEKTAQRRLVQFTRSQNGSTIN
                     ADFKPISPQERAPNSICISCITWEGKDECFVTSVDTIYLLESLVAVRFTVEEKNRIRR
                     NLEGFRPLTVSKTKPDSEEFFKVIMGFPAPKPRNIEKDVKVFPWKILSLALKKIIGKY
                     SASYSSTAGALSATLSASHSMGSDIGTESQNPSSPQSVSESTTSSVYPSNFTSTSLSP
                     ALVQTTSSFGSDFSNLAVSSSDYSTMPTGYGYETSFQNTQIMANEPSWDFGSSSNPED
                     FDLSSTIPYTMA"
     gene            <406578..>409704
                     /locus_tag="TRUGW13939_08699"
                     /db_xref="GeneID:55996187"
     mRNA            join(<406578..407100,407150..407174,407234..407963,
                     408072..408468,408524..>409704)
                     /locus_tag="TRUGW13939_08699"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491828.1"
                     /db_xref="GeneID:55996187"
     CDS             join(406578..407100,407150..407174,407234..407963,
                     408072..408468,408524..409704)
                     /locus_tag="TRUGW13939_08699"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347721.1"
                     /db_xref="GeneID:55996187"
                     /translation="MDPLTALSVAGSTIQFVDFGSRLVSKTQKLYKSADGVLTEHIHL
                     EVIIADLGTLLKGLQRKLPEHRQLYNNQTVIEDDEALDNLCRRSVEIAEELMRRLEKL
                     MISPRTRQGLDSENGEPECDVLKQQNQSALANLESSGKVDSLLMADRRQVTLEMFPEM
                     DELSESVGGVMEQEEFRLLVLLRETLDHLSLQQSHLSNQLTQSTQLILTSFVNARDEL
                     ASQIRDQSEKIIESQHARLYGKNPQQLEDFLKGKLGHTGSLQLPKGVKTSEEYVSGSS
                     AHDYAVEDEIHTLITENGILGSLSFISLMDRRESVEIPYENTFEWIYEGLEGSRKPWN
                     SFVDWLRQGSGIYWINGKAGSGKSTLMRYIYENDRTKQELKAWAGAMPSITCGFFFWK
                     SGDEYQRSQSGLLRSLLFEILQRDRKLIPEAMPELKRCFRNLVDALRTKRVKVCLFID
                     GLDEYEGEYCDIVELFGGYANSPNLKICLSSRPLLVFEQAFANLPSLKLQDLTYGDIS
                     HYVKDRLYGHKYMVQLSKQNAADISSLVDEVVTKASGVFLWVKLVVRSLKMDSFYHDQ
                     ASRIFQIVKVAHERSPGKLTLLKLYWAEEEDEMAAEIAPIQKYGDEELALACQVMDAR
                     LKSVCAGLLESYCPPFSDITPDAKVVYMHRTVTDWLAKPLVWDTIVSHSTENRIFSPT
                     YAMLRSCVMQLKTAEVSVSLPLDMSIISDALYYAKASELDLNAGFPALLDQLDITASY
                     HWRTGKAHIDNGHGILGGGKRRRKSSMSNCRPNMVAPDIDEFSARNARFPSKPFAEMD
                     LELDLNPDNEDAFAEEEDELALCTTSEEGALHHWSYGLETPGIKPIGKGSTFYNLARD
                     IGLSHYVSMKYDSAIIDDQDVNQHLLTHLSFNCTVPDPQLMERVLKAGTDPNFLYDGR
                     PPWEGVLLAAASHFSRRAGSQRTGDSPENGPANGLRF"
     gene            complement(<410236..>411397)
                     /locus_tag="TRUGW13939_08700"
                     /db_xref="GeneID:55996188"
     mRNA            complement(join(<410236..410535,410591..>411397))
                     /locus_tag="TRUGW13939_08700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491829.1"
                     /db_xref="GeneID:55996188"
     CDS             complement(join(410236..410535,410591..411397))
                     /locus_tag="TRUGW13939_08700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347722.1"
                     /db_xref="GeneID:55996188"
                     /translation="MPKAIFISPIDGKPGKPGQVYYPLVQKTVPQPTPTGSELLIKLS
                     AAALNHRDLFLRQHLYPGLTFDVPLLADGVGTVVGLGSGVQDQSWKSKRVILNPGTGW
                     KEDPDGPEDPTGYKILGGTKFDPRGTLQEYVIVDESEVEEAPSHLSDAEAAALPLTGL
                     TGWRALISKAGEKNSSNGAAVLITGIGGGVALMVLQFAVARGASVYVTSSNQEKIDKA
                     IQLGAKNGVNYKEDGWEKKLLSQLPAGKKTFDAIIDGAGGDIIEKGTKILKAGGVISV
                     YGMTVSPKMPFLMQAVLKNIDIKGSTMGSRKEFKDMVDFVKSTNMRPVVSRVLKTDLD
                     DIVGLDSLFEDMKSAKQFGKLVIEFGDSSSASKL"
     gene            <412369..>414336
                     /locus_tag="TRUGW13939_08701"
                     /db_xref="GeneID:55996189"
     mRNA            join(<412369..412486,412549..412694,412903..413050,
                     413097..413716,413773..414163,414221..>414336)
                     /locus_tag="TRUGW13939_08701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491830.1"
                     /db_xref="GeneID:55996189"
     CDS             join(412369..412486,412549..412694,412903..413050,
                     413097..413716,413773..414163,414221..414336)
                     /locus_tag="TRUGW13939_08701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347723.1"
                     /db_xref="GeneID:55996189"
                     /translation="MSSNLEKPPVSPPSDSKEAPIEGTIEEGNVVEAGDSQLLAQLGY
                     KQELKRQYSTVQIFAIAFSIMALLPSIASTLSFSIPAGPVGMVWADLASAMPTAGGLY
                     FWTHHFASEKWRNPLSFVVGYSNTLGLIGGLCSIDYGFALMLLSLISIARDGEWSASR
                     PVIYATYLGCVVVHAGLATFCGRIMHKIQSICIYLNVGLVVATVIALPIGNHKNGVPI
                     NSGAYVFGDMENLTTWSTGWTFMLAWLSPIWTIGAFDSCVHMSEEATHASRAVPMGIV
                     LSCGLCGILGFLSLAVMAACMDQNLENLLGSAFGQPMAQIYYDSLGKPGALGFMAVVA
                     IVQFFMGLSILVAASRQTWAFSRDGALPFSTFFRHVSKRIRYQPVRTIWGVAFAAIII
                     GLLTLIDSAAANALFSLAVAGNDLAWGVPIFCRLVWGDKTGRFRPGEFYTGIFSKPIA
                     ITAVLYLAFAIILAMFPTEGPNPTSDSMNYTVVINGALWLGAALYYMLFARKWYTGPK
                     STVS"
     gene            complement(<414498..>415982)
                     /locus_tag="TRUGW13939_08702"
                     /db_xref="GeneID:55996190"
     mRNA            complement(join(<414498..414964,415011..415212,
                     415263..415301,415359..>415982))
                     /locus_tag="TRUGW13939_08702"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491831.1"
                     /db_xref="GeneID:55996190"
     CDS             complement(join(414498..414964,415011..415212,
                     415263..415301,415359..415982))
                     /locus_tag="TRUGW13939_08702"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347724.1"
                     /db_xref="GeneID:55996190"
                     /translation="MFYSVLSCALLLQQATAQLSGTVGPLTSVSTKKSTKLCNVLDYG
                     AVADQSTDLGPPLTDAFDDCSSGGLVYVPSGDYLLSSWVTLSGGEAWALQIDGIIYRG
                     GTDGGNMIYIEHASDFELFSSTSSGAMQGLGYEFHVDGSISGPRLLRLYEVTDFSVHD
                     FILVDSPSFHFSMDTCENGEVYNMAIRGANEGGLDGIDVWSDNIWIHDIEVTNKDECV
                     TVKSPSHNILVEDIYCNWSGGCAIGSLGADTDISDIIYRNIYTWSSNQMMMIKSNGGS
                     GTLENAVFENFIGHGNAYSLDLDAYWSSETPVDGDGVTYTNITFTNWHGGEADGSQRA
                     PIRVICPDAVPCTDITISDWALWTESGEEQLYVCQSAYGDGFCLSSDSDVTSYAATTS
                     TATAAPSGYSAATMAADLADSFGTTASIPIPTIPTSFFPGQTPVSQLAGSS"
     gene            complement(<417220..>418940)
                     /locus_tag="TRUGW13939_08703"
                     /db_xref="GeneID:55996191"
     mRNA            complement(join(<417220..417409,417462..417836,
                     418042..418098,418162..>418940))
                     /locus_tag="TRUGW13939_08703"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491832.1"
                     /db_xref="GeneID:55996191"
     CDS             complement(join(417220..417409,417462..417836,
                     418042..418098,418162..418940))
                     /locus_tag="TRUGW13939_08703"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347725.1"
                     /db_xref="GeneID:55996191"
                     /translation="MMGSFLNGRVVPDHRMGTAAENPPSRVAPEWHQYQSVTSFSDTS
                     VPPGMQQADRAVSLSTTGSFSPSPKRLKDWSRDDSRRDSARKKKSFGYSPMSDRTSGS
                     SKRLLLLHRRIGRVICGLGPALSPSTDSLIHNFFQFTHLANLFYDQDAFLSRFPCALD
                     LATGKHEEQAVVLVVFALGSIVGKTVRSQYVEGEAIPGMEFFRPALHVLTSSWAAAFC
                     GTLTLPHGLVLCATYLSYLAQPLRAWKLIHLASTTVQQLLINEPEKDELFRIAWSCFL
                     IERVHYPPNSPHGLSSSTPEDLLDVCNDLCRRLDIWHQSLPAFIQPDLSSQEDANSQS
                     YILRLRYWSTRDIICRPLVAYVASLAPEETVSPEIMDKCRTGLFSCRSFLFFSGNLLS
                     QYTPYTYSASINCFGCAIILSLAAQSPILGQSISQINELQNMAVARIKLWAQPLTSIE
                     CALEILVILQTKMRYR"
     gene            <420533..>422216
                     /locus_tag="TRUGW13939_08704"
                     /db_xref="GeneID:55996192"
     mRNA            join(<420533..420701,420761..421972,422050..>422216)
                     /locus_tag="TRUGW13939_08704"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491833.1"
                     /db_xref="GeneID:55996192"
     CDS             join(420533..420701,420761..421972,422050..422216)
                     /locus_tag="TRUGW13939_08704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347726.1"
                     /db_xref="GeneID:55996192"
                     /translation="MYLPKLLILLVVGVIVYKTIRSKIRKRQIRQKEAELGCLPPPVF
                     QLTNGLGLPVKKESLQATNEDRNPQYIMDTMNSISPDCHTVRVPIFDYEIFVTRDPEN
                     MRAIFSTQSNDFDISVFRQMSWMPMIGRGIFTTRGWDWKHSRSLLRPQFARDIVSDVE
                     REERHVQALMKRLLVEPKSKWTEKVDLQPMFFNFTLDTASEFLYGKSVNSQEGTKHGI
                     EMATHFHNAKMAVHRRIEVDKFYWLVNSRKFRRSCNSLHQWVDEIVASRLSQLKVEKS
                     MNDEPKQRKFVLLDELAKETQNISELRGETLNVLVAGRDTTGSLLGWIFYFLVRHPEV
                     YAKLRETVINTFGAHPTRTKIDFHVLRNCTYLQNVMKEALRIATVIPMNERVALRDTT
                     LPVGGGEDGKGKVFIPGGTQILIPTYAMQHRKDLWGPDVEEFKPERFEKKQPGWEFIP
                     FGAGDRKCLGQQFAFTEAGHVVVRFLQRFDKMENLEEGDGRIRLHHAIENRSGTGVQV
                     RLHEAEF"
     gene            <424342..>440015
                     /locus_tag="TRUGW13939_08705"
                     /db_xref="GeneID:55996193"
     mRNA            join(<424342..425042,425785..426393,426448..426502,
                     426714..426847,426918..427051,427135..428175,
                     429412..430067,430798..431523,431579..431972,
                     435281..435364,435419..435607,435670..436143,
                     436199..436664,436720..436992,437743..437825,
                     438343..>440015)
                     /locus_tag="TRUGW13939_08705"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491834.1"
                     /db_xref="GeneID:55996193"
     CDS             join(424342..425042,425785..426393,426448..426502,
                     426714..426847,426918..427051,427135..428175,
                     429412..430067,430798..431523,431579..431972,
                     435281..435364,435419..435607,435670..436143,
                     436199..436664,436720..436992,437743..437825,
                     438343..440015)
                     /locus_tag="TRUGW13939_08705"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347727.1"
                     /db_xref="GeneID:55996193"
                     /translation="MPGMTFAIMGSLTNSTLTMEPLPISTILHNCPRALAWLWAVLMV
                     FDINNQNSPASIEEDQINKPSRPIASGRIHPTEASWLLQGMILLSLVLGYVTGVMQET
                     VALFALYWAYDNQSGNENWFMRNLLAAGGYIFYALGSLAIVSNHTDTREARLWMLIFG
                     LVILTTIHAQDFRDMEGDSLKGRTTIPLLMGSKSARWTLAASLVFWSVICPYYLGLSR
                     YAYFLPMALGGFTGLSLGKDPYDHEKSMTADMPRQATSPRHVLLKAVDTASGEITGWV
                     SWGFRGFTEAEIAEIRPGIVEKLNKPASEDRGSEKKDPGSTNTDTVEDDDPIKRLESM
                     TSADLKHWMDKLMPEGTKCMFVVSLCVAPKWQSQGVGSALLRWGTERADAAGVFIWVH
                     SSADAWPAYAKHGFETVGTLDVDLDEYAPAPAPDQEGKWGHYEFRCSKFQYIRSTDNA
                     MRHESPRKYLPLIKAMFSFFYRIYAFISGPETPKTGEPLRFGVLGASAIAPMAFINPA
                     KSHPEVVVACVAARDRSRAEAYAKKHGIPSVHDTYQDILNDPSIDSVYIGLPNSHHYE
                     WALRAVQAGKNVLLEKPATSNATEAEKLFNHPRVTASDAPVVLEAFHYRFHPAWQKFL
                     SLIHKDPLAGPVKTGYSQSFMFKGYFDRGDIRLNFALSGGCLMDFATYNISNVRQILN
                     DQHPQVQTVDFRRITDQGTGTDDPRRPEQIDEAVRATYKSHTGAVGRINADLITTGGW
                     PLLPSSWTRNWPSVGWPKCVAELEEKQIDNQKLGEGEAHFVQRTVTMYNHLMPHLYHS
                     LVVEDRHSIKDGSKVTRSWTEKKNIKAYDWSDKSDGRQGAYWWPTYRYQLEEFVHRVK
                     GRKGNGIWVDGQDSINQMKVIDETYTKGGLEIRPTMGIGGGIPDLRNHHDIRLGDVVV
                     SKPTMAFGGVVQFDRGKINTDSEFERTGHLNKPPVVLAASLQKLIAQHKLYGNRISDH
                     LADMLRKFPSMSKEYAYQGNGNDILFHHTYHHKSGSNCMGCRRDKIIDRAPRQSISPI
                     IHYGTIGSANIVIKDGETRERLKRDLGIMCVEMEAAGLMDEFPCVVIRGICDYADSHK
                     NKRWQPYAAATAAAFSKELLLGILDDRIEVIFPFLLALVKYLKPSKFPAEKAIVKLSS
                     SIISTINYHVQVTKMTEKLIVVFGATGGQGGSVITTYLSELGWKVRGVTRNARSTQAE
                     ALKARGVEVVQADLDEPVSLAQAIDGAQAIFGVTDYWGLFGTIAAQQGATATHSIDEL
                     AKEAEVQQLKNLVDMAAKSPILERFIISSLPNITRLSNEKYPNVYPYNGKAEAVDYLE
                     ENYLDLWSKTSVYRPGYFLVNFIDHPMGRPQKGEDGITRFVSNFDLNLKIPLIAHNED
                     SGALVRALIDDAPGKSLTGYREWASMNEVAQVFENATGYKAEAVQLPIGEFGFDCPPV
                     IQRDLIDNFAFANEFGLEGRNDPTLVHPKDVSFTAIFTMDGYLTDSYSVTGGLLTLKS
                     FSSVFPSITGANDGTRQGITVAAYNLGCFAGSIPTIWVGNWLGRRKTIFIGSSIMIVG
                     AILQCTSYSLAQLVVGRLVTGFGNGMNTSTVPTWQSECCKSNRRGQLVMIEGAMITLG
                     ITISYWIDFGLLFADPNPVAWRFPLAFQIFFALIIVSSVMFLPESPRWLILKGKEDEA
                     REALTALMAQPADSELIKTEFTEIKATVLEMSKGSFRDLFTMGPDRHFHRVVLAYVNQ
                     MFQQISGINLITYYIPVILEQRLGMDLVTSRIVSACNGTEYFLASWVAVFTIEQFGRR
                     TLMLFGAAGMSISMIILAITSSLQTPGGDIAAAVFLFVFNSCFAVGWLGMTWLYPAEI
                     VPLKIRAPANALSTSANWIFNFMVVMITPVAFQNIGYQTYIIFAVINAAIFPVVYFFY
                     PETTRRSLEEMDRIFHKTTNIFNVVQKAHDEPHMYGKKGELLRGLDDVEDEAIRRASV
                     LNRDSETNEKDITGTTADERDWQNFMPLQFIQIQYRIYPIIWTFLGCLYNGHGPLASE
                     HQIVRISCDIAQSDSVSIWYSKMGTPSFLGLKGQPLVYVVTFCCSIGFLLFGYDLGFM
                     GGLTTSPEFLSTFGNPNASLLAFMVASYEVGAMFGALYCLISGDRWGRKPNNFAGAVI
                     VTIGAILQTTSFGLAQFLVARLVAGFGLGMMTTVIPIWLSECTTPTSRGRMMAMQLSN
                     LIMGLIIANWLDYGMSFHPGSVQWRVPCAFQIAFPLILFVMLPFLPESPRWLAAAGHV
                     PRAKYALAALRGKEIDSVDVVEELKQIEYAIAIEAEEVGSWSDVFKDGGISGWTRVLI
                     GFSANFFQQLSGVNVMSSLGPYIFQNSIGMSRYDAMLVSGGLQIWYFLSSFVPWYAID
                     RVGRRKLFMIGSAGMGTCMMLSAIFVGIGTKKLGYAAAVVLYLFHSFFTLGWQSNMWI
                     YPSELLPLKLRLRGGAFAVVSQWLFTFLVVEITPPMITNIGYKSYIVFAVINFFTIPI
                     VYFCFPETSKLPLEAVDLLFADRDGKRPSILRVVKDSTNKEFMNNLTKELAERADQRA
                     ENEGIVNSAKGKTIELENVDLEGKD"
     gene            complement(<440137..>440901)
                     /locus_tag="TRUGW13939_08706"
                     /db_xref="GeneID:55996194"
     mRNA            complement(<440137..>440901)
                     /locus_tag="TRUGW13939_08706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491835.1"
                     /db_xref="GeneID:55996194"
     CDS             complement(440137..440901)
                     /locus_tag="TRUGW13939_08706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347728.1"
                     /db_xref="GeneID:55996194"
                     /translation="MPSISNHSVLVIGGSSGIGHAVAQLALDQNTRVFISSSNPTRIS
                     SAVNSIREKFPDGRIEGFPCDLKSAQAESNLEKLLTQVVAANGGQLLDHIVFTAGDAL
                     PIKALTDIDHDFIHDAGKVRFVGPLLVGKLAPRFLKQSYTSSFTLTGGTIARKPSPGW
                     SIAAGYMAGLEGMTKNLALDLKPIRVNLVLPGGVDTDLWGTVEERKDTMEMLKKISFQ
                     DKVASAAEVAESYIYLLRDTNATGSTVTTDGGGILI"
     gene            complement(<441658..>442794)
                     /locus_tag="TRUGW13939_08707"
                     /db_xref="GeneID:55996195"
     mRNA            complement(<441658..>442794)
                     /locus_tag="TRUGW13939_08707"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491836.1"
                     /db_xref="GeneID:55996195"
     CDS             complement(441658..442794)
                     /locus_tag="TRUGW13939_08707"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347729.1"
                     /db_xref="GeneID:55996195"
                     /translation="MATLTPVAVTLPKDKVPTKKNVRDIIGTFLTKEWPYVDPETLTV
                     SYHASFANAHCPVERPKPATGTPTETLKVFIKFHNDAGDCLEIFKSLAPTRHEEALFC
                     HEYGRTGLGAEVYGFFKTQDGTLGRVEELLDARNLEPEDVENSIIRADVAKGLAMFHV
                     LKTSLEKRAVKSYYEAVINGLRNYHKMDKLKALGKEGGVSIDRLVDYDYGRRLRNVVE
                     KLESIGGKTGWCIHDVQFMNVMVKNDAKEGVSKVTLIDFEFVMQNYRAFDIGGHFMQK
                     MFKWFDEESRIADCRKYTEEEKRHFCDEYAGQWNKLTGDSDTGDQVFLESEYGYLLAI
                     AFDMHNMLCFMDTQGDKNPLDLLGLNKLFDEFVDQYAKLNLIGS"
     gene            complement(<443245..>444923)
                     /locus_tag="TRUGW13939_08708"
                     /db_xref="GeneID:55996196"
     mRNA            complement(join(<443245..444378,444444..>444923))
                     /locus_tag="TRUGW13939_08708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491837.1"
                     /db_xref="GeneID:55996196"
     CDS             complement(join(443245..444378,444444..444923))
                     /locus_tag="TRUGW13939_08708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347730.1"
                     /db_xref="GeneID:55996196"
                     /translation="MDEDIKKPFPSAHAEHEEHTAITPGLLAPPVEYGPSGVRGLFSS
                     GYVLGAASLASLGGFSFGYDQGVMSIINVMDQFHNTFPPAETAFGTGFMTGMLLLGAF
                     IGCLFMPYLVDKISRKWALTCVVVIFDIGAIIQTAAQNYGMLVAGRAIGGIGVGTLAM
                     AAPLYISEISPPNLRGTLLVLESISIVSGVVIAYWITFGTRYMAGEISFRLPIGLQMV
                     CATILGFGIHLFPYSPRWLAMVGRRQESLASLTKLRGLPATDDRVCAEYEGIVAELEL
                     EKLLQEKRYPGASAYQREVNAWIDLFKNWRRTVVGCGVSFFQQFIGVNAFIYYAPTLF
                     RSLGQSDEMSLVMSGIFNTLQLVAVAVCFMIIDQAGRRPLAVFGAFGSCVCYIVIAIL
                     SGLYSDDWPSHMAAGWACVAMAFCFILVFGVSYSPLGWALPSEVFPTTLRSKGVALST
                     CVNWLSNFIIGVITPPMMASCGYRTYIFFAVWCFLAGIWAFFLVPETSGKTLEEIDDL
                     FGDTQGTEESEMVREAIALARSQMSSLSV"
     gene            <447149..>448848
                     /locus_tag="TRUGW13939_08709"
                     /db_xref="GeneID:55996197"
     mRNA            join(<447149..447440,447491..447616,447668..447736,
                     447788..>448848)
                     /locus_tag="TRUGW13939_08709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491838.1"
                     /db_xref="GeneID:55996197"
     CDS             join(447149..447440,447491..447616,447668..447736,
                     447788..448848)
                     /locus_tag="TRUGW13939_08709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347731.1"
                     /db_xref="GeneID:55996197"
                     /translation="MSGKAGRSAVPSNGVPMPQTFDKIPDVDLNTASQEGPPQYNNQS
                     KGINVSQGILRHNVDGKDADTGSQTTTLPPEKVFSIQLGSELFRLSGASIASDAPSYF
                     SRFFEEQLRQTENGGNVRTLYIDRDPATFREICRHLQGYHIYPRDGLEYVKLFADAQF
                     YSLPRLTSRIFESEIYIQIGERDFQVSRDMFSGPGDSPNFFNLGFAILFATPTDVFPG
                     LVRSGLLRPPSIVPPSIPSRSGDTFAQIVHMLRGYPIHIRNENHRTELLRDCRYYHLR
                     GVEQKLIPHHISYNPGRERDEILIRLEDVRQSGIQVVNDGSSDDTSILAGWVHYARPF
                     VDDNAYEMVLEIEGQNTVLNLDTMRADFRGLAKARVSSLVQVIANKLNLPNKAPLGLM
                     MMSGQANRASASPGNTPLSDDRPKIHIDAEADITVDNEPFQLGRSNFGNSSTNAGFTD
                     GPPAKRRREDEGAATEPRQWMIHNGQWRLRIQPDASGQLEVIFFAVKLDVSTNQRARN
                     TKRQFLG"
     gene            <449291..>450203
                     /locus_tag="TRUGW13939_08710"
                     /db_xref="GeneID:55996198"
     mRNA            join(<449291..449337,449391..449776,449842..>450203)
                     /locus_tag="TRUGW13939_08710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491839.1"
                     /db_xref="GeneID:55996198"
     CDS             join(449291..449337,449391..449776,449842..450203)
                     /locus_tag="TRUGW13939_08710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347732.1"
                     /db_xref="GeneID:55996198"
                     /translation="MAASTSNSDIKVTLYWLSQSRAQSILWVLEALSVPYQLKTFKRG
                     PDMLAPKELKDIHPLGKSPVISVERPEFSKPLILAESGAIVEYLLDHFGGEEKGLVPR
                     RYASEEDKTKGIETEEWLRYRFYMHYIEGSLMPQLVTALIIDGVRQFPVPFFVKPITG
                     IVANRIQASWLDKQFAVHFPFLEGQLKTVPGTTETQKGGICGPTFNAADILMSFPVIA
                     ATNRGIYSKTDCPELVAYADRLEKDAGYQKAVKKIEEVEGQFVSTL"
     gene            <450650..>451129
                     /locus_tag="TRUGW13939_08711"
                     /db_xref="GeneID:55996199"
     mRNA            join(<450650..450668,450734..450769,450890..451005,
                     451076..>451129)
                     /locus_tag="TRUGW13939_08711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491840.1"
                     /db_xref="GeneID:55996199"
     CDS             join(450650..450668,450734..450769,450890..451005,
                     451076..451129)
                     /locus_tag="TRUGW13939_08711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347733.1"
                     /db_xref="GeneID:55996199"
                     /translation="MAGPSKSLILDPALQKYYELNANRYKYFRWTPRNAWLTLVYVGI
                     VPGILGYVAYKTEGKYDPRGKRRGDTIAEW"
     gene            complement(<451853..>452572)
                     /locus_tag="TRUGW13939_08712"
                     /db_xref="GeneID:55996200"
     mRNA            complement(<451853..>452572)
                     /locus_tag="TRUGW13939_08712"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491841.1"
                     /db_xref="GeneID:55996200"
     CDS             complement(451853..452572)
                     /locus_tag="TRUGW13939_08712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347734.1"
                     /db_xref="GeneID:55996200"
                     /translation="MTVNRETTVPFHLKLFYHKHAYHTLNDFPIPTPTGPNSNNHLPP
                     HLEIYTWQSCTLRELSSLLAGALPSQLPSPQSGTRLCFRLIYPDTRGAATEGRGRYLS
                     KDIGSVILGQSSKDESTADDAHMNGDRRRGPDKGPLRLDEADKTLADARFVIGDYVDV
                     AILPPLDDGSVAPPVQGGRGPPGGPLGGGMRAFGPPRDNGGRRGGMGRGNGIPSGDWK
                     RGERLPAEERGGGWPRRRGGY"
     gene            <452985..>454130
                     /locus_tag="TRUGW13939_08713"
                     /db_xref="GeneID:55996201"
     mRNA            join(<452985..453865,453938..>454130)
                     /locus_tag="TRUGW13939_08713"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491842.1"
                     /db_xref="GeneID:55996201"
     CDS             join(452985..453865,453938..454130)
                     /locus_tag="TRUGW13939_08713"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347735.1"
                     /db_xref="GeneID:55996201"
                     /translation="MDFAALMAKEISKAKPSADKGEKNKYTRRAEVEAARIAAYNAEQ
                     ERLQREREDKATLKRKHEEEETERHREREEKKRKMAEESKKRREAEEDAAERARRKRL
                     GLPELPPKKQNDEDGTPVPEDEDIDGEELAKKLRDIDEPVTLFGETHKVKLRRYRRLV
                     QRSLTPQLSKGPIPTTLELVAEKDMKIPTTMPKDSEGKKFLVRQLASYFNMILEEWEI
                     ALAKRDLSVKQSLPGRQAYQAMVQSKENMRPLFKKFESAEIDDTVLEAIVEIVHCAQD
                     RRYVDANNGYLRLSIGKAAWPIGVTMVGIHERSAREKLSESDNKAHIMSDESTRKYLQ
                     SIKRCLTFAQVRWPPDDQLQLMG"
     gene            complement(<454435..>456129)
                     /locus_tag="TRUGW13939_08714"
                     /db_xref="GeneID:55996202"
     mRNA            complement(join(<454435..456017,456081..>456129))
                     /locus_tag="TRUGW13939_08714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491843.1"
                     /db_xref="GeneID:55996202"
     CDS             complement(join(454435..456017,456081..456129))
                     /locus_tag="TRUGW13939_08714"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347736.1"
                     /db_xref="GeneID:55996202"
                     /translation="MPPLSAAETEIDTIIIGNGPSSMILSYILHGHIPYYKADPPHPD
                     PLLHAKLRESSPCLLRHDLDTLTHHFAASRLSYSTQALPINVLLDTLLRPDGETDDLG
                     EVTNLEWRHKPHRAVPHLVIGNASSPGGLWAVDDPVPVSWDIGTLSYAGMLSLPGYTF
                     ADHYRKTKKTELAPFTRPSRKELAEYLRIYPKEAGISDSFVNGTMLDGIERTGDGFYI
                     RSHRLRCKHLVLATGIFSHTIKPPSVLMPLTTLQQNPKSSKAPLLVIGSGFTAADAII
                     SAPPNQPILHVFRWTPNERPSPLRACHQQAYPEYAGIYRLMKRAALATFTAQKRPKAR
                     RLASTSFLESRNWDEVYEGIPYSEIEDVQMKDGQAIVTFRLPNGSTLDRAVSGLTYGV
                     GRRGSLDYLDPTLRVEVLKGVEHPDESEISAKTLRNKVMEDLEVAPDVFVIGSLTGDS
                     LIRFAYGGCVYAASTLITDLSVSSGICTPKRPAGTPTGGREALLNGVDGHGQRAQFED
                     HQAQKTLSCRSDFESECSRPRMSGWWTALYNALFR"
     gene            <457603..>459892
                     /locus_tag="TRUGW13939_08715"
                     /db_xref="GeneID:55996203"
     mRNA            join(<457603..458169,458222..>459892)
                     /locus_tag="TRUGW13939_08715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491844.1"
                     /db_xref="GeneID:55996203"
     CDS             join(457603..458169,458222..459892)
                     /locus_tag="TRUGW13939_08715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347737.1"
                     /db_xref="GeneID:55996203"
                     /translation="MERPRRRRRPAFSCLECRRRKIKCDRKDPCSRCVSLAIPCVHKV
                     FRDAPETSIIQSSTQGRASVSSSVDTPSSRAQSRQSYTRRVVNEKGRVPLVARADISP
                     APTPEGQTEATCTTAQATRAEDEQPSAHALLRRIQHLENSLATSPVPAHSEPGGELID
                     RQPVHQDTRVSLYKTRTIKWSYWVGMADEFDLIMACYSAAGGSLFASYGQTDDDKPHS
                     FHGPEIESLLEEIGNLLRKSKVLAKRLKTGRPSKSLGGAGFDLRPPSRELSDAMVDLY
                     CTSFESVYRIIHVPSFRAEYQRYWDNPESATASQCLKILLVISIGSSLHEHENATTGL
                     RQKVQQWVHAAQAWLSGPLEKDRLDVSGLQVYCLVILARQIFSIGGDLVWVSMGSLIR
                     MAMQIGLHHDPKHLPAMSLLQVELRRRLWATVLEMAIQSSLDSAMPPIISLDHFDTEA
                     PSNYNDDEFDESTIELVAHPRSTYTTSSLQLILLDSIPTRLRILQLLSGLKAELSYQD
                     VLSLSSEVTDSYYAYRKFSQENINSGMTPFHRNLIDYFVRRFLIPLHCLFASKAQANP
                     LFYYSLKVSLDVAMAIVSPEPDDGFSRIMVTGGGLFREGFWYATSIIGREILSQVSVQ
                     YREGTLHRKSQHRELLKQAVRDMISLAVARMHQGDTNVKIHMFLSMILAQTKATEEGV
                     PCELMIAQGARDSLRLCHDLLQTQAGTETVPYYDDAGVALDGVPENPLWDFDLELFLP
                     DLGLS"
     gene            <460295..>461566
                     /locus_tag="TRUGW13939_08716"
                     /db_xref="GeneID:55996204"
     mRNA            <460295..>461566
                     /locus_tag="TRUGW13939_08716"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491845.1"
                     /db_xref="GeneID:55996204"
     CDS             460295..461566
                     /locus_tag="TRUGW13939_08716"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347738.1"
                     /db_xref="GeneID:55996204"
                     /translation="MPLKILINGAGIAGTALANFLVRSKQGHDITIVERASEFRTGGT
                     QLDLKSYGAPLMKRLGLIDAVRARSIHETAMTFVDTKGREWARFNINEAGKGYKAVTS
                     EYEIMRADLVAVLYEGSKAIVTKTSGKESPRLRYLFGKHAIELTQLDSSRVHVVFSDG
                     SSDEYDVVVGADGQNSLTRRILWEPKKDCDSTLRDTGYSVAYFHMPKSEEELNSTVFK
                     SCLLPGLKVLSLRCAHKDFTQAMLTVSTTEELKELVKQPVEKQKDLWETVYKDFGWES
                     KRVLAEMRTTDDFYSTSVAQVKVDTWSKGRVVLLGDAGYCPSVLTGLGTTASLVGAYV
                     LAGELARHGDNVGAALESYETVLRPYVEKVQQLPPMNLAIFRSKLGLNISYFVLAILS
                     KLKIDSLVNALTKEKKETWQLPEYPELELED"
     gene            complement(<462955..>464795)
                     /locus_tag="TRUGW13939_08717"
                     /db_xref="GeneID:55996205"
     mRNA            complement(join(<462955..463291,463642..>464795))
                     /locus_tag="TRUGW13939_08717"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491846.1"
                     /db_xref="GeneID:55996205"
     CDS             complement(join(462955..463291,463642..464795))
                     /locus_tag="TRUGW13939_08717"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347739.1"
                     /db_xref="GeneID:55996205"
                     /translation="MGRQYADDNAIPHGWRTKLPGFGIWIIVVIFRSFLEALFYSIYY
                     IPKSLRQSQGWTYRQACMTRLFERTFHIITELGFTQPLSLEAGKLGDQWVTINPAPSS
                     AYSGDFASATIKPETVGGTWYPELPSKQSLLEEQGLVVLSFHSGSLLWLTGRPEDSGP
                     TATLLNEKLGSNTYSFWLQYRLAGGDNPTPYPGAMQDAVTAYIYLIKEMGISPSRIVL
                     AGDSTGSTIAVALLRYLVSIKGVPGHDLAELPPPKACLLFSPSVEYSFEGDPEAVSAS
                     RNIKTDYVEPVMMAWGARAIAPPDIVRLDDPYISPALHPFHTPVPIFVQAGGAEVLCD
                     SVRGFANAMSSVPGNRVEYFEVSGVPHDVYVAGTILGWPKEQEEIHEAAASAVTPGPG
                     GTTMLGEGGGIEAAARRGRERKKRKREAQENQVIDHSISGNTLTADPNKAEGDRKEQE
                     NNVDSKTMTRSTDDKTLPVDKSSSQDKSPRQGAREGRWARFKKYFE"
     gene            complement(<465564..>467566)
                     /locus_tag="TRUGW13939_08718"
                     /db_xref="GeneID:55996206"
     mRNA            complement(join(<465564..465844,466057..467436,
                     467506..>467566))
                     /locus_tag="TRUGW13939_08718"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491847.1"
                     /db_xref="GeneID:55996206"
     CDS             complement(join(465564..465844,466057..467436,
                     467506..467566))
                     /locus_tag="TRUGW13939_08718"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347740.1"
                     /db_xref="GeneID:55996206"
                     /translation="MVHSSSHYYYDPLELETGQDVANLLQDERHNECNRIEWPLMSDD
                     LNWMRRSIVIVSYIVLALAALNIIAIVGILVYLLVNSNTSTDSEFSLYKNTRFKDCAA
                     VDPDASNCSTILAAWTKKSGSSLGAYYADQGRFYIPGTEVTAENRVSYDWCQTVSCFN
                     DYTVIPSSANDSAMGITALSGWWYVIVSAWSTIWTLRKVSPWFHPNSKTKPCRGWREL
                     GIIDWVLFLYHLCGPIIGWWVSFADSIINPVPWPTLSLIAWLTTWGYSSQIQYHPYSC
                     IFARVPRIPQALPWIFGLLAVLQCAATFYSAETDETMSGGTKKIYDSYTCLAAQIATT
                     LGTSTCSAEEICSKDWLFSAPYFEMPGDIGKGLPFGLCVTALVMAITVPVGILMTKIS
                     TSIKISFKRYYKMWSPLLCLSFLAIITILVVVFMNAIDFGKSWNRRKADALVAYDVEC
                     RVVHVALSPWRFYLDVNRYGRALRVVRLWFAWYGLQVCLFAKPALSIVIVALILLEVS
                     VIMALQFLSTLLVSGFGNGAFTGTSNMTNVPILNGAVVYPTQAWWSIPPAAGWTFAEE
                     SEAFVTG"
     gene            <468309..>469115
                     /locus_tag="TRUGW13939_08719"
                     /db_xref="GeneID:55996207"
     mRNA            join(<468309..468357,468466..>469115)
                     /locus_tag="TRUGW13939_08719"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491848.1"
                     /db_xref="GeneID:55996207"
     CDS             join(468309..468357,468466..469115)
                     /locus_tag="TRUGW13939_08719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347741.1"
                     /db_xref="GeneID:55996207"
                     /translation="MYHLAKSLYLHATSKEEYSVLLLGLDNAGKTTLLSQIKAIYQPA
                     ADGAPSPNVGRTVPTVGQNVATIPLNDMYLKIWDVGGQTTMRGLWQSYYASCHAIIFV
                     VDSTDVGGGLDDFSSGATLSSTDSDNVTSPQHGRLGECKQVLESVLQNADVAGVPILV
                     LANKQDREDCVEVVRIKEGFVRQVFEGEKGAGVRDSRVLPVSALLGTGVPEAVEWVQS
                     RVKWNKEGRPPLMR"
     gene            <469829..>470358
                     /locus_tag="TRUGW13939_08720"
                     /db_xref="GeneID:55996208"
     mRNA            join(<469829..469921,469984..>470358)
                     /locus_tag="TRUGW13939_08720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491849.1"
                     /db_xref="GeneID:55996208"
     CDS             join(469829..469921,469984..470358)
                     /locus_tag="TRUGW13939_08720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347742.1"
                     /db_xref="GeneID:55996208"
                     /translation="MAAQNDQTPSAVGHGPFHPAPPHETGKDEKWHKPGVQASEYDRA
                     PEFHAQPLPPGTAPSGSSYQPNPIHEIPGQANNDNVLRAHGKESTFTTPLSTFPGATS
                     GDVNKGWGKPMNGQTSNELRHEGEHHRKHHGSGFEGVGATGPPKHTDASISNP"
     gene            complement(<470720..>472417)
                     /locus_tag="TRUGW13939_08721"
                     /db_xref="GeneID:55996209"
     mRNA            complement(join(<470720..471734,471786..472174,
                     472228..472262,472318..472349,472401..>472417))
                     /locus_tag="TRUGW13939_08721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491850.1"
                     /db_xref="GeneID:55996209"
     CDS             complement(join(470720..471734,471786..472174,
                     472228..472262,472318..472349,472401..472417))
                     /locus_tag="TRUGW13939_08721"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347743.1"
                     /db_xref="GeneID:55996209"
                     /translation="MPYNIAMVCDFFFPQPGGVESHIYQLSTKLIDRGHKVIIITHAY
                     DDRTGVRYLTNGLKVYHVPFFVIYRESSMPTVFSFFPIFRNIIIREQIQIVHGHASLS
                     TLCCEGILHARTMGLRTVLTDHSLIGFADMGSILTNKLLKFILSDVDHVICVSHTCKE
                     NTVLRASLDPLMVSVIPNAVVAENFRPLSYPSIENSSGRESRPPPQVIGPNDTITIVV
                     ISRLFYNKGVDLLIAAIPRILESNPNVRFIVGGSGPKAIDLEQMIERNMLQDKVEMLG
                     PVRHEEVRDVMVKGHIYLHPSLTEAFGTVIVEAASCGLYVVCTRVGGIPEVLPQHMTA
                     FAKPEEDDIVLATGKAIAALRSNKVRTERFHDQVKMMYSWTDVARRTERVYNGISGAI
                     SELEFYGHYPDAGWDVVRGRMRSFALIDRLKRYYGCGVWAGKLFCMCVVIDYLIYVFL
                     EMLWPRANIDIARSWPKKPVPHPDAAAAMKGNMTRSTRDRLRAIS"
     gene            <472859..>475579
                     /locus_tag="TRUGW13939_08722"
                     /db_xref="GeneID:55996210"
     mRNA            <472859..>475579
                     /locus_tag="TRUGW13939_08722"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491851.1"
                     /db_xref="GeneID:55996210"
     CDS             472859..475579
                     /locus_tag="TRUGW13939_08722"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347744.1"
                     /db_xref="GeneID:55996210"
                     /translation="MAKKAKIPSEVSNNADSPAKKRQRDAAAPDAPSPSSTSPVSRPK
                     KRKREKAESAATTPRKNENPEGLQSPEIDSQDNHSKSQTKKKSASSADRSSPTTDAKD
                     TGTKKSKKRRSLSPVESSTGTPSLKAGSEKSRSKILDVDEHDEHHSSTPKKKKKKRNT
                     PKDAASPSSDEEDTNEKYHSRRSKNKEASDDTSTPSRKRKHQQTQGRKLEDDDPTTKH
                     SKIMKKFEKSTKGNKPNEEDADQTNDSEKELDETTAVVAKGLEPLPQPQPAPEKGEKP
                     TYSTMPNWITTPITKSPYEKKDDQLIDFSSLNLDKGIVSKLEKHGYKEATAVQATVIP
                     LLINRAHRHYGDLCVSASTGSGKTLSYVLPMDQSLEREPLARLRGLIVVPTRELVKQA
                     RESFEACGSNLRIGTAVGNVALKDEQQKLIRWDQVYNPENYIANQQRAFTGSDWDNFD
                     LLKYKDEVNRSSSSLSQYIQMPQPNVDVLITTPGRLVDHIRQTEGFSLRHLQWLVIDE
                     ADRLLNESFQEWVSVLMTELDKAKTVNLGGPVMDNIGHPLRSSSPRKVILSATLTNDI
                     TKLNSLRLDNPKLVAIGLEGAESTEVAKESEQFVLPLSLEEHYLPVDDGSEKPVHLMR
                     LILQEINRTTWGSIATPAYKLETGNKHESSDEDTSSDDTSSSGSDTSDSDSDSESESE
                     SDSSSDATSSSGSSSGSSSDSSSDSSSDESESESESESDSSSEETSVDEPLVQSTKPS
                     KVDTKSVLIFTKSTESAARLSLLLGLMNPSLKEKIGTIVKSNNSSSSRKTLKDYRAGK
                     VKIIVATDRASRGIDLVDLGAVINYDIPTSITTYVHRIGRTARAGKTGHAWTLVEHRE
                     GLWFQKVIVKSQNVVRSGKVMKYTTAKKNTKAMRKEFSAALEKLEKAVKG"
     gene            <476763..>478918
                     /locus_tag="TRUGW13939_08723"
                     /db_xref="GeneID:55996211"
     mRNA            join(<476763..477024,477085..477420,477476..477551,
                     477617..477803,477858..478129,478191..478327,
                     478381..478633,478699..>478918)
                     /locus_tag="TRUGW13939_08723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491852.1"
                     /db_xref="GeneID:55996211"
     CDS             join(476763..477024,477085..477420,477476..477551,
                     477617..477803,477858..478129,478191..478327,
                     478381..478633,478699..478918)
                     /locus_tag="TRUGW13939_08723"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347745.1"
                     /db_xref="GeneID:55996211"
                     /translation="MGISFWSDKEKGADPQVHAATSSQESVIQYGDIKYTAAEGANSS
                     RPTYQDAAGAPVETSSPLGYSVSFWVSLTLNINQMVGTGIFSTPASILKGVGSVGLTM
                     IYWFIGYLLSQSVLAVYLELASYFPSRSGSEVVYLEQAYPKPRYFFPTIFAIKHVIFS
                     FGSSNAIVLAEYLFGLADSSYTDWQLKGVAIAGYTVALIVVSINTKWSLRIVVAFGFI
                     KIATLLLISIAGLVILGGHTRIPDPNINWRNAWEGSSSASAYGATNAMVKIIFSYSGY
                     VNAFGLVNEIQNPIKTLRWSAPFSLILVTVLYILVNVAYFSAASREEILNSKQIAAGL
                     FFQKLFGAGSGASRALNVLICISAFGNLIAVMINTSRLLRETGRQGVLPWTRFWTYTK
                     PLGTPLGPYVFQWLITLLMIVAPPAGDAFNFVVDLSTYPANIFNFLLMVGLILVRRQR
                     GRVNLPRSEYRAWNLAIGFSVLTYLYMLVAPWYPPTTGANGGDVSFWYGTYLVVGVGL
                     LVLCGIYYYLWVSVLPNWKGYELRQTVLEFDNGSVSHKLVKVPKSELAQWDEDHDAVG
                     HLRRRIVHDSADSA"
     gene            complement(<479062..>480924)
                     /locus_tag="TRUGW13939_08724"
                     /db_xref="GeneID:55996212"
     mRNA            complement(join(<479062..480030,480082..480510,
                     480565..>480924))
                     /locus_tag="TRUGW13939_08724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491853.1"
                     /db_xref="GeneID:55996212"
     CDS             complement(join(479062..480030,480082..480510,
                     480565..480924))
                     /locus_tag="TRUGW13939_08724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347746.1"
                     /db_xref="GeneID:55996212"
                     /translation="MSLSTFDSINSPSPPAANSPSLLNMHDLPQQLIPNIVSQHAVQN
                     PEKLYASIPADNDDLSKGFRDITYREFRSAIDTAAYWLEEQLGVPAQGSFPTFAYYGA
                     RDLRYAIFLVAAMKLGYKMLSPSMLCAVDAHVYLVKASDCTVFLCSSSNLPLGHKIQA
                     TTQSPSQLFVVPELLELLPVHHDSPLHESPVYPYNKTWDATCDEPCLIVHTSGSTGMP
                     KVVVYTHRMLAAPDRLRLLPPYQNCPSMLGEMIGRRIFTTIPVFHLLGYAGFLVTPIY
                     LDVVGIMAPPDKTITADLADQIHRYARLDGGLYHPSLLEDLVRSEQKREQFGHLKVVF
                     YSGSPLENMTGEWLSSRFGCVRNIIGSTEGFSWPALRVIDPVVDWNYTHFFPIKGLNF
                     VSVGIDGAYGVDGDLFELIVERTPDTEKFTNFFHARPDEREWRTKDLWKPHPNPAMSG
                     HWLYQGRTDDLVVLSGEIKMYASGVEDKISSHPLIRSALVGGKQRKWPFLLLELVDQP
                     IGDLAEQQRILEQDIWPWVDEINKESTHDSVRLRLSLALIADAARPFVRLAKGSLARN
                     PTLELYKEDVDRLYAEVDA"
     gene            complement(<485251..>489279)
                     /locus_tag="TRUGW13939_08725"
                     /db_xref="GeneID:55996213"
     mRNA            complement(join(<485251..486414,486480..486798,
                     486915..487704,487755..488866,488915..>489279))
                     /locus_tag="TRUGW13939_08725"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491854.1"
                     /db_xref="GeneID:55996213"
     CDS             complement(join(485251..486414,486480..486798,
                     486915..487704,487755..488866,488915..489279))
                     /locus_tag="TRUGW13939_08725"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347747.1"
                     /db_xref="GeneID:55996213"
                     /translation="MEDYTPLDAPLFPIPDDPIFTAPQWQTLLSLADVVIPALTTARA
                     GNNKALHQKTVSAAQYDTAIATLTAQIKSPDAAEIARQYLDENASSLPAFKESFRRAF
                     ALNVPQEAKNGLSLILTTLNTRAGSLLLTGSSTPLQDQSFDAREKVLCHWLTSRLPQL
                     RQVARSVVLLSKKNWVLNSAIALQTIGFPRFPVYGKPAESFDYKFLQIPPGDNTEIIE
                     TDVVIVGSGCGGGVAAKNLAEAGHRVLVVEKAYHYPSSHFPMTQPSGLGHMFEQGGNA
                     VSDDGYMAVLAGAAWGGGGTVNWGASLQTQNYVRQEWADTGLPFFTSHEFQKSMDNVC
                     ERMGVNTDIRQNFQNAVTLEGSRKLGYNAQVVPTNSGNSKEHYCGHCTLGCHTGGKQG
                     PMASWLVDAAEAGAVFAEGFHAEKVLFDTVNGKKVASGVQGVWTSRDSHLGTSGKDVV
                     RRKVIVRAKKVIVSCGSLQSPLLLLRSGIKNPHVGRHLYLHPVLLGGAVFEQETLPWE
                     GNCLTTLVHDFENLDGHGHGTKLENVSMVPALFLATMPWLDGANFKRLAANLRHMAGF
                     ITLTKERDAGRVYPDPISGQPRIDYTISAFDRKHILEGLIASAKIAYVCGAKEFYTSY
                     RDMRPFIRSTKTTPTDTTTNTPDQCINDAALQAWIKEFRKKSPLNAEHGTAASAHQMG
                     TCRMSSSPKKGVVGPDGQVWGTQGLYVADASVFPSASGVNPMVTNMAITDWTSRKLAE
                     ELSRESLRKTGTARLYQPALVGCSLLANVYPPRTPFLFWTSDLSTMSSSDISQFNPRL
                     SITTLVQSSLNIDLKIFLVQHQSQADSSRFKVAASQTKPAAMPSRRFHSKNRHGCAQC
                     KKRKVKCDIVRPVCGNCARRKDKCHYVIGDSGIMWTPPPMPDPSEFSPPSNSSTITDT
                     GSSDSSTSTEMVLSAGPIFHLSPNADLSLLEKFVSDVSPTLSNRPDTQKAWALDVGCR
                     PIFQPNTSYLSHILIAISALHASLTQPALSLAEKHEYRDMGLYHQNAALTLIQPVLPS
                     LKEDPGQIAGLFGAAWLIFLFNVSQPRPQQSDRKDWVIDEIVKLSELAKGVVVILTTY
                     KASCASNEEEAKSLVMAGPLRGFFGHFLPWRHQTVSPSVRREKLPQSLQRILATIEAD
                     DSLSVLRKQLYHHAIDELALTVVAMAFNPKHPSIVFMWLISARREFVDLVSERDPFAL
                     RIFRAYGVWAARMDQVWFARRWGRSIVDSVDAALGGLPVMGESMG"
     gene            complement(<489827..>490670)
                     /locus_tag="TRUGW13939_08726"
                     /db_xref="GeneID:55996214"
     mRNA            complement(join(<489827..490278,490335..490424,
                     490613..>490670))
                     /locus_tag="TRUGW13939_08726"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491855.1"
                     /db_xref="GeneID:55996214"
     CDS             complement(join(489827..490278,490335..490424,
                     490613..490670))
                     /locus_tag="TRUGW13939_08726"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347748.1"
                     /db_xref="GeneID:55996214"
                     /translation="MTQTQERKPPKPRFGRLLKADTLWWNTEYSSDNDTLVDELWTNK
                     IPWERAFSLGPRGERHIYQLVEALGNNGDKKFHIDSRTISSLIVENDKNAVKLLFSDG
                     TSATEAFLVHNPFTQVKGPFAAQLGITVTPSPIPGIEIGDLAVSPPTYQTNVRGAFAA
                     GDCITPYKVVPGAISSGCNAAVAASSQLLAEKYGHHAMF"
     gene            <491046..>492348
                     /locus_tag="TRUGW13939_08727"
                     /db_xref="GeneID:55996215"
     mRNA            join(<491046..491216,491284..491320,491377..491480,
                     491542..491865,491929..491996,492054..>492348)
                     /locus_tag="TRUGW13939_08727"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491856.1"
                     /db_xref="GeneID:55996215"
     CDS             join(491046..491216,491284..491320,491377..491480,
                     491542..491865,491929..491996,492054..492348)
                     /locus_tag="TRUGW13939_08727"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347749.1"
                     /db_xref="GeneID:55996215"
                     /translation="MSEYSKLPFAFITPSEVLAAAIVLPLLCIFFIAVRFYVRHIQKQ
                     EISVDDWMGVVAMLLIIGMGVCLIIGAEQHVMGYAAPLPEGFDPQEAYQEFLGSYEKE
                     AKIEFYYQLLMIVAYGFIKLSLVFFYRRLFFVIKWSTFDIVSLAYIAIICMWTLAFFL
                     LFLFACKSKIYLHWAPLSDVENQCGDPLAPELGLVISDLITDLMVLALPLPIIWRLRV
                     STARKISITLVFIVGLIAIAASITRMAIYIIVSYRSFSSGYDIDQTVTTMLWWSMVEA
                     CLGLITSCLPVLSPLLRKVTLPGSLTSLVDRVLKVATSPETDPMVTFFSNPVMVQS"
     gene            <493238..>493918
                     /locus_tag="TRUGW13939_08728"
                     /db_xref="GeneID:55996216"
     mRNA            <493238..>493918
                     /locus_tag="TRUGW13939_08728"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491857.1"
                     /db_xref="GeneID:55996216"
     CDS             493238..493918
                     /locus_tag="TRUGW13939_08728"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347750.1"
                     /db_xref="GeneID:55996216"
                     /translation="MAHTFTTNSHPPALLDNTTTTTLLYPTPANPNPSTNHPVFTHAM
                     TVRHAVFVNEQGCAADAERDEDDARSWEFVIYAKRPPPQAQEEQPVAVVRLVPPPHAP
                     HDTLLDPARASEFPRFDTEHEPYVKVTRVAVLKEFRGLGLAGRVMRVAEEWAAANKEA
                     IDAMYRRVAGGDIQQQKGWNGLVGLHAQVQVEKMYQRMGYETDGSLGTWDEESIQHVG
                     MFKRVALN"
     gene            complement(<494294..>495409)
                     /locus_tag="TRUGW13939_08729"
                     /db_xref="GeneID:55996217"
     mRNA            complement(join(<494294..494671,494972..>495409))
                     /locus_tag="TRUGW13939_08729"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491858.1"
                     /db_xref="GeneID:55996217"
     CDS             complement(join(494294..494671,494972..495409))
                     /locus_tag="TRUGW13939_08729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347751.1"
                     /db_xref="GeneID:55996217"
                     /translation="MATTHSALPPQQAFVNPGHMSIYGHPSPSNSTANTPANSSPTSP
                     QMSSAGLVYPSQSRQIRPPKAPLYVPAVLRPTERPSKSSSSKDSSPITPPRSVHGSLD
                     SLNEDPAPVARQTTFHSIKAASDEAIKSEFLGEVTGVPTRDHWKADAAAHTCDSPTCR
                     SSFGIFTRRHHCRHCGHVFCASHTPYMVPLDQDARFHPEGSASRACDQCFKAYHRWEE
                     TRAARIQQKLDERESLSDSGEVEHDEQTPETAQRQPEFTIATSVPRGWNWSTF"
     gene            complement(<497488..>499215)
                     /locus_tag="TRUGW13939_08730"
                     /db_xref="GeneID:55996218"
     mRNA            complement(join(<497488..499060,499127..>499215))
                     /locus_tag="TRUGW13939_08730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491859.1"
                     /db_xref="GeneID:55996218"
     CDS             complement(join(497488..499060,499127..499215))
                     /locus_tag="TRUGW13939_08730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347752.1"
                     /db_xref="GeneID:55996218"
                     /translation="MTTCSSGHAGPEYSSHQTEVEHAFEKLVRIVSKVKCDEGKPFCR
                     RCCRLGRRCEYRNDGDRTRDGDGSGSGNGTAQTPAPLVSESFDSGPFDSEPTQIQRQT
                     LSSLERSAEERRAFEFYFRQAAPGISGVVDMAFWRGIVLQLGQTQPAIWDAIITIGTL
                     YENPRYRNNAHTHSNLIDQSTVDDTHRRALRWYARSLSNVREQLQRGAVDLHVALITC
                     LLYIGIETMQGHIKEGYQLYGQGVKLVSQIHARNQSSNANNFGLLGDVALPVFVRMGI
                     VSSIMTGLSLGVKSESGFVIDEPYHFDSVYDAYMSLHKLVLHCTTFAEGVFRRLLRSD
                     EEDTSKRVAQILLHSRLDDWRRAYQRLDDAQGLSRSTEYKGLAALFRMSWACASIIVS
                     TADSKEQNIYDQYIDLFEEMVQEGALNLTATATADGSQPGFTFEMGVGLPLFFVAIKC
                     RQPRLRREAIRLLQQAPPMQGLFKSARAVYLASKVVELEEDRPFTLDLAAENDQQLPA
                     ENRRVEILLSVGDPLPKDRICFLRSHWDSERGEWRLVEESIELEE"
     gene            <500165..>500443
                     /locus_tag="TRUGW13939_08731"
                     /db_xref="GeneID:55996219"
     mRNA            <500165..>500443
                     /locus_tag="TRUGW13939_08731"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491860.1"
                     /db_xref="GeneID:55996219"
     CDS             500165..500443
                     /locus_tag="TRUGW13939_08731"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347753.1"
                     /db_xref="GeneID:55996219"
                     /translation="MTTMVGGLSIGMVNLIVVLVVVGAGFLVIIASGFSHMLYGAPDP
                     LIQEPSQEQMDYMRGVRYRTKVNLYHTAREIVHDRHSKETNDLSMSMA"
     gene            <501846..>503576
                     /locus_tag="TRUGW13939_08732"
                     /db_xref="GeneID:55996220"
     mRNA            join(<501846..502049,502161..>503576)
                     /locus_tag="TRUGW13939_08732"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491861.1"
                     /db_xref="GeneID:55996220"
     CDS             join(501846..502049,502161..503576)
                     /locus_tag="TRUGW13939_08732"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347754.1"
                     /db_xref="GeneID:55996220"
                     /translation="MSLYYDAATILSSSTADQGGSFKSRIYNSKSLKASPAQIYALVT
                     EASKWDILLKEVIEKAGILSLEHKLTPLLCLLLVHDHLLSKNGIAAPASHPIRQAVER
                     HKARLKAELTRARVRRGCASLQDLQSVILDEKKALLGPDALTENMYPRWVRINNVRST
                     LKAQLDGTFSGYRNVESLKELRTTDQIYIDPHIPDLVALAPGAVDFSTTKAYKDGEII
                     LQDKASCFPAYLLLGDPDGSWSEGDLVDGCAAPGNKTTHLASLLAARRGFKKNQKNSN
                     KIISMDSSAPRSKTLQKMVSVAGADKIVTVLAGQDFLALDPADERFESVSGLLLDPSC
                     SGSGIIGRDDVPQLVLPESNRPSSTSNRGKKRKRDSKKENEEEDEEEAKQSPPERMST
                     ERLTKLSNLQTHIVEHALRFPAASRVTYSTCSTHVLENESVVSRILASDVAKQRGWRV
                     MRRDEQPAGLQKWKHRGIKSISNSTDEKSHVEINLSEEQLDACLRCWPGDDECTGGFF
                     VVGFVRDEELADTEATGEDSGDESEFGGFSD"
     gene            complement(<503701..>504994)
                     /locus_tag="TRUGW13939_08733"
                     /db_xref="GeneID:55996221"
     mRNA            complement(join(<503701..504373,504427..504504,
                     504552..>504994))
                     /locus_tag="TRUGW13939_08733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491862.1"
                     /db_xref="GeneID:55996221"
     CDS             complement(join(503701..504373,504427..504504,
                     504552..504994))
                     /locus_tag="TRUGW13939_08733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347755.1"
                     /db_xref="GeneID:55996221"
                     /translation="MVVMFMPSQAGAPTTTPLPYTASPLKLLVSDVILCLSCIRYLPG
                     ILLPLKPYSSGKLDELYPSRGNLTALAVHGVLIVYQVAFILSLPVLLFLPIYICLFYI
                     ASVFLLSNRICAFLNGRQRFLVSHVPLPRSDHESEHWIFINGVGVGRHWLQSNLDRLS
                     LTFGRKITGIHNETAGIIFDVIQCLIQRCFCYATEDVRDAYVFVKQTLLNEKYEKIVL
                     ILHSQGGVEGGLILDWLFDALDDKTLGKLEIYTFGNAANHWNNPTRKYTDQGKPERCI
                     PHIEHYVNSEDFVAMWGILDFIRIPSRYLGDVFIRQGSGHLLNQHYLDTMFPLSHDKR
                     QVLGENEFMRQNVKLISCGSTPKNTDFTMATEKLAQNRDIDGIGSKLRDYSRLWRYRN
                     GASPD"
     gene            <506316..>507983
                     /locus_tag="TRUGW13939_08734"
                     /db_xref="GeneID:55996222"
     mRNA            <506316..>507983
                     /locus_tag="TRUGW13939_08734"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491863.1"
                     /db_xref="GeneID:55996222"
     CDS             506316..507983
                     /locus_tag="TRUGW13939_08734"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347756.1"
                     /db_xref="GeneID:55996222"
                     /translation="MSDLSRNDIKTLALCLYNDPTLHDSDHDKIRSLITHLPNHLRDP
                     KFTSIITEPRHAAKPCLVHAGIASLVVSSLFTSLQKQVDESVPLLKERYGLCFGPEEI
                     YLLERMTIIEGMWSPPTARTGPTKMRYWDYQVNKCQACMISRVAADSSALRDMRTLLL
                     ATIDSSTKTPESRLLPNHPTLLSFINEWISLNSRSDELFYFSGIQAGSIKAVKERVEE
                     PLAATPRCHGNKNFSYPSAPYTAHTSSGSSFQSTGIFTPTRTPGGSTSSKVSSTFEWP
                     ALATRYPISDSESTVITAPTRGREPGVSFPSQTSSSSSQWLPFQQQQQQQQAYPQDSF
                     TYANTLPTNIHSTHSFSPHDGVKDNSFIERDTPAPRRPHGTNPEASQDRPNSLESTST
                     RSSHASFMSFIRREMPSASPPHPSPPPPPPLPRRRCMDLPRASKPDLHWEDSGVGIGY
                     PTRDESTWTFLHDSSTTSDEAEQQQHQQGQGQTQPRKSAFTEASEQQQEDDETPLISR
                     WSASSSIHPWSNLLKRTTRGPRLGKVKTGRAIFKPVTEKEGKKNKKA"
     gene            complement(<508521..>509837)
                     /locus_tag="TRUGW13939_08735"
                     /db_xref="GeneID:55996223"
     mRNA            complement(join(<508521..509104,509156..>509837))
                     /locus_tag="TRUGW13939_08735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491864.1"
                     /db_xref="GeneID:55996223"
     CDS             complement(join(508521..509104,509156..509837))
                     /locus_tag="TRUGW13939_08735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347757.1"
                     /db_xref="GeneID:55996223"
                     /translation="MQSNSSLFELPPLPSYTLSLRQPVLAPIPDNLLSLLLPVIAYWA
                     VSMVFHFIDVNDYFSKYRLHTPAELLKRNHVSRIDVVRDVLLQHAIQTVAGLMMSVFD
                     GPEYVGHEEYDVAVWARRVRIMQRAIPTVLGFVGIDSIALSKTVSDYPALSGFLAGGL
                     YPGLVQTLTLHTGQQATAPAHAAWEFVFARFIYSYLIPALQFFFAILTVDTWQYFWHR
                     AMHVNRWLYVNFHSRHHRLYVPYAFGALYNHPVEGFLLDTAGTGVAFLLTQMSHRQAM
                     WFFTMSTIKTVDDHCGYHFPWDPLQLITSNNSAYHDIHHQSWGIKTNFSQPFFTFWDR
                     FMGTRWQGDVSRKYERARTAAEAQVERERTENNGQSVNSVLESEPGPLDAFSQDVSVQ
                     ERAPRKILPRTTRSASTRSHGVNGSIRQK"
     gene            <510966..>511709
                     /locus_tag="TRUGW13939_08736"
                     /db_xref="GeneID:55996224"
     mRNA            join(<510966..510980,511119..511392,511465..>511709)
                     /locus_tag="TRUGW13939_08736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491865.1"
                     /db_xref="GeneID:55996224"
     CDS             join(510966..510980,511119..511392,511465..511709)
                     /locus_tag="TRUGW13939_08736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347758.1"
                     /db_xref="GeneID:55996224"
                     /translation="MIIYKDIITDDEIISDTYKLVADGPVLWTADCRKYLKGAENIQL
                     EGANPSAEEGEEDGGEGEKVMVHDIEDQFRLVWLKDEDGLKPSKDGFKSHLKSYVKAI
                     NNKLKEKGASEETIKEFQGGAAAAVKKILANYDNYDVLMNQSMDANGMHVLIDFREDG
                     VTPYATVWKHGLVEMKV"
     gene            complement(<512147..>515984)
                     /locus_tag="TRUGW13939_08737"
                     /db_xref="GeneID:55996225"
     mRNA            complement(join(<512147..513654,513704..514739,
                     514795..514834,514888..515432,515490..515808,
                     515857..>515984))
                     /locus_tag="TRUGW13939_08737"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491866.1"
                     /db_xref="GeneID:55996225"
     CDS             complement(join(512147..513654,513704..514739,
                     514795..514834,514888..515432,515490..515808,
                     515857..515984))
                     /locus_tag="TRUGW13939_08737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347759.1"
                     /db_xref="GeneID:55996225"
                     /translation="MLIKVGQSAARSTAYPRLSDRYSGRRRSAAADDFALLFPVNNEC
                     FEQSPDLLTIPPNLSDRGLDYPAEKRLASRMMVGSTESPDAYHVLEREQGSYGTGDAV
                     SMQFQAKSPRRSSGSKQSGVAGARHITRNRASYSCHTCRRRKVKCDKAHPICGNCSKN
                     GTECSYDIAPKKGSTAQEEDEYTNHGVKRRREASRPVDEDVDMSQSLFAGRGGASDVR
                     GGSHAIEARLDKLTNMIERLSKANDSVPIQEMSRQLQNMSQVIEPQTSTKPTTSTPGG
                     TTTKKTASSGTTSPRRAGDASGDEFPIPSGNAADPVDPIASLNLGHLSLEDGRSRYVG
                     TTYWAYISDEINELNQLLRDQTRTHDDSLPDESSNEDTMTNPKTSPRAKISPYSTSNY
                     QFRRRSSLRRDNFQRTILFPTGESPTSYERVIESHMLEDIPSRRQSDILYRGFMSGVH
                     AISPVLHPPTILKSYLAFWDWYDRRSHSADYCPDPSFIPLLYAIWYGGSVTISLRTIN
                     AEFPNVQSRSALSEMLNDQVTIWLANISFPRNPTLHGLVAFLLVQTILSREEQPLASS
                     LFISMALRVAQTMGLHRDPAQFGIQSSDAETRRRIWWHIVHMDSVVAMSSGLPPLVND
                     ENFWDVRETSEVKDTLLGTPQAEQYTKLVTNNLRPRDNPDDPTICGGNSMVNVFYLCA
                     RGKYIMARAIRRILRIQLGTKAITGSDMEELRSILIELQFQLNSLVNRIPLAHHPNAV
                     GQDNHSVASDPASVSPGKPFTGDGSSLPADGPNGCLEQYHTPVLVAFHKWARILLSLF
                     IDKAFCVAYQPFLKNAKSRIWPTARQGALRHCHGFMEKFIALATDADFQPFQWSWPGN
                     HQPMHAAMIMLIDLYERPNTPEALRSRAFIDKIFSISGPDGGVVGGEDGVTTARPLKD
                     GGKEAWDLMRRLREKAWQKAGLDPQQFWTEQAQIRAGVTSGANTPNSYTANRSGFVPA
                     RGKQDAYLMEFANRFYEMTRAHRLPNPVVSSLRQELPRYSQTMPAVTPKLQQHQQYTA
                     SNSPPSLAMPTVSPQQQSLDATLTLANLATETVGTPSPNSHHPLFYPQQQQQQQPPPP
                     PPLMQPSHSYPTGSPPMPSANFPIDGPPPTSPNGIATAPTPPSMMDPNLNFDWDQWDA
                     VFGQLLPVADELMELDPVAGLELPDIGLGLGNHDGTSDMWPDLKM"
     gene            <516562..>517363
                     /locus_tag="TRUGW13939_08738"
                     /db_xref="GeneID:55996226"
     mRNA            join(<516562..517111,517164..>517363)
                     /locus_tag="TRUGW13939_08738"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491867.1"
                     /db_xref="GeneID:55996226"
     CDS             join(516562..517111,517164..517363)
                     /locus_tag="TRUGW13939_08738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347760.1"
                     /db_xref="GeneID:55996226"
                     /translation="MASKELRIGVLLTDPVQLLDFAPIDLFSMATPEYLEICKIPPPI
                     VSLAKPCKIHFIGKKSSAASSENTNAVQEVTATSGVRLTHTTADEEVSPGNLDVLFLP
                     GPDPNNKPDDEVKEFLQAHNKHKTTILVVCTAAFVAGYSGIYDSRHVTGPRFLIPDLR
                     KLFPKTEWDESVRWKQDEHIWTAGGITNGNDLVAAYLRATYPSSVAETVCTMAEIGDR
                     PMKFDVGLKRSMLYIVWQVLKALPSYLFRSK"
     gene            complement(<517508..>518371)
                     /locus_tag="TRUGW13939_08739"
                     /db_xref="GeneID:55996227"
     mRNA            complement(<517508..>518371)
                     /locus_tag="TRUGW13939_08739"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491868.1"
                     /db_xref="GeneID:55996227"
     CDS             complement(517508..518371)
                     /locus_tag="TRUGW13939_08739"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347761.1"
                     /db_xref="GeneID:55996227"
                     /translation="MAPNIKPKYPEAKHANFQDWNHATAARQGSSNQTTNCPAPPEAV
                     MIQPLAEDYIPSFFYSNSWTASILSSPGFYPIRTWSRIEKPTEDGLFAKTLATGATIP
                     YCVTLRRQDNILDAGSQATTQPPSWLNTPSSSSSTTGPPSIDPPDIVMILAVSDIGTC
                     SYANTAHGGFLDTVLEEAMSLVVALHVSQSAFWPTSPRDTVQKLPRGNMHAAQLDTRY
                     KGHVSVPGILVVRAKLVRKLGRKYWSRAQIIQEDDYVNKGEHGVSKVKNKTTRVDSMA
                     FWLGSKDNAQL"
     gene            complement(<518836..>519916)
                     /locus_tag="TRUGW13939_08740"
                     /db_xref="GeneID:55996228"
     mRNA            complement(join(<518836..519820,519882..>519916))
                     /locus_tag="TRUGW13939_08740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491869.1"
                     /db_xref="GeneID:55996228"
     CDS             complement(join(518836..519820,519882..519916))
                     /locus_tag="TRUGW13939_08740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347762.1"
                     /db_xref="GeneID:55996228"
                     /translation="MAADAAGSVESSMQGPLCENCRRRGENCDLVWRFADATSFRIYS
                     VACPSRWNDLGLLSYFADVTSTYLALVECKAWFWTVEVPRMAENMPFLLHGVSALSAL
                     HIAENQSNYSSALSLSRKHFITASCQFRLMVNQIDTENCVAIFAFVLIVSMIQFKCSC
                     APSRLGLLSNYFDPMNVIGALRGAAYLSKTLVPFVDKQSSFSTLFVQQTAPSSEQTKL
                     AVKVITDQLNELSSMPLDADNKAAATHLRFWIAGLGARPKGWLQLSWWPASVSPGYLS
                     KLQQSDPVALLLYTYWCLGLHSEYIEWFLNEYAQQATRFVYSRLDSHYANMLDKTLQE
                     LQIVI"
     gene            <520573..>521790
                     /locus_tag="TRUGW13939_08741"
                     /db_xref="GeneID:55996229"
     mRNA            <520573..>521790
                     /locus_tag="TRUGW13939_08741"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491870.1"
                     /db_xref="GeneID:55996229"
     CDS             520573..521790
                     /locus_tag="TRUGW13939_08741"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347763.1"
                     /db_xref="GeneID:55996229"
                     /translation="MFPQNLLHILGMLPSALACVHGATPSYNFTRRGNATVPPLKKIA
                     IENVRVFDGFKLEHPRRVIIDRGYISDDPSGIEEVVEGNGKVLIPGLMDSHLHATSVS
                     ALEELSSYGVTTAFNMNCYNYTACDILRDQPGLTSAFFAGIPAVGPGSNHERLLRLPD
                     SLLVNSSSQAPEFVSWAFGNNSDYYKIISEPDGCDQGIQNALVEAAHRRGKKAMTHSS
                     YLEYFKMAVKSGSDGLQHTVADGLVPESTIQQIRAQGQYVTPTLTIFYQSLKNASTIE
                     FLTGEPTTNQTVGNGTMNTAAMHKAGVPLLAGTDAIGVIPPIDTPFGLSLHWELEHLV
                     EIGMTPAEALRAATIVPAFWHGHEDRGAILPGKRADLVLLNSNPLENITNTRDISKVW
                     IGGIEYKDVVSLS"
     gene            complement(<522049..>522912)
                     /locus_tag="TRUGW13939_08742"
                     /db_xref="GeneID:55996230"
     mRNA            complement(join(<522049..522416,522501..>522912))
                     /locus_tag="TRUGW13939_08742"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491871.1"
                     /db_xref="GeneID:55996230"
     CDS             complement(join(522049..522416,522501..522912))
                     /locus_tag="TRUGW13939_08742"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347764.1"
                     /db_xref="GeneID:55996230"
                     /translation="MSRRAQVEEVSDSDPEEVAPSDDPGDHIISPSIMHPPPEMASRP
                     PPQAPQDVPKHFHALYAVYFDKTRSRAEGRQVSSKLAVENPLARDILDACQQLGLRVG
                     FEPEKLHPKDWANPGRVRVQLKDEDGDLLNERVKNKHHLQILVAKFLQAHPTTEKSPY
                     RLRIHGLPMPDKLPGAPAAPKGWKIGKILPIHSPAYSGGGVSDNPFKEAMAEMEKMGG
                     MPGMPGMPAGLPGMPPGMMGMGEPSGGGEAKKKKEKKKGKA"
     gene            <523588..>525107
                     /locus_tag="TRUGW13939_08743"
                     /db_xref="GeneID:55996231"
     mRNA            join(<523588..523891,523941..524287,524350..524802,
                     524853..>525107)
                     /locus_tag="TRUGW13939_08743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491872.1"
                     /db_xref="GeneID:55996231"
     CDS             join(523588..523891,523941..524287,524350..524802,
                     524853..525107)
                     /locus_tag="TRUGW13939_08743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347765.1"
                     /db_xref="GeneID:55996231"
                     /translation="MASSSAALHRHLHHVPFMASSGQGSYIILEDGRRILDATGGAAV
                     SCLGHGNEEVKEAMIKQIGQLSYCHTAFFSIKPFEELADFLKASTGGRMSKVYIVGSG
                     SEAMEAAMKLSRQYYLELATPQPQRTKFIARKQSYHGITLGALSMSGHTFRREPFEPI
                     LLPNVSHISPCNTYRGRGDGESDAEYVTRLANELDAEFQRLGPNTVCAFVAEPVVGAA
                     MGCVPSVPGYFKAVKSVCDKYGALFILDEVMSGMGRCGTLHAWEQEDVVPDMQAIGKG
                     LGGGYAPVAGLLIGEKVVDALDKGTGSFRHGQTYQGHPVSSAAALAVQSVIQKENLLD
                     NVKVMGGLLQTELERRLSNHPHVGNIRGKGLFWGVEFVKDKATKEPFDHKLGLAFRIQ
                     DKGLTPDYGISLYGGQGTADGVRGDHILLAPPYNTTREEIMLIAELVQKVVEDTFAEN
                     DG"
     gene            complement(<525247..>526810)
                     /locus_tag="TRUGW13939_08744"
                     /db_xref="GeneID:55996232"
     mRNA            complement(join(<525247..526207,526263..526576,
                     526808..>526810))
                     /locus_tag="TRUGW13939_08744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491873.1"
                     /db_xref="GeneID:55996232"
     CDS             complement(join(525247..526207,526263..526576,
                     526808..526810))
                     /locus_tag="TRUGW13939_08744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347766.1"
                     /db_xref="GeneID:55996232"
                     /translation="MTSERPLKGPIVVSKATIPRPTKTEGEFLRSRLWDLFKSKSEGT
                     EKLDPPAPCSTYHGEWIGVRKDIQDPRAPQQPNLTEQDKFNMIQNHRQNDLTLFYISG
                     GAWFRAGPPGARPLIQRLCEETGARVFTFQYRLVPQNTVPTVLLDALVAYFYLVSPPP
                     GAFHKPIDPKKLILVGESGGGILHLDILQFIQAFSDASGLNSEKIRFFGRDISFQMPA
                     GCAIICPGADPALSMPSVKKFEKTDWLSEGAPWVQPNFPADSIWPSNPPRGDLHCDNS
                     AICHPFIDPSTWTDWKGMPPMWIACGEETYSDGIKFLVKNIKDSGVPVTFIEYEFMPH
                     VWNVVIPALPQSKHVMKLWAEACKRLGTLDASGQKAEAWYVKLGSLDMAKKRFEDLVS
                     FSNEEVLRKMRAARDENSMFIWKGPGASENSKL"
     gene            complement(<527896..>529022)
                     /locus_tag="TRUGW13939_08745"
                     /db_xref="GeneID:55996233"
     mRNA            complement(join(<527896..528257,528407..528765,
                     528835..>529022))
                     /locus_tag="TRUGW13939_08745"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491874.1"
                     /db_xref="GeneID:55996233"
     CDS             complement(join(527896..528257,528407..528765,
                     528835..529022))
                     /locus_tag="TRUGW13939_08745"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347767.1"
                     /db_xref="GeneID:55996233"
                     /translation="MPHYEVLLPKVNYTDWYSIVEVRVMRVITAIGCAAEIGYQTYTA
                     NAYTTSQNQAGAAGGLIISNDMVYPLASKIRQYLQQKKPCNTNETPPAYDFAMGETVW
                     ETLRKDAEWKRGFDANMTFRNQTVSVSWQSKYPIHDRIPSIQAAATGVTASTKTKVVI
                     VDIGGNQGVDLQRFANDFPELDCATVEFPLTLLFFKGADIYYLKSVLHDWDDIASVKI
                     LSNTAKAMKSQSRLLINEMVLSDTEESLLRAEMDILMLFLSNGMERTKAQWVELLSKV
                     DPPLKIVEIWSHPGDQQSVIETCLAE"
     gene            <529789..>530568
                     /locus_tag="TRUGW13939_08746"
                     /db_xref="GeneID:55996234"
     mRNA            join(<529789..529957,530045..>530568)
                     /locus_tag="TRUGW13939_08746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491875.1"
                     /db_xref="GeneID:55996234"
     CDS             join(529789..529957,530045..530568)
                     /locus_tag="TRUGW13939_08746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347768.1"
                     /db_xref="GeneID:55996234"
                     /translation="MWPFNRPKYSSIIILLFYDAWLMNIGNPYFWRCSTHDVLVPLYR
                     RNVALNHCDIGCGTGYYLVHNSYYHNSTVTLLDLEPDPLHVAKAGLERVHKDLNIQIQ
                     QHDILSHDPIPLSYQSQSTASEKYDSVSLTYLLHTLPVPPSEKIKVFSKLKKAIKSSG
                     VVFGATVLGPSPCHSLAARILLWILNLEKRLSNYADGVDIFVSGLEEHFAEVKAEVVG
                     SVLIFEASVPKT"
     gene            complement(<530993..>532043)
                     /locus_tag="TRUGW13939_08747"
                     /db_xref="GeneID:55996235"
     mRNA            complement(join(<530993..531053,531113..531230,
                     531297..531613,531678..531691,531747..531791,
                     531841..531859,531910..>532043))
                     /locus_tag="TRUGW13939_08747"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491876.1"
                     /db_xref="GeneID:55996235"
     CDS             complement(join(530993..531053,531113..531230,
                     531297..531613,531678..531691,531747..531791,
                     531841..531859,531910..532043))
                     /locus_tag="TRUGW13939_08747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347769.1"
                     /db_xref="GeneID:55996235"
                     /translation="MGYNSKQVTLLGVCGTGFGLSAIVVGLRFFVRTVLRPNTLGWDD
                     WTMLFTFGVAVAGTAVEILMVEYGVGQDMRDVNPENIPMVAKLTLLNSILSLVGTMTV
                     KVSICFFILRIVHLSSRTVKWMVTINLTVLVPVTVATIIVDLIQCIPLDGYWDKSVQT
                     KCINPDTINVLLKTSSGVGVATDFLTAVIPMVIVYRLQMHRYQKRVVYGLLVLGFLRI
                     NRQNRINSMVADRLHKR"
     gene            <533430..>534663
                     /locus_tag="TRUGW13939_08748"
                     /db_xref="GeneID:55996236"
     mRNA            join(<533430..533596,533658..>534663)
                     /locus_tag="TRUGW13939_08748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491877.1"
                     /db_xref="GeneID:55996236"
     CDS             join(533430..533596,533658..534663)
                     /locus_tag="TRUGW13939_08748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347770.1"
                     /db_xref="GeneID:55996236"
                     /translation="MGSSFSQTKLEMSASSENDHSGLVITGLGTEWPSVLIRPNDLKD
                     YALKFYSEVDSWLKTLLKINDQTGIESRAVVDVWNDPRWHFDKPPPAEVIDTVFRVHG
                     TRLAKAAALNALHDAGIDATSITHIVSVTATNSGSPGYDQLVARELGIPETTERVLLN
                     GIGCAGGLAALRVASDLATAATYRGQKARVLVVACEICSIHIRAELHAASESNTIGIG
                     PALFSDGASALVLCNSHALSHTTPRRFAVVDWSTHIVPGTDQEMSYNVTSHGFQLSLS
                     KNVPALASTAVKGPIQNMAMKNDDMNPVPQSEFDWALHPGGSAIITGVQKSLSLPDRA
                     LIATNEIYKTRGNTSSVSVLAVLDKIRSLEDRRKNVIACSFGPGLTVEMVHLKQYL"
     gene            <537245..>538282
                     /locus_tag="TRUGW13939_08749"
                     /db_xref="GeneID:55996237"
     mRNA            <537245..>538282
                     /locus_tag="TRUGW13939_08749"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491878.1"
                     /db_xref="GeneID:55996237"
     CDS             537245..538282
                     /locus_tag="TRUGW13939_08749"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347771.1"
                     /db_xref="GeneID:55996237"
                     /translation="MSSAEKKRIRDRRAQQALREKKLHHTKKLEEQLSYCQQYHNDQG
                     AQQLHQIIEGLRRQNENLLARQEQLKGLVCSWDIDAGDLGENSTPRAQPTEFDPPTIA
                     VPCSDNGHGFISIDNDTTPKLVPDNSLVAIDSCLPWRLLPLNNDDISNRKDISCPWFF
                     YPEKVIASPDLPSSPLDILYGTRTNPLADMISIALRRRPIRDPERLAIGWTSYLFSKW
                     LISPNPVSYAKLPEFMRPVLAQAQILHPMSLDLITWPTMRLNLIRNWHLYKDSLDEIF
                     GMLTCCLKVRWPWGESLLERNEQNELCIKKSFYETFMNEDGWGLTLEFIQKYPDITAG
                     LHIDTIVYKME"
     gene            complement(<538495..>540142)
                     /locus_tag="TRUGW13939_08750"
                     /db_xref="GeneID:55996238"
     mRNA            complement(join(<538495..539700,539762..>540142))
                     /locus_tag="TRUGW13939_08750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491879.1"
                     /db_xref="GeneID:55996238"
     CDS             complement(join(538495..539700,539762..540142))
                     /locus_tag="TRUGW13939_08750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347772.1"
                     /db_xref="GeneID:55996238"
                     /translation="MEDLEKASPSALSPNQPEDARSSNPDSRNNSLATEEPNTNAIAT
                     LYPETALDSGIVGWDGQDDPQNPQNFSDSQKWALLGLVSSITLISPLASSMFSPAVGF
                     VATDLKVTNETLLSFSVSVFLLGYTFGPLLLAPLSEIYGRRIVLSCANWFFVIWQIGC
                     ALAPNIASLIVFRFFAGIGGSGCLTLGAGVVADLFPVEKRGMATSIWALGPLIGPVAG
                     PICGGFVGETIGWRWVFWILLIASGVLAFGIECLNRETYAPVLMRWKAARLNKELGRT
                     DLRSAYDLSNAEDITISERLQQGLKRPVLLFFKSPIVFLLSVYMALIYGLLYLFFTTI
                     PTVFKSQYGFSTGLSGLAYLGIGIGFFCGIAFVATTSDKVVVKLTSQNNNKFEPEMRL
                     PVMIFFSCILPISFFWYGWSADKHAHWIVPIIGMLPFGLGMMGVYMPIQTYIIDCYPS
                     YAASVNATLTASRSLVGALLPLAGPKMFESLGLGWGNSLLGFLAVAFIPAPIFFSKYG
                     QTIRERFPVNLEGKGTSAKN"
     gene            <542037..>543584
                     /locus_tag="TRUGW13939_08751"
                     /db_xref="GeneID:55996239"
     mRNA            join(<542037..542246,542515..542721,542848..543279,
                     543342..>543584)
                     /locus_tag="TRUGW13939_08751"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491880.1"
                     /db_xref="GeneID:55996239"
     CDS             join(542037..542246,542515..542721,542848..543279,
                     543342..543584)
                     /locus_tag="TRUGW13939_08751"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347773.1"
                     /db_xref="GeneID:55996239"
                     /translation="MNGHKEVVELLLDVENININAKDEEVYTPLSAAAKYGHKDICGR
                     LIEKGANSDKQTNRLKPLYIAAQESHILLFHALKAGNPGAADWLLSWGAEVDSVDDAG
                     QTSLHIAVKGSVHDVQMMINYGASVNIADRLDRTHVATVRVLLDHDERVTNAKNRIGH
                     APLHKAATNRGTEVVKVLLQTRAETNKDKDGKTALHVMASRGAFNIACTVIIHRCNVE
                     LRDYMGQTPLHIASANGHRETMDILIRAGANLEARDHNDQTFLDIAEMNGYRETVAQF
                     KITGPKEPRSDDDWHMQTCISLRASPSFPELDEPALAQSMERVKWAWKKWIVAPCHIP
                     ALLRFTLYDILILCGEITAIKSNPKENAE"
     gene            <545683..>547479
                     /locus_tag="TRUGW13939_08752"
                     /db_xref="GeneID:55996240"
     mRNA            <545683..>547479
                     /locus_tag="TRUGW13939_08752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491881.1"
                     /db_xref="GeneID:55996240"
     CDS             545683..547479
                     /locus_tag="TRUGW13939_08752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347774.1"
                     /db_xref="GeneID:55996240"
                     /translation="MAAATESMAVNSSSPTPNAQCQDSTKDAFVGDTQRSEIANDKQM
                     STKEPMETVALPEKGRTRLETTLIMGALSVSLFLSALDTTIITTAVPTIVTHFNSEIG
                     YIWVGSAYLLGNAAVVPIWGKISDIFGRKQTLLVTVSVFLLGSLLCAISQNMAMLIAA
                     RAIQGIGGGGTILLPNICVSDLFPLHKRGMYFGILSTVWALASALGPVIGGIFTSRVS
                     WRWCFYINLPFGGVALATLTFFLKLHNPRTPIRQGLAVIDFIGNLLVIGGTVMILIGI
                     QFGGIQYAWNSATIICLLVFGAIAVALFCLYESRIAKYPVIPPRIFRYRNSISAYSLS
                     VMHAMAFLGGTYWLPLYFQSVLGANSLMSGVYLLPYVISSSIVSIGAGIVIKKTGNFR
                     LPIIIGLFVMTIGLGLMTYLDDEPHWDRIVLFQIIAGLGSAPNFQAPLIAIQTNIEPR
                     DIGAATSSYSFARQIGTFISISIGGVVFNNVMKSQRDHLASVLGQQLAQEFSGQEASA
                     SIQKINDLPPNQIHTVRTAYWNALQKMFILYACVSFTGLAISFWIKQTVLTKEHTEHK
                     TGLQSLKMEDRQKTKKPDEERPAPVKSANDST"
     gene            complement(<547787..>549607)
                     /locus_tag="TRUGW13939_08753"
                     /db_xref="GeneID:55996241"
     mRNA            complement(join(<547787..547832,548558..549126,
                     549202..549369,549446..>549607))
                     /locus_tag="TRUGW13939_08753"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491882.1"
                     /db_xref="GeneID:55996241"
     CDS             complement(join(547787..547832,548558..549126,
                     549202..549369,549446..549607))
                     /locus_tag="TRUGW13939_08753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347775.1"
                     /db_xref="GeneID:55996241"
                     /translation="MTIPVIDASALASGDKEKLVEFRTKLLNGLSTYGFVKLINHTVP
                     VPLVTETFDQIKKFFRLPLELKLPIANTQTDKQQRGWCLPGEEKTWYLESNKLGIKEK
                     EPKFSDSKESFDCGHPNDKLYPNKWPSTDVLPGYQDTLEGFFYSSGDLTLVLLELIAE
                     ALELDPTIFTSRCTNEASTIRINHFPPVDRAILDRGDVSRIWPHNDFGIISLVFLDVV
                     QGLEYEDRSNPGTFLPLPYESDQEVVVIAGETLQRWTNGLIRAGLHRVNRPLDFDGDL
                     VPERWSLVYFNKANRNVNVGPLKETTMITTKLVGFKVQ"
     gene            complement(<550925..>552475)
                     /locus_tag="TRUGW13939_08754"
                     /db_xref="GeneID:55996242"
     mRNA            complement(join(<550925..551716,551775..552035,
                     552099..552196,552262..>552475))
                     /locus_tag="TRUGW13939_08754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491883.1"
                     /db_xref="GeneID:55996242"
     CDS             complement(join(550925..551716,551775..552035,
                     552099..552196,552262..552475))
                     /locus_tag="TRUGW13939_08754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347776.1"
                     /db_xref="GeneID:55996242"
                     /translation="MAELSQYRRRSVSTRTIVATETTNIEYGEDRDTGELVSDSAGYG
                     EPPPPADRGKDAYLFLTACFILEALVWGLPFTYGVFQDYYSTHEPFKGSSNIATVGTC
                     ALGVLYLDLPLIFAILQANQNYLRVACSFGVVLMAVSLVISSFATNVATLIGAQGILY
                     GLGGSISYSTCLLLIDEWYVQRKGFAFGIMLAGTGCGGTIIPVITQQLLNRFGYQTTL
                     RAFAVAIVILAGPFVYCMRPRLPPTSRSLKNRINIKFMTTSTFMLLQLCNTIQGLGFF
                     LPSIYLPSYAASIGASPSVGSLSVLLYNIASTIGCVLMGAIIDKYDVTTCSFLSTVGS
                     TIGVFVIWGFSTSLTPLFIFAVEYGIFAGSWVATWPGIVRAVTQKTNSADPSTVLAWI
                     ATGRGLGNVISGPLSEALLQGSPWKGQAQYGYGSGYGTVIVFTGITALLSGASFVGRR
                     VGWI"
     gene            <554469..>555595
                     /locus_tag="TRUGW13939_08755"
                     /db_xref="GeneID:55996243"
     mRNA            join(<554469..555186,555270..>555595)
                     /locus_tag="TRUGW13939_08755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491884.1"
                     /db_xref="GeneID:55996243"
     CDS             join(554469..555186,555270..555595)
                     /locus_tag="TRUGW13939_08755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347777.1"
                     /db_xref="GeneID:55996243"
                     /translation="MGDSTATTGSQTANLPIIDFSKIEGFNSEATENAAEKQKLFQAL
                     RNVGFIYLKNYGISDSKVQLLFDYATRFFSQPLSEKEKIESGESKFFRGWFSPERTSG
                     DARIADQKEAFDIGDDGNPSRPNQWPADWPEFRTDMNYFFEKCHDIHLVLLSTLAETV
                     GLSRDSFLPYVQDKDHFFRLLHYPQTTLESFGSRLRASPHTDYGTFTLLFNDNSGGLQ
                     IRGKDGQWLDVHPIPGCAIVNIGDLLSRWFNGILQSTEHRVIEPSASRATLALGETIP
                     SRYALAWFGNPNRNAYIEPFSACITEDNPKRFDGVYAGKHVADRIAKLHKDGKAPEVW
                     KDSMYRKDLSGKA"
     gene            <556211..>558216
                     /locus_tag="TRUGW13939_08756"
                     /db_xref="GeneID:55996244"
     mRNA            join(<556211..556312,556397..556494,556573..557193,
                     557266..557604,557664..>558216)
                     /locus_tag="TRUGW13939_08756"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491885.1"
                     /db_xref="GeneID:55996244"
     CDS             join(556211..556312,556397..556494,556573..557193,
                     557266..557604,557664..558216)
                     /locus_tag="TRUGW13939_08756"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347778.1"
                     /db_xref="GeneID:55996244"
                     /translation="MQFTAPTSTTWFPAERLHEQPFGTAYVYPADSKHGVSISLPTWD
                     STIAYFEEAEAWKNKHIEWCYPRFFINRPIRELADAASQRLNIAKDADIAYFLFPTTA
                     IAQDCARHVIKDNQSVAVDIVHFRKPDGDCNAETAKVLDLASFAMAIIPKEAKVSAMM
                     FWINVGGGLTTRHATFSKDYICYLEVESSNKKFLIEPPRSIDSRLPTPSWIGDIASTS
                     MHVKSTIAKLSTSENAAQPQVNADDVILYPTGMNAIYHASEALASLATTSTVVAFGWI
                     YDETIHNLKNGPWEKFIGYKRGTKQDLENLTGRLKAGERIGALFCELPSNVFLSSPPL
                     QRLRDLADEYGFYIACDDTVAGFINLDPMPYVDVVLTSLTKIFSGASNATGGSVIINP
                     ASRDHDSIKATIQARYEHACVFPLDTKTLNHNSKHLIWRAKQCNQNALAVVEMLHGHP
                     LIKRLNYPSVDESLPIYKSLMRKDGGYGHVLSIIFHDEKIAQRFYDNLDIPKGSSFGT
                     NFTIAVPFALLVHYYNREKVAAYGLPEHIIRFSIGLENVEEIKTVIQSALAKVTDQKR
                     DSRL"
     gene            complement(<558392..>559990)
                     /locus_tag="TRUGW13939_08757"
                     /db_xref="GeneID:55996245"
     mRNA            complement(<558392..>559990)
                     /locus_tag="TRUGW13939_08757"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491886.1"
                     /db_xref="GeneID:55996245"
     CDS             complement(558392..559990)
                     /locus_tag="TRUGW13939_08757"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347779.1"
                     /db_xref="GeneID:55996245"
                     /translation="MSWQSSVNSGVGEDLDAFLESLIDFDTSYIESPEPFNSGGDRQP
                     SHGTEDNVDNNDPKVLTIMASISSILRHLETERRKGNARPSVAIKLKDLNEQKSITLS
                     VPVLHSPTTTAVSSIGSLSRTPSRSASPEAFLPEEGHTARTNTVPLLPEEATPPTVDS
                     TLYTMTSPSAVPDGCLLSLSEDVLPSTLPVLEAANPEQAIESPPGLVTPEATTADLSA
                     LSGENTESVIAQHRRRTTLTHTAAVPGERAQDMLSCTTALAPIHYQQACELSQTSQAS
                     TAASSKKMGNEASDKPKQERSKGWKRISLESESRGIIKRPRLETLDLATLLHNTDKFE
                     RVKELTADQDPSLVYKMVRNARAILTEPAIEGLSPSAPININAVIPYNNSRYSPSLQE
                     DIMQQFCDTVRQIEWVETLTFRSMVEYRILFVQLYQQYLSLQKMVDTKKGERRITVAK
                     ERLYTMLYPNIAKRTRNGCLSDEWEKFNRCIRRGKQWYTIASELGIGILHRMPSSIRH
                     TWVEQKLQTKTQLYLWIKIVKLLT"
     gene            complement(<561399..>563391)
                     /locus_tag="TRUGW13939_08758"
                     /db_xref="GeneID:55996246"
     mRNA            complement(join(<561399..561479,561546..563057,
                     563145..563289,563384..>563391))
                     /locus_tag="TRUGW13939_08758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491887.1"
                     /db_xref="GeneID:55996246"
     CDS             complement(join(561399..561479,561546..563057,
                     563145..563289,563384..563391))
                     /locus_tag="TRUGW13939_08758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347780.1"
                     /db_xref="GeneID:55996246"
                     /translation="MPMLEDPSQKYQQFAAPELPDRTWPSKKLTKRPRWLATDLRDGN
                     QALAKPLDFDQKWTFFQMLLRIGFKEIEVGFPGASDTDFNFTKRCVAEAPEDVWIEVM
                     TPCRKDFIRRTIDSVTGAKKVIISLYIATSDNFISTVFETTREAQFRTAMEHVAYLRS
                     ITKDDPTQQATTWNLMWSPEAFSDTDTTFAIEICRAVKDIWGPSEEVPIILNLPATVE
                     MSSPNTYADQVEMFIRGIADPVKACVSLHPHNDRGCAVAAAELGQLAGATRVEGCLFG
                     NGERTGNVDLVTLALNLYSQGIDPGLDFSDLPAIRKTAEELTHIPVHTRAPYAGDSVF
                     LAYSGGHQDAIRKGFKKWNQLEGGPRLWKIPYIPIDPNDIGSSYEAVIRVNSQSGKGG
                     IAWVLQHALDLDLPKDLLQSFSLAVKSESEKKGRTLESNEITKLFLENYHVLDKDPRV
                     LAYQKTNDIAKTLTTVRAIVLIRNLPREVVGHGATPLDAVSFSLSAFANSRFDFESVW
                     GNVTLEDGQVRKIAVVKCTSSSRSTWSVKTAGTMEEAQLLAALSAALDWQKDIPAQHQ
                     RLRLLPIVEVAAYAG"
     gene            <564041..>566489
                     /locus_tag="TRUGW13939_08759"
                     /db_xref="GeneID:55996247"
     mRNA            join(<564041..564104,564173..564204,564261..564335,
                     564409..564793,564850..>566489)
                     /locus_tag="TRUGW13939_08759"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491888.1"
                     /db_xref="GeneID:55996247"
     CDS             join(564041..564104,564173..564204,564261..564335,
                     564409..564793,564850..566489)
                     /locus_tag="TRUGW13939_08759"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347781.1"
                     /db_xref="GeneID:55996247"
                     /translation="MGPKTIYDKLFDRHVAVEKDDDRHIIHEVSSPQAFAGLEAQGRS
                     VRRPDLTLATSDHNVPTTPRPRRMKEPTARLQVQTLERNVKAHGIQYLGLNSKAQGIV
                     HVIGPELGFTLPGTTLVCGDSHTSTHGAFGALAFGIGTSEVEHVLATQTVSTSKWKNV
                     RVWVEGALCNGVGSKDLMLYIINKIGTAGGTGAAVEFAGPTIESLSMEARMSLCNMTI
                     EAGARAGIIAPDDVTFEYIKGRPLAPDASVWDEAVHTWRRLKSDPEARFDQEIKIDAT
                     DVTPTVTWGTSPEHAVHVGGLVPHPESFREESKQLNCKQALQYMGLEAGTRMTDIPID
                     KVFIGSCTNARLEDLRSAANILRGRKISPNIKAALAVPGSGIVKQQAESEGLDRVFIN
                     AGFEWREPGCSLCIGLNEDQLNPYERSASTSNRNFENRQGTAGRTHLMSPAMAAAAAV
                     QGKITDVRDFHCEKIEASVPLSYPDNLDDDSRFDEPEESSQTSDRVVETVNKVFRSVE
                     GYVAIMDRANVDTDCILPKQFCTTIVRTGLRDGLFHNLRWSPEGKPEPSFVLNQKPYD
                     KASVLLCTKPNFGCGSSREHAVWALVDFGITCVLAPSFADIFFNNSFQNGLLPGIVNN
                     ETISAVEIHAQAGRKIKVDLESQSIFDDNGAKIGSFEVDQHRKQRLLEGLDEISTALL
                     LENRIAQHESQRKTKWPWLDTCVTTGWGKLLGQGKSRLPSVRQEPELNW"
     gene            complement(<566581..>569108)
                     /locus_tag="TRUGW13939_08760"
                     /db_xref="GeneID:55996248"
     mRNA            complement(join(<566581..566998,567048..567532,
                     567589..567795,567856..567870,567925..568177,
                     568245..568266,568322..568531,568590..568780,
                     568837..568992,569080..>569108))
                     /locus_tag="TRUGW13939_08760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491889.1"
                     /db_xref="GeneID:55996248"
     CDS             complement(join(566581..566998,567048..567532,
                     567589..567795,567856..567870,567925..568177,
                     568245..568266,568322..568531,568590..568780,
                     568837..568992,569080..569108))
                     /locus_tag="TRUGW13939_08760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347782.1"
                     /db_xref="GeneID:55996248"
                     /translation="MGLNPALDASKPSSISETGDAFSAKSLSREDNWMLQTWDIDLTT
                     PVQPETSEPISLPFQTSLTTPIQSETSTRLDQTETWDSTRSFNGTDDLRIVPSLDGLS
                     TLDHDVQHGPDLEWSSFWAMNMCRDFSSLSLTHVISSHINSDTLKSIAQNISVRLSRK
                     VAGQHSLEPSSSSPEGVHFGGSSLDDLELTMSYIDAFFDDCYSVPEFVSRQETHTLLV
                     DMTFKISSLDPWAIIFINSALAIGSRVISKRVGTTVSSDLTKKSQDYFRIALASWKKA
                     HGGPACLFKLQAVSTMALYASKGCDAALARSLLSEAVYLIHFLMPTLGEYSTSMPKSE
                     ERNHFQGSFWLIYSLEKPFMMRFGGHSMIDDELIMFPPPFRTGPKEDSQQEFDWILLH
                     YRYARLCSLIVKTLYGRSALKLTQSDTMTSINRLQKALETWRLSIPERYRQLNAMQKR
                     PAEEYSTCIRADLQLKHAEAGLAIHRWAVVCPTALCFNYEMAYSDSLQHCTHLVEGLL
                     NGTRLLDQETCSLNWTHLSIPLLAAVVMFIVAVKAESRGEHFAPLGIASGCFGWLKRR
                     MATSPHPEFFEEVNQLSLMVNRLLYEQDTQMLQPSLFDYKGQSYIGQISSVKQVSPIN
                     LNAASLTKQSANMGSRSPSLGDIHFIDNSFPWDAQGG"
     gene            <572104..>572911
                     /locus_tag="TRUGW13939_08761"
                     /db_xref="GeneID:55996249"
     mRNA            join(<572104..572281,572373..>572911)
                     /locus_tag="TRUGW13939_08761"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491890.1"
                     /db_xref="GeneID:55996249"
     CDS             join(572104..572281,572373..572911)
                     /locus_tag="TRUGW13939_08761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347783.1"
                     /db_xref="GeneID:55996249"
                     /translation="MTAQHTAIPTKRQSVPQPNGNRPRTKICVFCGSSAGTKPAYVEA
                     AQALGRALAKQDIDLIYGGGTIGLMGEVAKTVCSIKGPQAVHGIIPQVLAEYERTDAY
                     QIVDNNVYLPDESKYGRTTVVQDMHTRKKRMMEEVLSGGPGSGFIGLPGGYGTMEELF
                     EVITWNQLGIHKLGVCLLNTEGYWDPIVEWVEKASGDGFVKRANKNIIVTASDAERAI
                     TALRDYKVSQGVYKLEWSQL"
     gene            complement(<574165..>574944)
                     /locus_tag="TRUGW13939_08762"
                     /db_xref="GeneID:55996250"
     mRNA            complement(<574165..>574944)
                     /locus_tag="TRUGW13939_08762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491891.1"
                     /db_xref="GeneID:55996250"
     CDS             complement(574165..574944)
                     /locus_tag="TRUGW13939_08762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347784.1"
                     /db_xref="GeneID:55996250"
                     /translation="MPAPPRIIVNNLTYIFPEYPTGVRNITLDLPPGSRTLLIGANGA
                     GKTTLLRLLAGKRLCPPKAISIGGVNPFNETLEGVTYLGLEWVVNPIVRNDVGVLELL
                     RSVGGDAYPERRDELVSLLDIDTRWRMHAVSDGERRRVQLAMGLLRPWTVLFLDEITV
                     DLDVLSRAEFLGWLKRETEQRECTIVYATHILDNLAGWPTHLVHMSLGAVKEWGEADK
                     MLQAIDGTVGRTGNSRLGELVLDWLKEDLKVRGPRSNLLLN"
     gene            <581443..>584600
                     /locus_tag="TRUGW13939_08763"
                     /db_xref="GeneID:55996251"
     mRNA            join(<581443..581597,581664..581883,581943..582185,
                     582304..582404,582481..582809,582884..583596,
                     583776..>584600)
                     /locus_tag="TRUGW13939_08763"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491892.1"
                     /db_xref="GeneID:55996251"
     CDS             join(581443..581597,581664..581883,581943..582185,
                     582304..582404,582481..582809,582884..583596,
                     583776..584600)
                     /locus_tag="TRUGW13939_08763"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347785.1"
                     /db_xref="GeneID:55996251"
                     /translation="MPLQKGFAAYWDRARETGADQNRQGIDGQVVRKRVVPSTTKAYD
                     KVTTMFEDYCTKYGLQAAVAAYDMRTLKDFMNIVSWGIEGKYGDPTPGEQAIICKWNY
                     LTANIRRKYGKDVPREATSSVTNTFVIPSIGAASRKRPKRQATTSRFVHLVATLWERD
                     WHLYRQPQARVSLSAEILVYSSSSARIGEMIQSSSRPGTGKGVYFRDVVMVVFRNEEG
                     MAEFAVRVVRPAKGQTYNPENNPEHAMHEGRGAKPFFLNPVLMFLALWIARGAFRDYS
                     TVDQILDIPPPAQGRDAHVLHWRDGNLPLFPGVDQRIQKANAFDAHRYFLGKRAGFPY
                     PPTIHEIRAEGVSLVDSMYSGSKRMKHAGHANPRIHNKFYEPNLATDLQSLQEGNDPR
                     TLVNEVFRELSIPRHPDLAQELPAAEQYRLQQREDYRDIQRALADGQTGINRSRLYTK
                     LRGLEKRALDVFQRSQQQAGPIEPGCEDDDGYSLGPQRSRYARACRLMPLRRRLAENI
                     FKVGHLRSPLGRQVLADLIALAGQRHEIEIRTGLEADRCHCDVAHDSNDGASSSSGEE
                     SDDGWNSSVGDGSGDDGDAGCHGFGEFCFICDTWFTGRPQWEEHCRSHVGNPSTIPAQ
                     CNPLIYGATLVHPGFCPVCLGNGHFSQYLDRGSWKKHVDACFGVWVGSHRRPLSCPFP
                     HPKCAALAVDPLTLVFHWWDIHVISIPRETVDKLQDVDLTVESIAPSRQRGFAFIDQT
                     QFAKARVLAGDDGVRPGRSGKRGVPSIAEDVKTDRRRARDLSRGEASTDDCQPAKRLK
                     TRKYPTIAVVIPWSPLWSSTRSTALSPGRLVDQRGSGHTPMTELNTQKSRNSRSACSF
                     HLNHT"
     gene            <586645..>588645
                     /locus_tag="TRUGW13939_08764"
                     /db_xref="GeneID:55996252"
     mRNA            join(<586645..587420,587850..>588645)
                     /locus_tag="TRUGW13939_08764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491893.1"
                     /db_xref="GeneID:55996252"
     CDS             join(586645..587420,587850..588645)
                     /locus_tag="TRUGW13939_08764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347786.1"
                     /db_xref="GeneID:55996252"
                     /translation="MNALIDLPAEIRLNICEFLCREDIYAFCQACHFSQVPPEYVRLC
                     GGIESVFRWAVARYSRVEDMEINTLNMLFEKKKYEYSIIRIGGRPALLYAAITRNHAA
                     VSLFIKNGFVVTSDSYNYHCGNMISLQLDVFQIALYGVVSVIEMMIDCFPAVKNVVWR
                     YMERHMVPSGALESGPKAIECFLLMTPPKRHQKILSQGVSWIILHENICLTEKIKAVG
                     LLLQQGANGYYPCGRTPLESAASRGYVEIVQLLVQEKYDPRQINQLLAQADPEDSDDD
                     SPDHKKWELPIPKYIFPERARLFENFYGPEAENFEDDKLLARRIQTTKDMVALSKLCE
                     PNRRGNRVNWNFDGDESEKSEEPWIHEEETLDCPTDVCIICYGLSRRSASNPPPHRFP
                     PKRQDSLRRHLIDCHLANAHGGISCTWEVCRDVPKFAEITDFLAHSLYVHAYDIKIQP
                     KHLPARHPVCRSEHSSLDDSEYLSESDRHSGIDTPASSISAEMATIDPRLLESDPAPA
                     TKFSLRRSKRIKMSL"
     gene            <591185..>593446
                     /locus_tag="TRUGW13939_08765"
                     /db_xref="GeneID:55996253"
     mRNA            join(<591185..591315,591374..591480,591548..592101,
                     592160..>593446)
                     /locus_tag="TRUGW13939_08765"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491894.1"
                     /db_xref="GeneID:55996253"
     CDS             join(591185..591315,591374..591480,591548..592101,
                     592160..593446)
                     /locus_tag="TRUGW13939_08765"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347787.1"
                     /db_xref="GeneID:55996253"
                     /translation="MASQSNHLVKVHELWKLLRQRTNEGSYELDGQHLHIAEVVATAQ
                     QSSIPYLSQDPKLHRLLQCSSDVLFDHLSKGWYVYGVNTGFGGSADSRTTEVILLQQS
                     LMQLTQTGILSRSPDGLAVPGHSTPLGWVRAAMVVRCNSTLRGHSAVSIPTLKAMADL
                     LQHRLTPIVPLRGSVSASGDLMPLAYAAGSLEGNPDILLEKNGKVQASHLALEEAGLQ
                     KISLGPKEGLSLVNGTSASAGLGALVVAESHFLALLTQFLTGGAVEALRGSSESFHPF
                     IAQTRPHPGQIESARNIYYFLRGSHLSRDVLEPKNRRREDLVQDRYSLRSAPQWIGPQ
                     LEDLLLADQQISIELNSSCDNPLVDSEANEIYYGCNFQAATVTSAMEKVRLALQMFGR
                     ILFAQSSEMIDPNLSGGLPANLAADDPSLSFTMKGVDINMAAYMAELSYLANPLSSHV
                     QSAEMHNQSINSMALASARMSFDAIDILTKMSACSVYVVCQALDLRCLHTKFLTEAVK
                     SIAFVTTSLFSTTLDSQQLDSLLVALKTHTDTAWAASSKSDLQVRCELLVSSAVPIVV
                     AHAKGAVAEVVEWKEQTTSAVSETWKTTYKTFADAPPTAQYLGNGSGVLYEFVRNKLG
                     VPFHEGFVEHPTADNNTLRGRPKKTIGGWISIIHDSIEDHSIYDELLTLVEKGILASE
                     NEKSRTNGVH"
     gene            complement(<597177..>598514)
                     /locus_tag="TRUGW13939_08766"
                     /db_xref="GeneID:55996254"
     mRNA            complement(<597177..>598514)
                     /locus_tag="TRUGW13939_08766"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491895.1"
                     /db_xref="GeneID:55996254"
     CDS             complement(597177..598514)
                     /locus_tag="TRUGW13939_08766"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347788.1"
                     /db_xref="GeneID:55996254"
                     /translation="MANTAPVLTVQDFFDGNPDVLFVRFVVVDHGSVLRVSVMPRKAT
                     LQVAADGSFNTNMSVFAVGITVFDTANMQALQVGVDKIVPDWTTLKVCSFYPSHAIVM
                     CAVREAGKAEASDNDDGGFGLCPRSILAKQVLHAQQAVGQDILVGLEIEFLLYKPGTS
                     DFTRPATAHANFNSTFLYDDALTRVLDDIAQTLAKADIDILKYHPEGMGPGIFEIALP
                     PYGPLQAADTAIYCRETIKTVARRHGYEATMCPFPFEQGNVYQCLQASVSVSDPAAAD
                     YFLSGVLGSLAGVGAFAMPSVLQSDQRLACTASRQLASWGYDNKSCAVRERRPGLWEM
                     RFSDAAMNPYLTFAAMIAAGVAGIESRRELTVKPVPHMLDPLKVSKDELGITDSIPAS
                     LEDRLARLADDNVLKAALGSRVLNEFVRLKRSEIEIASGMTVTEINERLRLIF"
     gene            complement(<598975..>615852)
                     /locus_tag="TRUGW13939_08767"
                     /db_xref="GeneID:55996255"
     mRNA            complement(join(<598975..608734,608813..>615852))
                     /locus_tag="TRUGW13939_08767"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491896.1"
                     /db_xref="GeneID:55996255"
     CDS             complement(join(598975..608734,608813..615852))
                     /locus_tag="TRUGW13939_08767"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347789.1"
                     /db_xref="GeneID:55996255"
                     /translation="MHVTHFRLQNSFSTLEIAVAWTVLLKDYVGSSIVSFLATGYTSP
                     DDLSFISLHIDKQKNIDQLFQSLQAQLSQPPPFTGIDEPLAFQTHLHIEDKKSETING
                     HTHLKETGQSNSDNITQLLNSKIDLTLKCTILDHGQEVQIRAIPHTALISSVQALRIL
                     RQFEHVLRQLNALTEQPGHLVYKIDTASAWDIRSVSEWNSTTQAPEPRTVLNVFTEHV
                     SNRPQSTAVSAWDGDFTYAELDRLSTAFGLRLASDAGIGPGNIVPLCFEKSKWVPVAI
                     LSVIKTGAAFTLIDENLPDDRLRRIAKLVSQDAKVALSSSSQKHRAQLMVSKVIALDS
                     NFLETTYLPSKKAQAEVHVTPDSLLYIVFTSGSTGIPKAIMLSHNNMCTFVTLSGALS
                     DVTPRSRILALSSYAYDVSLGDIFISLLAGACLCIPSSWECKNDVDWVVEQYKVTRLM
                     TTPSISKTLRPSDSPSLEVLVLCGEPCSEDALARWRGTRTRVINSYGPAECTVETVAN
                     YNVLESKKPTVIGRGLGACWIVDPVDHGRLTPVGGVGELVLEGPLVGLGYLHDEETTK
                     KKFLDHAPWLENGLPGLVNQHKARLYNSGDLVRYTDDGDIEYIGRGDLQVKIRGQRVE
                     LGEVAAHLQKLIPSSIQCTPEVVKLESGAELLVVFLVVNTIDEPKDQISKRLRVLVDR
                     AGTELQKRLPPSMVPSAYTKIDSIPLTLSGKVDHRRLKQLGLSLPTSEWIVWQNKTVD
                     EPSTNGNGHVNGSTQDPREIATQQKEHQEQHNKLEVLKRIWSDVLHIDIKSIHASDTF
                     FSHGGESLSAIKLVSAASRVGIQLDVATIFGYPQLSALSKQAKWSSISFPEPPARFSL
                     VKLEDGLAEISSLYGIGIDDIEDAYPCTPLQEGLISAEMLNSTKYVGRGIFELPKDID
                     IERLAQAWQRVIAVHPILRTRIVDTESNGLLQVVLREIPLFGAIKTQPLATYLTEDSQ
                     NKLGLGTELCRWSIVRHLGLSHLVLTMHHAVYDGWTIPLLGQEVFRAYHGVRIQPRIG
                     FNVFVKHVLSIPYKQAEEFWTRQLVDPEKATAFPLLNGAREPRADSVVSKNVPVPSNA
                     NQDTSVPSLLRAAWALLVSKLSGNDDIIFGATVSGRNVAIQGIDDLLGPTISTIPVRV
                     RIDRNDSVSNFVRTVQNQASETMPFENLGLHNIRRLNATTREGSKFQTLFIVDPPGES
                     SVNISKSLSPSDQELKEKLEQLDDSLSATLANFNEYSLMIIITQKNEQLQIKASYDSR
                     VLSHADADLLLDQFVNVAEQLGRSNNLAHSLRDLRLASVSDIEKIWQWNGHISPPVKE
                     SVHHIIGQTVSLQPKRQAIAAWDGSASFGELDEISSRLSYSLQSKGIGRGSLVPICME
                     KSMWATVAMLAILKTGAGFVTMDISNQPKKRLKLIVDQVNATCIVTNSQAAELASELC
                     EEVILCDHRSQDLTDSTNSTFKQDAQSQPSDTAFIVFTSGSTGIPKGIVITHENFSST
                     IAHHARELKITEDSRIYDFASYSFDIAVHNALMALSLGACLCVPSEDDRKNNIEGSFQ
                     QLQANWTDITPSVARLIDPSAVSGLKILVLSGEAISKDIVQQWGKKVDLINAYGPAEC
                     QICTVNGTIASVDNAADIGYGVACATWIVDLGTDNLTPIGAVGELVIEGPIVSPGYLN
                     DSNHSFIRDPSWLTEGSASVAGRKGHLYRTGDLARYRPDGKLVYMGRASTFAKLNGQR
                     IELSEVEFHVKQADTSLTEVIADVIDVNGTMVLTAFLVASKDDHPKSLDKDVTLTVEP
                     IPPPLGLKQTLKSTLPSYMIPGLFLRTSHIPLTTTRKADRNLLKLRASGISWDQIYEL
                     KQNEADTGDTELTPQQQTLAQIWSSVLKTDVKKITAQSDFFQLGGDSISAMRMVKHSQ
                     KIGLSLTVASVFRHSQLKELSSQLAEVVEKESIANTIHPFSLVPITSSVDSLVSTAAT
                     VCNVSRDAITDVYPCTAFQEAVFALTATDSSAYVQHKLLRFSDDLNIDGVLGAWYAVI
                     GATSILRTRIVQSKDAQLFQVVVRQKRQLWNWYNSTEDYIRETTKIPMGLGNELSRFG
                     VVRDDSTTPPSYVLIWTMHHAVYDAWTMDLILHQVSEYYHSQRLNTIIPNYNVFVDFL
                     QRQQGTSAKWWRDYLSGASNASFFPKTPMSLSGNSRNSLTSKEFDLSRVIPAGYSPAV
                     LLRAAWAIVMARHTSSEAVVFGEVRPGRNVPVKDVDKIPGPTIASAPILLHVDREQTI
                     KSLLDTVREDGIQMQEFEHLGLQNISRVSEDARAACNFQTLLVFRKAEDGVDDGSIFQ
                     TDDTIDDIRNFNTNHLLIYLSLTTTSVVIESVFQEQAISRGELDAASDQDLTQIWEWN
                     ATPAETIDAFIHELIAQNAKEDPYRPAVIGHDGQMTYKELDQYSDNLAAQLIAKGVGI
                     NTFVPLCFEKSFLVPVAMLAVIKTGAAFWVMDVTFPESRLKLTTKTLGAHLLLSSSSQ
                     VGLAQRLGNDVLVVNENTYQDFSALKTHPIIEASPRNTDRVMYVCFTSGSTGVPKGVK
                     VTHKNIASAAVAQTRELGWVREDRVYDFASHAFDANIWHFYLGFIAGASVCIPSIEDR
                     ISNLAGSITAFKSTALFLTPSVARTLDPKEVPTVKRLYLGGEAVTPLDVSMWRDSLDL
                     WGGYGPTETTPVCIFARLIVPESASNIGRGIGVRSWIVNPSNHNQLMAIGAVGELVNE
                     GPLVTSGYHNLPNRTAKVFIQDPEFLQRGFKRYSGRRGRVYKTGDLARYCYDGTLQYM
                     GRADTQVKLRGQRVELGEVEYHLKRALPHVSTICEVVIHPSSSRPMLVAFCALSAADQ
                     LDTHSTRAYLSKRLPPYMVPEFFLRIADIPRNKSGKVDRLNLRSLGPELLLTSMEQEN
                     EGSIECLYGPLTENETILGSLWATSLGQKNISLSPDTDFVDVGGDSITAMKLSNLSRK
                     QDLGLTIGDIKNHSKLSAMALRIRSLQAPSTSPIPFSMVDSSNHEKILVDVAATCGIP
                     VNEIEDIYPSTPLQTELVALTLKQPQAYMKRSVYEVPANIDVEKLVQAWDIVINTNAI
                     LRTRFVEVDNLGLVQVITKGHTWNEYNSLQSYIDSSTASNRDLGSSLCELAIIHDTDS
                     SKVAWTIHHALYDEWSVLIIDEQLRRAYQERTIHRPPSFNAVVRYITSQDPIKAQEFW
                     KTRLEGCTSVNVYPQLPSAHYQVRPTQVFNRTIRPDGRFLRNLQAKVHAAWALIISKI
                     SGSKDVVFAATLAGRNIPVEGIEQVVGPTITPVPIRIQLENEHQKALELLDGVEKDTA
                     DMAPYQHIGIKNIEKINEDTRNACKVQTLIVITPSSESSSEDADAIKTSTYEVESKEG
                     EAFHTFALVLFVFPSKIHVDLQVVYDPAILNRREIERLTGRLENVLSSFNKNAPISEI
                     GGLGREDLEDILRWSPDIPPSSNRLLHEVILGSANEHADKIAIDAWDSKISYSQLDKL
                     SYSLSLQLHKHGVGRGSVIPLLSPKSGYVPVAALAVLKTGAAFLPLDSKQPLNRLLAV
                     IDQVKPKVILTDGSVREMAESLAENHVLIEACLEPGPGTAEDFQHPDLAQLDDNACIL
                     FTSGTTGTPKGVMQTHRALSSAVQYQTAESGFTKNTRAFEFASYSFDVSWNMIFKVLS
                     VGGTLVVPNEEERQNDLSGALIKSAATLIELTASVARLLDPGQLPDIETLILSGEPVD
                     PREFELWKPKARVVICYGPSECTSVSTINPGIDAKAPLAGIGKGSACVVWIVDPQNYR
                     RLMPVGAVGEILIEGPIVGKGYYGNEKLTSASYLSLNLPSLHPASEQRQSVSSRKAFL
                     SGDLARYDEDGNIHFVSRKDLQVKLHGQRIELEEVQYHVSKFLADHVGPVVCGILGHS
                     SSGEDQRLAAFLVTGKTDTTGICQFSSPKQTAINALEHLDEQIEAVLPKYMVPSVYYF
                     ITTLPRTRNGKIDRKRLIELADTAKAENVYRGYSNRQIIRRKPSTPKETAMQELWSAV
                     LGIPVEHIGADDNFFNLNGDSISAMKLVASARKMGIDLRVADVFATPKLSDLVVNFEN
                     RNKWTPESFNVQPFQLLGGSPDVESIRSEIAVKCGVDAHEKIEDVYPCTPLQESMLAA
                     SIRYPGSFTSMRLYQVPKNVDESRLRAAWTSVAHMHRILRTRLVDLESYGVSQVVVDE
                     QSIAWDSYDSMYAFLQHADSVYMGPGTRLTKWAIIHGPDRKRYLVWTIHHATYDGWTL
                     PIVEDDVRKAYSGERLETKPLDMRPLVKYILTQRKEDSKAFWAQQLAGAEDGAVFPSL
                     PSHNYDPRPETYLEKTIATDVSATSTNIGLSGLLYGSWAAVVSHVTGNEKVLLGTILT
                     GRNAPIDGIDKVIGPAVTTVPILIDVNGNLKVRELVVKIQEMTAGWIPHEHIGIQNIR
                     SINEACRTACGFQNVLVLQPHRRSQNVRGGSNKEHIMEEVDETRVEGFPNQHSVLNQY
                     GLMMEVVPINDTVTVRASFDSTLISSTQVHRLINLWEHMIQQISGILQTGLPDTVASL
                     NYTSDQDLSDIWTWNKNLHQPVGPDRFVCQTIQDIARHQPDALAIDSWDGRMTYKRLD
                     VLSSRLSHHLVLSGVGRGHFVPVLFRKSLWANVAMLAVLKAGGSFVPLDADHPEGHLR
                     AIMQPLGANIILCAAKTRDRAARLVRNAVIVDATLDGSQDASRNIDQAPDIAPLTAHD
                     IAYAVFTSGSTGAAKGVRISHENLATAIHYQAGAEGFQLNTHTRSLDSSSYSFDACVF
                     NFFYTITQGGCLCVPSDESLKGDIGSFINAFHVNWAQTVPSVARTLDPERFPNLKTLV
                     LTGEALGKSDIEKWAHRVHLVNVYGPTECTILCAISSQISDTSQLGSIGVGRGANLWI
                     TEIGNPNKLAAVGAVGEILIEGPIIGAGYLGPYQYPLVENPPWLVSGRGNIPGRAGTL
                     FRTGDQAKYAEDGSIVFIGRIGSEIKLRGQRVDLPTIEYAVSSHIPQGLEFAAEIVQI
                     NLSATVRQMLVVFVGASVQKQAPPDIEEKTLDKILQKVIPALKSGLDARLPVYLQPEA
                     FIALTAIPKTSSGKTNRRKLKELGTQIRLSQLTWIRGDIEKPIHTPPSSTMESLLAVL
                     WGEVLGIDSTTISREDDFFHLGGDSLGVMRLTTKAHDHDLELKTSDVFTSSKLALLAK
                     RVNRLDRIDVAYKPYSLAKDIQDVHSFVQTHIVPALKIEDSQIEDILPANRFQVDYMH
                     NQEEPLGLQYAYIDIGPRVSWEKLQAACRIVVQEFQSLRARFVKHQGKYYQIILRDAP
                     LAVEEIATTEQITTFSNRFCPADGRQAHVSDIFTKMTLVNTGSNLRRVILRLSHMQND
                     GWCTVRILQSLATAFNDGIVEKTPDWTSLLHYRNQTAHASHLYWQRVLNKSSHPTSPL
                     VYKPGGSQVRTLRSFALPYFHNAEDNRRTRPTVVVNVAWALVLQKLANVQEVVFGNVT
                     TGRNGAMPGLDSVVGPCVNMLPFRLRLNTNHPSTSRRQHLRDLVEASAQQVDEHTEHE
                     GLDWDDLVDNSTEWASGTGYTSAVHFRNMAFEPELRFGDEKVVVTWYELVAKPHWTTV
                     LVYPEDNVLRLWLLASPEEIGEDGADEILQMLSTYCEEIVEELRG"
     gene            <616983..>621296
                     /locus_tag="TRUGW13939_08768"
                     /db_xref="GeneID:55996256"
     mRNA            <616983..>621296
                     /locus_tag="TRUGW13939_08768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491897.1"
                     /db_xref="GeneID:55996256"
     CDS             616983..621296
                     /locus_tag="TRUGW13939_08768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347790.1"
                     /db_xref="GeneID:55996256"
                     /translation="MAQCSIWGNGYVSSCLSEILPPSSCIASGLLILGMYHLYSRKGN
                     ILRRPEYMTVLSPLAIKLELLCLLLGGVLSFIRGYQSDTVLSTASPPAYLLLLVKLRL
                     SSGSSLIPTLQTHSVVLYTLQCIFCAVTAHAQVVTNAAQPLLLTTLIQSAIFAILSLL
                     HLASTRQPMDNNDAGDIRKDMTASFLSRMSFSWLDELVWKAFRATLEVPGLYPLSEEH
                     KSETIAREFSSISSANLLRRLWQLTKYDAPALGGWAAVNSVAVYISPALIQIFLTYLD
                     AADGTAWLCVGGFLAGGILAGTADCQCEWKRRQISAKVRAVLVNEIYEKVLRKRITRS
                     TSGEDGEATGGDIFNLMSVDAESVSAVSGDLYFVWVAFPVQTGIGTWLLYRLLGISGV
                     LGVLAMILLLPLNFLVARRAMAVQAQVLAASDKRIHATNDVLNNLKTIKYSAWVQPFM
                     KRVLSKRSAEINELRARYIWWSVNMTTFHALPFVVTMITLFLYTVVWGGSLRTSTAFP
                     ALAIFGIIRIPLDRMASAASFMMRAYVSLRRIESFLLEGETGKYQQLSASASDSDSSR
                     VGFENATFSWPSAVVGTSADHTSGEDILLTAMPASPFRLGNLNIAFQTNALNIVCGPS
                     GAGKSSLLLSLLGEMDLLHGRVFLAHDENPSSSSSFNNTTAYCPQDPWIMNRSIRDNI
                     LMEQPFDGPRYERVLHATALQPDLAAMDHGDLALTGEGGCRLSGGQKQRIALARALYS
                     PCKCVLLDDCLSAMDVHTANHVFFHGIKGLLMRGRTCILATHAVQLVTPHCGYVVVLD
                     EGRVVGQGTPEKVISEGLVASDYVGTSSTQAHVESATLEYSVEVDDKPHDVEPQSTYT
                     ETRAEGKVAWAVMRTYLATMGKKSYWILVLIMFGAQQIATLGTSLWIKQWASEYDKES
                     SSKPNVSYYIAVYAAIFLFYMLITFVRDLFTLHGALRASAAIYSSLLGAILNATPLFF
                     DRTPLGQITNRLTKDVEAMDQSLPGFSINALQLVASMAMMLVLISTVVPVFLVAAVFI
                     CAAYYLVTVLYINGARDLKRIESVQRSPIYQNFSESVAGCVSLRAYAHATASFTHQNR
                     VLVDSINQAYLLQWATQAWLMFRIDVLSSLVSFFTSMFVLLNSSRIDRGSAGLVLTFA
                     ASFTENVMWFVQIYSILQRDLNSIERILEYVGVEQEEEKKDRGIYDLPSPWPTEGRVS
                     FHSFTARYTNDLDPVLDDVSFEIPPGQRVAVVGRTGAGKSSLALALIRALRPDTGHVE
                     IDGVDIRSLPLEQLRQAITLVPQDPQLFEGTIRDNLDPLQMHSNAELVSLLRDMHVSQ
                     ATDSYLNQAATTLSRGQRQLLCIVRGILRKTRILVLDEATASLDHDTDAAIQATLRIS
                     IAQGTTVLTIAHRLHTVADYDKLVVLDGGRVVEDGPVAELLERRAAFWRLCEEAGYQP
                     G"
     gene            complement(<621800..>626341)
                     /locus_tag="TRUGW13939_08769"
                     /db_xref="GeneID:55996257"
     mRNA            complement(<621800..>626341)
                     /locus_tag="TRUGW13939_08769"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491898.1"
                     /db_xref="GeneID:55996257"
     CDS             complement(621800..626341)
                     /locus_tag="TRUGW13939_08769"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347791.1"
                     /db_xref="GeneID:55996257"
                     /translation="MALSPSLLGNTIIKNDALEQVALLCDIDPNRVEGIFPCTPWQRG
                     LLTSSLTRAGDYLSRYVLKLRSEVDISRFQAAVEAVVAATPILRARIVNLPGQGYVHV
                     VLDESVSWTKKNNLQEYLNIDKQTAMEIGSSFSRYGFVEQNEDGANFFVWTLFCTVCD
                     SSSMALLLPAIEETYLDQTRNTLTPFQSFVKHVGSVDEDTAGMFWKAQFTDSKAVPFP
                     PLPFPAYQPRIDSTVDHHVTELEWCMDNVTVSTALRTAWAILAAHYTDSDDVIFGAVV
                     TGRQVAVAGIERTVGPTHAMVPVRVVIDRQKSVGDLLQQIQRQSVEMVPFEQVGIQWI
                     RRISANVKRGSQFQTLLVIRSVEEDSEQRPSTLFTPQFDEMTSTDVGALSTHAMVVIC
                     QLKTHGLQLRIGFDSTTIDVRQVQRIAHQLEQVLRQVYTPANSVKRLSELETTSVQDL
                     RDIWMWNATVPETINRCVHEMIADTVQRQPEAPAVCAWDGELTYTELDKLSTKLAYHL
                     VEQGVTPGAIIPLCFEKSMWVPVAMIAVMKSGGVSLALDIEQPEKRLRTILEQVNPNL
                     ILSSVANHALAGRLYHATVVVINDSHLHLTQSSLDFAVHLPEVQPTSKLYIVFTSGST
                     GTPKGAIITHTNFSSALWHQNNALGFKPTSRVYDYASYAFDVAWSNILHTLYAGGCLC
                     IPCQDDRRNNLVQSMQQFKANYIDWTPTVARLVDPAEVPDLRYVSFGGESLTAKDAHQ
                     WRSSTATINAYGPAECSVRSSLEWIEGDKTTEPGIGKGIGTTTWVVDRQNHTQLVAIG
                     CTGELLLEGPLVGQGYHGDMEKTTQAFIEDPVWLLSGGPGVPGRRGRLYKTGDLVRYN
                     VDGTLQFIGRKDSQVKIHGQRVELGEVEYHVQQYLASKTDDTLLVAEIITPRASDNAV
                     LVVFVAISGLENENLETAVANATLGVNDELTAVLPMYMVPIAYIPMDQLPVTATGKTD
                     RRRLREIGSSFSLRQLIALNPLRGERRPPTTKTEQVLQRLWASVIGIDVDSISANDSF
                     LRIGGDSIGAMRLVGALREQGFFLTVADVLQRSQLCELAKVLEVGKDVATEGLPSVAP
                     FSFTQADDVPLFLERLVIPQIKVTTKIMDVLPTTDFQKLCIYEALCDPPSRWFYFIID
                     LPTDVDFRRLASACSSAVKYLDILRMIFITIHGSFWQVLVEGIEIGFDLYENHAQSLG
                     FTTKMCEEDLKRERALGQSFIRFFGVRDSIGGNKLVFRCSHAHFDGFCLSSIFDVIFG
                     LYDGTKIVTQSPGFAGFIAYTSNKRSKSILYWQSVMYGSCVFNWKQTDAADSTDSSQD
                     NLQITMKVKLPTIEENVSTASLFHAAIALALSANYKTSNVLFGRLVTGRAMLPSELQE
                     AIGPCLAELPVRVKIHARDTLLTVAVRLQRQFIQDSHFESVGMADIIQECTDWPATES
                     DFGWRTAFMPEFGSTSQSSIKYSVFIHESTLLPRKRPELYARRIGEDLEITYDSDGSI
                     LSQEMVRSVLGTIQSVLEG"
     gene            complement(<632686..>633276)
                     /locus_tag="TRUGW13939_08770"
                     /db_xref="GeneID:55996258"
     mRNA            complement(<632686..>633276)
                     /locus_tag="TRUGW13939_08770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491899.1"
                     /db_xref="GeneID:55996258"
     CDS             complement(632686..633276)
                     /locus_tag="TRUGW13939_08770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347792.1"
                     /db_xref="GeneID:55996258"
                     /translation="MQLFQNVAECKVPETPYAKNIERGLKATLALWNETNEMKMRFVS
                     SENDDIDMAVDRKEGTLNVHQRWLKYEEMHQKHRCRELVLSDCFVCDHIIEEMTRIIL
                     GAIYRLTVRDQEGVLRGVRNHLRWMPRDICARQGNQPGCLQVSWRDGELESISRLVGS
                     ELEHHVVLHEERCASLMTELLHGEPGSLLLLDNFKQ"
     gene            complement(<638546..>639835)
                     /locus_tag="TRUGW13939_08771"
                     /db_xref="GeneID:55996259"
     mRNA            complement(<638546..>639835)
                     /locus_tag="TRUGW13939_08771"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491900.1"
                     /db_xref="GeneID:55996259"
     CDS             complement(638546..639835)
                     /locus_tag="TRUGW13939_08771"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347793.1"
                     /db_xref="GeneID:55996259"
                     /translation="MQSLPTMAGNAPAPSSSGDSTLVTELRDAIQRIQALEQKMTQVS
                     TTGTAAGGDNRLIGTVEPFLGAFGTLDTFLTQMTIYFANKELVTIHKIQNVKQVRSVR
                     EYISNYLRVSNGLKYSDQGHRDQFYQGLKKSVKDMISIMNPRPETFRDMIKVASRIDL
                     QQYNRQMEKKSHGYFRGNHQTSMSQRGGPQYDKDGDIRIQPNSAISKKEMARRKKDKA
                     CYKCGRKGHFSRQCRQDQKDQNNDVSSHGVSVAHQNTTPDESDEEEDSHVDEVKDFWG
                     PIIEKRQGLEREPPQEEAKPGEAHPHQQSGQNGEGQIERGKTQHPLMFRDDGRNSHEA
                     SNREQRRTLQQLEVNGWLLEGIPQITKEQWNLVLGTTTKDKETQTEIPETGSESTETT
                     SSFQEFDYKDPTTKLCSCTIPKATSWEDSIQTWKHHA"
     gene            <642400..>646636
                     /locus_tag="TRUGW13939_08772"
                     /db_xref="GeneID:55996260"
     mRNA            join(<642400..643013,643075..643175,643230..643403,
                     643488..645091,645145..645251,645303..645639,
                     645701..>646636)
                     /locus_tag="TRUGW13939_08772"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491901.1"
                     /db_xref="GeneID:55996260"
     CDS             join(642400..643013,643075..643175,643230..643403,
                     643488..645091,645145..645251,645303..645639,
                     645701..646636)
                     /locus_tag="TRUGW13939_08772"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347794.1"
                     /db_xref="GeneID:55996260"
                     /translation="MTEPPAHGDYTVGWICALPETELVAAMAMLDKRHPGLPAIGPHD
                     DNSYVLGRTGEHNVVIACLPAATTGKVSAATVAKDMIRSFPAVRFGLMVGIGGAAPYY
                     GAKGNANSASGEEDEDSEDSEDDTEDIHDIRLGDVVISLHSKSSDAVVQYDFGKSLQE
                     KEFVHSGGKLNKPPSIVLGAVAHLKALHELEGHNISETLANMMSSRISFMKRQVMKDA
                     VLRDKWAQKESIICFEMEAAGLMDSFPCLVIRGICDYADSHKNKVWQPYAAATAASYA
                     KELLQVISGQGVMNMDPIKQIEKSIREIHGIVQDTGVVVHNLRNNSRHEKVFSKLPYA
                     KGSSFDVANAEHEARCHLKTRIDLLRQIQEWAESPKQKCIFWLNGMAGTGKSTISRTV
                     AGYFKEKNQLGASFFFNQGERDRGTTKKFFTTICTQLLLHIPELITHVEEVIDTNPYI
                     SDRMMKEQFDKLLLQPLLNLSQSQPTSIIIVVDALDECEQDDDIPVILKLLPQIQDIK
                     PMRLHIFLTSRPEFAIRLGFNQNNSYQDVVLHELPKPMIEHDIRVYLEDELSKICDER
                     SLSNDWPGNEAIKELVQMAVPLFIFAATACRFIKEGMHPKKRLQDLLKFQATTFASQM
                     GKVYLPILNLLMGDKEDDLKELLEEFQDIVGVIILLATPLSVKSLALLLDLPEQTISE
                     LLDPLHSVLDIPSNKYAPTRILHLSFRDYLLTTESLFHICEKETHQKIALHCLRVMNT
                     SLKHNICGLLSYGTQRDDIDSQAVHQNISKDLQYACQYWVYHLRHNEDRAVGPRVFDF
                     LKKHFLHWLEALSLMGVISEAVAMIDALQSRNGKSIDTEVSDFLYDAKRFILKNTYIA
                     NIAPLQLYSSGILKHLHILPRVEDLWSLGLQSLEGHSYQVQSVAFSPDGKTLASGSAD
                     KTIKLWNIQTGSELQALRGHSQSVKSVTFSSDGKILASGSDDKTVKLWNVQTGSKLQT
                     LHGHLNWILSSTAHSLPSQASAPMLQLSASNPSTEESQPINSSIASVEPADSDLPFQL
                     KIPILATGRQLDDEDPCSRVTAEESYARDDINCLSQQTCPSPEDNSGHLDVPDIRTTS
                     PLSTSQRDIALLDELPNEVFNPSCPTNEDRMSTFPESPILNTSFNGDGQPINSVDLSI
                     TMPIVQGVTRDQNSHVNATATETQSFDDVMHSHEDTDLDAVHQGWRERSATVETVHTV
                     LHQAYSSHVPRETRESRLSQSQIQQLIHGETAVVSLRDGRRRKRSRRRSTRTGMRHPA
                     SPDSAESDDSDDHNYHDTSDEEDGGLNN"
     gene            <646673..>647422
                     /locus_tag="TRUGW13939_08773"
                     /db_xref="GeneID:55996261"
     mRNA            <646673..>647422
                     /locus_tag="TRUGW13939_08773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491902.1"
                     /db_xref="GeneID:55996261"
     CDS             646673..647422
                     /locus_tag="TRUGW13939_08773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347795.1"
                     /db_xref="GeneID:55996261"
                     /translation="MTCPIRERPGLDAKEVTSPNSLHELSSKENTNCVEQIRMYGRLF
                     RKITLLSRVRYFCYFDEDPCLTVPEPMAFNIEQECNQDAGNKMSNIQAMDVEGIFTRD
                     VDTRGDTWSWCFKERKTASPSSSQSGDAVHSAPSIAHSSQSSKLHRQRKRTPYSTEEE
                     KLLIDLKRKQNLPWREIAKHFPGRKTSTLQVHYSTKLKDREVGTSKANHDHGDEFCTV
                     NPSLQSTEDNTPRQRYGLRSNRRSQGRFASE"
     gene            complement(<647830..>648262)
                     /locus_tag="TRUGW13939_08774"
                     /db_xref="GeneID:55996262"
     mRNA            complement(join(<647830..648072,648146..>648262))
                     /locus_tag="TRUGW13939_08774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491903.1"
                     /db_xref="GeneID:55996262"
     CDS             complement(join(647830..648072,648146..648262))
                     /locus_tag="TRUGW13939_08774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347796.1"
                     /db_xref="GeneID:55996262"
                     /translation="MSAPAPAPGSSLAAGSGPSPAGPPPGDFDLDLDIDTLCRCEFVR
                     HLGQEVHRVFRHYEQVPNEQEAANWLRDYREDLRLLWGVLGGDDPNTKNNMLARVKSK
                     FPGFDAWRRGLGPAPWE"
     gene            <649794..>652030
                     /locus_tag="TRUGW13939_08775"
                     /db_xref="GeneID:55996263"
     mRNA            join(<649794..649925,649977..650697,650765..650942,
                     650994..651216,651263..651790,651842..>652030)
                     /locus_tag="TRUGW13939_08775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491904.1"
                     /db_xref="GeneID:55996263"
     CDS             join(649794..649925,649977..650697,650765..650942,
                     650994..651216,651263..651790,651842..652030)
                     /locus_tag="TRUGW13939_08775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347797.1"
                     /db_xref="GeneID:55996263"
                     /translation="MDSNSFVLQQTPETACSTDKAMKLLREAFQLIISDGVDLRREPE
                     FCMIVDQLCEKAPEAAEAIVGTIQKSPKIDCLNFYGETLAIRKRKSTEDPIYRSPKYA
                     RRISNSSDANLVLGQDSTENGVKEENQGTEKDLANDGTPRTKSRSQVVEGQELAIADM
                     NLGVSTDKIPLAEETTESTILDMTLQAVHVIHQLCTYTKDVPRAIHAQILQTIQKSHS
                     GRVTAPIDTQWSDGSRWLQILDMGSSTGIRTTVLNMVEYMGAWEWFDEQCKHAEATVC
                     TKKGKLVERKWISGVGPVTVKEVGDTANFEGKRKELRKRIINQLHRGEKLSKLVKVIG
                     LGILLSPKIWDYTKMGWKHLDTLIKNTQSDHREMELYRILSGQVERLVHEGSPDLHAF
                     YNDLESEELISSCQVDQWRKEYILGSDPLPDAELNAAVDQLVHLISNKVLHKNTPDKE
                     DTISVNGSTELFCNIFEQLRPGRWMSDEIIMAVMQIVDKPTFVRHGLRIPLDEIVHGQ
                     LQAIKRPFANWARQMGNYRRVTKEADSLVYFCPINHQNSHYSLLEINEPERKIHHFDS
                     LAERARQDRVSSLIKKEFAGLKYLYEEAATPQQIDGWSCGARVIWNFKRLANGLPIGP
                     RDTVHDSNRMTLEIVDGLMACVEDGRIIKYRD"
     gene            complement(<652280..>653550)
                     /locus_tag="TRUGW13939_08776"
                     /db_xref="GeneID:55996264"
     mRNA            complement(join(<652280..652411,652467..652878,
                     652937..653154,653533..>653550))
                     /locus_tag="TRUGW13939_08776"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491905.1"
                     /db_xref="GeneID:55996264"
     CDS             complement(join(652280..652411,652467..652878,
                     652937..653154,653533..653550))
                     /locus_tag="TRUGW13939_08776"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347798.1"
                     /db_xref="GeneID:55996264"
                     /translation="MDLQDWSRIEGLDREYYQDIPDYAYTNVQPPDAGSLWQQLEKIY
                     LNARDCDTYGKDENAWCLDVVQPLLNSVLEGTMLRQSQQIEKDLLPTAANSLSKLNKK
                     ADYSFEFSGGPDAFDLYQKVSFGGLGMNISQTTDAYTKLVALFSGLEVKPDDGGKKEA
                     LAQLTIWLTAGIRRTAQLYQIAEEGSAEGHVPPTLGFTVIGHDWHIYMAYDLGKEMHV
                     IGPISTIYADTRSIYGIFKIRDLLRRAIQYAEEDYWPWLCD"
     gene            complement(<654536..>655438)
                     /locus_tag="TRUGW13939_08777"
                     /db_xref="GeneID:55996265"
     mRNA            complement(<654536..>655438)
                     /locus_tag="TRUGW13939_08777"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491906.1"
                     /db_xref="GeneID:55996265"
     CDS             complement(654536..655438)
                     /locus_tag="TRUGW13939_08777"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347799.1"
                     /db_xref="GeneID:55996265"
                     /translation="MAEKRKPDLLEANRLSKSRRRDLNQRITLQWGEYNIDIPSRNEP
                     SIKEIHDFLQELDKRSSYPQTIAANCNRKSMIDTIEYLSGYPLTNDIILIRDLEKLDD
                     VLRRPFETPILYRQAKSQHHQNDLNIKCFLQWLSENENKNLHVYDYSITDPSLRTRVT
                     TVEEVLQTFPSTGNSKPLNLLNLENQSGTLYCLGQISNHDIRVKIARRKSDDAGKIGS
                     TWVLDKASEFFLLSSRNTVSSIHIDNAGQLTWIEILEGRKIWYFPRFLHMRTLRWLAE
                     AGSQSPEHNRDGWVKVELCAGDIL"
     gene            <656910..>657386
                     /locus_tag="TRUGW13939_08778"
                     /db_xref="GeneID:55996266"
     mRNA            <656910..>657386
                     /locus_tag="TRUGW13939_08778"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491907.1"
                     /db_xref="GeneID:55996266"
     CDS             656910..657386
                     /locus_tag="TRUGW13939_08778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347800.1"
                     /db_xref="GeneID:55996266"
                     /translation="MSAKHPLRVLAIVSDKSQTWEQSPEEIIPFTLRVIAENNLCDVT
                     EISVSDTTLLAIQYYRTRKMFIFDILNEHYDAAKGHRPEDNELPVVVIHLSNRNIASQ
                     PHPEECARINETVRYLHDANGFGSTPPFVEDHTSGTPPNYPNPRSLTRSVPPQKAL"
     gene            complement(<660606..>662304)
                     /locus_tag="TRUGW13939_08779"
                     /db_xref="GeneID:55996267"
     mRNA            complement(join(<660606..660823,661298..661541,
                     661615..>662304))
                     /locus_tag="TRUGW13939_08779"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491908.1"
                     /db_xref="GeneID:55996267"
     CDS             complement(join(660606..660823,661298..661541,
                     661615..662304))
                     /locus_tag="TRUGW13939_08779"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347801.1"
                     /db_xref="GeneID:55996267"
                     /translation="MQVNATGWGTAEAEEFVVVTQDLDTMTIAETEETNPDDASIGTE
                     ESDSTISEEGHRAAQILAGQATAFEYFMESQDKQTRKFLELQQKYIHQEPMESIVKLG
                     FLQDKLEVMSDYRYEILNIKNIVEEQAKETDLVREFRDEGMVRSQQYQDKARLNQLLI
                     PVISGELIRSRAAAKIIKDEIERLRDNENVAKIDHPRHAELAWSFCYTDSCTIHRSSK
                     DGAGYWPNRKRPVERVLCRGSPRDNRERVGLEEGPEADGRNPQVYISARLNLQRPCKV
                     KLHLDGALVVDDGRPREVVSEDPVSDDDDRALYQRRFIAALPPPRPPVAPLPPALIRT
                     LPPFSQSPCPGRSFRGLATPALGQTLYPLLQYPRMRRRQRKSLRQLNES"
     gene            <666557..>667264
                     /locus_tag="TRUGW13939_08780"
                     /db_xref="GeneID:55996268"
     mRNA            <666557..>667264
                     /locus_tag="TRUGW13939_08780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491909.1"
                     /db_xref="GeneID:55996268"
     CDS             666557..667264
                     /locus_tag="TRUGW13939_08780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347802.1"
                     /db_xref="GeneID:55996268"
                     /translation="MYCTTFLTSASILALVTALPTPKAASAAISDSYTYYTGDGSVAD
                     GWPDESIWGSWSDLWAANAAVMPNTCGWNGWGADDSSTEIADIQTAIEQVASSTGVDE
                     RFILAIMMQESKGCVRVPTTNYGVVNPGLMQSHDGSGTCAGVNPCPQSEITQMITDGT
                     SGTLSGNGLQQLIAQAESTLGVTTSQAFYAAARLYNSGSADYSNLDDGLGSTPCYASD
                     VANRLAGWVLAASSCTA"
     gene            complement(<669044..>669541)
                     /locus_tag="TRUGW13939_08781"
                     /db_xref="GeneID:55996269"
     mRNA            complement(join(<669044..669078,669144..669332,
                     669382..>669541))
                     /locus_tag="TRUGW13939_08781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491910.1"
                     /db_xref="GeneID:55996269"
     CDS             complement(join(669044..669078,669144..669332,
                     669382..669541))
                     /locus_tag="TRUGW13939_08781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347803.1"
                     /db_xref="GeneID:55996269"
                     /translation="MPDYSSWFRIHNRLNVPLIQKSEAVYSGYWERWPPQRIEGHSTS
                     GWFQIKDKFGSFGSDGEVQYDANIDGQTYTIQFKAKCPSGDPNEAKIWNLSPGDNPPV
                     VTVSSISPHGHPTEADFVVISLHYN"
     gene            complement(<673747..>677946)
                     /locus_tag="TRUGW13939_08782"
                     /db_xref="GeneID:55996270"
     mRNA            complement(join(<673747..675036,675089..676034,
                     676079..676682,676766..676939,676995..>677946))
                     /locus_tag="TRUGW13939_08782"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491911.1"
                     /db_xref="GeneID:55996270"
     CDS             complement(join(673747..675036,675089..676034,
                     676079..676682,676766..676939,676995..677946))
                     /locus_tag="TRUGW13939_08782"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347804.1"
                     /db_xref="GeneID:55996270"
                     /translation="MVLPQNTNRPSKKIKRSVTEPPAKFAHGDYTVGWICALPETELV
                     AAMAMLDERHPGLPAIDPRDANSYVLGQIGDHNVVIACLPASITGRVSAATVAKDMIR
                     SFPAVRFGLMVGIGGGAPYHGARGDDNSVRGEEEEEEDSEYSEDDPEDLRDIRLGDVV
                     ISLPSKSSDAVVQYDFGKSLHEMKFILSGGKLNKPPGIVLSAVGALKAKHELKGHDIL
                     KTLANIMSSYPALATKFQYPGSQKDFLFKSNFVHEAGRKTCRTCCSLDSNLMKRNNRP
                     DNSPRLHYGTIGSADQVMKDAVLRDKWAREESIICFEMEAAGLMDSFPCLVIRGICDY
                     ADSHKNKIWQPYAAATAASYAKELLLVISGLGVKRMDPIKQIEESLRKINDAINDTSV
                     SIQGLKDDKIFAMLPYAEGSSFDAFDAEHDTCHPETRVDLLHHIKEWACNLRQKCIFW
                     LNGMAGTGKSTISRTIAQYFKKEGQLGASFFFKREERDRSTAKKFFTTICAQLLLHIP
                     ALIPHVEKAIDKDPYISGKLMEDQFDKLLLQPLLRLERSESTIVVIVIDALDECEDKD
                     DIRAILQLCLSRPELPIRPILEENDNHHGLVLHELSKTVVEKDIHIFLKAKFFEIKKT
                     RKIVGEWPGDDTLEILVMRAVPLFISAATICRFVGDLKWRPESRLLTILQDPAATSGS
                     QMDRTYLPVLNKLLSGADNTEITQLIQEFQDIVGVIILLGTPLSLNTLSHIIDLPRRD
                     VSNRLDGFHSVLSVPENSNSPICILHLSFRDYLLNTKSPFHIDEKETHQKIARHCLRI
                     MNTRLKQNICGLPSYGTQRDGIDSQATNQHLSADLQYSCQYWVYHINHSKGSINEYMI
                     FAFLRRHFLHWLEALSLMGVISEAVTIIDALQSGDRKDTGAEILDFLYDAKRFILKNI
                     SIASAAPLQLYCSGLVFSPMQSPIRKMFSYSRPKQIHILPQVEDYWSRGLQTLEGHSN
                     GVNSVAFSPDSQMVASGSDDKTVKLWDAKTGSELRTLKGPSSAVNSVAFSPDNQMVAS
                     GSDDKTVKLWDAKTGSELWALEGHSNWVHSVAFSSDGQMVASGSNDKTVKLWDAKTGS
                     ELRTLEGHSSSVYSVTFSSNSQMVASGSNDKTVKLWDAKTGSELWALDGHFYGVGSVA
                     FSSDGQMVASGSNDKTVKLWDAKTGSELWTLEGHSNRVHSVAFSSDGQMVASGSNDQT
                     VKLWDAKTGSELRTLEGHSHGVRSVAFSNSAASTINAEEQTTTKATSIQQRCDNCDPS
                     SYNFNPQVSLLDNWVVLAGENILLLPPEYHQFTVSAVKEDNLALGYRDGRVFIIGFQT
                     C"
     gene            <683709..>685298
                     /locus_tag="TRUGW13939_08783"
                     /db_xref="GeneID:55996271"
     mRNA            <683709..>685298
                     /locus_tag="TRUGW13939_08783"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491912.1"
                     /db_xref="GeneID:55996271"
     CDS             683709..685298
                     /locus_tag="TRUGW13939_08783"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347805.1"
                     /db_xref="GeneID:55996271"
                     /translation="MDQRQQYIPPPPPRPSTQRHGLFPPPPLGPPPSAYPGSNQWPIW
                     PPPPPMIHPSLIPSNQTYGRQQSTPLSIPIQPIPPPQSEVLPLTSPTYILVGASLCPG
                     VGIPPLYDNYGPSTTVQPSNQPWESAPVDKSPTRDGNIPSTPSARHFPPSVTLGNDNS
                     EAASPGFATYQTYNYEPARTSSHKHNASNTSLGRMSTGESTVNWPLERVINWLIRKGF
                     SKDWQETFKFLELEGADFLGLGQGGNGRGNLGKLHQQVYPQLAKECQKSGSGWNQHRE
                     HKEGKRMWQLIREIQDGNEASSQTHRRRGSQTMVISASTEGGLENSPNLGWESTVPPR
                     PASYIQHPAHRQTPNTGEKQTDQTRPGAAPFSYRQDAIYGDSRPEFTRHAVCNLETFR
                     KQSPSSPSGGNPFKPPPSLTSRKSFGPEYDFEETKVDFDTPHIPQSSSDDDSDDGLFA
                     KPLVTSKPQNTRSNKGRSVAFKSPNANDGQSLSPPYPSSAVFSNDPRSGFDGNGATFP
                     SAGHSSEEEKPRRNSSFATNF"
     gene            complement(<688413..>688779)
                     /locus_tag="TRUGW13939_08784"
                     /db_xref="GeneID:55996272"
     mRNA            complement(join(<688413..688512,688559..>688779))
                     /locus_tag="TRUGW13939_08784"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491913.1"
                     /db_xref="GeneID:55996272"
     CDS             complement(join(688413..688512,688559..688779))
                     /locus_tag="TRUGW13939_08784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347806.1"
                     /db_xref="GeneID:55996272"
                     /translation="MDASGPSISETDLNFDLNHIDWLDLFDTGDVPSLEDFGIYLDGA
                     ENVESTPSQQIEELRGMVGNSDSQLQYLADRVRKLEKSLVYLFKWAKDFRDSIDKAIK
                     LNKK"
     gene            <689566..>690636
                     /locus_tag="TRUGW13939_08785"
                     /db_xref="GeneID:55996273"
     mRNA            join(<689566..689886,689938..>690636)
                     /locus_tag="TRUGW13939_08785"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491914.1"
                     /db_xref="GeneID:55996273"
     CDS             join(689566..689886,689938..690636)
                     /locus_tag="TRUGW13939_08785"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347807.1"
                     /db_xref="GeneID:55996273"
                     /translation="MSLILHALLFTCAACGVLFPLKDGFPDPSPLQLLSVGSHSLGTL
                     SSGSLPATISTEGITNLQLLAFNEMVAVAFFSELVANLTEGIEGFNLLPGQDHVVPAI
                     VATLQQEELHAVNANAALQHFGVNPMAPCTYTFPVASVEDAIYWASVVTAAVLGAQHG
                     VIQNLAENGDVGLVQGLVSITGQEGEQEGFFRELQGKIPNELPFLTSSTREFLFSALR
                     RVADPLCASLEGISLPSFFPLDVAIFPDPNSPIITLTYSALEADCSSLSVVYTNQQNP
                     PIVKPIMFESITEDLITVKAQFPQDEFSINGLTIIALTSQPGPFKDASDVAKATVFGP
                     AFVIL"
     gene            complement(<694127..>694429)
                     /locus_tag="TRUGW13939_08786"
                     /db_xref="GeneID:55996274"
     mRNA            complement(<694127..>694429)
                     /locus_tag="TRUGW13939_08786"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491915.1"
                     /db_xref="GeneID:55996274"
     CDS             complement(694127..694429)
                     /locus_tag="TRUGW13939_08786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347808.1"
                     /db_xref="GeneID:55996274"
                     /translation="MQQSRPSSSETSPIEAQCQLSAEGFHESMEDGGAGAGAGAGAAV
                     IIEYGFPHDVTLSRLGIENAGMRNGPRYEANIGNIGRLTRFSRRTERDRGRKVIAS"
     gene            <695051..>696589
                     /locus_tag="TRUGW13939_08787"
                     /db_xref="GeneID:55996275"
     mRNA            <695051..>696589
                     /locus_tag="TRUGW13939_08787"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491916.1"
                     /db_xref="GeneID:55996275"
     CDS             695051..696589
                     /locus_tag="TRUGW13939_08787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347809.1"
                     /db_xref="GeneID:55996275"
                     /translation="MNTFFFYEPNATATRFSNKERFRSHPATKARVLNDNQNTGGIKA
                     ACDVDSTQQIPTTAKIRVATPQSSDDSVETDSAPETWDDCFDDAKHSDSGDSLRSLFS
                     DFADELEMSLEHFRDTSTSHVPPCEVTPGTAGPEPSREPHGSEYSKTALESSLAVASG
                     GQCAEPDDNGARPLAASNCDQASSSTRLFSESMYTPEPSSYVVGPSRVEKGTQTDLHG
                     INGADFRRDSCEGVDQMGVTVCGDPDTIHESTQERSSLERHGDGAGGTSIVNNTAMNI
                     ANSDYNEVVESPQLSLPAHVEDPSDFRSSHHAISHSSIDGSQHSQYLPIHGFFTVHER
                     EGQLAYTLSFFPSSIGSSLQLADERAHALPARGEGTEQYSNTPEPADNDDEDDYRSAQ
                     DHPLGADRPSSLSPGDGSSQQCLVGQKGDQYSPDEDALLRKLKGMNMAWTEIAKSFPG
                     RSKGSLQTRYCTKLKRKDILDDDTEKGQQGLKRRRKTVYEASEGDPSMQLQCELSGQL
                     ENCG"
     gene            <697041..>697772
                     /locus_tag="TRUGW13939_08788"
                     /db_xref="GeneID:55996276"
     mRNA            <697041..>697772
                     /locus_tag="TRUGW13939_08788"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491917.1"
                     /db_xref="GeneID:55996276"
     CDS             697041..697772
                     /locus_tag="TRUGW13939_08788"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347810.1"
                     /db_xref="GeneID:55996276"
                     /translation="MYSFPPGITIQDIKGYGTSGMAALIPDTQIIIKFPVTEQAEERE
                     RCDREKSIYQLFQSYKHPDSLLQYHGDTEYGILLEYAELGPVRLFLQGLASPLPVSDL
                     LRWARDVALALQFIHLNGVSHGDVHCTNFFLNKDLQIKLGDFTSSFIHSIIPEDALQE
                     DFRDFGSALFEMETRCLPFPSLSTIEREEALLAGKYPDITQTTVLGPIILRCWKGEYK
                     RMEDIIKDIDKAGMFILLHKIPGSD"
     gene            <701652..>702375
                     /locus_tag="TRUGW13939_08789"
                     /db_xref="GeneID:55996277"
     mRNA            join(<701652..701864,702004..>702375)
                     /locus_tag="TRUGW13939_08789"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491918.1"
                     /db_xref="GeneID:55996277"
     CDS             join(701652..701864,702004..702375)
                     /locus_tag="TRUGW13939_08789"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347811.1"
                     /db_xref="GeneID:55996277"
                     /translation="MDVSKAESNEAKYLVDVVGHVHIKELPKPESEIINGVNEEIQRL
                     EDQSGQGSSLFAKGGPRCEKFIGCGIDIVSIVKLYIRYETFVHQGPRDVIIKHPEQGR
                     VHMKNVQAIGIFKVAPNSGPVTFHLSRPGQKISATIPAKTIELHEDELLIVLGSVTVV
                     IDFVDVMKLVWDGYSALPMGKDIQNTDVLEFTKL"
     gene            <703930..>704575
                     /locus_tag="TRUGW13939_08790"
                     /db_xref="GeneID:55996278"
     mRNA            join(<703930..704045,704140..>704575)
                     /locus_tag="TRUGW13939_08790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491919.1"
                     /db_xref="GeneID:55996278"
     CDS             join(703930..704045,704140..704575)
                     /locus_tag="TRUGW13939_08790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347812.1"
                     /db_xref="GeneID:55996278"
                     /translation="MSTAETPMSISALLNPAPKTQPDVLPANIYTAVIYTPPYLDKGS
                     MDCHYNNIDSAPSKSIARRGRRRPHRPEYSEEEMYFIWYHRVDLGMTWNECVCVFNGQ
                     FPSSKGRPVQGLQGVFYRFIKSKGCPTVRQQHNNVVRRDRDGLPLPHIGVIEWCGISY
                     PWMRLEHRYNCITDWRLTGFELV"
     gene            <707460..>708424
                     /locus_tag="TRUGW13939_08791"
                     /db_xref="GeneID:55996279"
     mRNA            join(<707460..708190,708247..>708424)
                     /locus_tag="TRUGW13939_08791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491920.1"
                     /db_xref="GeneID:55996279"
     CDS             join(707460..708190,708247..708424)
                     /locus_tag="TRUGW13939_08791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347813.1"
                     /db_xref="GeneID:55996279"
                     /translation="MVVHRESLPRLRDKNELRIVLKDTKRRLEKRFKASQFTEWQKNK
                     KGTCTIQIWRQGLNAHKKGFYIESEISLVTYLASVLHVEQPRQQTETEDITEGLRILF
                     LELLIQDGLEIEGDGLPWFLSISPISSFLVRLNLDAIPPLANHLCAFSTIVSIQTTFN
                     GIPVEAPLPTIIKRISGLRFCPDSHIRIKNLLNFLEEVDQYQNTANMQLPHRAPEDPY
                     QRRPSESLKSFLDSLDQPQPLPYPPNSNTFRTSPHIGRPVDPDNSQAQEPGSVPESIP
                     DVQFWDHGFNAHEFTYDGDLCSIVMD"
     gene            <709716..>710165
                     /locus_tag="TRUGW13939_08792"
                     /db_xref="GeneID:55996280"
     mRNA            <709716..>710165
                     /locus_tag="TRUGW13939_08792"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491921.1"
                     /db_xref="GeneID:55996280"
     CDS             709716..710165
                     /locus_tag="TRUGW13939_08792"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347814.1"
                     /db_xref="GeneID:55996280"
                     /translation="MSSKSHETSSDRRANLASLDYKIRNAIGWFFSGFQHLSTVLAEN
                     TGLDVTSDNSSDTDFSRPVSTDNSFMLEANIAAPHVKTISSGLDGGETPGKRDILLER
                     SVPNEEQCFHLPRLRKPLISTINCKRCRSCPLLQIVRPRLWVQQKRG"
     gene            <711080..>712519
                     /locus_tag="TRUGW13939_08793"
                     /db_xref="GeneID:55996281"
     mRNA            join(<711080..711296,711342..>712519)
                     /locus_tag="TRUGW13939_08793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491922.1"
                     /db_xref="GeneID:55996281"
     CDS             join(711080..711296,711342..712519)
                     /locus_tag="TRUGW13939_08793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347815.1"
                     /db_xref="GeneID:55996281"
                     /translation="MHAHGDGYMPMRPPMSIMDVFFPGFSTVTASAQQLLVGDENTFV
                     RLLCMGVIFATFVQYATAYAKKLIDRHFGRTIHIPFTDESYDMVIHWIRQQLFSRKAH
                     SVIARIKTEERTFVQDQPAREKPLCYSPWQGSFNFSYNGHQLVFHTRANEYSEDITIT
                     AIGTSSDILFEWMEECRAQYLAFVREKVTIFQHQDGIWKINSRRAAKDISTVIMDENL
                     KYSILKDIQEFLDDQKWYINRGMLYKRGYLLHGDPGTGKSSFCWSIASHFKLEIYSLN
                     LSNLTDNTLSRLFTELPSRCIVFLEDVDAVGLEREIAGKAQSRQNTPRSEVSLSGLLN
                     VLDGVSSPEGRILMMSTNRPHALDEALIRPGRVDKKILFKCADSYMAAQLFRKIFQKQ
                     PNEDKKLGDVGEDELERLTKAFASQIPEEEFSPATIENFLLQHKHSPVHAVDGVQEWV
                     VNERKAAKAWTVVS"
     gene            <713372..>715402
                     /locus_tag="TRUGW13939_08794"
                     /db_xref="GeneID:55996282"
     mRNA            <713372..>715402
                     /locus_tag="TRUGW13939_08794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491923.1"
                     /db_xref="GeneID:55996282"
     CDS             713372..715402
                     /locus_tag="TRUGW13939_08794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347816.1"
                     /db_xref="GeneID:55996282"
                     /translation="MAYGVAEVWFMIIDLNACQIDGWTTICRITIQIARLCVLITLLI
                     IILIRRFYPRRRRSGSDEENEPLLAGSNQPRREQPMHSIDEADEGQTPGDQMGFREMW
                     NAFKHILPFLWPKGKANLQLRFIGTFLLVCSQRVLGVLIALQDGYVINRLMKMEMPWS
                     ELCMVLFLRVLKFGCVILYDLFWMPITYWSIGRLLIEPHSKILDLSKDFHDAKESSKL
                     WEGLNRGLGINSSFNRLITDIVPMLADLVLAPGLLLTTLGPYMGLLMTSIAIFYVWLN
                     GEFLARTLQLQRKRNSMLGREKTVLHETTANWNTVSLFSRETDEKLRYSEAVHDSIDA
                     RRSVTYLGLGQYAVQSIVLLTGYIGVCLRAAYQISQGRLLLGRYLTCISFWDRFSGSL
                     KSAPALFQSIASSLVDAENMVKLLEQQPSIVNSSTAERLCIEEGDVEFHNVEFKIKDQ
                     YILNKVSFRCPGGRTTAIVGASGGGKSTCLNMLFRFYDVTGGYIKIDGQDIRDVTLDS
                     LRGTIGFVPQEPQFFNTTIRENIQYGNEYATEEDIYSACRDVGLHDKIMTFPKKYETV
                     IGERGVKLSGGERQRLAIARLIIKNPQILLFDEATSAVDTETEAIIQRNISRLSAGRT
                     VIVVAHRLSTVVNADSIIVIKNGVVVEQGSHEELLEQGGYYKKLCSQKTELQ"
     gene            complement(<717088..>718220)
                     /locus_tag="TRUGW13939_08795"
                     /db_xref="GeneID:55996283"
     mRNA            complement(join(<717088..717368,717418..717707,
                     717784..>718220))
                     /locus_tag="TRUGW13939_08795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491924.1"
                     /db_xref="GeneID:55996283"
     CDS             complement(join(717088..717368,717418..717707,
                     717784..718220))
                     /locus_tag="TRUGW13939_08795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347817.1"
                     /db_xref="GeneID:55996283"
                     /translation="MSGTSDTSSTQYVDEFISKKYRSGVKTLQRGINGDSNVRENSIR
                     DVKTRTNVEIRKRALETLKLSEEVASRLEVQVDKLFEIASGGLGYIETLHQNPGNQVA
                     RDHLEDISVRLRRFCTDNSYPELFFEGIPERPIKTEEQGHFAKKAFFKPKDEKTKQKW
                     KEEGEKPKYQLLTFQEPKDYGEKKMGIKYTKDFFNKYHTAFLWVYRKEARTQTGRTMP
                     QEICIVAFDYDGKKWWDVFSQSAYDLGEAPSYRLSLGQDGNYSSNQKQISTPTEIKSL
                     PSNLRGEILKEVDDKVKTMQDGFQKTLDELTKTISSLHELVANLTRRQISPISPVEEE
                     L"
     gene            complement(<718663..>719458)
                     /locus_tag="TRUGW13939_08796"
                     /db_xref="GeneID:55996284"
     mRNA            complement(join(<718663..718835,719095..>719458))
                     /locus_tag="TRUGW13939_08796"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491925.1"
                     /db_xref="GeneID:55996284"
     CDS             complement(join(718663..718835,719095..719458))
                     /locus_tag="TRUGW13939_08796"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347818.1"
                     /db_xref="GeneID:55996284"
                     /translation="MWAAEWDAPRVVDILLQHGADVNVRDKLGWMALFWAAKGRAPLV
                     LEVLLQAGADRTVRDTNGLSALLVAETKGTKHAQRMTIVMRRPVFLFPWQDSSLLKLT
                     GLEKTIFTIDWDVKEGWDWARPSCIMFNEVAWPVNTGPLVERPLEGEAGPDPVALGYA
                     GLLDTQGFAAGVTSTLGA"
     gene            <720578..>721743
                     /locus_tag="TRUGW13939_08797"
                     /db_xref="GeneID:55996285"
     mRNA            join(<720578..720994,721039..>721743)
                     /locus_tag="TRUGW13939_08797"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491926.1"
                     /db_xref="GeneID:55996285"
     CDS             join(<720578..720994,721039..721743)
                     /locus_tag="TRUGW13939_08797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347819.1"
                     /db_xref="GeneID:55996285"
                     /translation="TSVSVAPVATTGTTPHPTLPRTTTPSPSLQNSATSVAVFQSAIA
                     SPSVGGQPDGFPNPSVPQLQSIEDQAHGLLIEMEPPHAISQDSLTSLQLMASSELLKV
                     TFFSDLLTNTTNRIEGYEIAESHRQSRLIDALITIRSQEELHGLYANRLLQYSGKNAV
                     SPCSYSFPVSALADAITLGSMLTSINMATLQDVAQRFAKNGDIWLIPIVMSILGQEAE
                     QEGFYRLVEGKLPSELPFLTGGQRDLAFSAIQQYIVPGSCPGQETISLRKFEALELLS
                     QPVAETSIIQLRFTSTASTPKNLTATFINQQNRPVTEPITIRQVNNMEATAEVVFPYG
                     TNEMNGLTILTLTRTMGPFENIDAVVDATVFGPAFIVVE"
     gene            <722682..>723001
                     /locus_tag="TRUGW13939_08798"
                     /db_xref="GeneID:55996286"
     mRNA            join(<722682..722834,722882..>723001)
                     /locus_tag="TRUGW13939_08798"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491927.1"
                     /db_xref="GeneID:55996286"
     CDS             join(722682..722834,722882..723001)
                     /locus_tag="TRUGW13939_08798"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347820.1"
                     /db_xref="GeneID:55996286"
                     /translation="MAKVIQKRRKDDGTCLEDWTDVFEDLNEWPVTFTDFLFQTVLGV
                     SWKGLSCHPFLTSAPGKEVLIPLIKIAQASGKCVLGGQWASTQWGP"
     gene            complement(<725055..>725504)
                     /locus_tag="TRUGW13939_08799"
                     /db_xref="GeneID:55996287"
     mRNA            complement(<725055..>725504)
                     /locus_tag="TRUGW13939_08799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491928.1"
                     /db_xref="GeneID:55996287"
     CDS             complement(725055..725504)
                     /locus_tag="TRUGW13939_08799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347821.1"
                     /db_xref="GeneID:55996287"
                     /translation="MSSKSHETSSDRRANLASLDYKIRNAIGWFFSGFQHLSTVLAEN
                     TGLDVTSDNSSDTDFSRPVSTDNSFMLEANIAAPHVKTISSGLDGGETPGKRDILLER
                     SVPNEEQCFHLPRLRKPLISTINCKRCRSCPLLQIVRPRLWVQQKRG"
     gene            complement(<727299..>728431)
                     /locus_tag="TRUGW13939_08800"
                     /db_xref="GeneID:55996288"
     mRNA            complement(join(<727299..728291,728342..>728431))
                     /locus_tag="TRUGW13939_08800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491929.1"
                     /db_xref="GeneID:55996288"
     CDS             complement(join(727299..728291,728342..728431))
                     /locus_tag="TRUGW13939_08800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347822.1"
                     /db_xref="GeneID:55996288"
                     /translation="MAADPPEPYSLSVVKRSRTAPSTDSPGTQPKMSPRWLFYSLKTI
                     YLFPRDDVATMIIPVTCLGTCAALSLHTRPLLLWETLCRIPLAVLWVWLNVLLFSISN
                     QRSEAAMLEDAINKPWRPLPSGRITSTQARRLLFVGIPVVIALSYCFLGAVEETMICL
                     LLTWMYNDLGGADEHFLLRNGVNSAAYFSYGCGTLRIAGGLTLHSAWHNGVLKYWLGM
                     ASAIILTTLHVQDLKDQEGDRARDRSTVPLAVGDSLARWTITVGVLVWSILAPMYWLY
                     WAPNVLPDRRIQSPAATIPCILAILVSLRVILWRDRRSDRSTYRYWSVWLMSIFALPL
                     LAAMDPELQSTILHKQWPAKLEALMA"
     gene            <728941..>730251
                     /locus_tag="TRUGW13939_08801"
                     /db_xref="GeneID:55996289"
     mRNA            <728941..>730251
                     /locus_tag="TRUGW13939_08801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491930.1"
                     /db_xref="GeneID:55996289"
     CDS             728941..730251
                     /locus_tag="TRUGW13939_08801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347823.1"
                     /db_xref="GeneID:55996289"
                     /translation="MYASHILFTSICVAYVVLIRRLRFRRAAHHARLVADSSNLDNEE
                     MPLPVAQEIYDSLMHAEFPFWIWKGIEMGLFRTYAIPTISAQLAKTSRLLPPKLPRRY
                     VETQVLFLEFTLRKWGTVPWLQAMARTRAIHAGYRESGAVREEDMLYTLAALATTPVL
                     LVEKLEWRSLSDVELAAIGTLYRAIADALEIDYSLYLASWTPGEQRTSIVGLDFYHAL
                     HRWQVRHEIRHMVYMPQNELLCEAAVDMLLWAIPGKPLKRFVTTALTSVMDDLLREAV
                     GFPPTPFWIAHTTYAVLDIRKFCLRYLCPPRPDFLKIQWCDSDPSSIQCAFAVDKSFC
                     RHGRPDKEFAGSCRTDPPRTGMTTYVAAPFFVKPTFRNRWLSPKAWWWWALRLPIPGD
                     KPVVHKAGGYTIPDLGPRGLGCMDAAQEKEEAKVETVGLAKGWW"
     gene            <731752..>733200
                     /locus_tag="TRUGW13939_08802"
                     /db_xref="GeneID:55996290"
     mRNA            <731752..>733200
                     /locus_tag="TRUGW13939_08802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491931.1"
                     /db_xref="GeneID:55996290"
     CDS             731752..733200
                     /locus_tag="TRUGW13939_08802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347824.1"
                     /db_xref="GeneID:55996290"
                     /translation="MEVRFSSKDQIRAWHSELRGSFDSGITLDVKFRKRELQQLTYLL
                     QDNVEQITEAIRKDLGRSHFESVFAEIMVTTNLAIEAYTNVDAWSKSQSRWAGLVWAL
                     HSPTEHKEPKGTVLIIGAWNYPISVQIGPLIGALCAGCTAILKPSEIAFHSAQLLAKL
                     WPQYMDSRMSRVITGGVEETTELLDLRWEHIFYTGNSRVGKIVAEKAARGLCPTTLEL
                     GGKSPVFIHESANLSIAAHRLMWAKSINCGQTCIAPDYVLCNKHLQDQLIEELRKAYI
                     KFWPNGARLSKDYGRIINDQQFSRLEHIVENTKGSIIIGGKRDAKTRFLEPTVIKDPP
                     SDDISMSEEIFGPILPIITVDGVDEGCAFVNGRDQPLALYIFAKRKISDFIIHKTKSG
                     GVVQGDLMVHYVVCPLSFGGIGLSGYGAYHGRAGFETFSHTRSSIHAPATGMLGRAVE
                     WLMASRYPPYSDLKLKLLTMLLGKNRPFGRPS"
     gene            complement(<739337..>740463)
                     /locus_tag="TRUGW13939_08803"
                     /db_xref="GeneID:55996291"
     mRNA            complement(join(<739337..740093,740148..740181,
                     740232..>740463))
                     /locus_tag="TRUGW13939_08803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491932.1"
                     /db_xref="GeneID:55996291"
     CDS             complement(join(739337..740093,740148..740181,
                     740232..740463))
                     /locus_tag="TRUGW13939_08803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347825.1"
                     /db_xref="GeneID:55996291"
                     /translation="MDTSNGVTFFPFQPTPSNQVSIVDVFFPGFGTVFSSMQHLLAGN
                     LDIYVRLLGFCGMLTFLGRCGFRYLTEFVETYFTSTVTVSQNDEASSLASVGSRKRRV
                     YAADKSNTHKKKALVYTPWNGSVYFWYKNHLLRLSCRVKEGVFNQQEVLRLSCFGRSP
                     RIVKELLEEGRTEYLKSTQNMTSVFENENGEWRKATSRNIRPISTVIMNEGDKKALVE
                     DIQDFLSEETRNWYARRGIQYKRGFLWYGPPGTGKSSFSFSIAGQFELDIYLLIIPKV
                     DDSRLTSLFAKLPPHCIVLLEDVDGVGTARTEGPEKPKTLSESSTPRKETNILGSCRC
                     LGFSTL"
     gene            complement(<741812..>742757)
                     /locus_tag="TRUGW13939_08804"
                     /db_xref="GeneID:55996292"
     mRNA            complement(join(<741812..741931,741979..742181,
                     742244..>742757))
                     /locus_tag="TRUGW13939_08804"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491933.1"
                     /db_xref="GeneID:55996292"
     CDS             complement(join(741812..741931,741979..742181,
                     742244..742757))
                     /locus_tag="TRUGW13939_08804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347826.1"
                     /db_xref="GeneID:55996292"
                     /translation="MASDTQIASRIMDPDRMHLHLREGTPWSEHRQRYDIELNQWVTV
                     AQDDALDVVDIRKLAASHNDIEIQNIIHTKLHHANILRYSGVFREKTAYYLISEHVEI
                     RVEDIRTTIHLVDEKQLAAIALQVRACYCRFVEPIMNITGPQWDRFSLVTAPGIGKSR
                     LFHHWGDMGWRLNPESCVPVDSDVMTPDIRRLGHVMTQLMNPVQPEAGVWVPSGNWSQ
                     NAERFVSRLMESADLPASLIQDPFLETTRREELAWIVPITLRMTWTPYRITEWHGHET
                     PW"
     gene            <742950..>746308
                     /locus_tag="TRUGW13939_08805"
                     /db_xref="GeneID:55996293"
     mRNA            join(<742950..743355,743408..743724,743783..>746308)
                     /locus_tag="TRUGW13939_08805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491934.1"
                     /db_xref="GeneID:55996293"
     CDS             join(742950..743355,743408..743724,743783..746308)
                     /locus_tag="TRUGW13939_08805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347827.1"
                     /db_xref="GeneID:55996293"
                     /translation="MQRTVDDLDVTAPQRRIAHYRGAARVSLDILEYDGKRLQPSDSH
                     YASIFQEIQEKRSYSEHRIPAIVDSCTFEAAIGLSGTSRESLLATPQLHLPFLHLPGE
                     TYLECLRIPSDVLAAIQALPGDDAWWGVDLFVADTDETLRRALCVQFTKSPGISDGEI
                     YLKVRHYQDRYAQTRDLEDRASEVYWWAQLSYNKQENLQRLFATSKSDYFRAFDALRV
                     IPGLWPGFQISALKTILYLGAKKEILNYVGTILHTWATILDGRRDWMRDTDYNTVQLL
                     QSRVPARCADDCRVLEECDHQLFSGIRDQQNRNRIWENLRRIDNLIPSWYTFFEDANY
                     FAICARVMKRLLVNSGGRISSIRHRLRTIYDGSNQEEGLVRLQVDEGSFYTYRGDRNT
                     QIRLGTVQLWLFVWRHWTSLAVQCPRKEGRQPTPVPTPPNEYMWSQLASLAFELGFNA
                     PEIERLRNLAVEPPPAREDTSAAPDLSLYLSGAGEGIRRRCGRPFADAQNFVRPAFFL
                     GIMLPTTAEGGRGISPLFVRVSMFQAFFSSLLHNGLDGLVRINSHLQHFPRVVDGLNQ
                     SPDQGRMYRLQRENDDLREEILRLQTVEQTFYDSVEQLQQAEQRVIDVTAANDEVRAR
                     NHSLVEQVGNLSGVTGQSLLEGRIAALDQDPIFGRGNESALTRCSACEVKDTELRNLR
                     ATVSRHTEQDRCILELQAELSRSQQCEADLRVDLSSLQRENLETQNQARMWEEQNAIR
                     LSSLQRLAAEQGRAQDQVTALRAQKRHLEIKISRLECGETTHKRRRLLRSSSSLHLRG
                     GQDRLAQANLEGRRLGTIEDPERESERANMSEMSSLFHQQDPTPGPATGPLPTQSVLV
                     PNSRRDLGELSFSSRVVADQMYGSRAIESQVDGKHTTSTNTELQPNPVGHADNDRFEL
                     QRMLTRRHPSRPSSCSTNSHDDWLQNQNAEVTHGTSATSPLKRWGVIWPEGHLPIIIR
                     SITTVRGHPRVVDQTLQLDRSDLEKICEKYIQKGFLLFSETGKALHPCRIWDAVKTCG
                     LMAILLIPRSEIVTRERERERSMLVWDSGLFTAMNESPICAVSAHHGQYTDD"
     gene            <746792..>748369
                     /locus_tag="TRUGW13939_08806"
                     /db_xref="GeneID:55996294"
     mRNA            join(<746792..746977,747027..747915,747971..748032,
                     748078..748198,748266..>748369)
                     /locus_tag="TRUGW13939_08806"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491935.1"
                     /db_xref="GeneID:55996294"
     CDS             join(746792..746977,747027..747915,747971..748032,
                     748078..748198,748266..748369)
                     /locus_tag="TRUGW13939_08806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347828.1"
                     /db_xref="GeneID:55996294"
                     /translation="MSVINFIPLAVGSHANFATNSRISPRTYLQFHQWLGIIAILEGL
                     LHSIALAFSGWVGVSPVVGGITLVVIFITSRVSVQRRFYEVFLKAHVLLAFILVSAIF
                     YHVRPTVVYALSPILAWLVMRLMRAANILHRQIRAGAHGHEATILDLGGAFLVCVKLS
                     RPWDFQPGQYVYLTLPNLSRSSQLHTRSRWSLVERFTEPLQSHPFMIAWWHRSRDDCS
                     QGGYQQPDTVVLIVEKCKGFSEKLARGSAGDIVNVKERLQIHTWSKERSTEESPAPEP
                     VAAGFPDITCWCSQVESTSGQIAIIEGPYGRSLDLGMYDRVLLFATGVGVAAQIPYLK
                     KMLEDFPERRRPQRIALYWETIDSNQVGWALDWISRLLAMDERDHLLIQIFLKDGSSS
                     QDGKKLKCITRTFDEKMVAEEIQSHSGPCVREDVGDMIQKVILQSLRPDIHFRELSFR
                     PST"
     gene            complement(<748636..>748896)
                     /locus_tag="TRUGW13939_08807"
                     /db_xref="GeneID:55996295"
     mRNA            complement(<748636..>748896)
                     /locus_tag="TRUGW13939_08807"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491936.1"
                     /db_xref="GeneID:55996295"
     CDS             complement(748636..748896)
                     /locus_tag="TRUGW13939_08807"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347829.1"
                     /db_xref="GeneID:55996295"
                     /translation="MATEAPIHPAQDLLLEKDNEAATTVIWPTEQEEVLLERQSRQGT
                     FNVQSDLLRRLAAAENALLDGNVSVDIDRLKRDAVEALAKIL"
     gene            complement(<749389..>749939)
                     /locus_tag="TRUGW13939_08808"
                     /db_xref="GeneID:55996296"
     mRNA            complement(join(<749389..749831,749888..>749939))
                     /locus_tag="TRUGW13939_08808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491937.1"
                     /db_xref="GeneID:55996296"
     CDS             complement(join(749389..749831,749888..749939))
                     /locus_tag="TRUGW13939_08808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347830.1"
                     /db_xref="GeneID:55996296"
                     /translation="MEPGDSVSPRHMSDSMRQEKRLAKIEKRLADAEQTLQSLVPVSQ
                     RSAPPPPNNTNGGPSFGSNDDRAVRLSEPCESDTYSDSQRTSHDPRRLMTFAGPAGPS
                     QTTSPMAGDTAPAQHSATTHEYHFDQCLSCGNKLDCYTYPVEKDYGSGQTGDLRHLFN
                     VLGP"
     gene            complement(<751085..>751877)
                     /locus_tag="TRUGW13939_08809"
                     /db_xref="GeneID:55996297"
     mRNA            complement(join(<751085..751465,751526..751752,
                     751799..>751877))
                     /locus_tag="TRUGW13939_08809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491938.1"
                     /db_xref="GeneID:55996297"
     CDS             complement(join(751085..751465,751526..751752,
                     751799..751877))
                     /locus_tag="TRUGW13939_08809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347831.1"
                     /db_xref="GeneID:55996297"
                     /translation="MGCNKTFSQNRSKAKQECREQMSQSLQKALGISVDPDRVRLKTD
                     KTDDPYYWDGPDDWADVLSENLSTLSNANLESLKDIVNKGIIHPRWKSQRGNLTGGDN
                     TDLPYEFKMKDLQSINGKQQEEIARLREQCGDAAKRISEGEKRENELQNNVEKLIQEK
                     EQFEKQVSYMQDGLRQAQITTEHYRMCNVECYSRAAEMLKVIDSSGLGRVQDPAFQGD
                     TGDPFYFSNS"
     gene            <757756..>760785
                     /locus_tag="TRUGW13939_08810"
                     /db_xref="GeneID:55996298"
     mRNA            <757756..>760785
                     /locus_tag="TRUGW13939_08810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491939.1"
                     /db_xref="GeneID:55996298"
     CDS             757756..760785
                     /locus_tag="TRUGW13939_08810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347832.1"
                     /db_xref="GeneID:55996298"
                     /translation="MSGIQTRSRSRDGGTDDPILNTPTRSPSRGRGRRGSAGVSRGSS
                     TGRSGRGSSSGRGRGRANIPSQESPQASQGPDGAESNESAQQAVNESSNPQFPLRHDS
                     TQRDTTQLPPIAEEPQTENPSDGQTAVPVTTESTISTPRREIRVPGGFSEWALSPVAE
                     ITLNPQSSASQAESPASSHPGQSSTSRNDQSPMTENPLDRQAAVTTESTTSTSRQETR
                     VRFSEETTGRTSPRQVESETFTQSTDSTTSFHSDVVDPEIRANVNSMSREARWQLRDR
                     LLSELFHISLIFQQVYVPELQTLQAIQDIENFNLRGWLNDFEEYHHGQDPGTLNRLLS
                     RGMWSENSHSLDIQGSDIVALRESQTLDELYRPLAAMILLFPSLDEEQCRQTINDFNT
                     RRPQDGSNAFCPNAWLPINRLWARARANPLKDALAEDAWGYISTYHNYHMMTSAFHSS
                     ILGRAAGLTLPLPLVTNPSDDDGGNRPSQDITNEVGSRSPSPGSEDTHSVQEPPTRPQ
                     SRRGLQPPRDAGGTSSPSQQGNPTPQNSSRRSRPQWPRERSRERPTERPRERLNTNSG
                     QERRHQTAAPRRADSWGPGYEPTRGELVSGWVKWCEEWWEIDQYRPIGSGYQINVKRP
                     AANGYMEYRMIPAHLVGGKAGGRAIIEEFTEEALDQGRREADLLFSEGSIDKLIEASR
                     QHTRIVGVSIHCRDVKGGYPYLNRNYMWVILQFPDDEGWYTTSHVREYLSEQFLQAEL
                     EDYHKEADLIPFAFIPDPTRCRYTSRDPTPGHAYSRPQIDPVYGPAMVHERHTRDTTG
                     RRAQAPGRRRSVIESDIEDDDIDATPFPRRTRDTTGRRRRAQQIDPVHGAPPRRTRLS
                     RRRHNRAPTRRESVIESGAEDNDIEASVHFTPPRRTGDTGRRRRAQAPTRGESVIESD
                     IEDDGIEASVHFAPPRRTGDTGRRRRAQAPTREESAADGEIREIMDFLQDGLRYRRTY
                     QTPPPETGQESPTAGISGQADDDLLRNLAEQMRRLHR"
     gene            <761803..>762087
                     /locus_tag="TRUGW13939_08811"
                     /db_xref="GeneID:55996299"
     mRNA            <761803..>762087
                     /locus_tag="TRUGW13939_08811"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491940.1"
                     /db_xref="GeneID:55996299"
     CDS             761803..762087
                     /locus_tag="TRUGW13939_08811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347833.1"
                     /db_xref="GeneID:55996299"
                     /translation="MANQRRQCVVKIEVTLVLVARQLFQDPLPIKQSVRGDPSPPAAT
                     AGSPQTTAATSCSPHTECWHCAADPWNLHSGEAGSALTRSHGTAEGMLMR"
     gene            complement(<762607..>763404)
                     /locus_tag="TRUGW13939_08812"
                     /db_xref="GeneID:55996300"
     mRNA            complement(join(<762607..762852,762934..763084,
                     763151..763249,763319..>763404))
                     /locus_tag="TRUGW13939_08812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491941.1"
                     /db_xref="GeneID:55996300"
     CDS             complement(join(762607..762852,762934..763084,
                     763151..763249,763319..763404))
                     /locus_tag="TRUGW13939_08812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347834.1"
                     /db_xref="GeneID:55996300"
                     /translation="MSRLSTTHKYHSPAPSSLVSPQLQYHVLSLTLQTISIQIFSALP
                     CCSCVLPAAVPLLKKSLSTIATMSAPDDANHRMHGWWVRLRVRQMPPAPADCAVWDYP
                     QSVEFAVLTAFLSWLVFLQGLINEIRDVGLFPEEGQDWLLDFNELARLLYITMSNQDQ
                     IAFEDVLERFVENLGSFGTLSLGFLAPGHKPRL"
     gene            <763732..>764004
                     /locus_tag="TRUGW13939_08813"
                     /db_xref="GeneID:55996301"
     mRNA            join(<763732..763766,763818..>764004)
                     /locus_tag="TRUGW13939_08813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491942.1"
                     /db_xref="GeneID:55996301"
     CDS             join(763732..763766,763818..764004)
                     /locus_tag="TRUGW13939_08813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347835.1"
                     /db_xref="GeneID:55996301"
                     /translation="MEELQRRLHEEWAEWQNSHPEGFIATPKEPSENGRIYWECRIPG
                     PPNTSWVTRLFLVHLTFPRDYPTSPPQCE"
     gene            complement(<765706..>766344)
                     /locus_tag="TRUGW13939_08814"
                     /db_xref="GeneID:55996302"
     mRNA            complement(join(<765706..766092,766144..>766344))
                     /locus_tag="TRUGW13939_08814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491943.1"
                     /db_xref="GeneID:55996302"
     CDS             complement(join(765706..766092,766144..766344))
                     /locus_tag="TRUGW13939_08814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347836.1"
                     /db_xref="GeneID:55996302"
                     /translation="MPTKPKSRKDRNAQERKRGFGVIGKAHQYAKICNSEIAVFERSN
                     EGKWRTYISMRHPDSSWPRMEQIQAQDPQALHLLPEDLDDRGKRKRKQPEQDDGEAAS
                     TKRHVSRRPTDMSLQESTISEDTLDDQDSLSDNTKKNPTTDGFFYTLPEPPSFQQISN
                     IVYGEEERHRFFAYGDVQADPDILDVVQFMGSLVR"
     gene            complement(<767266..>767819)
                     /locus_tag="TRUGW13939_08815"
                     /db_xref="GeneID:55996303"
     mRNA            complement(join(<767266..767642,767735..>767819))
                     /locus_tag="TRUGW13939_08815"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491944.1"
                     /db_xref="GeneID:55996303"
     CDS             complement(join(767266..767642,767735..767819))
                     /locus_tag="TRUGW13939_08815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347837.1"
                     /db_xref="GeneID:55996303"
                     /translation="MDGTGKSSSANFTISTRNSGGILKLKFDVENYIWMECLGGREEM
                     DLQYPQLARIGSSESVLEFYQHIRETVISLFQYDISEDGAIVAFAHANASRPRDATNE
                     FHPNFWLPHVRLYRTVPREGKELVKGKMIMYINTYHNHPIMLDVKRSLRMF"
     gene            <769260..>769985
                     /locus_tag="TRUGW13939_08816"
                     /db_xref="GeneID:55996304"
     mRNA            <769260..>769985
                     /locus_tag="TRUGW13939_08816"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491945.1"
                     /db_xref="GeneID:55996304"
     CDS             769260..769985
                     /locus_tag="TRUGW13939_08816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347838.1"
                     /db_xref="GeneID:55996304"
                     /translation="MDEELSNMTTAALIKKSFLIHRSFLSDAIPAIASGIGGAATGIA
                     GEAASAVTAAPSELHEAASALQTVASDVKTAAENQIETIVNKTESVLAEDVQQAINKF
                     IPANISVGTKEVCLGYVDGPGACHPLSTGANLIIAGLVFFILLTLIIACLIFFLPWLH
                     IFTRLGLCITMVFSCVAIFLTLTVAVFTVRSLAGELSKHSHGLLSIQSGGLGGYCVGI
                     LICILLASAVGMFGLHKENDGAR"
     gene            <776583..>778227
                     /locus_tag="TRUGW13939_08817"
                     /db_xref="GeneID:55996305"
     mRNA            join(<776583..776852,776920..>778227)
                     /locus_tag="TRUGW13939_08817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491946.1"
                     /db_xref="GeneID:55996305"
     CDS             join(776583..776852,776920..778227)
                     /locus_tag="TRUGW13939_08817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347839.1"
                     /db_xref="GeneID:55996305"
                     /translation="MEDSVTLTSRETISLDSLSEYDGPSSDLTTWDGVNDPENPQNWF
                     ARRKLWVSLVFSTMTFCYVMSSSGFSGMAPALVEEFRVSSTVGNLSGATIGSTIWGPL
                     SECYGRRIPILLGFCGFTACQVHVAAASNITILLIYRTFCGFFGTASTIIAGGALADI
                     WRLSSRGTAVIIFTICQFIALILGPIFGAYISYSHLHWRWAVWIPTIISAVLLLAAFC
                     SLPETYGPRILQQRARRFRMRTKKWAIHSQLDEQEADHSWKRYLLQPVSMLVHEIILF
                     LIAIYLSFIYGLVFLLCEAFPFVFAHVRQWSSENATLSLISIGMGVALGSFLMLWANH
                     IFNQKAQQHASDLGHLAVSIHQIAEDRLLPMASGGIVLSLGFFWFAATSNLHVTWVAQ
                     DVAGIFIGCGIFIIFLQGLNYLVDVYMHKVNSAFAATNILRSIVATVTPLIALPMFRT
                     LGAPWASAMLGFLSLILVPVPVFLHRYGKKIRTKNSVLLKMPEVTHPATRYTKTTIIS
                     PPLQSVHPSSAHHTTMI"
     gene            <782551..>783242
                     /locus_tag="TRUGW13939_08818"
                     /db_xref="GeneID:55996306"
     mRNA            join(<782551..782777,783185..>783242)
                     /locus_tag="TRUGW13939_08818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491947.1"
                     /db_xref="GeneID:55996306"
     CDS             join(782551..782777,783185..783242)
                     /locus_tag="TRUGW13939_08818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347840.1"
                     /db_xref="GeneID:55996306"
                     /translation="MASNAVPSPCVSTLLPTLASITPEPIGIVEIQVDMPSEEIRVVV
                     DDQVAPDIKILPTTPDVFGARPSDSRGHFHRRLVQGSNFTIVGQNSAQSV"
     gene            complement(<783420..>784628)
                     /locus_tag="TRUGW13939_08819"
                     /db_xref="GeneID:55996307"
     mRNA            complement(<783420..>784628)
                     /locus_tag="TRUGW13939_08819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491948.1"
                     /db_xref="GeneID:55996307"
     CDS             complement(783420..784628)
                     /locus_tag="TRUGW13939_08819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347841.1"
                     /db_xref="GeneID:55996307"
                     /translation="MEWKRLGVRISIWIVLQFGILTAGAAPQLSLSIVNNLPGDASVN
                     AYITGLDSGNRLVLLQPDGTWYRPDAATQSSTPTRIATDVAIPLGPYRSVSVVDIPGY
                     VTGGRIWFVVGTLTFSTVLDANGLVTLVEPSVTDPSNPNIGMQWGFIELTYSETDGLF
                     ANISYVDFVSLALGLSLQSADGSKQMARGLPAHAARLICDSLQMQARIDGQPWDQLCV
                     MDAAGDVIRVLSPANYVSKQPTAFNDYYRDYVDQFWMTYSHGLLTLNTDNAAGVIECT
                     VSDALLTCSGDNFGYSKPSTADIFGCSSGPFAIGDGDNEIHRAVVPILCAAFTRTTLL
                     SDDGNIEPQLDSTSYYTTSPSNYYSKIVHDYEVDGKGYAFPYDDVGKGQAGLVSSTSP
                     KLLTITVGGP"
     gene            complement(<786868..>787604)
                     /locus_tag="TRUGW13939_08820"
                     /db_xref="GeneID:55996308"
     mRNA            complement(join(<786868..787266,787320..>787604))
                     /locus_tag="TRUGW13939_08820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491949.1"
                     /db_xref="GeneID:55996308"
     CDS             complement(join(<786868..787266,787320..787604))
                     /locus_tag="TRUGW13939_08820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347842.1"
                     /db_xref="GeneID:55996308"
                     /translation="MPMKRSLLLPYFVLLIFATIQLALVSRMVAFLHIQKTQVKTYQA
                     LGSDSPLGFKIHVLPEKLSLNQGHTTNGAAGYGLVLSIALLAFTFSFRDDRDHTKKLL
                     TMTILLALLSFFILSAFIYVFAVTYLTSNNRINTIYAQSIDGAPYPIDSWTPETWYKA
                     LLLLPLTNVDLTGAYQEMAVWRWWIIPYLIVSMLAFGWTAIVWLNERSFKQPKSNLAV
                     SMYTCVISLS"
     gene            <791410..>792507
                     /locus_tag="TRUGW13939_08822"
                     /db_xref="GeneID:55996309"
     mRNA            join(<791410..791757,791806..>792507)
                     /locus_tag="TRUGW13939_08822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491950.1"
                     /db_xref="GeneID:55996309"
     CDS             join(791410..791757,791806..792507)
                     /locus_tag="TRUGW13939_08822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347843.1"
                     /db_xref="GeneID:55996309"
                     /translation="MRLQPALFPALLPLGAVCFYWTSGTETSPADRRSNFSPSQISSI
                     EQEAHGMLPNAALPSSISQDSLISLQLIAFNEIFEVAFFTELLFNLTNNVDGYELSDD
                     NGESIIESILTIQNQEELHALQANQLLEYFGTNPIQPCNYSFPVSNLREAIWHASLFT
                     SVNLGTMQDVTRIFADSGDTSLIQVLTSIIGQEGEQEGFFRIIQQKLPSEVPFLTASV
                     REFTFTALRSHVIPGSCSHLDAIHLKTFAPLNLITTPVAETEIIQFSYPNQTYYGDLF
                     AVYINQQNLPIVEAIGVNDVKDYAVNAEALFPYNANEMNGLTIMTLTNSPGPFIDARE
                     VAKSTLFGPAFIIVN"
     gene            <793645..>794495
                     /locus_tag="TRUGW13939_08823"
                     /db_xref="GeneID:55996310"
     mRNA            join(<793645..794307,794364..>794495)
                     /locus_tag="TRUGW13939_08823"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491951.1"
                     /db_xref="GeneID:55996310"
     CDS             join(793645..794307,794364..794495)
                     /locus_tag="TRUGW13939_08823"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347844.1"
                     /db_xref="GeneID:55996310"
                     /translation="MPAATRAAVGRSATRTPDPDNPPSSPPEIQRSRSGREVRRPGHL
                     SEEQERNAENKATHLKHKRNVPTATLRGQPITELRDPNQARDANQTETQRLLLELVDL
                     REELLNRDTQHQEELLRRDTQHQRELQKLGEALATTQRELEEIKGHITSTNPSACSYE
                     GHSEIIQELQSLRSAITTPATASDEPSWAAVVANGNKTQSILWNTTPGGRKRQAKETN
                     CIRDKPTAQSGDYSNPESALQRTGNTGHPGPWGRNHKNGILDPIPK"
     gene            <800005..>804404
                     /locus_tag="TRUGW13939_08824"
                     /db_xref="GeneID:55996311"
     mRNA            join(<800005..802095,802191..802266,802348..802857,
                     802918..804067,804119..>804404)
                     /locus_tag="TRUGW13939_08824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491952.1"
                     /db_xref="GeneID:55996311"
     CDS             join(800005..802095,802191..802266,802348..802857,
                     802918..804067,804119..804404)
                     /locus_tag="TRUGW13939_08824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347845.1"
                     /db_xref="GeneID:55996311"
                     /translation="MNEEYTNVDIPRVCHRWTPNTVSSVNSSSIPKISDGLSLQTLFA
                     DCDSQGLETAINHGINVLDRLREPLSQLSDVDRSQWLQPLEYLQKQAVRPKIIIGVVG
                     NTGAGKSSVINAVLDEERLVPTSCMRACTAVVTEISYNYEETPYRAEVEFITATDWAK
                     ELRILFDDLLDGKGNISREASTQETDAGIAYAKIKSVYPKYTKNQLENSTVSELIEHP
                     NVKKVLGRIESVVETNPKIFYRNLQTYVDSREKITGEKDATEKPFLDIEVWPLIKVVR
                     IYVKATALSTGMVIVDLPGAHDSNPARASISKSYIKQCTGLWIVAPITRAVDDKAAKC
                     LLGGTFKRQLKMDGGLNSVTFICSKTDDISLLECQDCLGLEERMSALRNKADEHSEKK
                     HGNRQYLDRLEKAMSEWAAAADEIDENVEMWETLKEEIADGKAVYAPSRPCSKKRKRV
                     SNGNISKTSWDYILNDYRADGDTGYEVDEHQGQSPTYSNPLTAGEVDRRLLELRARKK
                     ENRHHRQDLKIETETVLRRISDIEIVMAHIQAELNGLAISGRNEYARCAIRKDFAAGI
                     KELDQELAEEADSSSFNPDADDRDYEEVARSLPVFCISSRAYQKLQGRLELEPTIPGF
                     QAHEDTEVPQLQAHCKKLTEAIRDANSRCFLNNLDQLLNSLRLTSSADGNQTSDEEKT
                     NWANTIETHYKVLYADLEELILDMCQRFRNTIQCNIFTVYEDAVEAAVNKADEIVKRW
                     GGRVNTDNRAAGGFFWSTYKAICRRDGVYTNAEGIHDWNAELTEPVLKVVASGWERTF
                     SRRAQSLFLSTASEGARLLQSFHDSIHHTDSHTTNRLGNHVLSQQLRVYQQLVKGLCL
                     EDLTMVIRRSKEISRMFQPVVAEKIKPAYANCTVLSGPGSFNQMKEVMSCFVDQAKST
                     MFHRSIETVQKALDELVRSLEDSMIIKVGEMLISVKRDYTSTLGGNQSTASKCLFRSI
                     LNIITDSESDFRRLANKELEGDMTTVDTEFSPTSPHFSPSSPNYSPSSPNFGPTSTSF
                     NSRSPTYNPTSPTISNSRQHSHSPKYSPKSPVRSSTSSEISDFTIGVGSNEERQLALP
                     SEAETARFRLLRSLLNQPIYDEELREIYQIGDRIVSDTAFVLNDLKGWLWKDFQQHGI
                     LLPSCHNLPSAKISTSMFRFLMETNNDRQRKSVYRRLARVLFFIFVKNYVEQLEKREA
                     NGEFIDRHHRNLISIAHTTILQEVGDLSVNGKECAQKQISDSKSYGKRWWKLGSGIGI
                     IAILAGGPDVARYMESRGFSNSSLELLVNYMRHAYRNAIAYFQSLDAVIQTLFAKASL
                     TTNHIIEWAGQIDPLHLQFNAPPERTEWVDTQTMMNTATTSLLYYFEHYD"
     gene            <804977..>808045
                     /locus_tag="TRUGW13939_08825"
                     /db_xref="GeneID:55996312"
     mRNA            <804977..>808045
                     /locus_tag="TRUGW13939_08825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491953.1"
                     /db_xref="GeneID:55996312"
     CDS             804977..808045
                     /locus_tag="TRUGW13939_08825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347846.1"
                     /db_xref="GeneID:55996312"
                     /translation="MSAGRVTRSTSRGSGDDNPIPDTPTRNSSRGQGATGRGRRGSSS
                     TRTGRGGANQPSQESTQASQSPDRAEINDVNPESAQQEDLPQPPGNDSTQREPTFQLP
                     PIAEEPQTENPSDGQTNVPVTTDSTTSTPRREIAVPGAFSEWTTPPQVVEIPLSPQDS
                     ESQGEGSASTQPGQSSTSRNDQTPVTGNPSNVQTTVPVTSESTASTSGQETRVRFLEG
                     SAAPQVAEIPPNPPGSIPQVEGPSSTQPGQPSTNRSSTPLHGEIVDIEIRDNVNRMSR
                     EERRQVRDRLLSELFHMQPILRFRYVPELQTLRAIQNVENFDLDGWLAEFQDYYQNQS
                     PSNLNLLLSRGALSDNSYNLDLQGSDVVALRESQTLDRLYRPLAAMVLVFPSLDEEQF
                     RRTIDYFNIHRPQDRSNKFCASAWLYLNRLWTRSDANPLEESIAEHAWDYILTYHNYP
                     VMTSAFRSSILGRAAGLTLPLPLVTNPSDDDGGNRPSQDIANEVGSRSPSPSSEDTHS
                     VQEPLTRPPSRRGLQPPRDAGGTSSPSQQGNSGRRSRPQWPRERSRERPTERPRERLN
                     TNSGQERRHQTAAPRRADSWGPGYEPTRGELVSGWVKWCEEWWEIDQYRPIGSGYQIN
                     VKRPAANGYMEYRMIPAHLVGGKAGGRAIIEEFTEEALDQGRREADLLFSEGSIDKLI
                     EASRQHTRIVGVSIHCRDVKGGYPYLNRNYMWVILQFPDDEGWYTTSHVREYLSEQFL
                     QAELEDYHKEADLIPFAFIPDPTRCRYTSRDPTPGHAYSRPQIDPVYGPAMVHERHTR
                     DTTGRRAQAPGRRRSVIESDIEDDDIEAMPPPRRTRETTGRCRRAQQIDPVHGAPRRT
                     RPGRRHHNVVPTGRDWVIESDIEDDGIEASVHFTPPRRTDHLRRAQESDLEDMVPQPR
                     TGGTGRRRRRRATREEPAAEDGINELADFLRGVRDELRRQRTSQTPPPAAEGELDEIV
                     DFLQDQMGPPRTYQTPPPETGQESPTAGISGQADDDLLRNLAEQMRRLHR"
     gene            complement(<808396..>809963)
                     /locus_tag="TRUGW13939_08826"
                     /db_xref="GeneID:55996313"
     mRNA            complement(join(<808396..808968,809019..809710,
                     809762..>809963))
                     /locus_tag="TRUGW13939_08826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491954.1"
                     /db_xref="GeneID:55996313"
     CDS             complement(join(808396..808968,809019..809710,
                     809762..809963))
                     /locus_tag="TRUGW13939_08826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347847.1"
                     /db_xref="GeneID:55996313"
                     /translation="MVLRIAIVGSGISGLAAFWALRLTEHDVHLYERSDCLGGCEQVF
                     SWSDEEEKALIDPTLTLYNPTSHPNLAAWLSYLQIPTIPVHYTFGVENESTGFGWSST
                     SLWRLFSRNIFLMCRMLYDIWRFHLTTVDLTNPFHPRWFDSIGVFLRREKYSHIFCDN
                     YLIPLIASTWIQDPRCILSMPTGAVVSYLRRHRFQPFFARSFLWRSVEGGAKRYIEAI
                     FDNTDDCQVHRATRVHRILHEGSRLRLQVENGPTSDFDHVILATGPANALQVLDATNE
                     ERKVLEKFRTTTHTVFLHSDVKFLPPTREIWAFRNYRIHRSYSDALSELYSGSTTTYI
                     NYVQNEKGGDTKPLLLTTDPEVPPQESEVQCTFMYDGPVYDKDSIVAQREMKYIQGSR
                     NIWFTSSSLAHGLSEDGFCQGIEVARIICPELTVSLPFKFRGRHEKGGNEINAPRGRH
                     FGSIWQSVLHYMLVCYSWWHKLYRIWSRISDGERMWKR"
     gene            <812839..>813773
                     /locus_tag="TRUGW13939_08827"
                     /db_xref="GeneID:55996314"
     mRNA            join(<812839..813071,813128..>813773)
                     /locus_tag="TRUGW13939_08827"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491955.1"
                     /db_xref="GeneID:55996314"
     CDS             join(812839..813071,813128..813773)
                     /locus_tag="TRUGW13939_08827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347848.1"
                     /db_xref="GeneID:55996314"
                     /translation="MPQTLRPLDYGCTDWRISSQRAADLYSSSARLWTKKDLEDIEQQ
                     LRQSYAMERFSVRRIDGSIIQISNPMFKVQNPIWKPHVKYQEYWQLVKAQPNGPIETY
                     LCSYIVDWSNQTARNFRELIAQPMQVFDEKHLLWKNSKTWKLLAALVQDVLGTNTVKK
                     VLCFGLGDFCRTAPEWLKKQHDSWDENSEVKNVMSCMIQHSMALTIAQLCRGNETLPL
                     LAQDPEYTEVAEDILTKKEFKIVGTHGAGGFAEIDKASIIISPFAAAPVKQIIADLAQ
                     PVLIISTGFEVFNSNE"
     gene            <817128..>819377
                     /locus_tag="TRUGW13939_08828"
                     /db_xref="GeneID:55996315"
     mRNA            join(<817128..819179,819231..>819377)
                     /locus_tag="TRUGW13939_08828"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491956.1"
                     /db_xref="GeneID:55996315"
     CDS             join(817128..819179,819231..819377)
                     /locus_tag="TRUGW13939_08828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347849.1"
                     /db_xref="GeneID:55996315"
                     /translation="MHSGVIEDGAPALAYLSGATADPPSAATSPSAGRFRELHIRAGS
                     SSSSENANPIYTPASASSDKLQPAPVLLAESHNHATTQKALEAPIPTEHGQTRSDALS
                     NAACGSSHETDSSSPAHSQSASVIQPNQHENQGGLQPQGVQGRVDSEKPRPSLSSYQA
                     KSKPPSCETYRSSGIYLQPEAHIITEDQLINEVRAIYAGLVMVEKKCIDIDKQQTENP
                     DELKHVQWQALIALHRTLLHEHYDFFLASNHPLASTVLKKLAEKYSMPSRMWRYGIHS
                     FLELLRKRLPGSLEHMLTFIYMAYSMMSLLLESIPAFEGTWIECLGDLARYRMAVEEV
                     DMRDRDTWSAVSRYWYSRAADKTPEVGRLQHHQAVLARPNLLHQLFYYSKALTSTEPF
                     TNTRDSISLVFRPLLDASRPVNPSNPPVLTTFVKVHGLFFTRGEIAQCLSLANEFLNQ
                     LDAHIESAGTVFREQAVYIMSANYAAIFDFGHTDARLFPLFESKYLQKPKLELVRAAC
                     QHWKTKPREESITKLRRAPNSAEVKFESSDQTVSFASHLTFITLDAILQRMGDRKVLP
                     SAHLSLAFLWCTALVPKSMEFIQADVPWKRIATFLNSLIKPETDMTKISSEEFPVHET
                     GSARQLPEDFLIRGLAWSQLYYPVDFFNETADYEERYIELPSAIVPRTRRCLWLGLQI
                     AKVKCWIEYNQQERAFCATRFADELSKVAGQHQILGARDEHTNADVTMAD"
     gene            complement(<819886..>822334)
                     /locus_tag="TRUGW13939_08829"
                     /db_xref="GeneID:55996316"
     mRNA            complement(join(<819886..820040,820098..820247,
                     820310..820661,820778..820833,821091..821164,
                     821218..821586,821637..821812,821859..821881,
                     821929..822039,822090..822105,822155..>822334))
                     /locus_tag="TRUGW13939_08829"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491957.1"
                     /db_xref="GeneID:55996316"
     CDS             complement(join(819886..820040,820098..820247,
                     820310..820661,820778..820833,821091..821164,
                     821218..821586,821637..821812,821859..821881,
                     821929..822039,822090..822105,822155..822334))
                     /locus_tag="TRUGW13939_08829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347850.1"
                     /db_xref="GeneID:55996316"
                     /translation="MGNLDYGISQLACPVDGELTWELQQRGSHTFWVSKDHGREYSTV
                     MESSGTVPTALFPHDKQEEAQRSLHELWRLFSPLPPIPENKVRVLDIKCGTGDWANDI
                     VTLSSNFIVEGFDVSDIVTEQEYCSFYIRDLSLPLCESEVDVYQLLHTRQAMQYIPDK
                     PAFAANCFRALLPGGNLVIEEAHLVPEVVADLPLAAFNEWEAKLVKRYQASATESMKA
                     ALEDCGLRIIWETTSRLTLYGEKSEHFLAFKVFIQEYSLLLLRETKLPFAEAQVTIAN
                     MIKELQQENVRVYWKFCMPVDLLRKLNEAYGGISDLCTVSPSKILANRVVEISTAEEG
                     QPRYLAAISMDSFGNASEPAGQTASRARRTRPTRRVRQTSEESLKVEAIGPVIDLISL
                     QIGDTKKVTAYYESALERVSLPNLRILVEFIESIPTKRGGLEGTPPCDVIYGKTDYLT
                     KEFLIDKFRQGLPIDITSDKLKEIIKPPSTVEILTELFHVQRSEERFGRDEIDATSII
                     GVVDHEQAKKNEPGSGCEDDEVEDSRTSPGTIHIQGSHESSLENF"
     gene            complement(<824068..>824783)
                     /locus_tag="TRUGW13939_08830"
                     /db_xref="GeneID:55996317"
     mRNA            complement(join(<824068..824541,824592..>824783))
                     /locus_tag="TRUGW13939_08830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491958.1"
                     /db_xref="GeneID:55996317"
     CDS             complement(join(824068..824541,824592..824783))
                     /locus_tag="TRUGW13939_08830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347851.1"
                     /db_xref="GeneID:55996317"
                     /translation="MDKNGYTTINNLKLSPSELVGDIVRGIKDLLPLENPGDLTYTFE
                     PKHNSTLFHSIKKYVEYDINVSHLCSFYLSGTHPTGRIDLVRVVGCRPASQPANDEQY
                     MLGPQDYRLADAFVLIRPIHDRVTLNLYPGSHTMTCTQFTQKFNEGSSPTSETVGRDQ
                     AIVAMSTIWCNWPDDQACLRIEDTILFAFVVYSSGPQEVDNSDEEEVGCVDETRLVPF
                     TRY"
     gene            complement(<826949..>827848)
                     /locus_tag="TRUGW13939_08831"
                     /db_xref="GeneID:55996318"
     mRNA            complement(<826949..>827848)
                     /locus_tag="TRUGW13939_08831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491959.1"
                     /db_xref="GeneID:55996318"
     CDS             complement(826949..827848)
                     /locus_tag="TRUGW13939_08831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347852.1"
                     /db_xref="GeneID:55996318"
                     /translation="MMTSMESQRATEREQRLLRVPHDDVLQTLQRLDCQRSEQREASL
                     KRRREQAPLPTPSPTQFKRQRLMSEVVQRQRASVDSLVQGYDARFHGKARASATRSWC
                     KEVPLSLQVKAAKSFYEAFTNENTLPIAHCVLCYEKRMPCELTAVEWKYFLTPSVLQQ
                     ATTVLQQCAACFPRHNAALVQVCRGCRTDVEDGRLPKACSVNNMDIGCEHRYPEELDD
                     LSPVEERLIALHTPFGCITKFTVDNKTPSGMSYRKHVKGHIVVFPNKVEDLVATVLPH
                     PLLQAIENIHISADSLILCPALS"
     gene            complement(<828422..>829474)
                     /locus_tag="TRUGW13939_08832"
                     /db_xref="GeneID:55996319"
     mRNA            complement(join(<828422..829112,829167..>829474))
                     /locus_tag="TRUGW13939_08832"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491960.1"
                     /db_xref="GeneID:55996319"
     CDS             complement(join(828422..829112,829167..829474))
                     /locus_tag="TRUGW13939_08832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347853.1"
                     /db_xref="GeneID:55996319"
                     /translation="MPSNPAYLHLRDFIEEVGPDPARPSKGLALQLLVSLHIPEKEVQ
                     SDDVDIHDIPTLIRFFCEPGRSADLYQPDSFVYAWGSFLTATSQDRKFHILLHAHTVD
                     RHPGNLTNTESYCNRCPEAAQPTVTFQGIVNNSGGQLNSGSTLLHYRLQVTVYDSSTK
                     AEHTFPVTIYLKNGQRWTNFPSLSPQTQVFVGGRIFGTTKENQQLAVLADDIHFLQTM
                     PRTVPPSPASTGKRKHPDRWARQSSPHTPSKAARLTDTALAQPSTQCSSTLQSPATQK
                     NSAIPSVEADKETVVSWPPTDSEPDVSPASKQDSPAERRSQRSRNRISYADILSYE"
     gene            complement(<837705..>841281)
                     /locus_tag="TRUGW13939_08834"
                     /db_xref="GeneID:55996320"
     mRNA            complement(join(<837705..838724,838777..840711,
                     840774..841203,841271..>841281))
                     /locus_tag="TRUGW13939_08834"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491961.1"
                     /db_xref="GeneID:55996320"
     CDS             complement(join(837705..838724,838777..840711,
                     840774..841203,841271..841281))
                     /locus_tag="TRUGW13939_08834"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347854.1"
                     /db_xref="GeneID:55996320"
                     /translation="MILRHEDSQNVKARTNQAKAQADSTISISLPASPGQSSIQCTQP
                     TQPTPDLWKIAYDHLDGEQREILSNLNDKGNHSQTKALLDEVIHVTKEKYEEYQQKTD
                     GTLRQTSRKIINATLSFKDIITAVAGFDPTQHAASAWAIVSLGLTMTKNHNDLRDVLF
                     ESSEYLSDVLTQCAFIEKNFYLDGSSSIKEDVGNALVRLYGAILRYTAQIRDAQHPRV
                     GRMVLDCVTAITDHPLTKLQASVDKERDNLFRWIGLVKHLHCEKEAEDILSQIDALAE
                     SMKHLIEQFRLANLRIAEGAFYDSYINEHEDFCLPNTRSELRSQISEWAESTDDKCIF
                     WLNGMAGTGKSTIARTVAQSFKDKGQLGATFFFKRGEADRGNAKYLISTITRQLVTGH
                     RWLVPDVLSAIESDPNISSKFLSEQFDKLLLQPLLKLHLSQPTTIVIVIDALDECDRE
                     EDIQVILRLLFRLQNFQSVRLRIFLTSRPELPIRLGFKQNDNHRDVFLHELPIPIIER
                     DIRLFLEDKLSKIRDERSLSSDWPGHKNIEKLVKIAVPLFIFAATICRFVGEKRWRPE
                     KRLEAVLQDQATSSRSQMDRTYLPILNQLLSGANDREVKQLTQEFQDIVGVIILLATP
                     LSVNVLAQLINLPKIDISNRLDGFHSVLSVPENINSPIRILHLSFRDYLLATETPFHI
                     NEKETQQKIALHCLRVMKTGLKQNICGLPSYGAQRDNIDSQAVNENLSADMQYACQYW
                     VYHLDYSEARIVESLAFDFLKKHFLHWLEALSLMGITSEAVAMIDALQSGDGKGTDAE
                     ISDFLYDAKRFILKNAYIAGIAPIQLYSSGLVFSPMQSIVKRIFSGSIPKHLHILPQV
                     EDLWSPGLQTLEGHSGPVYSVTFSSDGQTLASGSNDETVKLWNVKTGSELQTLRGHSD
                     RVRSVAFSPDGQTLASGSANKTVKLWNVKTGSELQTLRGHSDRVRSVAFSPDGQTLAS
                     GSANKTVKLWNVKTGSELQTLRGHSGWVYSVTFSPDGQTLASGSTDKTVKLWNVKTGS
                     ELQTLQGHSDSVRSVAFSLHAVENPATRSVTIPQLHDNCGLTSYSINPQISISNNWVA
                     LGGENLLWLPPEHRQFETSAIKEATLALGYSDGRVSIIGFHTL"
     gene            complement(<844024..>844676)
                     /locus_tag="TRUGW13939_08835"
                     /db_xref="GeneID:55996321"
     mRNA            complement(join(<844024..844040,844091..>844676))
                     /locus_tag="TRUGW13939_08835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491962.1"
                     /db_xref="GeneID:55996321"
     CDS             complement(join(844024..844040,844091..844676))
                     /locus_tag="TRUGW13939_08835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347855.1"
                     /db_xref="GeneID:55996321"
                     /translation="MSKLAVLIDADNAQSSTINHLLSEIAKYGTTHVKRAYGDWTSPN
                     LKGWKEKLLEQSIQPIQQFAYTHGKNATDSALIIDAMDLLYSGRFDGFCLVSSDSDFT
                     RLAARIRESGLSVYGIGERKTPKPFVAACDKFIYTENLVHLEELAPHADRVTNDPGDH
                     SSVRQALMDDHLSNMLRTAVETASDDDGWARLSSVVSQTQ"
     gene            complement(<849092..>850210)
                     /locus_tag="TRUGW13939_08836"
                     /db_xref="GeneID:55996322"
     mRNA            complement(join(<849092..849223,849301..849938,
                     849994..>850210))
                     /locus_tag="TRUGW13939_08836"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491963.1"
                     /db_xref="GeneID:55996322"
     CDS             complement(join(849092..849223,849301..849938,
                     849994..850210))
                     /locus_tag="TRUGW13939_08836"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347856.1"
                     /db_xref="GeneID:55996322"
                     /translation="MHHWGNSYGYPYPVTTTTTTTTNTPSKYQSSSHMHGTSSAFSAN
                     ANPNEDWTKISDLAERRRIQNRIAQRNYRKKLKRRLEDLERRAASSSASPEQSHAEPE
                     QPKPASKSQSASSSTSSARSKQSSKANNHWSAPENEMGMQPGAAYGGMQEDRGMFGQQ
                     STRQLSTSPPPFFYPSYPSYSDPYGQSNYSSQPAHPHHSYHTIPQAQYGDLASLPAHH
                     MDQMPHTLPSGTSASKRLGGYPDDEVLNPLCINYASMAGIDMSTTTPQQQQQQHHRHH
                     SHSHHSHLQTPPLTNSYTFNNSGSTSPAGSLNDHFPLTPEPARLSPEHIVFL"
     gene            <855754..>855993
                     /locus_tag="TRUGW13939_08838"
                     /db_xref="GeneID:55996323"
     mRNA            <855754..>855993
                     /locus_tag="TRUGW13939_08838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491964.1"
                     /db_xref="GeneID:55996323"
     CDS             855754..855993
                     /locus_tag="TRUGW13939_08838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347857.1"
                     /db_xref="GeneID:55996323"
                     /translation="MDGVWRNFDGAKNVVSYQALSREEITEVLNVFPKSMRQNLAKKL
                     EGVDGRDVMDIEQLLHPGKDLMPKFDEENGGQIKQ"
     gene            <856593..>857511
                     /locus_tag="TRUGW13939_08839"
                     /db_xref="GeneID:55996324"
     mRNA            join(<856593..857070,857132..>857511)
                     /locus_tag="TRUGW13939_08839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491965.1"
                     /db_xref="GeneID:55996324"
     CDS             join(856593..857070,857132..857511)
                     /locus_tag="TRUGW13939_08839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347858.1"
                     /db_xref="GeneID:55996324"
                     /translation="MSTPKTWLITGASSGLGAALAEAALKVGHKVIATARNITTAAEA
                     NPQISSLGGHWIELDVTSPDTAKKVEDAVQEAGGVIDVVINNAGYSLLGSIEDMSDSE
                     IETQFSTNVYGPVRVLKGVLPFMRASKSGTVVNISSSAGIDGLPTCAIYAGTKFALEG
                     MSESLARELAPFNIRVLIVEPGSLRTNFWSAYVEPAAGMNKGYTDTPLDKTLQLFKSN
                     TGSQPGDAVKCAARILEVVDGVGMGSGKQDLLRLPLGPDCYKRFQTKIDYLQENLLAT
                     KDIAHSTTY"
     gene            complement(<859641..>862973)
                     /locus_tag="TRUGW13939_08840"
                     /db_xref="GeneID:55996325"
     mRNA            complement(join(<859641..860189,860243..862322,
                     862383..862622,862702..>862973))
                     /locus_tag="TRUGW13939_08840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491966.1"
                     /db_xref="GeneID:55996325"
     CDS             complement(join(859641..860189,860243..862322,
                     862383..862622,862702..862973))
                     /locus_tag="TRUGW13939_08840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347859.1"
                     /db_xref="GeneID:55996325"
                     /translation="MTNKESLKADLNSGSVQLSAPAHSLSIEEVLRQLFTRKEDGLTG
                     DEADKRLQTYGPNKLDEGEGVSIAKILLRQIANAMMLVKRPILGHPNFGIQSWIEGGV
                     IAAVVGLNIVVGFVQEYAAEKTMESLHSLTSPTGTVSRDGQTNVVPTADIVPGDMVEL
                     KTGNTVPADLRLVEAVNFETDEMLLTGESLPVHKIAETTFKEDTGPGDRLNIAYSSST
                     VTKGRARGTVIATGMTTEVGQIAAALQESGSKRRPVKRTEEGATKKRWHLQAWTLTVT
                     DAIGRFLGVNVGTLLQRKLSKLAIMLFGVAVLFAIVVMSANLWSNNKEVILYAVATGL
                     SMIPACLVVVLTITMAVGTKRMAQRHVIVRKLDSLEALGAVTNICSDKTGTLTQGKMV
                     VKRAWIPSYGTYSISPSPEPFNPTLGDIFFVDKAPIELSFEEAESRDPATYTDLLSNN
                     ECLEEILNVASMANLAHVYRAESGRSEWHARGEPTEIAIQVFASRFDWNRDRWTTGPD
                     ALWHHKSEFPFDSDVKLMSVIFGKLAKMEESLAVFTKGAVERVLDACTTITWEKNAEP
                     VLLTDVHRQFILENMESLAQLGLRVLAFGSKSYATDTKPFNDLEPSRSEVEKDLCFLG
                     LVGIYDPPRPETKTSIKTCHKAGISVHMVTGDHVGTAKAIAQQVGILPVDLGCVAKNV
                     ADAMVMTASDFDRLAEDEIDALPTLPLVIARCAPRTKVRMINALHRRGHFVAMTGDGV
                     NDSPSLKHADVGIAMGQNGSDVAKDASDIILTDDNFASILNAVEEGRRIFDNIQKFVL
                     HLLSENIAQACTLLIGLAFKDQDRQSVFPLTPVEILWIIMITSGLPDMGLGMEVATAN
                     IMDRPPQSKQGIFTWEVIIDIGVYGLWMASLCLTAFSLVMWGFGDGNLGHGCNRSYSA
                     ECDLVFRARATTFVCLTWFALFLAWEMVDMRRSFLRMQPGSKQYFTQWFHDVWRNKFL
                     FWAIIAGFVTIFPTLYIPVINHDVFKHTGISWEWGVVFVEAFLFFLGAETWKWAKRIY
                     FRRHELRAKVDAGTQV"
     gene            complement(<864796..>866689)
                     /locus_tag="TRUGW13939_08841"
                     /db_xref="GeneID:55996326"
     mRNA            complement(join(<864796..865060,865124..865167,
                     865235..865949,866064..>866689))
                     /locus_tag="TRUGW13939_08841"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491967.1"
                     /db_xref="GeneID:55996326"
     CDS             complement(join(864796..865060,865124..865167,
                     865235..865949,866064..866689))
                     /locus_tag="TRUGW13939_08841"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347860.1"
                     /db_xref="GeneID:55996326"
                     /translation="MVHAGQQIDSTHRQHYAPNNGTDGQAAYTGDSVRSHVADLFRGL
                     SLTRNPDLWQTLPAEKRYELENREDYIEIENALQALKGSTKNQQRRLLYNKMRRLIDS
                     ELSKCQKSQTRKPLSEEPDGTYFMGSHRSQFSRARRMMPVRQRLADNIFQEATLRSDL
                     GRQVLADMIALCKQEHEIEIRPGLEPGKCHCIASKDESSEKRAHIKSNKAFYSAQTMV
                     DNLGFTLTPDSMVHFNDATWPLLVMSFLAFAGNTLYPVVLRLVIWTFSKIVPKDSLTK
                     ETLQFILDHPRRCYTLLFPARPTWILFSIIFLLNFVDVLLIIVLDLNNPAVNSLSLGA
                     RILAAIFQAASARHTGTSSFNLADVNPAVQFSLVIMMYISILPIAISIRSSNAYEERA
                     LGVYPHEEGLDESNGSSYVMTHIRNQLTFDLWYIFLGTFCICIAEAQRIMDNDDPAVA
                     VFPVFFEVVSGYGNVGLSLGYPTVNTSLSGQFTVFSKVVMCFMMIRGRHRGLPYALDR
                     AIMLPSDHVTEIGLQTENSGSLGDAKSLRRRMLPMRTYLTT"
     gene            complement(<866924..>868157)
                     /locus_tag="TRUGW13939_08842"
                     /db_xref="GeneID:55996327"
     mRNA            complement(join(<866924..867101,867161..867261,
                     867320..867571,867713..867932,868027..>868157))
                     /locus_tag="TRUGW13939_08842"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491968.1"
                     /db_xref="GeneID:55996327"
     CDS             complement(join(866924..867101,867161..867261,
                     867320..867571,867713..867932,868027..868157))
                     /locus_tag="TRUGW13939_08842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347861.1"
                     /db_xref="GeneID:55996327"
                     /translation="MAPRKKSKSFLNTARKNGADQHRQGINGERVKGIVEPHTTKQYE
                     FCTETGKDPVSSAYDLASLKDFAHHLALGMEGRHDKDIAGQNSVIGVWKRFTAGFDRD
                     NDDAIPQPLMNSVLNYLHKTVFPERGNPEVKRPRNHARKNHFIHLGRQLWENDWHEYP
                     KPIMRVSIWAQILLYVFSSARLCEYLEGASRANSGRGLYCRNITFGVIRNELGEPELA
                     AQVVKDTKGMTKRPNKRPKHEVYEGLSTKPRALLLNPMIPILAMLIACGRLRDFNTLD
                     EVLAIPAPPEDEVYALE"
     gene            complement(<869623..>871356)
                     /locus_tag="TRUGW13939_08843"
                     /db_xref="GeneID:55996328"
     mRNA            complement(join(<869623..870408,870455..870539,
                     870589..870731,870789..871265,871321..>871356))
                     /locus_tag="TRUGW13939_08843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491969.1"
                     /db_xref="GeneID:55996328"
     CDS             complement(join(869623..870408,870455..870539,
                     870589..870731,870789..871265,871321..871356))
                     /locus_tag="TRUGW13939_08843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347862.1"
                     /db_xref="GeneID:55996328"
                     /translation="MNGRSQSPTDSQNSSPTLSRREKRKLEPSNGRRKAENSDKHATF
                     NAAGTIPRDAIVRITNLVQFLGSYNDDVDKIEHALDRLMEKDEKIKSLSSAIQELKHS
                     NNEELQGLKEEIEENSNRLIELEQRELTMIDNQQRFEAEKKQEKERRKQFDKEQQTKY
                     ERKLDAEKDRLSQVNALRTEKAQVEKTLGLYVKNVTELESQLKESESRHPIQSLSTEH
                     YENAFSNLREKIRAITQTYLCNLPPENELDIDEVQKEFTKLQSIFGTISLSASVASRF
                     LRVRGAQCIIVEAICSCFWQPFYVTARSLTSEAVAPLSQISNKLFEEDRYKESLWRNL
                     TFKGLDMPTSSQDRCQVRPEVKRIAEILQRLIPKQKHKDFEIDLEELLLESIRIWDEL
                     KRDSCVVAFDLQPPSVWSPGWKAEDCPDLGLADVEANSEPGNISKMKPWCLFPRVIFH
                     TIDGRKKFFPGNAIFANSPAFHENCAEIQRQEEEIAQIKKNFVRRPTISRGTRGLATE
                     "
     gene            complement(<872984..>874072)
                     /locus_tag="TRUGW13939_08844"
                     /db_xref="GeneID:55996329"
     mRNA            complement(<872984..>874072)
                     /locus_tag="TRUGW13939_08844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491970.1"
                     /db_xref="GeneID:55996329"
     CDS             complement(872984..874072)
                     /locus_tag="TRUGW13939_08844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347863.1"
                     /db_xref="GeneID:55996329"
                     /translation="MSNPEDYTVGWICAINTEYVAAQAFLDEKHDRPAYLPPHNKTDY
                     TLGRVWKHNVVIFVLPMGEYGTSSVARVAEDMMHSFPNIRIGLMVGIGGGAPSQKHDI
                     RLGDVVVSIPRNSQGGVLQYDFGKTIQGQAFQPTSFLDQPPTVLRAAVNGLEAQYESE
                     GNQLNETVHKILEKKPRLRRKYQRPDLASDQLYRSQVVHPLGSDLPCTLSCGEDPSCL
                     VPRSPRTEDDDNPAIHYGLIASANQLMKDALARDKLAAQKDVLCFEMEAAGLKNHFPC
                     LVIRGICDYADSHKNKAWQGYAAMVAAAYAKDLLYRIAPQQVEQEARMVNVLKEGDHY
                     TSITFGSNNSGFQVGTNDGPIYATFGVK"
     gene            <874477..>876475
                     /locus_tag="TRUGW13939_08845"
                     /db_xref="GeneID:55996330"
     mRNA            join(<874477..874597,874663..874813,874865..875685,
                     875874..>876475)
                     /locus_tag="TRUGW13939_08845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491971.1"
                     /db_xref="GeneID:55996330"
     CDS             join(874477..874597,874663..874813,874865..875685,
                     875874..876475)
                     /locus_tag="TRUGW13939_08845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347864.1"
                     /db_xref="GeneID:55996330"
                     /translation="MGGREPQLGAKPTERLAISFGDKNSGFQVGISHGPIYVPADRPE
                     PRPEPLWTVPFPYDPNFVGRDGLLDQIHEKSSIPGSRIVLVGLGGVGKTRLAIEYCHR
                     VRQQSPDTWVFWVHASNAARCEASLRNLADRAKIPGRQDRNANIFELFGNWLQDGKIG
                     EWILVLDNVDDDDLLRKPLTTPIEARGNAQNHASTQPPLRYLLENSNGSVIITSRNKG
                     VALEIAGYKKNLIDVQPMIMAEALVLMQKNLDCCSERADIVPLVEELEFMPLAIVQAA
                     SYITHRSPSCSVSQYLEKLRQSDRQATKLLNHEGHHTHRDWEAKNSILLTWQISFDHI
                     RGTRQSAANLLSLMSFFDWQGIPEDLLRVQVQLTVRTWLKTHGLEEEWKEQFIENLHA
                     EFPTGEYENWERCRSLFPHVRSAVSHRPKSQDTLRSWAAILYRGAWYARGCGNISDAR
                     EMAYMSRKERIKISGAEDEEALSSTAMLADVYRFEGRWEEAEKLEVQVMKTHKTKLGA
                     DHPSTLTSMANLASTYRDQGRWDEAEKLEVQVMETGFLNRSQRKLHTLPRDRTGPS"
     gene            complement(<881004..>882635)
                     /locus_tag="TRUGW13939_08846"
                     /db_xref="GeneID:55996331"
     mRNA            complement(join(<881004..882413,882462..>882635))
                     /locus_tag="TRUGW13939_08846"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491972.1"
                     /db_xref="GeneID:55996331"
     CDS             complement(join(881004..882413,882462..882635))
                     /locus_tag="TRUGW13939_08846"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347865.1"
                     /db_xref="GeneID:55996331"
                     /translation="MKRAQSPCLHDSGHDERPAKVRRQESLSTPSGSLKRDQEEQITV
                     QHPPSPFSPNPDSENPVNLERQATTRLSLTNTATEHTDKIFDWIPAPSEIGELDNMSQ
                     PASKRSRSRSISTDRGRARSLSSDSDRSSARDAKSSAYKAVNYVTILETKGCFMRQSS
                     SGPHPDDIALCERLLHQPIEPPQGTLFDDQYITDFHNALQNRSEARLFVDLHPLLMPS
                     AENQFIQGKTRLKDVIDGYNDLWVKTEPIYGPKPQPDHARGLKWSTFSESQRRRLGIK
                     PDDKSPYTAREDMYFPYVTAEIKCGNQALELADRQNMHSMCIAVRAVVSLSRAAGCPE
                     KVHRRILGFSLSHELEGLRIYGYYPEIDGGNTSYFRWPVAQLNIWTKEDKWACYRFME
                     NVDREFLPIHTDRLIRLLEDVPELEEYSLSDDVEIESQVSRIGSQERSGLRRTTSSLG
                     RGLQPELRMMVQTLQQQLAEQKDREDKLLTQLERQREREEKREAEQKAREEKLLLKQR
                     EREDRLLAQLEQLTQKLTK"
     gene            <884922..>885833
                     /locus_tag="TRUGW13939_08847"
                     /db_xref="GeneID:55996332"
     mRNA            <884922..>885833
                     /locus_tag="TRUGW13939_08847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491973.1"
                     /db_xref="GeneID:55996332"
     CDS             884922..885833
                     /locus_tag="TRUGW13939_08847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347866.1"
                     /db_xref="GeneID:55996332"
                     /translation="MGELLRMPKEIWLIVTDSLESEDLVRLSLTCRRVQTIAEERLYR
                     QCNLEQVISWAWETWIRNKTFEKLVHYRKGPGRREWIFRDIPVLMSAALQVKRDAVNL
                     LLKNDFVVTKEAISFLLSQGRQQDIISTLINGALYGYDALVKMMVKCISGLESAEVDK
                     YGVKKVGALDIFQAASLDRPEITKSISLILPRRMRQSQLYTALVFGINTGMLDDGQKV
                     KAVKSLLAHGAKPVDGRHEKPLELAVRWGYDEIVSILFQGRKFNSRSESHRKAWRIAK
                     RRGHNNILKTLLPEHRVSTRQLSSQLT"
     gene            complement(<903861..>906405)
                     /locus_tag="TRUGW13939_08848"
                     /db_xref="GeneID:55996333"
     mRNA            complement(join(<903861..903881,903949..>906405))
                     /locus_tag="TRUGW13939_08848"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491974.1"
                     /db_xref="GeneID:55996333"
     CDS             complement(join(903861..903881,903949..906405))
                     /locus_tag="TRUGW13939_08848"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347867.1"
                     /db_xref="GeneID:55996333"
                     /translation="MLSELYTTDRSSWGTITRELFSNYGMFKQKLGEAFGNIDELRTA
                     ERQLRYLRQTGSAQQLATKFRQIVTPLHYDDAIQIATFENMLKEEVQTELIKLDRPDN
                     IDRFIEMAVKIDNKLFEIKQKRQEFQRWKKVGGFPQYANTSAKRGTQYDKDGDVKMQL
                     NNVISKEEMAKRKENKACYKCGRKGHFARQCRSGQGRQNGNASPQKITTVHQQIAAIH
                     QTIVTPSDSEEEESENEQVDEVKDFWGPILEKEIYESLKNFEQEDTPGQSKGRLRQSS
                     EREPPQEEDANPEEAQPHLQQGQEKGPIREPRREDQYSKTAGRRIDDLSSGSESQHPL
                     TFRDGGKDREVDHEDSDREPDTPQQSQLTRTTNLRRDAARAIHQANETIRLFQKRPPI
                     TRKEWDSVLGTSTTVPGTRIEIPETNSEDSETTEEFPEIDYEEPKRECSCKPPKPVCW
                     EDSIQTYRQHILECEECHEWTFHKCDMHGKKNIALANEFEYVSLTKGTRLCHPMLGHT
                     ERCSCMYYPQYGGHHHKKIHWTQCYESKCPTHLEEKEKNKWKPTAPMIIYQPIPDCPK
                     GWNECWCYAEEIWHPFHNSIETDQCYAKKCPYHEGRVIYTDEDWTEIVLSQKRYLERH
                     RKGHHLIATTIKTGETVIIIKGTIDGHEAKLLLDSGASTNYISEAYVKKNRIQTYETN
                     LWHTVQNFEGQITIEGFVRRTENITIKSGEHEESIQLDLSPFERKDFDVILGMTWLRK
                     HNPVIDWKHETVSIDLKMLQTEQMGIKPDQQLKVKHAEEINEIGRQIETRRKPKEIYE
                     KELKEVLDKLPEKYRDFTELFEHRYHK"
     gene            complement(<908728..>909078)
                     /locus_tag="TRUGW13939_08849"
                     /db_xref="GeneID:55996334"
     mRNA            complement(<908728..>909078)
                     /locus_tag="TRUGW13939_08849"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491975.1"
                     /db_xref="GeneID:55996334"
     CDS             complement(908728..909078)
                     /locus_tag="TRUGW13939_08849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347868.1"
                     /db_xref="GeneID:55996334"
                     /translation="MLDALDAGRTKLDEYYAQTDTIRGHIYAVSTMLAPVNKFRFFLS
                     SDWDQKWRDIYRNAFQQALIPYQAQVKSQSQDAYSSHTAAQPSSRLEEMLDGKDIQPR
                     AMTDEISQYLDSGQ"
     gene            complement(<910219..>910764)
                     /locus_tag="TRUGW13939_08850"
                     /db_xref="GeneID:55996335"
     mRNA            complement(<910219..>910764)
                     /locus_tag="TRUGW13939_08850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491976.1"
                     /db_xref="GeneID:55996335"
     CDS             complement(910219..910764)
                     /locus_tag="TRUGW13939_08850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347869.1"
                     /db_xref="GeneID:55996335"
                     /translation="MSQSQLSDFTSSLYSGDIDDLPSLSTQQITPSASHHTIDSGFHR
                     PDDLLVPPSLIRVGPDRRNRFVLYDKMSHNEFIDWWLQTDYGRKRKINWDSHRHTVIW
                     NSYNQVAEGVDGTPKVMCKRCGKILEHPYSLSLNSSGKAQYHGTSTIQKHLKTAGCLR
                     SEKGKKAEITKFLQKEVCFRL"
     gene            complement(<916046..>917062)
                     /locus_tag="TRUGW13939_08851"
                     /db_xref="GeneID:55996336"
     mRNA            complement(<916046..>917062)
                     /locus_tag="TRUGW13939_08851"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491977.1"
                     /db_xref="GeneID:55996336"
     CDS             complement(916046..917062)
                     /locus_tag="TRUGW13939_08851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347870.1"
                     /db_xref="GeneID:55996336"
                     /translation="MQRMELLLTNMSARLSHVEGQVNNTTEPPMPEVPTDATPSVTPM
                     YSANKPRHSLDHPDKYDDSDRSRYMQFVAILYAKLTVDAPAIGGPYEQLWYAYGRLAG
                     KAQTKVYPWMRLHGNVNTVTPATLEAFFAHLNVLFEDHQLVEKANLELNRIRQGRTPF
                     QDFISEFERILLLAGGQSWTDDVKISRLKTAINQEMRRATVGSDMPKQYEAFCERLHR
                     VANDLEELKRIDNIQSRYKRNTSRPLTKGTSPDRGQPQVMDWTPAGLPINTVRTDNCF
                     RCGKPGHIAQYCPEPAPLRRAPSPRNRGKKKHDTFTRISNTGVKENETESDTGSDSTS
                     ESKE"
     gene            complement(<921402..>924334)
                     /locus_tag="TRUGW13939_08852"
                     /db_xref="GeneID:55996337"
     mRNA            complement(join(<921402..921826,922056..922148,
                     922874..923026,923080..923561,923690..924032,
                     924084..924227,924280..>924334))
                     /locus_tag="TRUGW13939_08852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491978.1"
                     /db_xref="GeneID:55996337"
     CDS             complement(join(921402..921826,922056..922148,
                     922874..923026,923080..923561,923690..924032,
                     924084..924227,924280..924334))
                     /locus_tag="TRUGW13939_08852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347871.1"
                     /db_xref="GeneID:55996337"
                     /translation="MSFNKHGRQYDIVVFGATGYTGLLTAEHITINFPSNLQWAVAGR
                     SPNKLKQVVSRCKFLNPDRVQPDIEVCNIDDKELAVLARKTFCLISAVGPYALYGEHA
                     FKACAEAGTHYVDCTAEVPWTLAMIKKYEATARTSGACMFPQTGLAVPSDILTWVMAT
                     EARSKFSSKISDVVMDLHELQSYKPYALSPVTNEHPLPKWPIWSAITGLYRVPRLGLL
                     SSSPTGNANAAIVFRTWGLMKTEPELQNEFYGPNFTYQEFVYAGNVLRGVMGHCILLT
                     VAVLLFLPPVRALLRLFITKPGEGPDKEVARKEIIEFRAIAETEVEPKINKQIFGRLS
                     YTGSMYYLTAAVLAEAAGTLLQGDRERLKGGVYTPACLGLIYVNRLRRAGFQIESDFE
                     SIPTGDVSIITMLILIPAHKSRLDAGILVNFVHLSKHRVVIIMSSLEFHAPGWHDEGR
                     TPVVDGKYYDRATGEVRLATDGDHQEYMGPPSVDIIVKSQHIDTVHCTYRAARAFPME
                     ALLCHIMKVVGERKLEVDSVIATPYAIRIILSHELTPDKFTEIASEMVNGIWNKTE"
     gene            complement(<925411..>926435)
                     /locus_tag="TRUGW13939_08853"
                     /db_xref="GeneID:55996338"
     mRNA            complement(join(<925411..925589,925670..>926435))
                     /locus_tag="TRUGW13939_08853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491979.1"
                     /db_xref="GeneID:55996338"
     CDS             complement(join(925411..925589,925670..926435))
                     /locus_tag="TRUGW13939_08853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347872.1"
                     /db_xref="GeneID:55996338"
                     /translation="MSPTPSQDNDRALRQFVPTLHTDVYDTIDPSKTKITQPFTAVIL
                     GGSGAVGSGLARAYARAGATGIVLAARRLSLIEAVADEAKAISPSIQTLAMQCDVSSA
                     SDIAAVATATRTRFGATVGIVVVNAGYSGHIVPDIAQESVENFQNAFSINTMASAYAA
                     QSFIPILNESAAANTTSQKRLFLAVSSMSAPTVSGPVAHIHYCASKFAQVRVIEMLKE
                     QQHAANGDDSIFFASLHPGGVKSDFARQSNIPESFLPFMTESPDLAGAFCVWLTQNQS
                     RIQGLSGRFLSVKWDVDELLGKMDEIVDKDLLRARFAV"
     gene            <929733..>931266
                     /locus_tag="TRUGW13939_08854"
                     /db_xref="GeneID:55996339"
     mRNA            join(<929733..929819,930081..930175,930243..930876,
                     930996..931015,931071..>931266)
                     /locus_tag="TRUGW13939_08854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491980.1"
                     /db_xref="GeneID:55996339"
     CDS             join(929733..929819,930081..930175,930243..930876,
                     930996..931015,931071..931266)
                     /locus_tag="TRUGW13939_08854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347873.1"
                     /db_xref="GeneID:55996339"
                     /translation="MASIGASYYEDTATANDLFFTARYSLMNYAIRYRNLSLPASGEG
                     GLLNEWQAWIEYESIVRTNYAIYVFLCTLSVNFEVPNALLDSDMKDCHLPCNEDIWLS
                     PTPQTWLAVRQYDSNPPIRFSDAMRELNSPQTQPTVAFTAFGGYVTFHALVKQLGNLN
                     QGPVWLAIVAPTLLNSLELALEKWRMSFEKDFEYPFFPRYPQGVLVINSISLYRQAHV
                     RLCGDFGPLRSAMATRDVQEIVRGMNSINVPITRTKTCLKAARCAIDALRTPIRLTLH
                     NFSTPEEQESVKLTLETRGELNLAPVHAQKPFATQLVYAWALIFERCNATKVQGILAE
                     ALNIYASTL"
     gene            <931802..>932812
                     /locus_tag="TRUGW13939_08855"
                     /db_xref="GeneID:55996340"
     mRNA            join(<931802..931843,931901..>932812)
                     /locus_tag="TRUGW13939_08855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491981.1"
                     /db_xref="GeneID:55996340"
     CDS             join(931802..931843,931901..932812)
                     /locus_tag="TRUGW13939_08855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347874.1"
                     /db_xref="GeneID:55996340"
                     /translation="MAHSTRASTMRFFDVAVTFTADQFRGIYRGKTYHEPDFGEVLKR
                     AEDYGCGRVMLTTMSLSGAEQNLQLVREYPKVCRMTLGVHPYHAGEIYASEKSKDGQN
                     EYLESIKMLARGLLAEIPSPLAAFGEIGLDYVYLDRADKGTQQRAFRDQLELATQLRL
                     PLFLHVRESTTDFVSIIKPYLPRLPRGGLVHSFAGTKEEMLQLVELGLDISVNGVSFR
                     THEQIEMVKHIPLDRLQLETDAPWCELSSNDPKIEQYLEAARPLPPSRKHNKFILGQM
                     VKTRNESCTIERVGLVVAGLKGVTMEEVVEAAWRNSCRMFW"
     gene            complement(<934137..>935737)
                     /locus_tag="TRUGW13939_08856"
                     /db_xref="GeneID:55996341"
     mRNA            complement(join(<934137..935069,935126..>935737))
                     /locus_tag="TRUGW13939_08856"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491982.1"
                     /db_xref="GeneID:55996341"
     CDS             complement(join(934137..935069,935126..935737))
                     /locus_tag="TRUGW13939_08856"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347875.1"
                     /db_xref="GeneID:55996341"
                     /translation="MSDIKYSSTPSQSGVPDNPLEPDEDKTGEVLDYKGDLPESQEDN
                     FIRNSDTNSEPIDPAEARRVLWKIDLVIIPLISGTIILSAVDKIIISNAAIYGMMTDT
                     RLTSSMFSWVGSIFYFGYLLFEYPSALLIQRLPVAKLLAFTVFLWAFLMGCTAATQNF
                     AGLMAVRFIMGMSEATCNPIAAIVTVMWYTKSEQPVRVAFWYNQLSSVFSGLVSYGIG
                     HTNSTLAPWRLLFIALAAFSALWAILIWVLLPDSPVKCWWLSDREKYIAIRRIRANNT
                     GIEDRTFKWYQLRECLSDPKTWLLAIFVCAQNIPNGCLVTFSALIVSGLNYSPLLTTV
                     LGIPTGVIATIWQLVLSLPTSRLKNRRCITIALGNIIPTISAILLWQIPDENRHGRLA
                     AYYVFYTYWGPYVMSTTLPMANTSGHTKKLTTNAVFFLAYCLGNIIGPQVFQGSDAPN
                     HPKGYIGLLASLIVASVSICLYGILCSLENTRRGKERGIEELPEVTDPFSDLTDYQKA
                     SFRYTY"
     gene            <936345..>937670
                     /locus_tag="TRUGW13939_08857"
                     /db_xref="GeneID:55996342"
     mRNA            <936345..>937670
                     /locus_tag="TRUGW13939_08857"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491983.1"
                     /db_xref="GeneID:55996342"
     CDS             936345..937670
                     /locus_tag="TRUGW13939_08857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347876.1"
                     /db_xref="GeneID:55996342"
                     /translation="MSLSPAFVKPWLPKNEHPSILFTGAQLVDPVDGQVHPNASVHIN
                     QGIIRAVSIIGEPIETPGNTINVNLGGQYLCPGLIDAHVHISAVPGEMDFRHIMAMPE
                     SEALLRMTYVCRDMLYRGFTSVRDCGGAPGSLKQSCSEWLVPGPRLFISGHAISQTGG
                     HGDFRHQHDHSHCSSSFVSGLGRVCDGVAACIAVSRDELRRGADFIKIMGSGGVVSPT
                     DKLENHQFSPEEIQAMVMVANNAHTYVTCHAYSPQSIRIAIENGVRGIEHGNLIDSDT
                     ALLMAEKDCYLTPTLVTFFSMGDPAVAHFLPPDSRTKNIDVMKMGLDALRIAKECNVT
                     MCYGSDLLGPLGKYQNREFGLRSQVLSALDILQSATINPAKMMGQPQLGQIKPGFFAD
                     LLILKNNPLDDITVFERSDEEIQLVMKEGRVCRSSIEALPGLLDEIMHF"
     gene            complement(<937901..>939476)
                     /locus_tag="TRUGW13939_08858"
                     /db_xref="GeneID:55996343"
     mRNA            complement(join(<937901..938176,938237..938318,
                     938389..939273,939328..>939476))
                     /locus_tag="TRUGW13939_08858"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491984.1"
                     /db_xref="GeneID:55996343"
     CDS             complement(join(937901..938176,938237..938318,
                     938389..939273,939328..939476))
                     /locus_tag="TRUGW13939_08858"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347877.1"
                     /db_xref="GeneID:55996343"
                     /translation="MSSVSEPAAPSIRTAIPGPDTHRIKEDLDAVIDARTVQMVINYD
                     QSFGNYITDVDGNTYLDVYAQIASIPVGYNNTTLIKAAQSSDIVSALVNRPAVGNFPS
                     RQWLALLRDGLMRAAPPGCTQVFPAQSGSEANDLAFKAAFMAYRRQQRAGSPWTEYEQ
                     ATAMKNQAPGSPDLAILSFRNSFHGRSFGSLSTTRSKPIHKVDIPAFKWPHATFPQLR
                     YPLEDYVQENAREEERCLQEVENIISSWHCPVAGIIVEPIQSEGGDNHASPDFFQKLQ
                     AITKKHGITLIVDEVQTGFGATGKFWAHEHWELPSPADIVTFSKKAQTAGYFFSDGSL
                     RPDKAYRQFNTWMGDAARIIICNAVIDEILSKKLVEKTAQVGAVLYDSLATLAAKYPN
                     RMQSLRGKDKGTYIAFDTPDSSSLLKKMRELGINIGSCGVQTIRLRPMLIFEESHVAP
                     LLAAFETAFSQLS"
     gene            <941512..>942651
                     /locus_tag="TRUGW13939_08859"
                     /db_xref="GeneID:55996344"
     mRNA            join(<941512..941755,941813..>942651)
                     /locus_tag="TRUGW13939_08859"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491985.1"
                     /db_xref="GeneID:55996344"
     CDS             join(941512..941755,941813..942651)
                     /locus_tag="TRUGW13939_08859"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347878.1"
                     /db_xref="GeneID:55996344"
                     /translation="MTVPSYRIGSIPGDGIGLEVISAAIEVVRKLSSTLKTFSIEFTD
                     LPWGSDYWKKTGSYVPEDYLETYRKFDASLFGSVGAPDVPDHVSLWGLLLAIRSPLQL
                     FANVRPVRTFPGTKSPLANPPPEGIDWVLVRENSEGEYSGHGGRSHVGQPWEVATEVA
                     IFTRVGVVRILRFAFETAQSRPRKHLTVVSKSNSLRNGLVLWDEVAAEVARDFPDVTW
                     DKTLVDAMTIRMVNNPHTIDTIVGTNLHMDILSDLAASLAGSIGIAASSNLDPTRKNP
                     SMFEPVHGSAFDITGKGLANPLGAIWSAADMLTWLGEAPAADHLMECVKAVCRAGILT
                     ADLGGNAKTQDVVNAICEEIEHRGLG"
     gene            complement(<943176..>944832)
                     /locus_tag="TRUGW13939_08860"
                     /db_xref="GeneID:55996345"
     mRNA            complement(join(<943176..943278,943345..944614,
                     944667..944754,944812..>944832))
                     /locus_tag="TRUGW13939_08860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491986.1"
                     /db_xref="GeneID:55996345"
     CDS             complement(join(943176..943278,943345..944614,
                     944667..944754,944812..944832))
                     /locus_tag="TRUGW13939_08860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347879.1"
                     /db_xref="GeneID:55996345"
                     /translation="MTHTVPQLKDKSLFIEKCQINGEWVGAQSGKTFEVTDPATNKVI
                     GTCPEFSAKDTERAIKAASDAFPVFRKTSVRERSRLLRRWNDLILQNADDLATLITWE
                     NGKPFAEAQDEIKYAAAFIEWFSEEAPRLYADTIPVSIPGNRVLTVKEPVGVCGLITP
                     WNFPAAMITRKIGPALAAGCTVVAKSPGETPFTANALAELALRAGIPKGAVNIVTALE
                     NTAEVGQILTTHSDIKKVSFTGSTRVGKLLMGQASSSVKRVSWELGGNAPFIVFDDVE
                     DIDAAVTGALASKFRGTGQTCVCANRIYIHRFHYEAFAERLVKRIRDLKVGHGFAQGV
                     TLGPLIHPAAAQKVADHVVDAKSKGARVLLGGNPIRELGPTFFQPTVLADMTHDMRIA
                     SEETFGPVAALFPFDTEDEVIQLANRCEVGLAAYIFSDNIRRVFRVAEALEVGMVGAN
                     TGSVSDVAAPFGGVKESGFGREGSKYGIEEFVNIKTITLGGIF"
     gene            complement(<945834..>946547)
                     /locus_tag="TRUGW13939_08861"
                     /db_xref="GeneID:55996346"
     mRNA            complement(<945834..>946547)
                     /locus_tag="TRUGW13939_08861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491987.1"
                     /db_xref="GeneID:55996346"
     CDS             complement(945834..946547)
                     /locus_tag="TRUGW13939_08861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347880.1"
                     /db_xref="GeneID:55996346"
                     /translation="MTQLSDYRVLSFDVYGTLVDWEGGILAAIQPTLDKNNAQFSRKH
                     LLTIYHELEREQQTKTPEMPYHQLLTTLLPQFASRLGLAAPSQEECNQFGESVGSWPA
                     FPDTVDALKCLSKHYKLVVLSNVDRASFAKTNAGSLEGFPFDLIITAQDVGSYKPDLR
                     NFEYMLKAVKSTFDIEPSRVLQTAQSQFHDHHPASKIGIKSAWIERPGASMGNLSDNI
                     YDWRFDTMGDMAKAIGAGQ"
     gene            complement(<946936..>948349)
                     /locus_tag="TRUGW13939_08862"
                     /db_xref="GeneID:55996347"
     mRNA            complement(join(<946936..948251,948301..>948349))
                     /locus_tag="TRUGW13939_08862"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491988.1"
                     /db_xref="GeneID:55996347"
     CDS             complement(join(946936..948251,948301..948349))
                     /locus_tag="TRUGW13939_08862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347881.1"
                     /db_xref="GeneID:55996347"
                     /translation="MEDLFREARFTSLRLLGHAEKYSTTRSHLGIYLNVGLTARYKRP
                     SGVPVKPALFHALSALISKHPILSAIPLAVETPDPYFIRLPKIALSEVVTFVEEDANP
                     PSPDWQEIVDKVLEEQHNCPFEVQSNRTLPFWRIFVLESNNVPGSFTLVFIFHHSLMD
                     TKSALSFHDEMEGHMAQYAGVEPSDVVYGFPGPLVPPLEGLYTLPVSQDFLRSQEKYT
                     EPSHDSWTAAPQFTPMKTRFSSLWLSDVDTKMLMTLSKKEQTSVTAALQALIATCIFS
                     VLPSTYRTLQGDCAVSLRRFLPEPVTATTLGCYVGSSSTTYLRMPSFDWDEARRTKIA
                     IEHTMAQKGGDMPVGYLAFIQNQHHWMLQKLGRKRMSAFELSNVGASSTLRGGSNFEI
                     ESMLFSQSSSACSAAIKVSAVTGPDGRLALGFTWQEGVIEADMIERVKRALKGEVEKL
                     AALG"
     gene            <949366..>951494
                     /locus_tag="TRUGW13939_08863"
                     /db_xref="GeneID:55996348"
     mRNA            join(<949366..949552,949605..949693,949765..950375,
                     950447..>951494)
                     /locus_tag="TRUGW13939_08863"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491989.1"
                     /db_xref="GeneID:55996348"
     CDS             join(949366..949552,949605..949693,949765..950375,
                     950447..951494)
                     /locus_tag="TRUGW13939_08863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347882.1"
                     /db_xref="GeneID:55996348"
                     /translation="MKRIITHFLGDISFETSTLQEIADSLNQGQDQERSDSDSSIKSH
                     DATPTNDYSMDPLSTSTMHYSGELSHWNFSRMLERRLRSLGDRTGQTKSLDHAEGFFR
                     ATALQSSDSCVALAKSYFPPKHIAEFLTSAFLKFSQTNYFYFHEATFREKLDFYYATK
                     HQLSINDAGWICTLLMTFAIGTQFAHMQTAPTPGSSASATENTPDDVIGLELYRFSCR
                     LIPDLITVASVETVQAFLLLGVYTLPIDTAGLAYIYYGLAIKTAIQNGMHRKLFDGKV
                     APGIIEVRNRLWWSAYSLESRIGILHGRPITISPAEIDAPMPLDLPALRPVGQSSNLS
                     NFTAAIILTNHLTKASEAMRSLRRCQRSKKKKYLRQLAATCDRLSSWWDSLPTETHCR
                     DLAPDGPFFRCNVHLEIYYTTTLIYMGRPFIISLASSGSLNPDSGLTIHELPDIVNTL
                     RRDSLHAALRVIELCQLLQDYVGLARVSYTEFSGCRVALLALIAHSINEPASRISSAL
                     AQGMGLIRQMCSGLESARSEVAVIEALERARQRLHSHTVAEQRGTREATTGYDQFKEW
                     AKLWQGDGSDIVSTNLDAPFEQRSPNSVPSFDGFFSSFPNELGEFTAIPGLNYDLSLG
                     QEWLGGSQPEGSEWIIDQPL"
     gene            <952659..>953719
                     /locus_tag="TRUGW13939_08864"
                     /db_xref="GeneID:55996349"
     mRNA            join(<952659..952863,953280..>953719)
                     /locus_tag="TRUGW13939_08864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491990.1"
                     /db_xref="GeneID:55996349"
     CDS             join(952659..952863,953280..953719)
                     /locus_tag="TRUGW13939_08864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347883.1"
                     /db_xref="GeneID:55996349"
                     /translation="MSSGYKLYDYNPSEAAAIVFAAIFAVTTLAHIFQMISRRTWYFT
                     PFIIGGLCEFLCLFYQLLSPPFFCCGGMLSNAKSQNTVKLGNCIIVIGLCVQLIFFGF
                     FVVVSVVFHRRINSSPTDASLTTSVLWSRYLKVLYTVSVLIMVRSIYRVIEYVQGTSG
                     VLQEHEYFLYILDATLMLLCCVIMNIFHPSQIIHGGQVYDKVDEDLELLNNRGH"
     gene            complement(<956456..>959521)
                     /locus_tag="TRUGW13939_08865"
                     /db_xref="GeneID:55996350"
     mRNA            complement(join(<956456..956994,957054..957690,
                     957742..958879,959205..959302,959369..>959521))
                     /locus_tag="TRUGW13939_08865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491991.1"
                     /db_xref="GeneID:55996350"
     CDS             complement(join(956456..956994,957054..957690,
                     957742..958879,959205..959302,959369..959521))
                     /locus_tag="TRUGW13939_08865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347884.1"
                     /db_xref="GeneID:55996350"
                     /translation="MASKRKASAMAATVDDEPVDPSDELAFYCLGGGNEVGRSCHIIQ
                     YKGKTVMLDAGMHPAKEGFAALPFFDEFDLSTVDILLLSHFHVDHSSALPYVLSKTNF
                     KGRVLTTHATKAIYKWLIQDNVRVSNTASSSDQRTTLYTEHDHLSTLPLIETVDFYTT
                     HTINSIRITPYPAGHVLGAAMFLVSIAGLNILFTGDYSREEDRHLIPAEVPRGVKIDV
                     LITESTFGISSNPPRLEREAALMKSITGVLNRGGRVLMPVFALGRAQELLLILDEYWE
                     RHPEYQKAPIYYIGNMARRCMVVYQTYIGAMNDNIKRLFRQRMAEAEASGSKNVSAGP
                     WDFKFVRSLRSLERFDDVGGCVILASPGMLQTGTSRELLERWAPSERNGVVMTGYSVE
                     GTMAKQLLNEPEQIPATMSKGSGGPGSRANPDEDQKVMIPRRCTIDEVSFAAHVDGVE
                     NRNFIEEVGAPVVILVHGEKHQMMRLKSKLLSLNAEKTVKVKVYTPANCDEIRIPFKK
                     DKIAKVVGKLAEETQPTDLDESELMAGVLVQNGFDLSLMAPADLREYAGLTTTTITCR
                     QHLTLNSATMDLIKWALESSFGAIEQFGSSAKESKKENGTNGKLLEEADEEIEYAENE
                     AYLVMGSVVVRYMARTREVELEWEGNMMNDGVADAVMAVLLTVESSPASVKQSCKHHH
                     HDHSHDDSQVESTHRNFNPHERFAQLLMILEAQFGETVTPIERPRVSTQAAANDSATE
                     PAATEAEEEPLSEDERVKAEAAELARLHALGIPFPGVEIKVDTHVARVYLEDLEVECG
                     NAVLRDRIRVVLERAVETVASMWTQEISSRSGHTHANGIAYDQDKLLEKKLAMIEA"
     gene            <960092..>961817
                     /locus_tag="TRUGW13939_08866"
                     /db_xref="GeneID:55996351"
     mRNA            join(<960092..961139,961183..>961817)
                     /locus_tag="TRUGW13939_08866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491992.1"
                     /db_xref="GeneID:55996351"
     CDS             join(960092..961139,961183..961817)
                     /locus_tag="TRUGW13939_08866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347885.1"
                     /db_xref="GeneID:55996351"
                     /translation="MAQTQPQNPSQYPSQSFSPPVSTPSPGAASPANIGAIPPPNKRQ
                     RLSPLPQSQSPYESPVFGTLQLPQNPSPIMNGTNMNGISTPGRGPVVPSPVSVAPAPP
                     GSMGPPSRPAEKPTDAADLTDVLAQSGIDVKEEEAYLTQSYSAPQVTPRPQPPGLNTS
                     FTSTPSTPGTASAGGSFDLSQGRLPATQEQQVYPPYSDNAPYNQPTFEETRAARRSQF
                     HLQEPFLFTKVLEQKMQTRVYELGVRLPTEGLYHPMPGSRQPIEVTGPDGSSSVRRGH
                     TIINQEGAPLVDIMSLMSLCCEERLRGIVEYSASLSKSRRAHSHGVVPLEWKDLAAPA
                     PSSSAAEGSSKRNAPCPRASDNEPITNPLTDKYFTLSSKDLSTEEARAAKRAKRSADA
                     IINETSNSRAPSLDLASGAATPTPQTPAGSDRKGMTKKEARKQIDARASEAQQHQQSV
                     ETARKALSSTLFGGSKKRQYSWLNKGASASAASSPRPHSPAVGATGADKTEKSRSDSV
                     ATPAVARLGNWREDKAAGIQVRDILFVLEQDGRGSRHVQKAYSRDLKEERLE"
     gene            <963227..>965486
                     /locus_tag="TRUGW13939_08867"
                     /db_xref="GeneID:55996352"
     mRNA            join(<963227..964048,964103..964184,964239..964586,
                     964643..965102,965154..965241,965289..>965486)
                     /locus_tag="TRUGW13939_08867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491993.1"
                     /db_xref="GeneID:55996352"
     CDS             join(963227..964048,964103..964184,964239..964586,
                     964643..965102,965154..965241,965289..965486)
                     /locus_tag="TRUGW13939_08867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347886.1"
                     /db_xref="GeneID:55996352"
                     /translation="MSTPSTATATHPSHHPHYGYSHHQVAYQSSNGTYPAGSSAPSRL
                     ANNYTYSASTPTAVAATAQSHPLPSATAKPSSSSSNVPPYVNNNSNSVSMSSAASARR
                     KKPNWQEFYKNGLPKEVIVIDDTPPPDQTTASSRAVVAAGVNGQQPAGKKRRTGVETA
                     YDLSYHDRPSYSMNPQQYGDHHSSAGSLSTDRTTSLHTTAPTSLGSAGSVGTSNGVYF
                     EDANIGQKRKRNTRTSTRQEAKRRELETVGDAFLSYVPPPQPPIKAKDVPVPVIRDYS
                     YTRHEKVDDDDGHYIVNNDTPLTDRYSVVRLLGQGTFGKVVEAFDKQRKVRCAVKIIR
                     SVQKYRDASKIELRVLSTLASNDKTNRNRCIHLRDCFDFRNHICIVTDLLGQSVFDFL
                     KSNSFVPFPSSQIQNFARQLFTSVAFLHDLNLIHTDLKPENILLVNNNYQTFTYNRTI
                     PSSSHTSARNARHRRVLLDSEIRLIDFGSATFDDEYHSSVVSTRHYRAPEIILNLGWS
                     FPCDIWSIGCILVEFFTGDALFQTHDNLEHLAMMESVIGGRIDPKLVRQAVQGRGNSQ
                     NQAAKYFNRTKLDYPNAETTRASRKYVKAMKQLHEFIIPLTPFNKLFLDLLQKIFVYD
                     PKQRLTAKQALKHPWFKESTVDDGTEAVRLANLHSRSQSRN"
     gene            <966877..>967464
                     /locus_tag="TRUGW13939_08868"
                     /db_xref="GeneID:55996353"
     mRNA            join(<966877..967163,967238..967315,967365..>967464)
                     /locus_tag="TRUGW13939_08868"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491994.1"
                     /db_xref="GeneID:55996353"
     CDS             join(966877..967163,967238..967315,967365..967464)
                     /locus_tag="TRUGW13939_08868"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347887.1"
                     /db_xref="GeneID:55996353"
                     /translation="MSSAARKAQADTNRSQDMASEIKALRKFAENTAKHAPHLVAEWH
                     TKQGDDGIVPTGFISYLLMTWCPGVPLGEGRYESMPQAKKKKVFKAFKEALEDTKRCG
                     VVSKGDNPTLLWDAENDEKCYMVDFKFSGRPHYIDVAERIWQRWGLQPGPPE"
     gene            complement(<967696..>968701)
                     /locus_tag="TRUGW13939_08869"
                     /db_xref="GeneID:55996354"
     mRNA            complement(join(<967696..968125,968172..968465,
                     968517..>968701))
                     /locus_tag="TRUGW13939_08869"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491995.1"
                     /db_xref="GeneID:55996354"
     CDS             complement(join(967696..968125,968172..968465,
                     968517..968701))
                     /locus_tag="TRUGW13939_08869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347888.1"
                     /db_xref="GeneID:55996354"
                     /translation="MKDLIPSRYGLSHYLTTATNCLLAKMRGMLMPDKKNEAAELRLV
                     PMWPPRPSVHRSCLVFMRFQLMQLLTCSDGAIWSHHTLGSINLIKHRTPRRFDSDFDK
                     ALFVAHIGPIVFDCLLDHRPCYLAEPQWMEIYHSLVCDLNTLTERSLLATSMRSQMIK
                     LPDLWHDLNRTIRGSDLFNEEGQVSLLFRCFNARQQFLDWIEEYQSYCTRMSPVSPSP
                     QELALRRELYGTAIECLIVVKRLLETIIYTDESLAIEAEVQALAQSLLDLQKQPSPKH
                     SWLFMGHEMGVTRSVLLTRHQWESPM"
     gene            complement(<969734..>970344)
                     /locus_tag="TRUGW13939_08870"
                     /db_xref="GeneID:55996355"
     mRNA            complement(join(<969734..970242,970296..>970344))
                     /locus_tag="TRUGW13939_08870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491996.1"
                     /db_xref="GeneID:55996355"
     CDS             complement(join(969734..970242,970296..970344))
                     /locus_tag="TRUGW13939_08870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347889.1"
                     /db_xref="GeneID:55996355"
                     /translation="MKSIPSSMALIASCATALSVHEEQNAFNLILIASDSSINGSSLI
                     ATNAYEVDSMGLLMPVNEDPDPGTGPAVASVFYTDAATGTLCTNSLLTGIQRFAYTAY
                     SNYTSSLRFDTMENNAGLNVSFPPFTLKNGWLTAPGNLTWAWCPDSDDVGDAWYLPGT
                     VTLGSVFHGCEAIDGLLLAVNQTSS"
     gene            <971394..>972688
                     /locus_tag="TRUGW13939_08871"
                     /db_xref="GeneID:55996356"
     mRNA            join(<971394..971577,971636..971943,971995..972347,
                     972418..972577,972641..>972688)
                     /locus_tag="TRUGW13939_08871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491997.1"
                     /db_xref="GeneID:55996356"
     CDS             join(971394..971577,971636..971943,971995..972347,
                     972418..972577,972641..972688)
                     /locus_tag="TRUGW13939_08871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347890.1"
                     /db_xref="GeneID:55996356"
                     /translation="MSVSNTFLDIENNVASQRPLGDESRWSALLKSGIERVVVIFGHS
                     LLQAVVKERKEKAGYSLSMFNQRGQCLFLCLRSQGDHYALQVPCMRPAPRKSIGHSLK
                     EIDGMLEMAPGGEIYAPLTAKEVALESDTVIWHRIRETYFSNKGKWKRWLPFYGPTTV
                     REVEFQFVGVVDPGDRYKVFGVTPVDIEKVRERADSRIALEPNDVDIEYGYSGCGQCF
                     TKNCPAFIDRSRPCNLDLINEAKQQKKKLCLLGQLKDCANSPSVANGLNTLGGMAQNS
                     CIYDLEGENKVVIPKLNQPYDQTDTVRGIEMVMGWQIDRMKLKVPKFIAWAWFSLALI
                     WLLAAFFGLVIMYAKD"
     gene            complement(<972775..>973482)
                     /locus_tag="TRUGW13939_08872"
                     /db_xref="GeneID:55996357"
     mRNA            complement(<972775..>973482)
                     /locus_tag="TRUGW13939_08872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491998.1"
                     /db_xref="GeneID:55996357"
     CDS             complement(972775..973482)
                     /locus_tag="TRUGW13939_08872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347891.1"
                     /db_xref="GeneID:55996357"
                     /translation="MDGFLSIPGELRNIIYKQLLVLEDPIDPLSGSKQLLLHTELLYT
                     NKQIYHESVSVLYGHNSFDLAGYDFELLARFLNQIGRNNASYIQCIWLGFPCLRDIED
                     ELTFEDDSSQILTKIQSDCTALKTLMFTPFNTHTMGLELDAIESPEIVTKALSMIDAR
                     FRGIASLKEVILEVYEDAPILDIRERIESQGWTINVVEREEEIVWDHDGFSGFGDDNY
                     YNDSSEHEYGTDDNSDF"
     gene            <974345..>974910
                     /locus_tag="TRUGW13939_08873"
                     /db_xref="GeneID:55996358"
     mRNA            join(<974345..974605,974668..>974910)
                     /locus_tag="TRUGW13939_08873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035491999.1"
                     /db_xref="GeneID:55996358"
     CDS             join(974345..974605,974668..974910)
                     /locus_tag="TRUGW13939_08873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347892.1"
                     /db_xref="GeneID:55996358"
                     /translation="MVYISSSTTAAVNPIASEPKLNIKELYSALVYKARHPEGFVAAI
                     ESSTIEHEHATGLTRRVVFKPGFMGKVEKQVVEEVVEFFPPTRVDFKVPATGMQVSNV
                     ISHEADKEDELYLTFSFDFPHPGITDREAQKDEVEAHQAEARKGGSKVVPHTIEVARQ
                     MKIDGEL"
     gene            complement(<975037..>977253)
                     /locus_tag="TRUGW13939_08874"
                     /db_xref="GeneID:55996359"
     mRNA            complement(join(<975037..975717,975765..975859,
                     975922..976055,976115..976251,976507..>977253))
                     /locus_tag="TRUGW13939_08874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492000.1"
                     /db_xref="GeneID:55996359"
     CDS             complement(join(975037..975717,975765..975859,
                     975922..976055,976115..976251,976507..977253))
                     /locus_tag="TRUGW13939_08874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347893.1"
                     /db_xref="GeneID:55996359"
                     /translation="MQLLSFRKTQKIIMPDKLYQYSTASALMAGVASRGIRLSELLSH
                     GTHGLGTMASINGEVVIIDSITYHLQPTGTVRVVDAHEELPFAMITAFNDCVTKKQAT
                     FPNLPDKESLLQHLQSLHHGTPNRFVCFVIPRVRLDHLKARVVRGQQYPRQPLSELGD
                     AQKVNTYQDVAGSIVGFWSPKYMDGVSVSGLHMHFLSEDKQFGGHILELKSTREIGVQ
                     AAVLNEFDLELADNEDFSEATLGTGGEALRKSRGRPVFVAGAMSSSLPGSRELPRSQY
                     DLTTYLGRVREAAGISDPRMLFVSSSGLENAKKAITAYKNGHVNEMSPELWRAKQIVD
                     STLHPDTGQPVFLPFRMSSFVFSNLIVTAGMLTPGLKTTGTLLWQITNQSLNVAINAS
                     NANKSTPLTTSMMVKSYLMAVSASCSVALGLNAIVPRIKNISPNTKLILGRLVPFAAV
                     SSATALNVFLMRGEEIRSGIDVYPVLSEEEKKKREITGEPIESLGKSKAAAKIAVGET
                     AISRVLNATPIMVLPPLILVRLEKMDWLKARPRLVTPVNLGLILTTSVFALPLALGAF
                     PSRQAISASSLEEEFWDKGGEGGKLEFNRGM"
     gene            <977508..>979202
                     /locus_tag="TRUGW13939_08875"
                     /db_xref="GeneID:55996360"
     mRNA            <977508..>979202
                     /locus_tag="TRUGW13939_08875"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492001.1"
                     /db_xref="GeneID:55996360"
     CDS             977508..979202
                     /locus_tag="TRUGW13939_08875"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347894.1"
                     /db_xref="GeneID:55996360"
                     /translation="MSTRNLANVTVESLANAGVNLVFGIPGAKVDGIFDALIDHPTIR
                     LIVCRHEQNAAFMAAAVGRLTGLPGVCLVTSGPGTSNLVTGLATATSEGDPVIAIAGT
                     VSRVQAGRHTHQALDVNKVLEGVCKSVTQVGVEDQVSEVIANAFRRARRYPRGATAVA
                     FPIDLIKSTSVAISPFPSLSFEPPSYGGGNTKLRKIAVDRLMAAKYPVILMGMRSANK
                     AIVASTQRLIKDYTIPVVETFQAAGAISEDLLHRFYGRVGLFRNQPGDKVLARADIII
                     AIGYDPFEYDAEVWNVDPSRHSIIHIDYTDTKVSQHYLPQIELIGNPADIIDELTSSI
                     RASKPNYWTGAEDRLENIRQELDSWQATATAGLSTEDPVQPIHFVHLLRSLLPKETVV
                     AVDVGTVYIYMMRYFRTYLPHHLLCSNGQQTLGVGLPWAIAASLIQQPPCSEKVVSIS
                     GDGGFMFSSQELATAVQQGCNITHFIWNDSAYNMVEFQEEAKYGRSSGIKLGGVDFVK
                     FADAFNAKGFRVSTAGELKTVMQEALAYKGVAIVEIVIDYSKSSDLMRNVIPNDYK"
     gene            complement(<979524..>981862)
                     /locus_tag="TRUGW13939_08876"
                     /db_xref="GeneID:55996361"
     mRNA            complement(join(<979524..979710,979776..>981862))
                     /locus_tag="TRUGW13939_08876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492002.1"
                     /db_xref="GeneID:55996361"
     CDS             complement(join(979524..979710,979776..981862))
                     /locus_tag="TRUGW13939_08876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347895.1"
                     /db_xref="GeneID:55996361"
                     /translation="MTTLMDAMSAFSFSYPNGEPQTPTRTPTASEAFGDACFQTPKFE
                     SSFYDPRVTWDTADPYASSPELLKTPQKFIFGTPGNSLQALDGSFGQHISPNIAAKGP
                     VDTDTIKRKRGSRPTTNFGDEGPGTVNSTRSAATIQTPPPTSTSRRRAGDSGDADQGF
                     LESVRRLTAATDGHLETPSRLIGASPQLFANLENSPDLFRFSTIDPSASPFYPQQKLF
                     LDQEGNDFSSLPTHPFGHSGNASAATPNVASQSQTLEVPPLPTMQGSLDLPEFSHNNT
                     FAFGAPAPADAALFPAPFSTSPRVLIPKADDPSLFLSSPARRFGPSQPVPEPRTAPRP
                     TRQPYHHQTEEAKRESLRRTSQVQSRPLSGAWSFDDEDDDFTPRAQAFKPGLTRSQTT
                     TAIPSSLAHSRQQSQQSSAGSLASTSGVKKAPPKGRISPVKTMRQPLPRSNSSSLPSR
                     SQSLILKIDKDGRAKTEFQPTGTQFTGLTDPILEMEIDGSATESESDSADFSDYPAVH
                     SGRNSFAYQGSASLVGRTGSISRPNSKSSHASSHSGRRSPWADSRTRRPQSAVIPPEW
                     INTPRRFSIPANPNFTRHSSSTDSTLPDPDEDSGDAQHALRQVLQGRGRHTIGRYAGG
                     RMPISQSMNHLPSSPPGLGRFDLGPGDPATSPTTITDPDVGTPSTDRRSNPSNGTRCV
                     CKSMENGGHLMIQCESCSHWLHTKCVGLNRANLPPVYICVYCCATPMRGGRLRDPVVG
                     APHAASSPLARKSFRHR"
     gene            <984397..>987979
                     /locus_tag="TRUGW13939_08877"
                     /db_xref="GeneID:55996362"
     mRNA            join(<984397..984597,984662..984784,984841..985425,
                     985711..985943,986005..>987979)
                     /locus_tag="TRUGW13939_08877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492003.1"
                     /db_xref="GeneID:55996362"
     CDS             join(984397..984597,984662..984784,984841..985425,
                     985711..985943,986005..987979)
                     /locus_tag="TRUGW13939_08877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347896.1"
                     /db_xref="GeneID:55996362"
                     /translation="MAATQTGSRKRKPPRRRLQSNATRGGRTKKVKKNKKPARSPLHG
                     LQDSAKEDIYRSRLPELNDPYEEPCMVADPMPEGYIFVARGDPYVTRNCKIHSKATTD
                     MVFIVYDRKAKDKLGIRVKKETYEHVTELASQTADKRAAAVLAQDTRDEKKAQKILKQ
                     TFPDIPPKCAKTILQHAFLKGSGRVGRSTKQPDTMKARLAVEAHIRHQHTSYDSLLGD
                     GTGRDDARAAVRKTVHALRDQWAGKSKSATVSKSASESISATESISATESISATESIS
                     ETEESSEEESPRRMTRLRLRPRLASPEPPTMEKEDIVESPRKRLKTEDAATSQANELV
                     SVPALTPNSNNGSGGYATAKNTKEADVGITEFVSAETPGFEGILKKRYTDFLVNEILP
                     SGEVLHLRNTEVPLKISSQLNKTVEKEEQKPTEEDKNQDEPATEEAAPEAFQLADNDL
                     ELLKSLFGDDVSQQIIDFHARVRGAPKAAPGKFGQVNAGVVDGKDTRTKMHMTLRRVF
                     NSLLSSVTDKDNNMIISATPNRHKKAPKGFRGETGNRNERTKWDDLGGPYLHFTIYKE
                     NKDTMEIIGFLARMLRMNSKSFQFAGTKDRRGVTVQRACVFKVLAERLSSLNKTLRNA
                     VLVDFEYSKHGLELGELNGNEFVITLRECEFPDSQDSQSSLDRAKGLVETAMHNLRDR
                     GYLNYYGLQRFGTFSKGTHETGIKLLQSDFKGAVDTILDYSPRVLAAAQGSEAESAGS
                     FISSDDMARAEAIYIFNTTRNVNNALDKLPRKFTAETSIIRHLGRSGNDYLGALQAVP
                     RNLRLMYVHAYQSLVWNHAAGERWRVYGDKVVEGDLIIINKQEEQATDEQTVDADGEV
                     IIAPQAEDSATTADDAFTRARPLSADEAASGKYTIFDIVLPTPGFDICYPANQMTEFY
                     KKFMASEQGGGLDPFDMRRKRRDIGLSGSYRTLLSRPGADYSYQVKAYSQDDQQLVET
                     DLESLKQEKTSSNDEEVQQPESAVEGDKIAAVLKFQLGAGQYATMALRELMKLGGVRE
                     YKPEFMGR"
     gene            complement(<988885..>989698)
                     /locus_tag="TRUGW13939_08878"
                     /db_xref="GeneID:55996363"
     mRNA            complement(join(<988885..989424,989514..989605,
                     989656..>989698))
                     /locus_tag="TRUGW13939_08878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492004.1"
                     /db_xref="GeneID:55996363"
     CDS             complement(join(988885..989424,989514..989605,
                     989656..989698))
                     /locus_tag="TRUGW13939_08878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347897.1"
                     /db_xref="GeneID:55996363"
                     /translation="MAALTNSPSVCWSIDTIVGRTLLSSYVTAACANQVKRDIEESVF
                     QARINSALQGLDYRKILGNLNNEVYVEIGQDHQRSLHQAIGFLHRTKPDDEYKHMVDE
                     YLVSEVFDISSQYAESNSSTGLNECSPPPYSTAREAEPQDPERQSPSRSDIEIWRYTS
                     RLWEEGTSSGQVPAVTDELLRRFPPLYKVTVDFKGLEGEGQAPNKKQAKHIASKDICQ
                     KLGIIL"
     gene            <990103..>990617
                     /locus_tag="TRUGW13939_08879"
                     /db_xref="GeneID:55996364"
     mRNA            join(<990103..990110,990299..>990617)
                     /locus_tag="TRUGW13939_08879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492005.1"
                     /db_xref="GeneID:55996364"
     CDS             join(990103..990110,990299..990617)
                     /locus_tag="TRUGW13939_08879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347898.1"
                     /db_xref="GeneID:55996364"
                     /translation="MSGRDEVAFQSREAALNEATFNKATFNKATFNKATFNKATFNKA
                     TFNKTTFNKATFNKATFNKATFNKATFNKATFNKATFNKATFNKATFNKATFNKATLQ
                     ESAGNI"
     gene            complement(<991156..>991794)
                     /locus_tag="TRUGW13939_08880"
                     /db_xref="GeneID:55996365"
     mRNA            complement(<991156..>991794)
                     /locus_tag="TRUGW13939_08880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492006.1"
                     /db_xref="GeneID:55996365"
     CDS             complement(991156..991794)
                     /locus_tag="TRUGW13939_08880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347899.1"
                     /db_xref="GeneID:55996365"
                     /translation="MASTNDRFAIKSQTDAIKRQIAESLWGPQPIVKRFSNGERSREL
                     NFDAYFRFYDSSYARFHNRQGTMWAQTCQQNLWIVEQIRNNRTRENIRDMMARGNPAC
                     SPDSSIDLAAQLLLMLKFDANPLNAISGTTKIMWTHGTVKSSIDKHFSHEPETTEACV
                     FLDQDFTGHNIEQIAGIKIVWTDNLADHLRLVERDTKVAIFHHVTFLECQEK"
     gene            <992398..>994137
                     /locus_tag="TRUGW13939_08881"
                     /db_xref="GeneID:55996366"
     mRNA            <992398..>994137
                     /locus_tag="TRUGW13939_08881"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492007.1"
                     /db_xref="GeneID:55996366"
     CDS             992398..994137
                     /locus_tag="TRUGW13939_08881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347900.1"
                     /db_xref="GeneID:55996366"
                     /translation="MRILFTNKLAPAIQDYLEQCLEPSLDELHWSLYMCGHNFETARP
                     YLVFSSTNAKKRKTAIELVRGSGILRDAPTVKLRHTCYIPGLHAPMELLGDHVRVDAS
                     HNPASNESFYYMPSENTLGVSVFVAGLPNESRMRQATAGGIICVGSRFFYLTVSHVLE
                     QDEELQLPGGKSRNQSQILDEDDSSDEEEEEGGVSELRSDDSISTDGYVISTSSSCVN
                     QYSEDGESLNEASHGILAIARLHDEIALFQVQRPLQSSTAQFVPSGFIELGPPDRIRS
                     HKLDYLLIEIHDKSLIRPNILSASRTPLSSISVDKVAQIDNEDCDVAVLTASRGVLRG
                     VLIATPRYLSLPKATTMRKTFSLRLDGIIQRGDCGSWVVDATSGHFYGHIFGGGAGTR
                     TAYIIPAADIFDDIRAKCAQPVILPSATGENVQTHSRIPSNELHSGSKASQQPDSSGL
                     QEAGTLEDKTVSKVNHEAFKEILDDIMCPGDSSNSTESLAENAPQKFAVTDRDIEVLS
                     SGNVSETPKNHQISETSCSSPAVKLKPKFLEENSKPKSSFYVPSFRTYTSKHRDAAQD
                     PAEKADNVNHTDG"
     gene            <995009..>997685
                     /locus_tag="TRUGW13939_08882"
                     /db_xref="GeneID:55996367"
     mRNA            join(<995009..995146,995218..996113,996169..997130,
                     997189..>997685)
                     /locus_tag="TRUGW13939_08882"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492008.1"
                     /db_xref="GeneID:55996367"
     CDS             join(995009..995146,995218..996113,996169..997130,
                     997189..997685)
                     /locus_tag="TRUGW13939_08882"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347901.1"
                     /db_xref="GeneID:55996367"
                     /translation="MAAAGFRSVPAFSIPTSDEAFLPRFVLSFYIALHNQPTPRFNMI
                     QARRAAALATRRCVTHVGRASTQRPPSWLSTCRSYSVTGYNAKPKAFHSQLENTPNAD
                     DLLSSLSSSAPATSTPQTLTEKIVQRYSVGLPEGKKVKSGSYISIAPHHCMSHDNSWP
                     IATKFLDIGATKVHDNRQVVMTLDHDVQNKSESNLKKYRQIEEFARTHGVDFYPAGRG
                     IGHQIMIEEGYAWPGTVTVASDSHSNSYGAVGSLGSPIVRTDAASIWATGRTWWQVPP
                     VAKVTLVGILPPGVTGKDVIIALCGLFNQDDVLNHSIEFVGSEQTMRSISIDERITIA
                     NMTTEWGALSGLFPIDSVLINWLRARATTSAMLNPELGDKSRFTHERIDELIENPLTA
                     DSGATYAKSLYLNLSTLSPFVAGPNSVKVATPLRDLEAKKIPVNKAYLVSCTNSRASD
                     IAAAARVFREATKDGVTPKIAPGVNLYIAAASIPEQRIAEAAGDWQVLLDAGAKPLPS
                     GCGPCIGLGTGLLEPGEVGISASNRNFSGRMGARDAMAYLASPEVVAASALDGHIAGP
                     GWYQKPEGVEKVIIGEGSGDHQADVALSVEDALDKIIAQAESMIVDAEKDSTDSTDSA
                     AAAVDDAEETLTDILPGFPEKVEGEIVFCDADNINTDGIYPGRYTYQDNLPAQKMAEV
                     CMENYDAAFKEIAREGDVLVSGYNFGCGSSREQAATAILAKKIPLVVAGSFSNIFGRN
                     SINNALMSVEVPRLVQRLRERFAKGKDGADTQLTRRTGWKFLWDVRRSKVVVTEDNGE
                     TWSQKVGELPPNVQEIIARGGLEKWVKAEIQK"
     gene            <998418..>999706
                     /locus_tag="TRUGW13939_08883"
                     /db_xref="GeneID:55996368"
     mRNA            join(<998418..999026,999080..>999706)
                     /locus_tag="TRUGW13939_08883"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492009.1"
                     /db_xref="GeneID:55996368"
     CDS             join(998418..999026,999080..999706)
                     /locus_tag="TRUGW13939_08883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347902.1"
                     /db_xref="GeneID:55996368"
                     /translation="MSYPQDRRRRAGAGFSATGNRTFMGYWVPLAITVGVATISIAAW
                     VWSEREEGDDEGEYGRNHPDNYPPPGPDGGLPPGADFARSAPSDARQDDNTVMGRMQG
                     ALRRTPSPQQLLDGASRRVAAGVAAAGAMVGGALSSIREERGDFEDHSRWSEEADSRA
                     RGTAEPGPRGVAPSSNRKKTVALVVSADALSGESDDISLAEHASILSHLPSHVNPDVT
                     RVFVLIYAPGLKHAIGIPSSTRPTPSVDSSYSNIGHEEAVDAGAPAGNDLTALAPQST
                     DDLETTSPLFKTLYTQAQTVVDKDTMIMPYSTSNGHLYLLRHLSPDTVYIQESLSGNE
                     GDTVKQLSSWVRHVVVVVGDEGGRGGLVDSEDESALAGEQREKWWQKEGVTGIGKHID
                     VVDSLKIGDDWRRRISGHD"
     gene            <1000704..>1003577
                     /locus_tag="TRUGW13939_08884"
                     /db_xref="GeneID:55996369"
     mRNA            join(<1000704..1001043,1001108..1001320,1001398..>1003577)
                     /locus_tag="TRUGW13939_08884"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492010.1"
                     /db_xref="GeneID:55996369"
     CDS             join(1000704..1001043,1001108..1001320,1001398..1003577)
                     /locus_tag="TRUGW13939_08884"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347903.1"
                     /db_xref="GeneID:55996369"
                     /translation="MMATAVSKPASQPPKMKRPPPSFTQTAVNGIKQSPSASSSPSVT
                     SKRLPGTNQPSTNSVAGPVANGVNNRPINKMRKDSQKPGDPLVRPQRPSTRNSVVETD
                     RRLTKIPPEPFVKTTSYILKRYAKAQPSLIIHLHPTHFRFDQQDGSFPYNSEMKVIIE
                     HIRSQTVPHDMLEELLRAGVKFYEVKVVDHKSVSAQTSKSTIPSSDEKNTPFSIHNYN
                     QHVTPSPYIPYPKQNQVRPEKIDSPRLETSGKEPGASTAEDSSAGQDGTTNGVSAGES
                     SAKQPTPKPKVFTTVLHPTSLSIQAELTYLSTTPHPLANAIANANKKQPTTQATSKTS
                     TTSTAGPPPAKRQKMLVDPEDLPEFEAKLIRAVAPPLYLDPVDNFESAQRLLQLMESP
                     LHRDKPPSSKTRKRTVAELAADEALAAEEERFMLIMDERLEPATSSAASGAKSAVDDT
                     AGAVPFEPRFSRFKTIENIRIQHEEKAKREHEKQVQQEHIKRQQQQEQERERRRMIDQ
                     RQAEEHAKEERRQQLVAQQAHAQLAAQQQQRLANGLSQASQGQMSSPIVRNQTPHNTS
                     SPVVGNNVGVAVGGVPMNVTASAQGAGSPPRPPSTMHHAHPGVMSHPMAASRSQQSQS
                     RNGTPQMTQGTPAMGHATPVMRNVTPTQRMGHSSPPNSSMAQTPVMTQSMMGTPQMGG
                     AGMGLTPQQQQHLILQQRQQQLLAQQGLNPQQVAQMQAQHNIQSHHQQQQQLLHQQQQ
                     LQQQNQQQLQQNVHSQHSYQAQLLRTQMAQMQMAQQKQGGQQQAGMQMTPQQQQQQQM
                     LLAAAQQNGGQVAQGPLQWGNRHQQMYQQRIISLRQDIVRRYGQQYGAPQSFPPQLAQ
                     QYSAGVEKSARAYVMEMMRKEQVAIRHAAVLQQQQQQQQQQQQQQQMMANGMGK"
     gene            <1012080..>1013725
                     /locus_tag="TRUGW13939_08885"
                     /db_xref="GeneID:55996370"
     mRNA            join(<1012080..1012092,1012386..>1013725)
                     /locus_tag="TRUGW13939_08885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492011.1"
                     /db_xref="GeneID:55996370"
     CDS             join(1012080..1012092,1012386..1013725)
                     /locus_tag="TRUGW13939_08885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347904.1"
                     /db_xref="GeneID:55996370"
                     /translation="MAFEARDVEIDPALQDLGYPTPDSEDMRSEYNMADRLTIDVECP
                     PLGTSTCSSFSPMDSPTPTPTSLYSQGSLASPGWHDGGAYSHGLEGTRTATPLRSSFR
                     MADITAGDGMMQQYENVDGHERVPLFDYMPGYSDNVEQFWIPQDIPKAYEPANSFQCQ
                     PNMGPQYPQMVRNCYRNNQPSYLPESASNPCLSRPIFHQTERLPNTMSMTNMSQWMPP
                     ADMMQPQTITPAQAFTQAPMTPPSSYAGFPGSANTLRTHTPVTPVRSCSLGSGTETPM
                     SRLSGGHSDNTDEEWLSPGMRESLRHRQPQRQLSRKSLKKSSSKQSLRLENLPSIIKQ
                     VQFKCTEPGCKGRFKRQEHLKRHMKSHSKEKPHVCWVPGCNRGFSRSDNLNAHYTKTH
                     SKRGGRNRYVATLDETSPDFDPEFRGQLTPDGRPIYGSKLDDPIPMDSTDADGESWDE
                     "
     gene            <1015785..>1017524
                     /locus_tag="TRUGW13939_08886"
                     /db_xref="GeneID:55996371"
     mRNA            join(<1015785..1016145,1016200..1016313,1016368..1016494,
                     1016552..1016990,1017042..>1017524)
                     /locus_tag="TRUGW13939_08886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492012.1"
                     /db_xref="GeneID:55996371"
     CDS             join(1015785..1016145,1016200..1016313,1016368..1016494,
                     1016552..1016990,1017042..1017524)
                     /locus_tag="TRUGW13939_08886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347905.1"
                     /db_xref="GeneID:55996371"
                     /translation="MTSHQHGDETTEYTPLLGDAPPPQQPDWKQRLLPQWTPKKWRVI
                     LVTVMILLFVNFGDTLSTAPQVRIFEEAACRKYKRSIGLVEPNGTVVLDGDICKSEPV
                     QSEVALVIGWKNTLDILPSVAFGLPYGVVADKIGRRPVIIISLAAIALSEILPRLVCW
                     FDWPLRLVWLTGIARAPGGGQLVATTMLLTIVADIFEADERATALFRLTSLSIAAEIV
                     ATPISASVMNIDPWIPYFLGLAIMLVTAMASFFMPETLDDAKARRLLAEEIEDEEDIP
                     ESLQPSPTAKDTVFNTIITQAQDFISSTRHMWRNPKLVVLLSVAFAGSMDRSSLFLII
                     QYASTKFSWSISEASYLISVRGCVSLAAFWVLIPFLSTYLTRSLHYSAVEKDLYVSRI
                     SAFFGALGYFLLFIAPTPAPLVIGTLFMSLSLPFVVGVMSVATSFVSPEHVATLYSAM
                     SVMQSLGAIVAGPTFAKLYAVGMQLGLAWSGLPFAAGSLIFVVVLIPMMFLRPARVD"
     gene            <1018935..>1019985
                     /locus_tag="TRUGW13939_08887"
                     /db_xref="GeneID:55996372"
     mRNA            join(<1018935..1019179,1019234..1019528,1019610..1019805,
                     1019868..1019921,1019978..>1019985)
                     /locus_tag="TRUGW13939_08887"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492013.1"
                     /db_xref="GeneID:55996372"
     CDS             join(1018935..1019179,1019234..1019528,1019610..1019805,
                     1019868..1019921,1019978..1019985)
                     /locus_tag="TRUGW13939_08887"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347906.1"
                     /db_xref="GeneID:55996372"
                     /translation="MSRSLSLLAASAAVTGALASIQACQNSSLTTSCSSSSSYSLSAR
                     ASGSCCLESPGGLLLQTQFWDAKPAIGPADSWGIHGLWPDNCDGTFSSSCDSSRAYDD
                     IESLLEDAGKTDTLAYMKKYWQSNDQDVETFWEHEWSKHGTCINTIEPSCYTNYKKGD
                     EAVDFFGKVVSLFKELDTYSALKDAGITPSDSKTYKLSDIEDAAGKLHNGKKVYFSCS
                     SNEISAAYYYFHLRGNAINGEYVPVDTPEDSDCPSSGIKYPVKESSS"
     gene            complement(<1020194..>1021330)
                     /locus_tag="TRUGW13939_08888"
                     /db_xref="GeneID:55996373"
     mRNA            complement(join(<1020194..1020863,1020918..>1021330))
                     /locus_tag="TRUGW13939_08888"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492014.1"
                     /db_xref="GeneID:55996373"
     CDS             complement(join(1020194..1020863,1020918..1021330))
                     /locus_tag="TRUGW13939_08888"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347907.1"
                     /db_xref="GeneID:55996373"
                     /translation="MAGDLENDPSAAALDLDNSEAYDSAEDEDFQLEEAGGAAEDSGL
                     SSSEEEEDESGAGNDRPTKRRKLAKTSTKKPDVAAEQMELDSGDEITIQKAKSKKKKR
                     KTKGQADEDDEDVMFDEDEEGGEGGFVKTRSMRTKIQEDRKPLAKIDGATIDVDALWA
                     QMNAPEPEPGLLSATSKPTEGDEEQELPTDQDKENVTAEPQTQEKLASEDLIKIKRTY
                     KFAGEMHTEEKLVPRDSAEAKLYLAETNGEKAAEEVQSDNNVVKFRRPLRKISRFDPN
                     PSGVIKKSWEKQAITLDQDAKGPKLNTVEKSRLDWAQYVDEEGIKDELNVHSKAKEGY
                     LGRMDFLGRVDANREEERRNIRLKGL"
     gene            <1021786..>1023632
                     /locus_tag="TRUGW13939_08889"
                     /db_xref="GeneID:55996374"
     mRNA            join(<1021786..1021966,1022032..>1023632)
                     /locus_tag="TRUGW13939_08889"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492015.1"
                     /db_xref="GeneID:55996374"
     CDS             join(1021786..1021966,1022032..1023632)
                     /locus_tag="TRUGW13939_08889"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347908.1"
                     /db_xref="GeneID:55996374"
                     /translation="MPHSVPVPAAGFQALILCGPGVSLNTFTSNPEEYPKALIPVANK
                     PMVYWGLDWCYRMGITNITLVTPPASQAPLETALSQNPHLTSLPAPSPTVVAPKELTL
                     TTGTAELLRLPEIQSAIKSDFILLPCDLICEIPGESLLEAWMVSQAALGGADEDNGIT
                     HSGTKITGLGGEKGGRRGGMGVWYETRGKEESVKGEVADFVGTAPLEQDEAPVVYPPV
                     DGPSSIRYNLSKLVYAAPMDSLKEKMEDDKGLLLRHSLVNKHARIKLLTTYRDAHIYI
                     FPYWVKEMAKRNEKFQSISEDLVGWWAKAEWQTGLGEKLGLREILEPQEDGRGENGSH
                     DGFTVEDEVDLKAMSTTRPTVSRPEEDSLDESGETRFASRVNTLASEFDSEAPSTKSK
                     TKLTVPSMLAYIHSSLPSAPLVRRVDNSSLLLSISLKLAKLEPIEEVGRQAASPFAHA
                     AKIAYPAGIAQRCTVTKHDCLLSENVTVEEKCVIKESVIGANCHIASGARLTRCLIMD
                     GAVVGERSVLTGCVVGRRSRIGRESVLKDCEVQDGNAVPDETDAKNEKFMVFEGLDTE
                     DGDEAMSTEDDHEAGKGFDEGGQDLGF"
     gene            complement(<1023913..>1024896)
                     /locus_tag="TRUGW13939_08890"
                     /db_xref="GeneID:55996375"
     mRNA            complement(<1023913..>1024896)
                     /locus_tag="TRUGW13939_08890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492016.1"
                     /db_xref="GeneID:55996375"
     CDS             complement(1023913..1024896)
                     /locus_tag="TRUGW13939_08890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347909.1"
                     /db_xref="GeneID:55996375"
                     /translation="MGQCSSCRLEDNLQRDPNYDSNASTYSIFSTPMSSDSDRQVSIL
                     DLNVGSRILPSSPPPLPDMNPANLSANTQNQGMSVRSPEASLSVDDWITVSTSSNIDS
                     EATTYIQQNSDADIINLRQTIPNRDRANNSSSPTSSSDFTTISTDSGSSSGIVEVRKK
                     GRRNRGWNRHTLNHRREDNDDRAVEPRTPRKKKNRGSRHYNSNRVSKNQHRASSSPQA
                     GPSRQPPTPVSAPRIKVKMYSFESTDEEERYKLKFGRFIQDLVQEFEPNVYQNCGVDP
                     ASLADIDKNIRFHKKKLNEYAAAVREANYLSKLINRRSTTQYSESSDESGN"
     gene            <1028507..>1029549
                     /locus_tag="TRUGW13939_08891"
                     /db_xref="GeneID:55996376"
     mRNA            join(<1028507..1028680,1028741..1029149,1029212..>1029549)
                     /locus_tag="TRUGW13939_08891"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492017.1"
                     /db_xref="GeneID:55996376"
     CDS             join(1028507..1028680,1028741..1029149,1029212..1029549)
                     /locus_tag="TRUGW13939_08891"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347910.1"
                     /db_xref="GeneID:55996376"
                     /translation="MSKIITVFGATGLQGGSVIRAVQSHPQLSYEFRIRGVARDPSKP
                     AAKKLASTGVDLVRADLNDVDSMITAIKGSHTVFLVTQFEDSYSYDVEVQQGKNAADA
                     CKRTGIEHMIFSSLVDISQASNNVLTKVVHFDSKAHIEQYIRDIGLPATFVLAGSYMQ
                     NQFYTIRKAGDEYVLPLPAGDNMQFPLLDVASDYGKFVNIALLQRQDMLGKRIYAAQG
                     YYRPSRIANELSEILNRPARVLILPPEEFQKLMPATMAEDLTEMGQAFASPGYYGGAD
                     LKESQKLLQGKLKTWKDFVKHHAGRFLQDA"
     gene            complement(<1031979..>1035828)
                     /locus_tag="TRUGW13939_08892"
                     /db_xref="GeneID:55996377"
     mRNA            complement(join(<1031979..1032025,1032548..1033704,
                     1033767..1034439,1034499..1034675,1034723..1034788,
                     1034844..>1035828))
                     /locus_tag="TRUGW13939_08892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492018.1"
                     /db_xref="GeneID:55996377"
     CDS             complement(join(1031979..1032025,1032548..1033704,
                     1033767..1034439,1034499..1034675,1034723..1034788,
                     1034844..1035828))
                     /locus_tag="TRUGW13939_08892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347911.1"
                     /db_xref="GeneID:55996377"
                     /translation="MATVTGNFRHQDYTVAWICALPLEMTAAAAMLDERHDDLPARPN
                     DSNAYILGRIYGHNVAIACLPSGVYGTTSAATVATQMQSTFESIRFGLMVGIGGGVPS
                     GKVDIRLGDVVVSKPTRDSGGVIQYDYGKTVTGGSFERTGVLNKPPPVLLAAVSRLQA
                     EHGLEPSRIPALLSEAVTRKPRMRESFAYRGEDQDVLFDSEYDHPDFENTCNKCNTRR
                     LVTRPSRASHDPVIHYGLIASGNQVMKHGCSRDNLAQELDVLCFEMEAAGLMDNFPCL
                     VIRGICDYSDSHKNKQWQEYAAATAAAYGKELLSVVHASHVVDTLPAGSITDMSYYKG
                     KPSSKAKFSNSEIARNDGRDVEGLLERISSYDHERIHRRLTQKRLTGTTHWFLDHPDF
                     KAWFTEKRISSLWCSGKIGSGKTMIAFVSQFSYFRYHDFNNHRTAVIDAAKYDLGCPT
                     VFFYCDNEHPAALDASSILSSFIKQLCEFLRRTYSTYLKDVTGEIWKFFGHERVQPDL
                     EDLKEIFIGLFRQVSDVIYVVDGVDALDQEHAKSLLKFIQSLFRDSKPWKGSRILLLS
                     RDQVPGYVNITTFIPGIRQISTSANVMQDIETYIESSITDKTMYRKLTDDPLLIGDIQ
                     RILLAESSGMFLWVYLQLEILWDTCHTNSEIQSALAALPKDLEETYGRCIERINHKDS
                     RVLKVLKWVSFATIPLHVEELREAVAFDLGDTAWNTEKMPQKEFVIGCCANLVVVDSI
                     DNRVRFAHSSVKQYLEKGRERNIIQGYPTTEQGVLECGEFCVAYLSFSDFSLQLSTRR
                     NETAVVAVPPPFLLAQGTLPGLLTRRLFQNPRNQKRSVSVPFRTGTAPTPDRTRYKFL
                     DYAVTNWALQTKQIPHTSLMWEKFEGLATCFNETWNFHPWVSGGRSESSRLHGIFGWA
                     VKEQHQPLLSIARAAGPKLLRVSNVPVIGEGLPALHIASKFGYGTIVRSLMDLCNANV
                     LDLQGYTALHHAASRGHIEICQLLLSAQGIKVNATSNSQYTPLWLAAMVKLLIEKGAD
                     PSSA"
     gene            <1038254..>1038883
                     /locus_tag="TRUGW13939_08893"
                     /db_xref="GeneID:55996378"
     mRNA            <1038254..>1038883
                     /locus_tag="TRUGW13939_08893"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492019.1"
                     /db_xref="GeneID:55996378"
     CDS             1038254..1038883
                     /locus_tag="TRUGW13939_08893"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347912.1"
                     /db_xref="GeneID:55996378"
                     /translation="MSSNDVLNVNTSSYNHLHLAFATLNPDFSINVTQIQDQFDAFVS
                     MTGVQRVISFGGWEFSTSAATYELFHEAVRPANRATFTNNVIDFLNDHKLDGLDFDWE
                     YPGEPDIPGIPALSKEDVQNLADFMTALKKNMTTHAAGKTLAVTAPASWWYLKNIPID
                     VLAQASDYVVYMTYDLHGQWDHGSAFSDLGCSKGNCLRSHVNLTETLNA"
     gene            complement(<1040332..>1040835)
                     /locus_tag="TRUGW13939_08895"
                     /db_xref="GeneID:55996379"
     mRNA            complement(<1040332..>1040835)
                     /locus_tag="TRUGW13939_08895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492020.1"
                     /db_xref="GeneID:55996379"
     CDS             complement(1040332..1040835)
                     /locus_tag="TRUGW13939_08895"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347913.1"
                     /db_xref="GeneID:55996379"
                     /translation="MQEKAISSSNGVEQWTAIQKALNKIIVTYGLNGDDAYHPCLKPI
                     DLSWQLPTTCSTSDLSKRDTCNYDRIFEVYQEVPENETEPGYQDTYWAGFDLSLKQGD
                     NADYLCDSGYQVVGPVPWHKIDTPIPGSLGPLDLNQGKYTGCKYNRGDVTGNGTLTCN
                     GISGTAS"
     gene            complement(<1042990..>1046190)
                     /locus_tag="TRUGW13939_08896"
                     /db_xref="GeneID:55996380"
     mRNA            complement(join(<1042990..1044302,1044355..1044730,
                     1044782..1045375,1045429..1045756,1045823..>1046190))
                     /locus_tag="TRUGW13939_08896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492021.1"
                     /db_xref="GeneID:55996380"
     CDS             complement(join(1042990..1044302,1044355..1044730,
                     1044782..1045375,1045429..1045756,1045823..1046190))
                     /locus_tag="TRUGW13939_08896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347914.1"
                     /db_xref="GeneID:55996380"
                     /translation="MADILAISAAVVQFLDIAVRVSMELSSLYSDLRDVPGELRRLKL
                     DIDQQIAIAKYIQSSHATFQRDSPGTSTSTAPINQTLAHYMLAMDELASLLQSIRSED
                     GSGPLRSWNAIRAVHKRKDVLYVDNLNMVESLTKRTSELSFQIKTLIEELQVNVDRTF
                     HLTQKVEETSTKTDQQLREIPTLTTLSNATNVAISELTSNINSSQQQLITATTRTNAQ
                     VGTLLDQWQELAPTFHEFREILQNNPRLLNSVYQLGGYKSAVGAQPCRSSVYNDRSRG
                     ATTSHFNDFTCRDISQATNVEPFSFLHFRKVFRRQHYRQCSKSKTSETSLEFLMKIIP
                     PTWLLSHTIHLGFSFQSCNSQSSWKISPLVIGTARLVDSSKSPAFRAIQETRKLMYSE
                     TGLQPAQASALERTLKDMFECKQASVFDEDSNGNTLLCETLILYFIYMLRSSDPTATE
                     IISLIRFLIDGGSNPNVHRQVDYKEWIVGEQPGTVLDIFASKLLRLDRNFIRNWPIDN
                     SVYTSLVEAGTIFSRPLGTPIIKYTDFGFIHFEQEMEELQTFEEQVDVCDMNDLMISI
                     IRRNEADFIRALGKDDIDAVSRANGLTSMHLAIYWPWALQQLIQAGGDVNCEDNDQRR
                     PIHLAVGCGQAEAVEILLQCDCSVSTPEYSNSLLQESLTRGREFDHVSSLIIDALIDR
                     HVRLRELGILLLPNYSDISRETISEIEAPKIYDALTRTKHRIPQSLQVDRDEKGVYDT
                     ADMDGLIRLTVTLAEKLWKGGFHRIDDFAPLNGLTPLLQSRYIADFDMVSWFIEKGSS
                     PFTTHRDGLHSGLHLYAARIAHTGAHLKDPRNVPFSPQHWHQLTRREDMWRDSCRCLC
                     STNGCTPISVVIKMSGTFSLMMQHKNYAGMVEFLGICQEKMIYQPEMDPCHTQQLLEA
                     IVFEKMNLQHTCCYVGPLGELGPWPPYFNEGKRIFRDDVKAEFRQALDRYAAKILECQ
                     CPIAEKPICVVLHDTCGSLT"
     gene            <1047078..>1048719
                     /locus_tag="TRUGW13939_08897"
                     /db_xref="GeneID:55996381"
     mRNA            join(<1047078..1047137,1047193..1048151,1048215..>1048719)
                     /locus_tag="TRUGW13939_08897"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492022.1"
                     /db_xref="GeneID:55996381"
     CDS             join(1047078..1047137,1047193..1048151,1048215..1048719)
                     /locus_tag="TRUGW13939_08897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347915.1"
                     /db_xref="GeneID:55996381"
                     /translation="MSSTTTTTVTTHGETTGIPPCNEIIQTLVEAGLGHRLLLPTNSA
                     YESRIESWWALNSRLHPWCIVQPHNAEEVSTILKALLKTGSDSNNSNNGEWHIAVRSG
                     GHGPRYTNNIDNGVTIDLAHMNQASYNRETNIASIGAGGRWATVLAELQKEDVFVPGG
                     RDGSVGVGGFLLGGGLNYFMGRQGLGCDSIKNFEVVLASGKIVNANAQENSDLWRALR
                     GGGSNFGIVTRFDMDALPSRNISYGLRMMSSDYTSEFVDAVVHFTDHFHEHDGDALVP
                     WVMHTSRLAHVGVVAAAIYVNTEGDENSTAFDRIKQIPNIHPDRTFTDSYAVAAERSQ
                     MAGGAWTTNATLTFKNDKQIITRVVDLHSQFVQTLMHALGGENFDSMSFLQPLPGFIG
                     DISNKKGGNVLGLETRHNMIMWTGGILVKTNQNDYDMAHGKLMALMADIKSYAASVDG
                     EGRLKYMNYADPSQDCLGSYGEENVEFIRQVAARYDPTAVFQKLVPGGWKISRVGVE"
     gene            complement(<1048820..>1051197)
                     /locus_tag="TRUGW13939_08898"
                     /db_xref="GeneID:55996382"
     mRNA            complement(join(<1048820..1050566,1050647..>1051197))
                     /locus_tag="TRUGW13939_08898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492023.1"
                     /db_xref="GeneID:55996382"
     CDS             complement(join(1048820..1050566,1050647..1051197))
                     /locus_tag="TRUGW13939_08898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347916.1"
                     /db_xref="GeneID:55996382"
                     /translation="MRGLRNERRPRGKYARLICQRCRSRKIKCVLPNPEQIELSGAPQ
                     GPDHACDRCRNFNLECIVERTMLGRPAAVNRGRRSGSAVVDGVGDADAEQPLDIKEYM
                     WSGDAEEPLQIKHHHHQGPAAKSKHPSKQDVFESIIDPACFLSLILANNPVFGSNIVH
                     STTPWGGFLPDLIDDDLAESLDRRLAWHRFFLPQTPSLISVRHRLLSNDSASHTPATN
                     LLFALLCSMALETPECASEHYSQLISSVQLAVSSYGQDFIFSPPIHRDSVIISLLLSD
                     YRPTAIVSSQSVAHKAVKSDLYVNIAYRIAERLEMLSDKPRLDFNLVNSINSLELEAE
                     LIDSLQTLQLYSYDALTSGYIATPVMGMLQLLDRMRPYIALYEHVLKIRPCSPRLIYH
                     IQYAISNYTMIEVMARMKQSWDSWDNLAAVMEDGKNKCLEHIESCNRCLATSLNHYFS
                     PEEGELSAATRALLEFRFKWVSMKISGAGLLYAMVLQTRARGSPAKNGPEISCQEGVQ
                     IGTQAIDNLISIQRGQIADFSSFLGRFALKYPGEMKSVLDSFLDCGSRLKIDGVAFHP
                     PPRRVVLEIVILCKNIVENMVVFLKSFSRLPPFLPERLEMLATCERQLDAMVAAPWTS
                     TNSAFASGCIYAASSKLIHRLRDFMNNLQSRVSRREEQQRQQQEQQQQQQMQQHQLLM
                     PQQPLHEDQASIFDLHSNSDGHDSGLDASFEGWDSWPHFGGFDMFTTSDDNFDWSLAW
                     DMFFDCDPMNMNTAMNPMNTNPPFN"
     gene            <1054980..>1057173
                     /locus_tag="TRUGW13939_08899"
                     /db_xref="GeneID:55996383"
     mRNA            join(<1054980..1056645,1056697..1057070,1057126..>1057173)
                     /locus_tag="TRUGW13939_08899"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492024.1"
                     /db_xref="GeneID:55996383"
     CDS             join(1054980..1056645,1056697..1057070,1057126..1057173)
                     /locus_tag="TRUGW13939_08899"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347917.1"
                     /db_xref="GeneID:55996383"
                     /translation="MAALVQTIPQQNGTVTLLQTRPSSASGHSSFVSASQVSQPQFNR
                     GHAMSFSSYNGVNTSGPNRASVAPYAFTSTPGLVAAAGNAPQRQPQTYASAVTQNGAP
                     QHLSHFAAGSVSSSSTSSNSSSRPSYISQDDSILSSRRRQADTAPRPLSTVNLPSQSP
                     FLNLSSPATTKTTKPSPDRYRRGKRSQDTNTAQPAVAIPTRSSSYDPAAATTISQPSR
                     PTIAGHVRVPSADDTRVEKPTNPDIANRYRRRSWASIDAAGAHAQEPPSPSFFSPLPE
                     LKFDNEPTRPASSYSQRNTSSESVHSDHKGSAGTSHNPSPLSNQMIPETPTSPALKTS
                     PEIAHSPAAQRLADISKMSGKKPGKSRLRRAFSFGSAAELRKVSAQNSMGSHIDQDPT
                     GEELDPEQAAIAARQEANGLGNSIYTHQLGSTDNLSISSTASSASIMLRKMGRGMKKS
                     TRSLVGLFRPKSISNMQTDSVTVEPTAQVSVVNIEAERKTVVANPDPHDQSGGGTVFP
                     KIQATKIQAPLVSEPASNDGNNSRKSILGGERERAEVLAAVKKGILKRSGSSSPVVRP
                     TEPTRPYTGDSPNSSAPSTPDEQSHRIGHRRTDTVKIEGEDYFLQPGKLNPDSKSAPG
                     TPQPVVSRSIVFSPRIQFHETWPSGEYDRRGEIATCNKLTPLLAQQIKEELNTFKMEM
                     EVHETSKVYTHFL"
     gene            <1058524..>1059557
                     /locus_tag="TRUGW13939_08900"
                     /db_xref="GeneID:55996384"
     mRNA            join(<1058524..1058536,1058592..1058658,1058717..1058835,
                     1058959..1059135,1059190..>1059557)
                     /locus_tag="TRUGW13939_08900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492025.1"
                     /db_xref="GeneID:55996384"
     CDS             join(1058524..1058536,1058592..1058658,1058717..1058835,
                     1058959..1059135,1059190..1059557)
                     /locus_tag="TRUGW13939_08900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347918.1"
                     /db_xref="GeneID:55996384"
                     /translation="MSDTAQQDENDRVKKENGEIFRQLNESELRGKVKVIIIIGPAGS
                     GKTNLVKLITNKDMKVGHDLKSGFGDPDLPAEEVEAIIYSTLGYFTRALGGVHGVLHV
                     QSIFEPRSSQEIRDSIRFLDKIASKRKGDFEKLEMQMAKEEWKIFGIDSRDGSRSFRF
                     GVDVEQDNDEDKEIAKKKIINSVFQRYRIKKPEELVMPFSEWSGGEQFVTIAMYTIGG
                     MVVTGMGGILTLGVMFGEVAVDFSIKFLF"
     gene            <1060883..>1061935
                     /locus_tag="TRUGW13939_08901"
                     /db_xref="GeneID:55996385"
     mRNA            <1060883..>1061935
                     /locus_tag="TRUGW13939_08901"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492026.1"
                     /db_xref="GeneID:55996385"
     CDS             1060883..1061935
                     /locus_tag="TRUGW13939_08901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347919.1"
                     /db_xref="GeneID:55996385"
                     /translation="MAESNQLADQQVLQNFHKSWALRVLPDSLKPYGELLRLHRPAGI
                     MMFYFPCLFGTFLVGALNSSKSVDFLHLILLENAKLLLLSFLLRGLLCTWNDIIDQDV
                     DRQVARTRVRPIARGAVSTPAALVFTGLQVYLAWLGFGLLPAECLTAALPFLALHVFY
                     PFAKRLTHHPQFILGLAHTNGVFMAFPAMGMPLLSLGGILSPWSSVGEEEGQANLLCA
                     IALSLAILFWTLLNDTIYAAQDLADDKKAGVGSTMIYWEDQARNFLRVLGILTVVVLL
                     GITFVMRRWSITDGVVYSALTCGGTMLGLYLMVEYVDLEDPASCGWWFNRGNVLVGGA
                     IASGLVGECLAGTVWQ"
     gene            complement(<1062044..>1063498)
                     /locus_tag="TRUGW13939_08902"
                     /db_xref="GeneID:55996386"
     mRNA            complement(join(<1062044..1062854,1062906..1063029,
                     1063088..1063223,1063298..>1063498))
                     /locus_tag="TRUGW13939_08902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492027.1"
                     /db_xref="GeneID:55996386"
     CDS             complement(join(1062044..1062854,1062906..1063029,
                     1063088..1063223,1063298..1063498))
                     /locus_tag="TRUGW13939_08902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347920.1"
                     /db_xref="GeneID:55996386"
                     /translation="MSPSTTIMAPYKINVDMDTSLLQQLNRIDSAILNNEDERVALVH
                     AMRAALSRIETPWESALQIVFTQPSVFAALKTCVDAGLFVQWLQQPLHGEPASASTLA
                     RLVDVDEMLLSRLLRHLAATNMLHEEAPGVYRLSRFAHSLGLPEYASMLPFLFETSLP
                     GFSSLPAYLQSNKYANPADAKATNWHYLRGVSRFADLQSRPSEMATFQLMMTTYAANK
                     TSWVDLYPVENEILRCAESTSSSALVVDVGGGRGHDLQRLLHLWQGLLDGNNTARIVA
                     PTPGQLILQDRQATLVNAVGESLIRKMAHDFFQQQPVRGARVYYLHTVLHDWPDREAG
                     VILGQIGLAMQVGYSRLLIHETVVRTDEVQDLSEWKKTTSDMQMMMVLSSAERTEQNW
                     RELIARAGLTVVKIWNSGASAESIIEVVKDK"
     gene            complement(<1063898..>1065207)
                     /locus_tag="TRUGW13939_08903"
                     /db_xref="GeneID:55996387"
     mRNA            complement(join(<1063898..1064165,1064221..1064251,
                     1064301..1064365,1064414..1064531,1064600..1064981,
                     1065031..>1065207))
                     /locus_tag="TRUGW13939_08903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492028.1"
                     /db_xref="GeneID:55996387"
     CDS             complement(join(1063898..1064165,1064221..1064251,
                     1064301..1064365,1064414..1064531,1064600..1064981,
                     1065031..1065207))
                     /locus_tag="TRUGW13939_08903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347921.1"
                     /db_xref="GeneID:55996387"
                     /translation="MEGQSRPKDCQRNAAANAFLAISAITLAIVGVVVPLRIWVRVKL
                     VKNFWWDDACILISFRTKAIVIPTFACLYETVRLGIGKHFLCVDPADSVLLGKFQYIA
                     EFLEIYSVIFARLSAALFVIRLFAITSRLKTFLYGYAVFMTISLAITGVLVLVQCTPT
                     AALWDVTIKGHCWSAEARSFVNNFNGAISILSDFLLAGLPVYFLWTVQMNTRLKIAVC
                     SLMGVSIIPGICATARTALAYTQTSSDPIYSFAILIVFGSLETTMAVICATIPALSPL
                     FSQERRQRFNRPRRYNDYQYADSSSARNTLKPNSRAGDGPDTVDTTPLVPLANGNNNK
                     AISKTVEISVTR"
     gene            <1065943..>1066747
                     /locus_tag="TRUGW13939_08904"
                     /db_xref="GeneID:55996388"
     mRNA            join(<1065943..1066350,1066418..>1066747)
                     /locus_tag="TRUGW13939_08904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492029.1"
                     /db_xref="GeneID:55996388"
     CDS             join(1065943..1066350,1066418..1066747)
                     /locus_tag="TRUGW13939_08904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347922.1"
                     /db_xref="GeneID:55996388"
                     /translation="MAQSTAFVLVGGVSHTPVFFDALIKELSQHGYQSHAVSYPTVGR
                     DTVGTTQQDEVKAIQDAVARFVDDEQKDVILVMHSYGGWPGSRAVKGFDKESRTKEGK
                     KHGIVELVFLAAFLLPDNAPMANYSYLPPWLTNENGERIPNEQSVPLLFSDLDPASQQ
                     HWLSKFEPQRNDFTAETIPDAPWHLSIPKTYIITSQDKTATIPFQLTMLQGVMDETWS
                     IKTIKAGHEPFLSQPANLAKVLLQPTF"
     gene            complement(<1066808..>1067842)
                     /locus_tag="TRUGW13939_08905"
                     /db_xref="GeneID:55996389"
     mRNA            complement(join(<1066808..1067081,1067146..1067266,
                     1067326..1067573,1067631..1067735,1067790..>1067842))
                     /locus_tag="TRUGW13939_08905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492030.1"
                     /db_xref="GeneID:55996389"
     CDS             complement(join(1066808..1067081,1067146..1067266,
                     1067326..1067573,1067631..1067735,1067790..1067842))
                     /locus_tag="TRUGW13939_08905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347923.1"
                     /db_xref="GeneID:55996389"
                     /translation="MSKEDNYPLTRGSISWTRINLLQYVWRDTLGYLIHPEISRQVRD
                     IADIATGTGLWLCEIGNDNSYRNLHGYDISADSFIDANNLPPGVQLRAVDASKPAPEE
                     LKGQYDVVHIRLLQSVVHNDDPTWIIDHSIELLRPGGYLQWEEFDPLQVDLHENGQAP
                     NLAKLVEKLETRVPGSWVSNLPATLQRYNMNIIAVDRKREVPWHHKTVTHLCCMVFEE
                     YASMFLDKAGPPGSGDEMRALVSAAYEEAQRGAYASHLFQTVVAQKTK"
     gene            <1068540..>1070493
                     /locus_tag="TRUGW13939_08906"
                     /db_xref="GeneID:55996390"
     mRNA            join(<1068540..1068759,1068824..1068906,1068969..1069020,
                     1069100..1069500,1069556..1069882,1069936..1070046,
                     1070099..1070265,1070319..>1070493)
                     /locus_tag="TRUGW13939_08906"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492031.1"
                     /db_xref="GeneID:55996390"
     CDS             join(1068540..1068759,1068824..1068906,1068969..1069020,
                     1069100..1069500,1069556..1069882,1069936..1070046,
                     1070099..1070265,1070319..1070493)
                     /locus_tag="TRUGW13939_08906"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347924.1"
                     /db_xref="GeneID:55996390"
                     /translation="MAITEVNLWFAAGVLFAVYLATTIVYRLYFHPLAKFPGPTLAAI
                     TDYWELYQDFFREEGGHLYLELDKLHEKYGPVVRIRPNEVHVKDSHWMDVLYPGSLER
                     RDRDPLVGTAIGTPYATIGTGPHALHRIRKAAIAPFFSSRSVAEMEEMLQDRASIFCQ
                     TLENQISKVLDMRVFFFAWTTDFITGQIFGNSAGVFWDGERAHNYFDIMFDFSGKFPL
                     TKHFPWLVTMGLALPLAAWKILFPSLVPYVSIYKDLLDRAQNACIAHTDKSNVNPKDG
                     KEDIFETILTSDLPPEEKTPKRMANEVFNLLVAGSLTTAKTATYGIFHVLANPDIYER
                     ARAELKEAIPDNKSMPSLKTLQKLPVLTAIIKETNRLGCVVTTRFPMISPNKDLQHGE
                     TAIPAGSSISMTYCKAGMDPSIFAEPNEFRPDRWIAGEQKPHDYDHYVLPFGRGSRVC
                     IGAHLAYAQLYLLLAYAFRFFDMELYDTTRERDIDIKGGGPLGEPTRSTKGVRVRVKG
                     VVA"
     gene            complement(<1072785..>1074275)
                     /locus_tag="TRUGW13939_08907"
                     /db_xref="GeneID:55996391"
     mRNA            complement(join(<1072785..1073098,1073177..1073619,
                     1073674..1073797,1073854..1073983,1074045..>1074275))
                     /locus_tag="TRUGW13939_08907"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492032.1"
                     /db_xref="GeneID:55996391"
     CDS             complement(join(1072785..1073098,1073177..1073619,
                     1073674..1073797,1073854..1073983,1074045..1074275))
                     /locus_tag="TRUGW13939_08907"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347925.1"
                     /db_xref="GeneID:55996391"
                     /translation="MSSVVPAPLTASNRNRSFHLQPDMTQNFTQVLADISRLRDVTFS
                     NNEERSQVRLALWKLLTEIESPWETVHRLAWMEPAFVAALKVCLDIDLFKKWTEDGGG
                     PKSVVELARITGADEALLGRVARHLAAMFALREISEDTYYLTPFTESLAKPGASDTIP
                     FMIGSTWPAFLHLPQYLADNSYQNPSDPKCSNWQATKQSDQSYFEFISSDPQRVQTFQ
                     NVMDAYNTARGNWVDLYPTDRLVANWNPDRPLLVDAGGGKGLDIMRFRERHSGLPSGS
                     LVLQELEAAVPTISVHESIKVMGHNLFEEQPVKGARAYYTHIVFHGWSDQEAVKVLKL
                     LAASMEKGYSTLLLHEKVVPTQGATPDITAGDLTMMATFSARERTFRMWEELLTLAGF
                     KIVKLWSSPAFPESIIETQLL"
     gene            complement(<1075610..>1076034)
                     /locus_tag="TRUGW13939_08908"
                     /db_xref="GeneID:55996392"
     mRNA            complement(join(<1075610..1075643,1075709..>1076034))
                     /locus_tag="TRUGW13939_08908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492033.1"
                     /db_xref="GeneID:55996392"
     CDS             complement(join(1075610..1075643,1075709..1076034))
                     /locus_tag="TRUGW13939_08908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347926.1"
                     /db_xref="GeneID:55996392"
                     /translation="MVLSSKAGLCSSLHLNVTSTPPSPLGLPLGPAEFIANPHLEDGI
                     AQINWDDFALEAKGSALIATELGNSVQRVTPRGVVDIIAGGINSTTLAEPSSVTFGRT
                     KRDSNTLRSSSVEDACF"
     gene            <1078190..>1078862
                     /locus_tag="TRUGW13939_08909"
                     /db_xref="GeneID:55996393"
     mRNA            join(<1078190..1078296,1078359..1078426,1078502..1078562,
                     1078627..1078647,1078737..1078778,1078835..>1078862)
                     /locus_tag="TRUGW13939_08909"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492034.1"
                     /db_xref="GeneID:55996393"
     CDS             join(1078190..1078296,1078359..1078426,1078502..1078562,
                     1078627..1078647,1078737..1078778,1078835..1078862)
                     /locus_tag="TRUGW13939_08909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347927.1"
                     /db_xref="GeneID:55996393"
                     /translation="MGVVKDVLSPGDGQHFPKPGDQITMHYTGTLENGSKFDSSRDRN
                     EPFVCNIGVGQLIKGWDEGVPQMSLGERAKLTISSDYGYGARGVPGLIPGGATLIFDV
                     QLLKIN"
     gene            complement(<1079233..>1081235)
                     /locus_tag="TRUGW13939_08910"
                     /db_xref="GeneID:55996394"
     mRNA            complement(join(<1079233..1079408,1079469..1079916,
                     1079982..1080213,1080263..1080423,1080470..1080633,
                     1080687..1080729,1080779..1080849,1080905..>1081235))
                     /locus_tag="TRUGW13939_08910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492035.1"
                     /db_xref="GeneID:55996394"
     CDS             complement(join(1079233..1079408,1079469..1079916,
                     1079982..1080213,1080263..1080423,1080470..1080633,
                     1080687..1080729,1080779..1080849,1080905..1081235))
                     /locus_tag="TRUGW13939_08910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347928.1"
                     /db_xref="GeneID:55996394"
                     /translation="MASSSDNVRDAELAIDAASTHDTKNNNNSNSNSNSKANSTHVDD
                     VNELGPAEEEVVVANSARPNAQKEAPMSVARMSDEERAAAEKALVRKIDLRLLPMLVI
                     MYILNYLDRNNIAAARLAGLEDDLKLVGDQYQTSVSILFVGYLLMQIPSNLFLNKMGK
                     PAIYLPAAMSIWGVISTATAAVQSYGGLVTVRFFLGFVEAAYFPGCLYFLSAWYTRKE
                     LGLRTAMLYSGSLISGAFSGLVAAGITGNMDYARGLRAWRWLFIIEGAITIVVAIISA
                     FILPNFPRTTSWLTEEEKELAAWRLEEDIGEDDWVDSEQQSFLHGVKLALADIKTWIL
                     MIMIFCMVSSGSVTNFFPTVVQTLNYGKIQTLLLTAPPYVLAMITAFANAWHADRTGE
                     RYFHITLPLYIAVVAFVIGAATTSTGPRYLSMMLMVPGIYTGYVVALGWISNILPRPP
                     AKRAAALAFINAVSNASSIYASYMYPSSAGPRYVVAMTVNCVTAFIAIVSATVLRFIL
                     VRLNKKLDRGESVHGAVVGVPGQAGARGFRFLV"
     gene            complement(<1082080..>1083744)
                     /locus_tag="TRUGW13939_08911"
                     /db_xref="GeneID:55996395"
     mRNA            complement(<1082080..>1083744)
                     /locus_tag="TRUGW13939_08911"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492036.1"
                     /db_xref="GeneID:55996395"
     CDS             complement(1082080..1083744)
                     /locus_tag="TRUGW13939_08911"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347929.1"
                     /db_xref="GeneID:55996395"
                     /translation="MFESFQSNPWVSLTLPPPAFFTLPGPQPMSLAPPLNEPSLAQPF
                     QIPPGLYAQSLDFRVPVTIASVYAVTVLIVNRINKARGHKPWSVSKSTLFKQLVILHN
                     VFLAVYSAWTCWGMWTALRSSIPRFNNEHGAAGIVDAFCRLAGPRGLGNAALYDSIAG
                     KWTMPNPEYSLGANGLPDPTDVGRLWNQGLAYYGWFFYLSKFYEVIDTAIILAKGKKS
                     STLQTYHHAGAMMCMWAGIRYMGQPIWIFVLVNSFIHAMMYTYYTVTALHIRVPNAVK
                     RSLTTMQIMQFIGGTFMTVSYMFIRYSIPLSASRSLSLEDLTKAMPAAVASAAESGIA
                     AATASAGVVPWLKKLAFRAAGAEGIAENVLNAQGQHFGADAARYSQIKQEIIHAAQYE
                     TVDCVDNNGQAFAILLNVMYLLPLTYLFARFFVRSYLRRIEPAADGQKPSNQMHQVEQ
                     AGLDALKGVSREIRRAAMEQNGDGDTSATDEEFTWGQDRLRPLTAIAKKKTEKVEPIV
                     ESSSSNSSTDSFEAVPPKHRAKRSEAEASASPVKSSNTFGVLKDDA"
     gene            complement(<1084715..>1087141)
                     /locus_tag="TRUGW13939_08912"
                     /db_xref="GeneID:55996396"
     mRNA            complement(join(<1084715..1085830,1085906..1086065,
                     1086835..1086891,1086951..>1087141))
                     /locus_tag="TRUGW13939_08912"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492037.1"
                     /db_xref="GeneID:55996396"
     CDS             complement(join(1084715..1085830,1085906..1086065,
                     1086835..1086891,1086951..1087141))
                     /locus_tag="TRUGW13939_08912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347930.1"
                     /db_xref="GeneID:55996396"
                     /translation="MATTSQLPGISLQVTVTIAPENVPKFFELFKPVYEKVIEEPECT
                     FFEVYISPENPGVLSWVENWTQSIEWLFQNQLSKEYYKDANIVAIVCLASVTEHFFII
                     MSGLRGMVKDGWHPKGKQGGKESWRGDFKGIGQVAGWMGKGKDPNADDQAEHVSRPLT
                     SLKDPSSFGPPPKRNGASAVVSPGATTPTTTTTSSSRSLGAAVPQSSHRAAAAEEEDK
                     PAPPPVPYRANQSGLKTDHLPPPPVRHNTDSVSQPVSSPSARPSLPPRLPARGPAPQS
                     ASPPPPPYSETDDNVTQMNQGAVSRLGQAGVSVPGLGIGGTGSDKSATVQTNLNKQVN
                     ELHRYGNMSAQEDSQNHVADSKNGTTYGQTQERYQNTDNNSASSASALDSRNMGATAN
                     NLRQRGGEQFEAGKKKLIALNQKHKITDRIHSYFEQPPASSGQESAAPAPPPPPHPSN
                     NNANLSRQNSNNIDVEALNKRKPPPPPPPAKKPGLQAKPVGSSTPSPPPLPLGTKPR"
     gene            complement(<1088093..>1088890)
                     /locus_tag="TRUGW13939_08913"
                     /db_xref="GeneID:55996397"
     mRNA            complement(join(<1088093..1088503,1088570..>1088890))
                     /locus_tag="TRUGW13939_08913"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492038.1"
                     /db_xref="GeneID:55996397"
     CDS             complement(join(1088093..1088503,1088570..1088890))
                     /locus_tag="TRUGW13939_08913"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347931.1"
                     /db_xref="GeneID:55996397"
                     /translation="MASVTSSVTVSPANDFDEQESIYLARSRILHRIRLGIAGTIFVT
                     AIAGFACATSTMRHYNDTQWYDLVGLPLWPLNLDTRGTSGLVAGGVLISFQSLIYIIT
                     ALLPSPRPRTHKLNIMASAVAVSGLITATTCVAFAIHLPASPHPTGFTTSETIHSWSC
                     KWQSIGSVNATSLNGGPLSAPSGFSTICKESRASFILLSVLIGLEVIMGISAVAGHLF
                     ELSVVKKRKMYNMEAEQFAMASKHP"
     gene            <1090163..>1091042
                     /locus_tag="TRUGW13939_08914"
                     /db_xref="GeneID:55996398"
     mRNA            join(<1090163..1090312,1090459..1090499,1090546..1090551,
                     1090608..1090915,1091002..>1091042)
                     /locus_tag="TRUGW13939_08914"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492039.1"
                     /db_xref="GeneID:55996398"
     CDS             join(1090163..1090312,1090459..1090499,1090546..1090551,
                     1090608..1090915,1091002..1091042)
                     /locus_tag="TRUGW13939_08914"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347932.1"
                     /db_xref="GeneID:55996398"
                     /translation="MSSSAERVFRIYELTELILLELDCPVEITRAQSVGRYWRNVIQT
                     SSALAKAWAVEKHASHTAPLRLVYTIESTKEYLLMGDVMVIIEQIGRWREGRETLTYS
                     LDRRNLMSLRVDESNFQPQDFDSMSQIIPDDDVAIKVLVNDAQGRLGPAFSLQRYYLD
                     TNLGKIAKGFAHKIFLKKENI"
     gene            complement(<1091454..>1092682)
                     /locus_tag="TRUGW13939_08915"
                     /db_xref="GeneID:55996399"
     mRNA            complement(join(<1091454..1091488,1091540..1091618,
                     1091679..1091741,1091800..1091940,1092015..1092122,
                     1092205..1092354,1092431..1092575,1092633..>1092682))
                     /locus_tag="TRUGW13939_08915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492040.1"
                     /db_xref="GeneID:55996399"
     CDS             complement(join(1091454..1091488,1091540..1091618,
                     1091679..1091741,1091800..1091940,1092015..1092122,
                     1092205..1092354,1092431..1092575,1092633..1092682))
                     /locus_tag="TRUGW13939_08915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347933.1"
                     /db_xref="GeneID:55996399"
                     /translation="MPYSLRGKNVLVTAGSRGLGALVCEKFAENGSNIAINYYSNVDS
                     AKALANSLQEKYSVKVHIIKGDATAAEDNERLVKETVSELGGLDIIIANAGWTRFAKP
                     GDIYDLSLDEWNRCWQANVMSHLQLMQAAKPILEQNADGGVYLLTSSIAGTLTGGSSM
                     GYSVTKAAGLHLMKHFAFCLGPKIRVNAVLPGLLLTEWGNQYGETAINNMKEKAALKQ
                     ETSLEDCANVYINLAQNSSMTGQEVIVDAGLAMGSLPK"
     gene            complement(<1093290..>1093948)
                     /locus_tag="TRUGW13939_08916"
                     /db_xref="GeneID:55996400"
     mRNA            complement(join(<1093290..1093770,1093848..>1093948))
                     /locus_tag="TRUGW13939_08916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492041.1"
                     /db_xref="GeneID:55996400"
     CDS             complement(join(1093290..1093770,1093848..1093948))
                     /locus_tag="TRUGW13939_08916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347934.1"
                     /db_xref="GeneID:55996400"
                     /translation="MNRLGLLYPSELDGDAKSLYDELYAYTTTKYGTGKGIYITKDGR
                     FVGPFGAHLHIPIVGKQFLGMAKAVSQLPGLAPKHREIAVLVTGAKFKAAYELYGHRL
                     LALDRGLVEEEFHAILRGECPATFTDDEKSVYALADELVGKAGPLSQEKWDAVANPIG
                     KDTAAGLVQVVAFYSYVSTILNGFDCKVPDEDD"
     gene            <1094377..>1095417
                     /locus_tag="TRUGW13939_08917"
                     /db_xref="GeneID:55996401"
     mRNA            <1094377..>1095417
                     /locus_tag="TRUGW13939_08917"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492042.1"
                     /db_xref="GeneID:55996401"
     CDS             1094377..1095417
                     /locus_tag="TRUGW13939_08917"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347935.1"
                     /db_xref="GeneID:55996401"
                     /translation="MEETKATEIASFPPNYLLENIVVRHDGSIIITAYNQRELYYLTN
                     PDLGPVKPRLIHTFEHYPTGIVEGQPDVFYISTITIMRDKDEKGPCRLYKLDMRKFKS
                     DKSPIPELFLTFPAEARGLNGSCALSRSVFLLADSWSSQIWRVDIPEEGKGGGPPSVR
                     SWHKHDMMDRSTDPRKADVPGVNGIKYHSGTHHVYFTTTSQTIFASIKVNPDTLESIG
                     DPVEVTDRWMWADDFIIDEIANVAYVTTHRQNSIEQIDLKTGAQRTCIGTPVRPDLLL
                     GPTCGAWTQNPEDHGRRAYFLTEGGHMNPYEGVFRNAKVLRVEFSDAGRSSTGLIGTL
                     YQWFQMAKSVFN"
     gene            complement(<1095537..>1099351)
                     /locus_tag="TRUGW13939_08918"
                     /db_xref="GeneID:55996402"
     mRNA            complement(join(<1095537..1097198,1098239..1098784,
                     1098850..1099176,1099298..>1099351))
                     /locus_tag="TRUGW13939_08918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492043.1"
                     /db_xref="GeneID:55996402"
     CDS             complement(join(1095537..1097198,1098239..1098784,
                     1098850..1099176,1099298..1099351))
                     /locus_tag="TRUGW13939_08918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347936.1"
                     /db_xref="GeneID:55996402"
                     /translation="MSDASNSLLTEHLSYTPLSLIDDIINSINNLIYQAISSLETGLL
                     NTPPERLGFSHAANASTIPDTDADGNIEYPEARVEIENGLHQLETLFESSVDRSFDKF
                     EIYVLRNILTVPDDIVNHMKLAHYESLSFSKKNPDTPTPESISLQRKKLQETRKLQQA
                     LRRESAQNEAVITQLRTILSTAQEANTKQTDNQNTTAASQGLPSLGFLTSGPAADILR
                     VGQNQSLTTNTDFVLSQLPALHTMTEKLREQLRSLPNTAPEGQNKRDERQDYIDSRIR
                     IHLERSGQPAFGDGNTVIPGRKIASAEAKALESCNGAYPCDTCYGYGYPCGYRQQRRV
                     RETSTQKDVLSTDVPTKQVTALHGGESLLRDSSLQALSTPEDSMQGSSSNEDLFMDQP
                     ARYIGRHSLEAFPRYLGLQLQSDLLPQMQPLVWNLQVRDQPQCRVGDTLCTMVTLDMA
                     KGYIRAFFAVDFPACGFLDFDALIDRTEKHFTGTSQGLPFEALIGGIIGMSSILTLTS
                     NIQPEIHIVRHAESILTDQAILNNPSIDFLAALFFRSLYLRATATPHTTWLASCSAMH
                     TAESLGLHKESGFDNYPGMWNSTACGSLFWMACAGNRLISHELGRTPVILHGVTRKFP
                     YASHDESNAAILTYLGCFLPLTDGTAGSESDVEHLTDLFEAVKAYKTKEHPYLTLFTA
                     DVCFCLHRRIRVNNEVNIIQRAHSQQIISIGNAAVQAATVLAEKGQAWWNMLSTLFQF
                     CCVLISMDSVDALGDLHYTIQTINLIKDRYPSRTISEAFSVLQLLIRAMKQKKEKEVS
                     YLDILEDLESPPLPPTNASSVAMPPAVEVPQMLPSGNDTDFSFDFRAWCPEDLDWVFA
                     TAPPVH"
     gene            <1099832..>1100518
                     /locus_tag="TRUGW13939_08919"
                     /db_xref="GeneID:55996403"
     mRNA            join(<1099832..1100413,1100471..>1100518)
                     /locus_tag="TRUGW13939_08919"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492044.1"
                     /db_xref="GeneID:55996403"
     CDS             join(1099832..1100413,1100471..1100518)
                     /locus_tag="TRUGW13939_08919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347937.1"
                     /db_xref="GeneID:55996403"
                     /translation="MAPDDAAQKKRNRLPFKPPRQQSSTATGGVSKTTKPKSTSRKST
                     SSTTTPGPSASRRKSTATSAKKSKATVESEDDNDDDDDGSSEDGSGSGSVNGERSQSQ
                     EPDYILAEIVTNEKSRDIESGEPAIPPKLLTKLLHHHFQNPKTKIAKDANEVVAKYID
                     IFVREALARAAYERTEGNKDTGDGRPSIMDGFLEVEDLEKLAPQMILDF"
     gene            <1102353..>1103880
                     /locus_tag="TRUGW13939_08920"
                     /db_xref="GeneID:55996404"
     mRNA            join(<1102353..1102676,1102730..1102962,1103016..>1103880)
                     /locus_tag="TRUGW13939_08920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492045.1"
                     /db_xref="GeneID:55996404"
     CDS             join(1102353..1102676,1102730..1102962,1103016..1103880)
                     /locus_tag="TRUGW13939_08920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347938.1"
                     /db_xref="GeneID:55996404"
                     /translation="MRANTMASRLAAIVGLVAIAEAAHSHGHLHHRRHPDTEKQTEKR
                     GGQCEFPSDAGLVAVTPDEQNAGWAMSPNQLCEPGSYCPYACPPGQVSMQWNPKATSY
                     TYPLSMDGGLYCDESGTIQKPFPEKPYCADGTGAVNAVNKAGKPLSFCQTVLPGNEAM
                     LIPTLVEETATLAVPDPSYWCSTAAHFYINPPGTGDEGCIWGTSDNPIGNWAYFVAGA
                     NTDSDGNTFVKIGYNPVVQEPATPFRDTPATYGVEITCEDDAGCNGLPCKIDPSSDGL
                     NEVTSNESADGAGGGAFCVVTVPKGQTANINVFEAGDSSAPAPSGPASTTSPATSSAP
                     PTTTSTSTTSTSTTPTTTSTSTTPTTTTTTTTSTTPTTTSTTPTTTTTKTSTSKHVST
                     TSPSSTKTTPSSTPASRTPSGTYSYAPHVFIETGSGSAGSPTGSSGASAASATTSGAA
                     APMSTGSVAGLALGLFAGVMMQL"
     gene            <1105210..>1107294
                     /locus_tag="TRUGW13939_08921"
                     /db_xref="GeneID:55996405"
     mRNA            <1105210..>1107294
                     /locus_tag="TRUGW13939_08921"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492046.1"
                     /db_xref="GeneID:55996405"
     CDS             1105210..1107294
                     /locus_tag="TRUGW13939_08921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347939.1"
                     /db_xref="GeneID:55996405"
                     /translation="MFYSFAPPRSGPVAKRRKIRRACDYCRLHRVRCDGAVPCSQCIT
                     NKVQCVHPSVSQKQQKQPASTRSSAAHTAVLPVPVPEHAVQPVQTAPDQLPRAESGSV
                     DHTSTDPWIEGLGSMIEFTSRINNFCSVVSKMSVQPSLAPNDPPPPLPGTSYESPGLL
                     QTREHNSVDVGHSAQGLQARLLHLYSTRFYWLVPVVNRVDLQNQSPSAMSQSMLEAIM
                     AYCLQSLYHAGLHQRLLSLRAEIGGSDTDQSALDISIACFRRALAYSGHFVVYSQPSL
                     QDIQRHIFMSLFLLNTGDFQAVYNITGLAIGLAKSLNLHHQPPSHLPAEEAELRQRIW
                     WTLLHIDFHCSRYLGKPTAVALKDTTCARPRAISIATDLVPLEIAFHSCLMSLTVTAR
                     KIAEALNAHHDIACNHEFIERIEWRAELLSQEISELQRWRDSLLQTPPFANLRLSSKK
                     RRPRTFEIEGNAFYDEDSWMNGESTARILQSTLLELQYHDIVIWFHRPFIQFPTRGLV
                     PQRSPHADIHATTALHHAFTMIEVIHSRTLNHDALYGCCEIYQYVWNAGLTLIGFMLA
                     YPLCYWFPEARKHAETSLRILEAGGVSNTIASRATHLTQYLLGRVDVLMALLRSDQCA
                     KDTTAGNVHRHKKTIDEVDLLAEESSPPAVPTPDSAFDALWSWADTVDPETWHEYCNE
                     ISDVLTDIPEIL"
     gene            complement(<1107586..>1108589)
                     /locus_tag="TRUGW13939_08922"
                     /db_xref="GeneID:55996406"
     mRNA            complement(join(<1107586..1107743,1107808..1108363,
                     1108428..>1108589))
                     /locus_tag="TRUGW13939_08922"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492047.1"
                     /db_xref="GeneID:55996406"
     CDS             complement(join(1107586..1107743,1107808..1108363,
                     1108428..1108589))
                     /locus_tag="TRUGW13939_08922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347940.1"
                     /db_xref="GeneID:55996406"
                     /translation="MSVSQVDPDQYTRAGSITKAYFRDVYSAIEPTKSDLSQQGKVAI
                     VTGAGKGIGRAIALAHAKAGAAGIVLITRFSQSAEETKSIIEADYPHVKVLALPTDIT
                     DESEVSRSIDSIKSTFGTAHTLINNAGVFSSIATIDQADPATWWKDFEVNVRGTYLVT
                     AAFLRLAAANIQPTIVNLVSTIALTPPSLSSYFVSKLAVAKFTEFLPLENPNVAAYSL
                     SPGIVLTDMTLDPFKPFAKDTAELTGAVTVYLAAKRPQYLNGRHLVANWDVEELEARK
                     DELISSDKLKVGQFI"
     gene            <1108874..>1113549
                     /locus_tag="TRUGW13939_08923"
                     /db_xref="GeneID:55996407"
     mRNA            join(<1108874..1109029,1109100..1109400,1109456..1109504,
                     1109567..1109764,1109824..1110874,1110928..1111193,
                     1111248..1111507,1111554..1111609,1111669..1112346,
                     1112406..1113338,1113406..>1113549)
                     /locus_tag="TRUGW13939_08923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492048.1"
                     /db_xref="GeneID:55996407"
     CDS             join(1108874..1109029,1109100..1109400,1109456..1109504,
                     1109567..1109764,1109824..1110874,1110928..1111193,
                     1111248..1111507,1111554..1111609,1111669..1112346,
                     1112406..1113338,1113406..1113549)
                     /locus_tag="TRUGW13939_08923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347941.1"
                     /db_xref="GeneID:55996407"
                     /translation="MDTPTEAKGSEPANDHEINHLVDDFLSRQISSAGGCGKIILRDL
                     SVIGAGVGHQLVSNVSVALAQLLDLAKPTTWLSRKPPSSRVLLHKITGTVGEGEMVMV
                     VGRPGSGCSTFLKSIANMREEYLGMEGDVWYGSFDAATANKLTQGKVAFVTEDDVHFP
                     TLSVKTTLRFALNARRPTSDPDRQTCIKRDLQTVLKLMGLDQAASVRVGNDYIRGVSG
                     GQRRRVSLAEALCTRAGLFCFDNPTRGLDSSTAIRFIKVLREYTTRSRCATVMSLYQA
                     NDPAVSLFDKVVVLNEGHVAYYGPMCEAKGYFESLGFCCPPRVSVSDFLASMSGNPKG
                     RIVRDGVERPVPVEPIDFQTRFQETRFYQQSLEEALAPPQVPSPPKSPGYSLPFYRQV
                     YECTFRHYQVNLTDRASWIAEAAGTIVQALLLGTLFRNQQDVTEGLFTRGSALFFCVL
                     IMSLQASAEFGNTFVQRPILLKQKSLLFYRPGAYALGQILADIPWKLVFVLYSLPIYW
                     MINFQRSAGNFFTWLVALYIGMIALGVTFRAIAVFTTSPTRAVLPVGLLVNTLIMYTG
                     FYITPPGMKVWLSWFRHLNPMYYMFESIALNEIGSSTYACSDQDTVPRGPAYNESIYQ
                     TCAVPGSVPGNLTLSGNLYLIAEYGFVHAHKWRNVGINAAFYVFFSIMVMIGMERFRT
                     AGAQMSTIFYRHLPQYKSTSSSTSDIEKPAPGSEAIDEHNQVLGDLASGSLGEDNHLF
                     AWRGLSLDLSNKKRLLHEVTGWLVPGSMTALMGMSGAGKTTLLDTLAQRIQIGVISGN
                     LLLDGNTLPASMGRRTGFVHQNDIHLNSCTVREALQLSARLRRVASVSLEEKMAYIET
                     VIRMLDMEDIADAIIGVPGAGLNLERRKRVSIGVELAAKPDILLFLDEPTSGLDGNSA
                     LSIVQLMRNLSNAGQTILCTIHQPSSQMIELFDSLLLLIPGGKTAYFGPLGPRCTTII
                     DYFARYTRRCGDTENPADYLLDISADPRMDWLLTWEQSPEYTKTQDYVQSIVDGKDTS
                     KNPSSDRAHAASYLEQLHVVTSRAFTNYWRDSDYVLGKIQLNIWMGLLNGLTFLQLSN
                     NLVDSRGRMFSIFVGVITGPVLSLQIEPRFVILRDQFLARENESRVYHWSVFVISALV
                     VEIPFTLLGGLIYWLLWYYMVGYFYISTRAGYAFLMYELYSLFVASLAQLTAAIFPTA
                     LAAQVANGFIWLVVNTFNGPLSPPPLTPTGWRWFYNISPLFYFIEGIASNAMHALEIQ
                     CDPSEISVFRAPPSETCEQYTSQFFNMSSASGYLINPTATGQCEYCSYSNGDQYITQY
                     DMSYSERGNNVGIFIGFIMFNYTMTLFATYLIFIFNWRKRYQK"
     gene            <1113985..>1114521
                     /locus_tag="TRUGW13939_08924"
                     /db_xref="GeneID:55996408"
     mRNA            <1113985..>1114521
                     /locus_tag="TRUGW13939_08924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492049.1"
                     /db_xref="GeneID:55996408"
     CDS             1113985..1114521
                     /locus_tag="TRUGW13939_08924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347942.1"
                     /db_xref="GeneID:55996408"
                     /translation="MTTPIPTMDAIEAGQFRETLTAAVRQHEVRYTDAHSLSMRWEKD
                     DTEADKDTARFQMMLQALHFPAAHELVIKENDSTPGWTARGKIRETLAAARRTSGRSI
                     VIVHYAGHGELDSSRDLMLGKTSRFSADRFLISLALDKVYDLQNTTNVDVLFILDCCY
                     GYAACRASEVTDRVVELV"
     gene            complement(<1114670..>1115482)
                     /locus_tag="TRUGW13939_08925"
                     /db_xref="GeneID:55996409"
     mRNA            complement(<1114670..>1115482)
                     /locus_tag="TRUGW13939_08925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492050.1"
                     /db_xref="GeneID:55996409"
     CDS             complement(1114670..1115482)
                     /locus_tag="TRUGW13939_08925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347943.1"
                     /db_xref="GeneID:55996409"
                     /translation="MENVKDVELRDLGTCLIIWRRSSRPATKPHPWPTLHQGTLSPDI
                     CHRKRAGHRFAEVANVVETLRQRENAMKKPAHGLEMGVRSVCLPLGGLINPSSIPPTC
                     RAVFKVHTSNNITPQGLEQFVAWTETIPPSAGIFLEGVFEPGSMCIILSSAYAVYSKL
                     AGIRGYRLVTETSGRNLLTRNKPAVPYSPPSKEAVPYSPPSKENAPLAQPVLFSPGME
                     RSNEDGGGFPYATVILFPVILCQPSGCLPTNQISPNSSLGGLSCLEVRSANR"
     gene            <1115739..>1116190
                     /locus_tag="TRUGW13939_08926"
                     /db_xref="GeneID:55996410"
     mRNA            join(<1115739..1115962,1116016..>1116190)
                     /locus_tag="TRUGW13939_08926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492051.1"
                     /db_xref="GeneID:55996410"
     CDS             join(1115739..1115962,1116016..1116190)
                     /locus_tag="TRUGW13939_08926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347944.1"
                     /db_xref="GeneID:55996410"
                     /translation="MPIITNFTLPPSQDALTLPPDSNSAFFIAFLASRDPSTGQPWCP
                     DVRASLPHLTAAFSGDTAPQVAFVDVGQRDEWKNPSNIYRTDWKVSGVPTLVRYERVD
                     GRVKDVGRISEVEILDKKQFSTFIKSQASL"
     gene            <1116602..>1121083
                     /locus_tag="TRUGW13939_08927"
                     /db_xref="GeneID:55996411"
     mRNA            join(<1116602..1116642,1116699..1116830,1116887..1117238,
                     1117305..1117520,1117567..1118314,1118377..1118462,
                     1118515..1118528,1118634..1118670,1118719..1118850,
                     1118907..1118960,1119013..1119146,1119196..1119224,
                     1119310..1119389,1119442..1119507,1119917..>1121083)
                     /locus_tag="TRUGW13939_08927"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492052.1"
                     /db_xref="GeneID:55996411"
     CDS             join(1116602..1116642,1116699..1116830,1116887..1117238,
                     1117305..1117520,1117567..1118314,1118377..1118462,
                     1118515..1118528,1118634..1118670,1118719..1118850,
                     1118907..1118960,1119013..1119146,1119196..1119224,
                     1119310..1119389,1119442..1119507,1119917..1121083)
                     /locus_tag="TRUGW13939_08927"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347945.1"
                     /db_xref="GeneID:55996411"
                     /translation="MGHFVTVATCNLNQWALDFEGNTKRIIESIHRAKAAGARLRVGP
                     ELEICGYGCLDHLLEQDLFLACWEMLERILTDESCRDILLDIGMPVQHRNVRYNCRVI
                     CLDGKILLIRPKMYLANDGNYREMRHFTPWCQPRVSEQYHLPRRIQTLQGATHVTFGD
                     AVVSTPDTCIGAETCEELFTPDSPHTHMSLDGVEVITNSSGSHFTLRKLNTRLQLITE
                     GTRKNGGIYLYANQQGCDGDRLYYDGCAMVVLNGEVVAQGSQFSLNDVEVVTATVDLE
                     EVRAYRCSMARGFQAANSKYKYERIQTVFELSPPEMDLDLSMTPSIPLTPRYHSPEEE
                     IALCSGCYLWDYLRRCGVAGYLVPLSGGIDSCATATIVFSMCRLVIEAVKAGNAQVIE
                     DVKRIAKYTDKLPETPQELCNQIFHTVYMGMSKQSSKETRQRARDLSEAIGSYHVNLD
                     IDEVYEAQKNLVKSTLKFDPKFKVEGGTAAENLMLQNIQARSRMVTAYEFAQILPTTR
                     ERPGGGSLLVLGSANVGESLRGYLTKYDCSSADINPIGSIDKSDLKRFIAWAEKEFDI
                     PCLQEFLTAVPTAELEPITETYVQSDEVDMGMTYDELTTFGRLRKVNKLGPYGMFQKL
                     VHEWGNERARQPGDGGPVLEPRQIADKVKRFFHYYAINRHKLTVLTPSIHFNDYSPED
                     NRFDLRPFLYPSFWQNWGFKKIDKEAKLQSTLRLLIPRLRLLQKKDNASSVAQRRELA
                     QLLDNGRDASARIRVENVIATDIGVEVMEIVELYCELLLARAAVLDQIAFSDKGVQAR
                     NKAKEEAKQLFEAGAKTGGPAEHKDGGGGRGFGWFSSSRTTATKTPEKPQIKHQLEST
                     GDESDQFDEENCYINPAIDEAAAAIFYSCPRFPREVKELTTLRTLLMERWGKEFATLA
                     QENKAGVKLPDRLVKRLRVKPPSEELVESYLREIANAYGVVWPANQEIEGDIPELMQE
                     EEDQPAPSSSPPPPPESGDIGNAPGPQTPRKNLPDMRLGSEADELSRATPPKDIGTHD
                     VTGKSPVSVAKPGPRSDNPEPRVRIPGEKGNIAGEERPGGGLQRKDSKGIPDVDELSK
                     RFAALKR"
     gene            complement(<1121330..>1122101)
                     /locus_tag="TRUGW13939_08928"
                     /db_xref="GeneID:55996412"
     mRNA            complement(join(<1121330..1121398,1121453..1121500,
                     1121562..>1122101))
                     /locus_tag="TRUGW13939_08928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492053.1"
                     /db_xref="GeneID:55996412"
     CDS             complement(join(1121330..1121398,1121453..1121500,
                     1121562..1122101))
                     /locus_tag="TRUGW13939_08928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347946.1"
                     /db_xref="GeneID:55996412"
                     /translation="MPVYKIHGFQWPRGGVPSVRVFIVLENLDDAAAEYIQQKKTSNL
                     ILDALKKNHPVATGHLPDLQLIEQYDPLDTTEAAVSQPYAFVADRVTLLPEHTRPRRG
                     LSVSIDQHQLDETISPEARDSLAEIRDAIAPGQQIGWWIVYNGDPERYFPEIDDDDIS
                     YDGASVLSSENGHSSVSDFRSESQPDFKQPPVPDIPPQSPTITGPGLKKKRSFWKRRA
                     "
     gene            <1122478..>1123186
                     /locus_tag="TRUGW13939_08929"
                     /db_xref="GeneID:55996413"
     mRNA            join(<1122478..1122512,1122595..1122634,1122696..1122725,
                     1122796..1123026,1123085..>1123186)
                     /locus_tag="TRUGW13939_08929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492054.1"
                     /db_xref="GeneID:55996413"
     CDS             join(1122478..1122512,1122595..1122634,1122696..1122725,
                     1122796..1123026,1123085..1123186)
                     /locus_tag="TRUGW13939_08929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347947.1"
                     /db_xref="GeneID:55996413"
                     /translation="MVLSFILIQNRQGKTRLAKWYSPYSDDEKVKLKGEVHRLVAPRD
                     QKYQSNFVEFKRSTKIVYRRYAGLFFCVCVDANDSELAYLEAIHFFVEVLDQFFGNVC
                     ELDLVFNFYKVYAILDEVFLAGEIEETSKQVVLTRLEHLDKLE"
     gene            complement(<1123490..>1124476)
                     /locus_tag="TRUGW13939_08930"
                     /db_xref="GeneID:55996414"
     mRNA            complement(join(<1123490..1124084,1124149..1124273,
                     1124342..>1124476))
                     /locus_tag="TRUGW13939_08930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492055.1"
                     /db_xref="GeneID:55996414"
     CDS             complement(join(1123490..1124084,1124149..1124273,
                     1124342..1124476))
                     /locus_tag="TRUGW13939_08930"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347948.1"
                     /db_xref="GeneID:55996414"
                     /translation="MLYLVGLGLADEKDITVRGLEVVKSASRVYLEAYTSILLVDKEK
                     LEAFYGRPVIVADRELVETGSDDILEGAKDVDVAFLVVGDPFGATTHTDLVLRARELG
                     IQTKSIPNASIMSAIGCTGLQLYNFGQTVSMVFFTENWKPSSYYDRVKENTSLGLHTL
                     VLLDIKVKEQSLENMARGRKIYEPPRYMTVAQCASQMLETEEERQERVYGPDSLAIGA
                     ARVGAPDQKLVAGTLKELAEVDMGEPLHSLVLLGKRAHDLEKDYIQQFAVNDDTFNTS
                     WKKGYGST"
     gene            <1125162..>1126232
                     /locus_tag="TRUGW13939_08931"
                     /db_xref="GeneID:55996415"
     mRNA            join(<1125162..1125335,1125387..>1126232)
                     /locus_tag="TRUGW13939_08931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492056.1"
                     /db_xref="GeneID:55996415"
     CDS             join(1125162..1125335,1125387..1126232)
                     /locus_tag="TRUGW13939_08931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347949.1"
                     /db_xref="GeneID:55996415"
                     /translation="MMRNKKKKKTSSPLWKLSELELRAGFAQMMFVSGETAEPSQETT
                     TLIEDIVRQQVIEMLSRSTALATRRGNRAISTDDLIFLIRHDKAKVSRLRTFLSWKDV
                     RKNVKDSDDKAGADAADFAAGDDPLAGAGVAGPQDVAAKPKNKRAKVGLPWDINSFYS
                     VQVPEREDEEDEEEEEQNYATLQRLATADERTKNMTREEYVFWSDCRQASFTFRKGKR
                     FREWAGFGIVTESKPNDDIVDILGFLTFEIVQTLTEEALKVKEREDREKKGRGIAENG
                     DGENPKKRKRETGLFDPPEEGRTPIEPRHIREAFRKLQATPQKAVAMLLHDGRVPPRF
                     PLRLV"
     gene            complement(<1126480..>1127226)
                     /locus_tag="TRUGW13939_08932"
                     /db_xref="GeneID:55996416"
     mRNA            complement(join(<1126480..1126502,1126567..1126975,
                     1127038..>1127226))
                     /locus_tag="TRUGW13939_08932"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492057.1"
                     /db_xref="GeneID:55996416"
     CDS             complement(join(1126480..1126502,1126567..1126975,
                     1127038..1127226))
                     /locus_tag="TRUGW13939_08932"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347950.1"
                     /db_xref="GeneID:55996416"
                     /translation="MSSSTSVSSVDPYKAKNIEPNVQLKDKIEDLVKFIKDTKYGMLT
                     TMASDSELLTSRAMALAGTENGGADLIFHTNLLSGKTMDLTVHPKETNMSFLDVLSGG
                     WASISGTATILAGREIIEKFYSPALKVWLGDLGDGVHDGSPSDPRIGVIKVEAKSVVH
                     VLPRKGLVGRAVDAGKAIAKGDVPPINKIRELSTEELANWRQSHKE"
     gene            complement(<1127914..>1128603)
                     /locus_tag="TRUGW13939_08933"
                     /db_xref="GeneID:55996417"
     mRNA            complement(join(<1127914..1127980,1128045..1128102,
                     1128162..1128177,1128231..1128292,1128354..>1128603))
                     /locus_tag="TRUGW13939_08933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492058.1"
                     /db_xref="GeneID:55996417"
     CDS             complement(join(1127914..1127980,1128045..1128102,
                     1128162..1128177,1128231..1128292,1128354..1128603))
                     /locus_tag="TRUGW13939_08933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347951.1"
                     /db_xref="GeneID:55996417"
                     /translation="MAESDNINDETCVSPHTDPSAKNLMDLPTELHIHISSFLSYPDA
                     LALKHTSRLFYLVVDTGVELKIDWLVERFERKLECPMEKCGGILSVDVAKEAVLSSMG
                     KAIWRNEVLIFGALFIFWTLLWSIFTRVLLNKHADSPSLLNPFYLSWL"
     gene            <1129564..>1131252
                     /locus_tag="TRUGW13939_08934"
                     /db_xref="GeneID:55996418"
     mRNA            join(<1129564..1129685,1129743..1130689,1130743..1130894,
                     1130950..>1131252)
                     /locus_tag="TRUGW13939_08934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492059.1"
                     /db_xref="GeneID:55996418"
     CDS             join(1129564..1129685,1129743..1130689,1130743..1130894,
                     1130950..1131252)
                     /locus_tag="TRUGW13939_08934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347952.1"
                     /db_xref="GeneID:55996418"
                     /translation="MSPSPKISTRARATDINEGRENDIRGPDEHQVHRQLWSREGFPG
                     SVVFNFCAFLLLALYSTLSKLWVANIDSSQVVTTDVYTYIGVIAQVLNDGLPRSAWLI
                     IGDKSTRTTSSRLTLSYTMIVVQIALGALMMVLFLASSDKLAAAFVPEQVRQSSLTYV
                     RISSVEALSSAMETVVSSCTRALDHPDVPLLISSMKFVVNIMLDLLIISRFHVGSFVP
                     TVNTQAWIRLACDLSSAICGLLYFLYISFKLRRQSQEQTATLSLTALKTLARPSSYTF
                     TESVIRNAIYLWIVSRIILLGDNYATAWGVFTTIRWGLVMVPVQAFEASTLTFVGHNW
                     GKWRAHVGVNLRRPTASKAEIFSIIRPALISCFVVLIIEVILCIVLSTRGIQSFAYFL
                     SNSEAVAEITQMMWKAIDWTYIFYALNYQLAAILLAASPRWYLYQALGSNFLWMLPWA
                     IVVTKMSFTPSKSWTIYAIIFGGALVFDFVDVSLTLLIWGFRLSKGKVKVGVLKRQV"
     gene            complement(<1131304..>1133208)
                     /locus_tag="TRUGW13939_08935"
                     /db_xref="GeneID:55996419"
     mRNA            complement(join(<1131304..1131521,1131576..1131670,
                     1131752..1132145,1132202..1133041,1133100..>1133208))
                     /locus_tag="TRUGW13939_08935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492060.1"
                     /db_xref="GeneID:55996419"
     CDS             complement(join(1131304..1131521,1131576..1131670,
                     1131752..1132145,1132202..1133041,1133100..1133208))
                     /locus_tag="TRUGW13939_08935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347953.1"
                     /db_xref="GeneID:55996419"
                     /translation="MTFMDQRATWRVATNLEKKSLLIAVNSLAGLAILFFGYDQGMMG
                     GVNTSYDYVHTMKFGYVDSTATVVVTDTLLQGGIVSVYYLGTLVGCLMGGSLGDRAGR
                     IKTIGIAAVWGIIGASLQCSAQNATWMICARLVNGIGTGILNAIVPVWASEISEYQTR
                     GAFITMEFTLNIFGVVIAYWLEFGLSFINGGRSQFQWRFPIAFQIPMLIVLLVTCWAF
                     PESPRWLCKVDRHDEALHILRRLRGTTGEDAGKAEAELADIRAVVELERQNADHTSYF
                     HMLFGIGFGKLHIGRRVQLVMWLQILQDWTGIAGITMFAPTIFSIAGFDSQKAQWIAG
                     LNNIFYSFATLICVFTLDRIGRRWTLWWGAAGQAIAMFLAGGLSRGGLNATAAGDTES
                     AKAWGAAAAAMVYLYTFIFGATWLTVPWLYPAEIFPLQVRAKGNAWGVVGWSVGNGSL
                     TLALPYIVQAINEKTLYVFATCNILSIPIVWAFYPESNQRTLEEMDLLFAEDSPWVWD
                     AETNFARLREENPELLMVGRSGFQSQMENALREKNNASQIERV"
     gene            <1134758..>1137469
                     /locus_tag="TRUGW13939_08936"
                     /db_xref="GeneID:55996420"
     mRNA            join(<1134758..1135036,1135100..1135566,1135616..1136031,
                     1136087..1136186,1136237..1136327,1136382..1136576,
                     1136628..1136721,1136787..1136994,1137054..1137127,
                     1137324..>1137469)
                     /locus_tag="TRUGW13939_08936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492061.1"
                     /db_xref="GeneID:55996420"
     CDS             join(1134758..1135036,1135100..1135566,1135616..1136031,
                     1136087..1136186,1136237..1136327,1136382..1136576,
                     1136628..1136721,1136787..1136994,1137054..1137127,
                     1137324..1137469)
                     /locus_tag="TRUGW13939_08936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347954.1"
                     /db_xref="GeneID:55996420"
                     /translation="MEEGKKGFFSLFPFSNRASRPHSTPSFHGPQGVRGACLKRIVLA
                     FKPTTNSHALPPLASSQPRKRAVIPELDHAAIVLKTRTGCVCYVRPRVEAFMSQCTPD
                     SPSKVVPAVVIHRQPQELSSKTIQGYFDHFQDSDDVFQEQFTKNAFLVLPKSIKSQRG
                     QREEATLDRKSAELFDKEDFSADLTNYLDSKSLVPCDLEEELDIPEGPYFVVGKSLHQ
                     AWRLYPDNLGAFSTAVIPDDINTTPGCSYTQVFRELEGLGFAGVAVPSRLYFKKSDKK
                     PLNGIRISVKDNMHLNGVVTGLGNKAYAELYGRQSESAELIQSLINKGGVIVGKTKLS
                     AFAGSEIPPSQCIDYKSPWNPRGDDYQGPSGSSSGAAAAVAGYTWLDVSIGTDTTGSV
                     RHPATSHGTWGHRVTWNDTQWGGIVPSCSLLDTVGIISRTTEEVRDVLGALGAPQSKQ
                     NGPTIILYPIDWFPLADENQQRMTEVFVKALENHLGVAHTKISLAEEWSKSGPEQLRD
                     KSLSEVFDMAASLVGYDFYHNFDDFRFQYFQKFQKPPSIHSFTETRKRDESRTLEERS
                     RAFQMILRFRVWTFERLFSVSANGTCQTIMIVPQGRPGANYRDIEPKSEPNGKPIPRP
                     GPIWFTSITGAPQLLVPRTDLALLKVAEDTLRKAGWPTDILTGRFMFEVGDNERFSIP
                     SENYLKL"
     gene            complement(<1137751..>1139546)
                     /locus_tag="TRUGW13939_08937"
                     /db_xref="GeneID:55996421"
     mRNA            complement(join(<1137751..1139315,1139368..1139457,
                     1139510..>1139546))
                     /locus_tag="TRUGW13939_08937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492062.1"
                     /db_xref="GeneID:55996421"
     CDS             complement(join(1137751..1139315,1139368..1139457,
                     1139510..1139546))
                     /locus_tag="TRUGW13939_08937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347955.1"
                     /db_xref="GeneID:55996421"
                     /translation="MPHFTSSQPPVHVPETIPIWTWLFDSEHSPLHNTPSSQIGGYIN
                     AITKEHLSYLDLKTHSTHLSTALIKKYGLQPGQTVSLFSPNTVWYPCAMFGTLRAGGI
                     VSGASPAYTVDEMTYALKISNAKFLFTIPDSIQVAVKAALAAGIPQSHVFLLEGSVSG
                     FNTMSDLLEIGKSFNSNQIAQYQFPPGKTNRDVCGFLSFSSGTTGLPKAVMIAHSNVI
                     AQCLQVQQITPETHRRILAVLPLFHITGLVHQLHLPVLLNANVYMLPSFSMDSMLQTV
                     QDYKLEEMLLVPPILIRMIRDRQTMQKYDLSSVKRFSSGAAPLSDEVLQLLQEMFPGT
                     GFKQGYGMTESCSCITAHPPSMYDYKYAFRVGTIVANTDVKIVDPDSGRECGLNEAGE
                     IWARGPQIVMGYLNNKTATDETFDKDGFLHTGDIGQIDEEGMITIVDRLKEMIKVKGI
                     GVAPAELEDLLLGHPDVDDAAVLGIADDYAGQRPKAYVVLKPAAETDHKKIAMGLLKY
                     VQEKKVRDKWIFEIEIIDEIPKSASGKILRRVLRDLSKSGRKGLVVRVDRPPAKL"
     gene            complement(<1139903..>1140898)
                     /locus_tag="TRUGW13939_08938"
                     /db_xref="GeneID:55996422"
     mRNA            complement(<1139903..>1140898)
                     /locus_tag="TRUGW13939_08938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492063.1"
                     /db_xref="GeneID:55996422"
     CDS             complement(1139903..1140898)
                     /locus_tag="TRUGW13939_08938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347956.1"
                     /db_xref="GeneID:55996422"
                     /translation="MADISSMEDPEFSAVMKSFGPRRASPKIATALEYRATADAFIGS
                     LLSTHPVPDNVVETKYTITSYDGAEVDIYHFIRDDGIAKKEGPQPALLYAHGGGIVAC
                     PVDTISRTLATQQASEFGVQCFAVDYRMAPEFPFPTPLEDCYAALKWLVEQSQSLNVD
                     PKRIVLIGDSGGGTLVAGLSLLARDRGVSPPPAKQILLYPMLDDRSADIAESRPDDAR
                     SQYFSSYINMIKICWDAYLGTSTGASLNPDVQPYACPARADVLAGLPPTYIDVGSLDL
                     FRDESLAFASKLVAANVDVEFHMYEGVPHCFDLIARDIQITRNAIENRKRAIGSI"
     gene            <1143327..>1144734
                     /locus_tag="TRUGW13939_08939"
                     /db_xref="GeneID:55996423"
     mRNA            join(<1143327..1144360,1144413..>1144734)
                     /locus_tag="TRUGW13939_08939"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492064.1"
                     /db_xref="GeneID:55996423"
     CDS             join(1143327..1144360,1144413..1144734)
                     /locus_tag="TRUGW13939_08939"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347957.1"
                     /db_xref="GeneID:55996423"
                     /translation="MSSKKYPLHNRGIYRNLPTFDPAIKNLTAIITGANGVSGFGLLR
                     SLLESPERWTKIYAISRRPPPKEMTEKLLRPDQRARVEHVASDFLDDPSQITEALKAA
                     SVTRADYIFFYSYFQPRPKPGTGPREVAEELLRINVSLLSNFLDSLSILNLKPRRFVL
                     QTGAKHYGVHLGRLRVPAIESDPRVSHPEPNFYYPQEDRLFEWCRKTSNDGKENVGWN
                     VIRPAWILGAVNNAQMNALYPFAVYAAVSAHRNVPLAFPSTWSAWQELNLNASARLTG
                     YLTEWAVLEDKCKDQAFNAQDTSSLTWDRFWGELIRWYDVKKGFVGPADDDKCTIEMK
                     GRAFGEESPMGYGPPLVTRLSFSLVKWAKDPENQEAWKEIMAANPNITYDPFADVEQN
                     FIWGDAAFRRSGPVSMNKARHMGWTGFVDTHESLFEIYGDMAQLGMLPPLKVDSAQAL
                     M"
     gene            <1145214..>1146641
                     /locus_tag="TRUGW13939_08940"
                     /db_xref="GeneID:55996424"
     mRNA            join(<1145214..1145390,1145489..1145571,1145634..1145778,
                     1145847..1145882,1145935..1146544,1146601..>1146641)
                     /locus_tag="TRUGW13939_08940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492065.1"
                     /db_xref="GeneID:55996424"
     CDS             join(1145214..1145390,1145489..1145571,1145634..1145778,
                     1145847..1145882,1145935..1146544,1146601..1146641)
                     /locus_tag="TRUGW13939_08940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347958.1"
                     /db_xref="GeneID:55996424"
                     /translation="MSSIAQRLRQTTNFLGGGQQSPSSLPWNPDSAGFPRRKDLPRID
                     GAPEGAAWVWGKDDNIGRLNLLTPKRVLQASSEIKTGELVPLNLPLNNPEPPAFHRED
                     FKHTIKVVADEVCFDDLYELNTQSSTQWDGFRHFAHLPTKTFYNGTKAADVKGPDANL
                     KCSIHHWSEHGIAGRGILLDYRRYAKANSINYDPCSGHAISFQELVKCGKTQGIDIRP
                     ESQGGDIKIGDILLIRAGFVERHGELSLEERQKVIAHQTDTENGLEAFQFAGVKQEEE
                     VIDWLHDCYFSGVVGDAPAFERWPTQRPYLLHEYILSLWGMPLGEMWNLEQLATKCAE
                     QKRWTFFLTSSPANVKGGVSSHANAIAIL"
     gene            complement(<1146849..>1149284)
                     /locus_tag="TRUGW13939_08941"
                     /db_xref="GeneID:55996425"
     mRNA            complement(join(<1146849..1147171,1147233..1147428,
                     1147493..1147732,1147803..1148111,1148180..1148247,
                     1148315..1148474,1148534..1148634,1148692..1148798,
                     1148869..1149003,1149160..>1149284))
                     /locus_tag="TRUGW13939_08941"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492066.1"
                     /db_xref="GeneID:55996425"
     CDS             complement(join(1146849..1147171,1147233..1147428,
                     1147493..1147732,1147803..1148111,1148180..1148247,
                     1148315..1148474,1148534..1148634,1148692..1148798,
                     1148869..1149003,1149160..1149284))
                     /locus_tag="TRUGW13939_08941"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347959.1"
                     /db_xref="GeneID:55996425"
                     /translation="MLDVLSLYLFLPLAILCHAQTPPSNPFPAGNSTTDPLVVNLGVP
                     YAEAPIGSLRWQASVPPSTVGNGTVVPATAYGYACPQTSDPTLSITPFQPNGGVNEDC
                     LVLNVWAPADATDLPVFVYIHGGGYDSGSSSSFDVPFMVKNAKDKFIGVAIQYRLGAF
                     GFLASEDVHNSGVVNAGLYDQYLALQWVQRYINLFGGNSSAVTLAGGSAGAGAAMLQA
                     MAYGGQVNDTLFDRIFATSPYLPQQFNYSDSMPTDNYYSFAQEAGCYDPTTGDKSNIF
                     QCLVGQDTIILQNASSIVNNRARFGHGAFEPTTDGIFVQDIPSAQLTNGNLNGNYALI
                     GNNADEGEMFVPPNITTDAGFTAFVKFLYPLLDDNDMLQVQELYPAIDGISTTRYATD
                     GLDNTTNAVNVSPFVTGHQQRANNLYAETTFDCPAQWLAEGFSRNGRQSYKFQYSILT
                     SLHGNDLYSYMNLGNSLPSNMAQAFRDAVISFMNSFISTGSPSDETIYNTTVPLDTAS
                     VLKNWSSYSLDSPLQMNLNQTGGTPAITNDPRDPYHIEVIVYNDPGLSPLFSLVDAYN
                     WEGGRGKRCDFWKSIGYKVPG"
     gene            <1150876..>1152066
                     /locus_tag="TRUGW13939_08942"
                     /db_xref="GeneID:55996426"
     mRNA            join(<1150876..1151061,1151130..1151365,1151417..1151840,
                     1151899..>1152066)
                     /locus_tag="TRUGW13939_08942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492067.1"
                     /db_xref="GeneID:55996426"
     CDS             join(1150876..1151061,1151130..1151365,1151417..1151840,
                     1151899..1152066)
                     /locus_tag="TRUGW13939_08942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347960.1"
                     /db_xref="GeneID:55996426"
                     /translation="MHYSTVLQLATLAALGDASKINPGHHALHNHRRYATSNGTGYSL
                     TDEYPTGLDFFSRFSFYTDNDPTHGFVTFVDEDTATSNNMISAQGNTTYIGVDSTNVA
                     SSTGRQSVRLTSTTTYNSSLFVLDLAHMPGSNCGSWPAFWTLGANWPYQGEIDIIEGV
                     NQQSGNAMTLHTSDGCTINNNGFSGSISTNNCFVNATGQSNNAGCGIDSTDPTSYGDG
                     FNNNNGGVYATEWTDEFIQIFFWGHDNVPSDLTNGSPNPASWGQPVALFKGDCDIGSH
                     FQSQNIIFDITFCGDWAGSVWSSSASCSSLSSSCSDYVQNNPSAFQSSYWLVNSLKVF
                     SRS"
     gene            <1152497..>1155001
                     /locus_tag="TRUGW13939_08943"
                     /db_xref="GeneID:55996427"
     mRNA            <1152497..>1155001
                     /locus_tag="TRUGW13939_08943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492068.1"
                     /db_xref="GeneID:55996427"
     CDS             1152497..1155001
                     /locus_tag="TRUGW13939_08943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347961.1"
                     /db_xref="GeneID:55996427"
                     /translation="MHIWFLAVVLLNGARAVSVELPLNKTSWQQYIVSPQSRHVVPSA
                     IAISTGNVWNADALISGSGIARLTRAQEQYPTWPSGTTAEASSEAGPNTSGSYYAANA
                     IDNNLTTIWNDATANQYPDVLTITSPSLVTLDGVTLESSTEGYPVNFTVETWNGSSWA
                     VSGSITGNNETRCQVPFSQNVTTDQIRLTVTADQPSASGDYTRVVELWPGLVPLIPSV
                     VLDFGQDVVGFLQIEFAGASTNAPGIRIAFSETLEYLTDVSDYSRSERGSGSSKLTPG
                     SDQIAVASAPMNWTDTNGCKYNGIQVCADGLHAFRYVKISLDSISSDEPYTSNWGFVD
                     IKSVSLNYTAYVGTPSSYSGWFECSDEQLNQFWYDASYTNEITIDTFLKDTTEPRGAD
                     SPTLDGKTVIFDGAKRDRDPYVGDIAVSGRSIYLTHQDASIAASNVLADLAQHQSSNG
                     WIPPASINNYTLPLFDYPLWWVATSWDYILYTADTEYASTYYPNLQAVLDNWYPSMTD
                     NSTGLLDKPTSYGDYAFLSRYGAITYDNALYVLALNNAASIATFLNLSDDATRWLQRA
                     DQVSQDVDKYLWDSEVGAYLDVATNKTRHGQDGNGLAIIAGIANGTKAQSALDYLGNK
                     TALSYGNSFMDDNSIPGSDGSTRVYAFTSYFDIQARFLSGRADSAIDEIRRLYGCMTS
                     QDPGTTFWEGINNGTAYEQGTTSMAHGWSTGVLPALSNYVLGLIPIAPGYQRFSINPS
                     FPSGLSWARGQEATAYGDVYVEWTSVNDVITINFTSPNGTLADVTVPKKNSVKLDGTT
                     VWHSSNQTKTGIEVQQGTDSISLIGVSGGQHIVVSS"
     gene            <1155551..>1157134
                     /locus_tag="TRUGW13939_08944"
                     /db_xref="GeneID:55996428"
     mRNA            <1155551..>1157134
                     /locus_tag="TRUGW13939_08944"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492069.1"
                     /db_xref="GeneID:55996428"
     CDS             1155551..1157134
                     /locus_tag="TRUGW13939_08944"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347962.1"
                     /db_xref="GeneID:55996428"
                     /translation="MIFKKHFVNTYNLWVVIFVAIGTISSAYGLAIIGSTVGQPNFYT
                     YFNLAPQGEPGYAHTTNIIGALNGVNSAGAIAGCYFQAWASDFYGRKRTIQIGSVVMI
                     IGGALCSGAVNIAMFLVGRFVAGLGAGILACVVPMYQAEVSTAETRGAMVAITGIMYA
                     VGYTLAGWLGYACYFMKATDPHATFSWRFPLAFQVISPLIVLAGSPAIPFSPRWLLQQ
                     GRRDEAWDIVQRLHKTPDDPNSIHARQEFYLMEKQHELDKSMTTRRFEIFRTAANRRR
                     ALMAFLLMWGDQFLGIFVITNYGVLIYSGLGLTGSVPLLLNACWTSFTLIGNTWTAFY
                     IDRFGRRRFMLIGSIGCICSLIFLCSLTATYLGTENTAGLRATVFFVFFYCFWWCFFV
                     DATQYVYVPEIFPSHLRTQGVAIGLSGYYLASEVTLVAAPVALNSIGWKFYLVLIVPS
                     AVYICYIYFCFPETKGRTLEEIGELFGDGDQVAAHWYHTTEEERAKIAEEALRDMKPS
                     GSASDEELKPTNFHDEKVS"
     gene            <1157613..>1159143
                     /locus_tag="TRUGW13939_08945"
                     /db_xref="GeneID:55996429"
     mRNA            join(<1157613..1157762,1157816..1158120,1158189..>1159143)
                     /locus_tag="TRUGW13939_08945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492070.1"
                     /db_xref="GeneID:55996429"
     CDS             join(<1157613..1157762,1157816..1158120,1158189..1159143)
                     /locus_tag="TRUGW13939_08945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347963.1"
                     /db_xref="GeneID:55996429"
                     /translation="AMATAHLASWSCNLTYSQLPRNVIDAAIRTFYNWAGCAVGGSNH
                     LTTTTALNALEPFFGQPAASLLGAGDRLVDAQHAALLNGIASHVHDYDDTHLDTIIHP
                     AGPVASALLAVAEWKVGASGKDILLALVCGIEAECKLGLAVWPEHYDIGWHITSSAGS
                     IGAAVAVSKLLSLSVEQTSHGIGIASTQVTGLREMFGSDTKAFHTGRAAQSGLLAAVL
                     AQQGYTSSGQALEAKRGWANVVGATKEDVQVNLNKWLGLDTEDLQEQSDVGLAGGLSS
                     GRWEILRNSFKPYPCGIVIHPVIDGCCQLHSEIKRLGLSSTNIQQVQVTVHPLVVELT
                     GKTAPKDGLEGKFSFYHGGAIGLLYGKATPDEYEDHIVQDPTVVAIRGRIQGTIDPKL
                     RPDEAKIVLTMNDGSVLERHVEHAVGSLNAPMDDEALEKKFKNQCAKVLADVDLASQT
                     CWNIEEIKHIPELGWALSL"
     gene            <1159366..>1162630
                     /locus_tag="TRUGW13939_08946"
                     /db_xref="GeneID:55996430"
     mRNA            join(<1159366..1159457,1159595..1160272,1160332..1160892,
                     1160966..1161611,1161866..>1162630)
                     /locus_tag="TRUGW13939_08946"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492071.1"
                     /db_xref="GeneID:55996430"
     CDS             join(<1159366..1159457,1159595..1160272,1160332..1160892,
                     1160966..1161611,1161866..1162630)
                     /locus_tag="TRUGW13939_08946"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347964.1"
                     /db_xref="GeneID:55996430"
                     /translation="CLALLLFFPALLATLQQYMHEWHVTNVFGSRISKIAVNSLVARI
                     RLLENTLKQHNVPIPYSTKASKSSAGETLCRNGQETSNISRQQSSMVQSEYSKSQNDG
                     RPDRKQALIERIDRGNSLTPGLDPEIELLVNRTGSLQFSDHGQLKYFGATSNVHFLRN
                     SIPFQPPTSTFLPSSAEKDKSPSDSSLLEYTGDVTHTVPRELEDHLIQLYFTWENPYF
                     RVVDEEAFMSARQQALSRSDNEDDTPVSSCYSEFLVNAMCSWGALFTDRDVPELPPLH
                     DFFIFQAREKLQHDMDNPTIATVQGLAMMSGSEVSRGRDSRGWLYSGMAAQVAHHLGL
                     HMDVEHYVQSGDIIREEAIARSAAFWGTYVIDTAWSYYLGRLVRPVVNVNRNPAQTPS
                     QTTNSQPRIWRNYTDEPMSLPEYGGQHIDPVASMWRQQLKLCFIMERFQHTLYDKQTS
                     SIGQLRMHTSAVTWALDKWMDELPSDLTVNYESTSNIYLPHVLVLHAQFHEVMIFANH
                     PFITEPKGGSSTGFLSLQAQRKYAESAQRITQIIRMYDRLWTLRRINIQFIHPMFTAA
                     MVHLYVACTASSHNREVFTAAVSDLETCCNALRDVGEYMELAVWQLRSIDHIRQVWYD
                     LLENQEDILMSSPLSAFNSNDSERWLAIEAVVQKAWVPHGPLKQPSATAGRASFFLDL
                     CFHIQQRPLQLIHKYLAMADPTKRSAYGTASSDTDFRKTWDREEYAKKGKEDEAKSRA
                     EAKARYEAKLAGKKWHAPVDYSTLETTSSRTSRLDVASMVGKTTMVPAGSAVGKRGRS
                     AGFYCSDCDLTFKDNIQLVEHLNSKQHLIAIGESGEVKRASVGDVRNRLRWLAHKKRE
                     KEEEDRKALNLDLGSRLKEREEEESREREEKRAKRREKRKAVKQEDEGWEGRLGIIA"
     gene            complement(<1162860..>1166086)
                     /locus_tag="TRUGW13939_08947"
                     /db_xref="GeneID:55996431"
     mRNA            complement(join(<1162860..1165359,1165426..1165535,
                     1165598..1165894,1165946..>1166086))
                     /locus_tag="TRUGW13939_08947"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492072.1"
                     /db_xref="GeneID:55996431"
     CDS             complement(join(1162860..1165359,1165426..1165535,
                     1165598..1165894,1165946..1166086))
                     /locus_tag="TRUGW13939_08947"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347965.1"
                     /db_xref="GeneID:55996431"
                     /translation="MGAQMDTFAARLASFDATVPSIKSRASTTSRTIQPIAWPYDSPS
                     PEQLADAGFFFNPYDTNPDNTTCFLCRRALDGWEDGDNPVEEHLKHSPDCGWAIMMFI
                     QQNTSKPSEIEDPTLPSVAEARKATFSVGWPHDGKRGWLCQSDKMVEAGWYFCPSDDS
                     PDLASCPYCKLSLDGWEETDDPFEEHHRRSSTCSFFVFALPAAKSTKKGTRAKKPRVS
                     KASRLSTQSVMTTTSEAPVEDDQMDVSVMSQATAKKGKAGKRSTKPKSKKSKKTDTVD
                     VTADEADIAEEQFAEAEPVEDKSPEPAKPKRATRGKKRASEAISQDTTAESQHEEPSP
                     KRRATAIRNSAVSQSVAAEQDDVEEAPIEEPSPKPPAKKGRKGAKKAGSTKTRKASTA
                     SATTKMAAHIARDESVLDAAIEEDHDRTLQNSEPFEFQYKDEKRESARFGKQSISAST
                     ASAQNPGSSVLGEETVDEQEQQPEQLPEDELDPALDTESIVEAPVEPKTKKESKRKPT
                     TKKPKKGKASVQPEPELEDEPEPMQLERDHTPEEEYLEEHPYTASEKDELESSPAQKS
                     SVFAEIPVEEPRPASKQGKKQGRKQATDKAKRSTKTTETEKEPVSRASSVDASDELAN
                     LSLNHTESKSTTRKNARKRKSQEEEEIEIADEHEIPVENKLQEDKAHPAQTKLKRGHL
                     SKDAEDRGLEIEQHSKPKAKRGRPAKQSQKQLPEPQQQRKQTIENAEEQEDGPEQNAY
                     EDQTLTQSSTAIEDHAQDVVPKTEDQPKRGRPAKSKAPSKAAKEQEDELQRNMDEDNK
                     PEVVSQAKEQPKRGRPSKLKAPPKTAQRYSDLPQDTHRAQSFIESVAQSSPPQSSEGV
                     IPGSGTQERTPSLSPQSSDAENQPPSARPPSARPPIFSPAKTQTTRVPLATSTPTLSP
                     SKRQLKTGNLSSTHSWKPSDIEQLLLDSLADKENRGFTGSLNISKQMLTSPEMKMTVD
                     EWIKFNAKDGEEKLKLECERLIGVFEKEGGRAMRALEGLECVE"
     gene            <1166232..>1168165
                     /locus_tag="TRUGW13939_08948"
                     /db_xref="GeneID:55996432"
     mRNA            join(<1166232..1166537,1166600..>1168165)
                     /locus_tag="TRUGW13939_08948"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492073.1"
                     /db_xref="GeneID:55996432"
     CDS             join(1166232..1166537,1166600..1168165)
                     /locus_tag="TRUGW13939_08948"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347966.1"
                     /db_xref="GeneID:55996432"
                     /translation="MRGQVTSGPELRQAVHVICRGQSSDPFRAEDALDRGRGNRRQSS
                     SLSIALLLWEPNSTNLTRSTSPFFLRQSSYGVISLSLCWFFSPYCSQLLQTVNMRRLV
                     ALRNAPRLTSPTSLSLSGAPFIPHALYTRSLRPLSACSFHTLRPSSPSNHRLFDRAHI
                     NDQPLHGLSRERAIQSSPFSSSTTLNNGGNDWEDNPNLSISTFSELPSKNFGVNQHMI
                     INEEFKEALRQILWRFRAPIRYAFAYGSGVFSQTAAPGIGPGHPSPPQAIRNVQQGKG
                     KMIDFIFGVSHTQHWHSLNLQEHRDHYSALGSLGSYAVSQVQDNWGAGVYFNPFVTVN
                     GTLIKYGVVNIDTLCKDLSQWDTMYLAGRLQKPVKILRDHPSVRLANQVNLISALRLA
                     LLLLPETFSEHQLYTTIAGLSYMGDPRMTVSAEDPSKVNNIVTGQMDYFRRLYAPLIE
                     NLPNCDFNDPRCTESDWIDDPEANVQLNQDMDPVKRGNMVRRLPKSFRERLYFQYQGR
                     YQIPRAEFLKMMEKANDEDPNRIHRRQGGPFEQRVAADDSLKEELHTAITKTIRWPAT
                     MQTIKSALTAGVGRAWTYVREKRKKHSDSKNKPQPPKSDPETVQSSESSKTSEPKKG"
     gene            <1168906..>1170330
                     /locus_tag="TRUGW13939_08949"
                     /db_xref="GeneID:55996433"
     mRNA            join(<1168906..1168991,1169084..1169248,1169334..>1170330)
                     /locus_tag="TRUGW13939_08949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492074.1"
                     /db_xref="GeneID:55996433"
     CDS             join(1168906..1168991,1169084..1169248,1169334..1170330)
                     /locus_tag="TRUGW13939_08949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347967.1"
                     /db_xref="GeneID:55996433"
                     /translation="MASRTSAFDLSKCARPNILKLQPYRCARDDYKDDGTNVLLDANE
                     NAYGPGLALDAAGNLPAASTVNDAGSPQIDFLGLNRYPDPYQIELKKLLCNLRNTKVH
                     TQKDLTPDNLFVGVGSDEAIDALVRCFCVPGRDKIITCPPTYGMYAVTADVNDVEIVK
                     VPLDADNGFQLQTDKINEALSADERIKLVYICSPGNPTANLIRKEDILKVLEHPTWNG
                     VVIVDEAYIDFAPEGSSLAEWVNEWPNLVVMQTMSKAFGLAGIRLGSVFTTPEIATLL
                     NNMKAPYNIPSPTSVIAQAALAPKNLAVMDQNRTNIITQRERMLAEMPKIPGVGRFLG
                     GQASNFLLVQILDSNGKPDNVTALGAYEAMAEKKGVVVRFRGKEYGCEGSLRVTVGTE
                     DEVTRFLKELKVVLHSLHTGTQV"
     gene            complement(<1172378..>1173248)
                     /locus_tag="TRUGW13939_08950"
                     /db_xref="GeneID:55996434"
     mRNA            complement(join(<1172378..1172749,1172803..1173060,
                     1173129..>1173248))
                     /locus_tag="TRUGW13939_08950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492075.1"
                     /db_xref="GeneID:55996434"
     CDS             complement(join(1172378..1172749,1172803..1173060,
                     1173129..1173248))
                     /locus_tag="TRUGW13939_08950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347968.1"
                     /db_xref="GeneID:55996434"
                     /translation="MDFDPAIMLMPGNNSGLSGNQGWFYNNDMMEKFDYSLDTLDMSS
                     SPSHGLTSNNPIIKKEIIFEPYVPTSAMTPPSSTSTPSPQMSLAKPSRTRSSSKKDKT
                     TPKKTRVPKGGTASDDDLPEDKSLRRREQNRIAQRTFRERKDRYIQNLESHIKDLNAK
                     HQSLEANYKKSTDHVSALYTQLVELQSELEAWRSFAHTTSAGPSTPSSSSMQSPVIPV
                     ASHDETEIMQALQIHPFYHPPPRSAFGPISS"
     gene            complement(<1174805..>1175336)
                     /locus_tag="TRUGW13939_08951"
                     /db_xref="GeneID:55996435"
     mRNA            complement(join(<1174805..1175050,1175118..>1175336))
                     /locus_tag="TRUGW13939_08951"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492076.1"
                     /db_xref="GeneID:55996435"
     CDS             complement(join(1174805..1175050,1175118..1175336))
                     /locus_tag="TRUGW13939_08951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347969.1"
                     /db_xref="GeneID:55996435"
                     /translation="MQDRSNRWDRLELIFSRKAPGMKARHSQAFSSRLRKNAVAGIGD
                     VRRRCRKPGEALPGPLAAFGLAVLHSPGAANIATLPNFNFAETPCDLQTGLDPRPPRA
                     ASGRLDAASWFHILPSTPPIASHHARQPPSGQPTRSPRDTSGTQHMHTRLVL"
     gene            <1175382..>1177030
                     /locus_tag="TRUGW13939_08952"
                     /db_xref="GeneID:55996436"
     mRNA            join(<1175382..1175507,1175577..1175823,1175892..>1177030)
                     /locus_tag="TRUGW13939_08952"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492077.1"
                     /db_xref="GeneID:55996436"
     CDS             join(1175382..1175507,1175577..1175823,1175892..1177030)
                     /locus_tag="TRUGW13939_08952"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347970.1"
                     /db_xref="GeneID:55996436"
                     /translation="MVQGPARGGGSKPPPRRRIPAPASQPQVISWRFSSAPAKPSRIT
                     EPITPPEHNAAKDDEKAKKKQPEPRVELKDLQKSFALTRKTPVEPPVEQKPEITQVKS
                     VLDPFCVLPTALNREDEQLLQFYLTVVSRDVYGTRSDAVFNPVRDISFALSLRSPMTL
                     QWMLIAAAGFVAGRRGEGPPLAIFRRKSVAYQTLRQKLGTSPTGPISDELIDVLIMAT
                     MTESRISQRDASNIHLRGYERAVQTRGGFKKMILASTTPLLFTSHLMPFLICEPPAGD
                     IVLGPSDARHAFHILEIIAKGENTIDPSELHFMPPDPNSPTSNAKYEPSLKLHLSESL
                     RLLLASSLLSRHLRPDFSTHSRYALQTAQYLSLFIILTTLWRLHGELSQSKLFLNRLN
                     LSLIRSGDQDSQGQDLLTMEGLMWITIKAAFDALQGNADNQAGLIVDSMSALKLFGAA
                     NEAVRRMLVEYMYEMLSEGIDRSVLIRNSQLAGTMSLRIQDYGNFSRDIDEIT"
     gene            complement(<1177735..>1178111)
                     /locus_tag="TRUGW13939_08953"
                     /db_xref="GeneID:55996437"
     mRNA            complement(join(<1177735..1177978,1178047..>1178111))
                     /locus_tag="TRUGW13939_08953"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492078.1"
                     /db_xref="GeneID:55996437"
     CDS             complement(join(1177735..1177978,1178047..1178111))
                     /locus_tag="TRUGW13939_08953"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347971.1"
                     /db_xref="GeneID:55996437"
                     /translation="MGLLKTSLLVGGGIYAVKTIMKKHDKKEEEMRNNNNNNMTAPMY
                     QQGPPPQYTQQQPYQQGGDQGYTNNNNNNQNGYMNGGYNHGYQGSSKGQDNGVEKVRY
                     "
     gene            complement(<1178690..>1181602)
                     /locus_tag="TRUGW13939_08954"
                     /db_xref="GeneID:55996438"
     mRNA            complement(join(<1178690..1179095,1179154..1181229,
                     1181307..1181509,1181585..>1181602))
                     /locus_tag="TRUGW13939_08954"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492079.1"
                     /db_xref="GeneID:55996438"
     CDS             complement(join(1178690..1179095,1179154..1181229,
                     1181307..1181509,1181585..1181602))
                     /locus_tag="TRUGW13939_08954"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347972.1"
                     /db_xref="GeneID:55996438"
                     /translation="MGRGKKFGKRGGGSGGGGGSRGVRGSWEELEKSNAKYESYYNDH
                     GIIPAEDQEAFWPALRRELPNSFRFTGSRGHAVAVKQRLVDFHIPQITSITYEGNAVE
                     PPKPVPWYPDELAWYMTTPKKVIRRFPPFASFQKFLVAETEVGNITRQEVVSMIPPLF
                     LDIRPGMTVLDMCAAPGSKSTQLMELLHIGEEDATRKVMEDIKQGTYDPSKLPAGLED
                     YGRTTGLLVANDSDFKRAHMLVHQMKRLNSPNLLVTNHDATGYPSIKLPSPPGRERFN
                     NYLKFDRILADVPCSGDGTVRKNPTIWKDWTPGNALGLHATQLRILVRALQMLKTGGR
                     VVYSTCSLNPIENEAVIAAAVARCGGSNFVEIIDCSQELPDLKRADGLRSWKVLDRDC
                     RVWNSWQEVEEHRKTAGISGLGRLSSTMFPPSKDLPLERCLRVYPHHQDTGGFFITVL
                     EKKTEIKAKPENVDKVVPKASVAAVVEELEQKTKDNNGGPLDKIESLDDIVPHSTGTD
                     GKDATVAESSHQPSYTATLDAPASPSKRSSGHLEDQVPTKRTKLENGTEVIIGDRPVH
                     HPPPSAVEGQEDNTDFPKAEAPAQAKPPVKRKPGQPFEEPFKYVTGTEDEITEIFKFY
                     NISDQFPRDRFMVRNAEGSMTKTIYYTSVLARDILTENEGRGMKFVHGGVKMFVKQDA
                     QRPNQCQWRIQTDGLPIIESWLGPERTVTLTKKQTLRKLLVELFPKLDQHTYQQLGEI
                     GHQTKDIQLGCCIMRVEPSESEDGLQERMVLPLWRSMYSVNLMLPKEDRRAMLLRLFN
                     DETPVIHPPKFRSEDTPTTDLASDSQTESKDKSEAEAKAEIADSEMTYAQIEKDIPPP
                     IAKTEEDLIKAENILRGQEQADLMSSRETYQRDGDEEDRFNTTV"
     gene            complement(<1182274..>1183903)
                     /locus_tag="TRUGW13939_08955"
                     /db_xref="GeneID:55996439"
     mRNA            complement(join(<1182274..1182474,1182533..1183717,
                     1183781..>1183903))
                     /locus_tag="TRUGW13939_08955"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492080.1"
                     /db_xref="GeneID:55996439"
     CDS             complement(join(1182274..1182474,1182533..1183717,
                     1183781..1183903))
                     /locus_tag="TRUGW13939_08955"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347973.1"
                     /db_xref="GeneID:55996439"
                     /translation="MSAAVSEPAGQKARPVKPDEDAYKASLAQAEKEHTTAQEKLNQI
                     KAKIESAKPNNQDSPAAQRQKELRAELAAIRQKQQGFKSARSSTQEKLSALDSNLKAR
                     VAEQNNSRNKISFKNVEEIDKEISRLEKDVDSGKMRLVDEKKALSDISSLRKQRKNFA
                     GLDDGQKGIDTLKKQIADLKKAMDNPEARALSDKYNEITKELDSIKGDQDSAFKTLNS
                     LRDERTKLQKDQQAKFLAIREIKDTYYKARKAYKEYEDEAWKVRRERQKAERDAFERE
                     KKKKIADKKLEEASQLAYTDEILTAQGLIRHFDPSYNFASLGLDDAKKTTDGAFRAEV
                     GRTVDDSDIKGIRVVKKDEREEDYFKGTGGKKGKKGKKGTTASPAPGTPTEGKFNLSF
                     GVIEDFAKVKVDQPMSQGDVPTVVEKLAAKITEWKKNQASKTQENIKKAKEEIERLEE
                     ESQRATDHGKKVAQTNAGVNGHVSAEAEAKQEEDGAADAADELKKASLEDKA"
     gene            <1184559..>1185416
                     /locus_tag="TRUGW13939_08956"
                     /db_xref="GeneID:55996440"
     mRNA            join(<1184559..1184654,1184737..1184819,1184888..>1185416)
                     /locus_tag="TRUGW13939_08956"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492081.1"
                     /db_xref="GeneID:55996440"
     CDS             join(1184559..1184654,1184737..1184819,1184888..1185416)
                     /locus_tag="TRUGW13939_08956"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347974.1"
                     /db_xref="GeneID:55996440"
                     /translation="MDETSGVSKEAERQVTRLWHTWKTVHSMLSDRGYEVSEEELGIS
                     LADFTAKYTDSMGFPERSRMRVVAIPSEAMKAKHTGIKRRATDPDPVPDCGQIYVEFC
                     TDSTGVGAKQVRAFIHTVDEGNYHSGIFVTQTPISPSAVRLLTTLDKRICEHFQESDL
                     LVNITRHELVPKHVLLSAEEKARLLDRYRLKESQLPRIQFSDPVSRYLGLRRGQVIKI
                     IRKSETAGRYASYRWVI"
     gene            complement(<1185961..>1187633)
                     /locus_tag="TRUGW13939_08957"
                     /db_xref="GeneID:55996441"
     mRNA            complement(join(<1185961..1187203,1187272..>1187633))
                     /locus_tag="TRUGW13939_08957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492082.1"
                     /db_xref="GeneID:55996441"
     CDS             complement(join(1185961..1187203,1187272..1187633))
                     /locus_tag="TRUGW13939_08957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347975.1"
                     /db_xref="GeneID:55996441"
                     /translation="MSSALTGLVARSMYGNVPPDPHTRAQDNPTLLISWWCTCFSFVI
                     ILVRVIGRYQRTNRFFTEDKFMIASIIPLFVRMAFVHVVLIWGTNNTKTHSLTELEIH
                     HRETGSKLVLVSRIFYALYIWMAKYTVCEFLRRLTGMVWTRTFQIALRSIEYFLASTL
                     VAVIIATLVECQPFNHYWQVTPDPGPQCRLGYANLMTMGVCDILTDFFLVALPVSLFV
                     TSAMTIKRKIQLTVLFASSFVLVAITGYRVPSVIRRDGLQSFRSLLASFEILAATAVS
                     NFVVIGSFVRDRGLKKAKFKRPGGSLSITESADQSSVRRTTLTQNHWGSDADLVRDMG
                     IRIDPEMHAVEANKVRPAPVAMTGGVAEGWTFSQGHQRNDRASTAGNFRSQSHLSASG
                     DSESLKVSPRRVSFHDVGGLLDDCDPPSPTTTRAPYPLPRSSSHLSTQSTNTGMSRYM
                     PYDQGSDPPWQDVGGLLSPSDSYTSNSPASNVSSSHNPRGNPETALNRPAPAYYHRES
                     DEYHNIPDLELHDAGGLLSNTTSNTN"
     gene            <1189432..>1190406
                     /locus_tag="TRUGW13939_08958"
                     /db_xref="GeneID:55996442"
     mRNA            <1189432..>1190406
                     /locus_tag="TRUGW13939_08958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492083.1"
                     /db_xref="GeneID:55996442"
     CDS             1189432..1190406
                     /locus_tag="TRUGW13939_08958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347976.1"
                     /db_xref="GeneID:55996442"
                     /translation="MADAPSGWLDIHGHFSLPRAASEDAGVVKAFRDIHFMLSEAPRF
                     NAEDTLAYNDRAGVSMQMLSSLPPTTDQLRKSNDFGLSIVRQYPSRFGLLAALPTDEP
                     EETLKEIERMRNQDTHDSIQPDGFAVTTLRNGVSLGDAQLRPVWEELNNRKEVVFVHP
                     NAYVRGQDGRPSALIDVAFDTARTITDMLYKRVFLDFPKITWVFAHSGGAFPALSGRV
                     LLLGLEPWVPNQARITKEEMKKQMSRIYMDTAATAATGMEPAVKMAGIEHIVYGADCG
                     VPCSTELTMEENRESVMAIAQKNTGDGNFVGMNGFDLFPNAKVRAASS"
     gene            complement(<1190866..>1191498)
                     /locus_tag="TRUGW13939_08959"
                     /db_xref="GeneID:55996443"
     mRNA            complement(<1190866..>1191498)
                     /locus_tag="TRUGW13939_08959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492084.1"
                     /db_xref="GeneID:55996443"
     CDS             complement(1190866..1191498)
                     /locus_tag="TRUGW13939_08959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347977.1"
                     /db_xref="GeneID:55996443"
                     /translation="MSTAVSVYLIGAQCTGKTTLLAALRETIKLKYPSSPFSAVTEVA
                     RDVLSQNQFTREDITSNPDRALQLQQLILTAQFEKETKLAHSMILSDRSGVDPIVYGV
                     QYGPPRAQKLLEKSLGWPFLRDRMKRSLVFVCPPHKEWSTDDGTRLMADSWEEWYNVH
                     LTFARVLQENDIPFYVIPMELVDLEDRVDYVLNMWKVYGNPATRISMHIE"
     gene            <1191846..>1197240
                     /locus_tag="TRUGW13939_08960"
                     /db_xref="GeneID:55996444"
     mRNA            join(<1191846..1192691,1192748..1193330,1193398..1194596,
                     1194676..1196118,1196185..>1197240)
                     /locus_tag="TRUGW13939_08960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492085.1"
                     /db_xref="GeneID:55996444"
     CDS             join(1191846..1192691,1192748..1193330,1193398..1194596,
                     1194676..1196118,1196185..1197240)
                     /locus_tag="TRUGW13939_08960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347978.1"
                     /db_xref="GeneID:55996444"
                     /translation="MAPQSLGSFSQILQSEFLLTDSKWCYNVNELPGPKITNPGGWVK
                     SLDLECSRTTQKLELKFIKVDQNRATSTREIAHLIHLSFSDFRLGKVVEDEWQGCTAR
                     ETGDYLVRLLQHGIKLNGILYSFYGHSNSQLKSRSCYLLRGSKEEVTRLVESLGDFSK
                     IQTVAKKAKRIGLLFSSCHALLKVACGRYEDIDDIEASGYNFTDGCGLVGGSTARLLS
                     QKLKIVIHNQLYHPSVFQIRFKGYKGIVSLEPQLRKGCYFQFRASMRKFSGTTDSSFA
                     VVDYSQPYTYGYLNDDIVLLLHALGITKDVLWKKQREHFHRLQDSLTDPGVAFVVLCS
                     LGRLDLVEKLVLGGIEKIASPLRGLVNSELTKMLNKRQEHKCRILVPDSRLVFGICDP
                     REVLEEGECFLRVTDDMYGRRPRTIHSCEVLVTRNPCLHPGDLRKLKAVDKPELAHLT
                     DCIIFPVKGKRPTADQMSGGDLDGDKFFVCWDPDLVPTTMSEPAEYPPGQAPVSFQGI
                     TVDDWIEYFARYTSASLGRVKKLFLQWAVHKGALSRECQELNRLHSLSVDGNRIKIPD
                     RLATPPPLDEDISQGFILHILHEEARKEALKKLLAPTPRSKYDTREVIETILCQPRTC
                     SEFSMLRLVHDWCCQTSEANISELLHYFDLPAMTPEQRRWLLRELPTSIEYPSLVMNG
                     LLYSGILDRQELIPFHLDYPGMRWKRIFSTDDRLANLFEVIAKSFSEFHRKLLVLKVH
                     ERLTIAIYIQQQIAPEEEVLVGQGVRVIAFPHTQEPGNRRGRIHATKSTYHLYYDHNV
                     FQLYQSRRQNTFVWIGRPGKNDSSYKTVQGVANRNRERQKTIDAGVNRDWVTSIALDR
                     FSAHTKTQIGRVYRDDIVAAELYVISNTDVNSFQVLDLWMESVDTMETIPLFEKVPPP
                     LTIPELATADLTSQPDDIRGFFESGDISLLDQASLQGKISTILQVCFETAGTSLSGNI
                     YEHYLQSSEAVAAWAMQEELLEGLIQGLVYTPGHVVFFAALSPWQENFPWSLSRTLKA
                     QSLRLLKATFQATSTSGIFALKAMKTILGEIDSLSLESFQGIVEDACLLLKSPDQLLD
                     IYLDGLAHTSERLIHESPTVRDYFTRHMFAITLDHCEEASESVSRKDDLWAFEPFTLS
                     SEPPVLVSHRRLDAPQLERLAAGDHVQFQLARYPENVFLTEKPMFDATIESSTQGSVT
                     FMCLSYPPHYCVSARWRMKHCGSFVTSRAMLDSLVSLIKDKERACALYPLLVENKSLK
                     HDSLGDRYKYRTDLNQCQNEAVEYSLKAPLTCIWGPPGTGKTQTVAVILQELISRRPE
                     DRILVTAPTHNAVDNILKRYLGVAGQTGLRPLRVSTNIWKVDRELLGYTCDGMERKEI
                     GHNRTSRNQALERIQQARLIFTTCAGAGLGLLRGEEFPIVIIDESSQQTEPMSLVPLT
                     KGCQKAILVGDHVQLRATVRKYTKILGFEISLFERLYIAENIPAGSLQRVMLNVQYRM
                     HPQICDFPSQEFYEGKLKADTSCERNTLPEHGFPWPEIPSSGGQLERCVFVPCLGEED
                     VGHRSKGNLLQAELCKEIYRMIVSTSVSVAVLTPYTRQVKILKDRLPGSATVTSIDGF
                     QGQEADIIIYVTVRCNPHGDIGFLSDLRRLNVVLTRARSGLIVIGCPRTLTNAESPTS
                     SDEKGDSRIFNSRTVDQDAGPVWKRLVQSLKRVEIPLASK"
     gene            complement(<1197546..>1198584)
                     /locus_tag="TRUGW13939_08961"
                     /db_xref="GeneID:55996445"
     mRNA            complement(join(<1197546..1198029,1198118..1198336,
                     1198421..>1198584))
                     /locus_tag="TRUGW13939_08961"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492086.1"
                     /db_xref="GeneID:55996445"
     CDS             complement(join(1197546..1198029,1198118..1198336,
                     1198421..1198584))
                     /locus_tag="TRUGW13939_08961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347979.1"
                     /db_xref="GeneID:55996445"
                     /translation="MKSVISHLAACSVLGMVVAGQDVNDTENGMADVIQGNADCASVA
                     AIFARGTFDSGNIGVWVGPQFFEELSSRLPSVALQGVDSTAYKADLDGYLSDGGSDDG
                     AASLASTVNDYNSKCPDSAIIVSGWSQGALVAHKALEQVSSAALDKVAALVTFGDPNG
                     VWSGISLPTSIPSSSFSSSCVTGTVFDPLCAQLPNDFKLPTSISDIVGPFSSLPDVTV
                     GTQQIKAAASLIVEFPKQLVKSWDSFVSNLTPDQFVRLMLTPQHFTYGNNGMAGQAAE
                     FVAGLAAVQSAQ"
     gene            <1199580..>1201503
                     /locus_tag="TRUGW13939_08962"
                     /db_xref="GeneID:55996446"
     mRNA            join(<1199580..1199981,1200058..1200480,1200568..>1201503)
                     /locus_tag="TRUGW13939_08962"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492087.1"
                     /db_xref="GeneID:55996446"
     CDS             join(1199580..1199981,1200058..1200480,1200568..1201503)
                     /locus_tag="TRUGW13939_08962"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347980.1"
                     /db_xref="GeneID:55996446"
                     /translation="MSRLLRNKEGCWTCRLRRKKCDGSRPECSTCTSLAIPCYGYGPK
                     PDWMDHGEKEKAVTASLKQVVKHTSRRKAIPRMPKELSRLMNIAPKNSREASSSSSSP
                     TLSIQQDGIHVPVNQDLSEDIEDDTPGNKPTTNPVPQADDHHEDIVLYPIAADESACL
                     MHYLDNVFPLQFPMYKPSILEGGRGWLMALLLNMKPLYHATLALGSYHRRKVALKESS
                     DHMCQVASIIEQEKHLATCLAEFQQIIRSINESLRVSTCPKEGMSVMALVVQLIFFEY
                     FTGEGTAWQIHLHAATNMYRRGYPNILFHFNLGERSKTIMLEDLPLSEGEHPDTMQEV
                     ATFRFLAVTVAWLDIISAITAGTAPRLLPSYADETVWKCPQIKFENYIGCKVSVLIQI
                     GRISALHEHKTNAMAQDQPMNIAFEETVSDISREIQGGLNQMALEGLCFAEGGPSENP
                     SASTMSPPAVDDRTIVTNVYTYMASIYLHLVTYGFQQMELISSNICAALGMIHVHVPT
                     HLLPSLVCPLFVIGCVAPQEEGMSFFRHIFSSPPVLDALFEHRMKLLPVLEETWRRRE
                     TTDNLSWAQVLELTPNILPI"
     gene            <1202062..>1203379
                     /locus_tag="TRUGW13939_08963"
                     /db_xref="GeneID:55996447"
     mRNA            join(<1202062..1202625,1202701..1203145,1203240..>1203379)
                     /locus_tag="TRUGW13939_08963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492088.1"
                     /db_xref="GeneID:55996447"
     CDS             join(1202062..1202625,1202701..1203145,1203240..1203379)
                     /locus_tag="TRUGW13939_08963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347981.1"
                     /db_xref="GeneID:55996447"
                     /translation="MKTVVIVGGSFAGLSTAHRILKQATKTGLSAKVVVVSPNSHFYW
                     NVASPRALLPGQIADDKIFKPIAEGFKQYPTSQFELVVGSAKGLDVAARKVEISTGPG
                     GNGATTSLDYDFLILATGSRTKEASDGVQMPFKNLGSTEETKDALHEFQEAVKRSKTI
                     VIAGGGPTGVETAGEIAFEYGRAKKVILLTSGQTVLDGSMTSVSNSAISILKDLKVDL
                     RLRTKVSSSRQATPGGPQELILSDGSHLTADLYIPTHGITPNSSYIPSKYLNADGFVV
                     VNDHLKIKGLENEPVWAIGDVSDREAPQFMFVDRQSNHVVKSLFLALEKKDPVPYKMG
                     FSGMGLQIGRKTGTGQIGFIRLPGFLIHFLRKNLFLERVPSFIDGSEF"
     gene            complement(<1203740..>1205340)
                     /locus_tag="TRUGW13939_08964"
                     /db_xref="GeneID:55996448"
     mRNA            complement(join(<1203740..1204236,1204304..1204326,
                     1204393..1204456,1204513..1204803,1204896..>1205340))
                     /locus_tag="TRUGW13939_08964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492089.1"
                     /db_xref="GeneID:55996448"
     CDS             complement(join(1203740..1204236,1204304..1204326,
                     1204393..1204456,1204513..1204803,1204896..1205340))
                     /locus_tag="TRUGW13939_08964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347982.1"
                     /db_xref="GeneID:55996448"
                     /translation="MHIRSILLLGLNAFSVAWAQLADTSSYPIGPLTTSDAKWATKIC
                     DITDYGAVADGATDSGAAILAAFNACSSGGVVNIPLGTFALATWVTLSGGNAWAINLE
                     GIIVRTGTAGGNMIYIEHSTDFEIYSSRGEGAVQGYGYQFHSEGTYVTNFAIHDIALV
                     DSPAFHLTLDTCNQGEVYNMIIRGGNEGGLDGIDVWGFDIWVHDVEVTNKDECVTIKN
                     PSNHILVENIYCNWSGGCGMGSLGTDTDISKIEYNNIYTVNSNQMFMFKSNGGNGTVT
                     EVTLQNFIGHGNAYSLYINAYWSDQTVADGDGILYNSITFNNWKGTCANGAQRPPLYV
                     LCSSTNPCTNIIIEDFAMWTESGSTEYYKCADAWGQGYCLEGGSQHTAYGTTTSTVTA
                     APSGYSAATMPGELTAGLGITTSIAIPTVPNTFFPGATPATPRVYGS"
     gene            complement(<1206302..>1208321)
                     /locus_tag="TRUGW13939_08965"
                     /db_xref="GeneID:55996449"
     mRNA            complement(join(<1206302..1206521,1206584..1206691,
                     1206758..1207145,1207204..1207445,1207513..1207761,
                     1207817..1208072,1208136..1208187,1208259..>1208321))
                     /locus_tag="TRUGW13939_08965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492090.1"
                     /db_xref="GeneID:55996449"
     CDS             complement(join(<1206302..1206521,1206584..1206691,
                     1206758..1207145,1207204..1207445,1207513..1207761,
                     1207817..1208072,1208136..1208187,1208259..1208321))
                     /locus_tag="TRUGW13939_08965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347983.1"
                     /db_xref="GeneID:55996449"
                     /translation="MASTKKPYLGLSGGWLTFWIMVACTTDMMLFGYDQGVFSGVVVT
                     EDFLKVHTLVGPSRTKLLSTITAIYDVGCFLGAILAFTIGEKLGRRKSIILGTTVMVI
                     GTILQASSYSLTQMFIGRVILGIGNGVNTATAPVWQTETAQAKWRGKLLILEMALNVF
                     GYCLVNWINYGLSFHEGSIAWRLPISLQLFFMFILFLTIPWLPESPRWLMAHGHVNEA
                     RNVLACIENRPTSDPYIETQYDEIRFSIQYEEENAIGWRDMLRGNKGDGTKTLRRLIL
                     GAGTQALQQFQGINIMSYYLPLVLINSVGLSNNLSRLLTACNATSYFFSACFAVALVE
                     KFGRRGMMIMSGLGQFVAFLVITILLRVAETHKVYATVSVAFFFLYHVAFAIGMLGVP
                     WLYPTEINSLPMRTKGAAVATATNWITNFAIVEITPIGIQNLGWRFYIVWTVLNAAFV
                     PIIYYANYPREANRTLEDVDAYYRSNPALIVIKDPDAISTKRPIKYIQHEDEEIMRKT
                     NNITLKLDNSVLSEHMNY"
     gene            complement(<1209224..>1210237)
                     /locus_tag="TRUGW13939_08966"
                     /db_xref="GeneID:55996450"
     mRNA            complement(<1209224..>1210237)
                     /locus_tag="TRUGW13939_08966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492091.1"
                     /db_xref="GeneID:55996450"
     CDS             complement(1209224..1210237)
                     /locus_tag="TRUGW13939_08966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347984.1"
                     /db_xref="GeneID:55996450"
                     /translation="MASPSSVFLVGIGYIGQNVLDELLAAKHPVTALVRRPEQASELE
                     KIGVKTVLGTLSNLDLLTAQTVQHEITINTASCDDLPSVEAILSGVRQRVHAGQSCIY
                     LHTSGTGVLEDGAVGMYKNNKIYRDDVPEDIDAIPSTSMHRHVDIPIVQAARELGDKA
                     KIAIILPPLVYGFNPAHQRHSFGLVGLVRFAMKHGFAGYVGEGHNMWSVVHVKDLGHA
                     YTALLAYIKNSDPETLQRNPYFFAENGSEISMGEGSKHISRVLHDMGKIQSPQAQTFS
                     EAHYQDVFGPLTPVGLGCNSRSRAIRLRELGWEPRESTDIWTSWKEDEVPSIVAGLES
                     ASA"
     gene            <1212109..>1213741
                     /locus_tag="TRUGW13939_08967"
                     /db_xref="GeneID:55996451"
     mRNA            join(<1212109..1212210,1212268..1212525,1212581..1212991,
                     1213047..1213241,1213324..1213461,1213523..>1213741)
                     /locus_tag="TRUGW13939_08967"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492092.1"
                     /db_xref="GeneID:55996451"
     CDS             join(1212109..1212210,1212268..1212525,1212581..1212991,
                     1213047..1213241,1213324..1213461,1213523..1213741)
                     /locus_tag="TRUGW13939_08967"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347985.1"
                     /db_xref="GeneID:55996451"
                     /translation="MTSGPIVRIAPDTYSIDDPDSVRILYGHGNGFIKSKWYTASGNP
                     YIPDLFTTRDPTLHRNIRKKVASLYATSHLLRMEPIIDDCIDLLVSRFAEVADKRTQI
                     NLQHWMQCYAFDVIGYIAVGKRFGFLDKGEDTLGIFPSLHGYLKYCATMGVYSEFHSL
                     IYNIINTVSSGGIGEIVQFSKREIDKRLLIEAQGKSEIDRDMLSEVLQLHEANPQRVT
                     MIDIMSICVTNIGAGSDTTSISLTSVLYHLIRNPLCLEKLRAEIDQHFSTNVSGHIKF
                     ADAQKLPYLQACIKESLRVHPATGLPLGRVVPKGGVTVADTFFPEGTTLGVNTWVAHA
                     NASVFGPDALSFRPERWLDSSKEELKAMDNYFLAFGQGSRTCIGKNISLVEMTKLIPI
                     LVRNFDFRLTGPDILKNGLQCENVWFVKQNNIICDIQHRSTLKHSKGE"
     gene            complement(<1214011..>1215306)
                     /locus_tag="TRUGW13939_08968"
                     /db_xref="GeneID:55996452"
     mRNA            complement(join(<1214011..1214306,1214380..1214574,
                     1214629..1214742,1214793..1214933,1215016..1215094,
                     1215148..>1215306))
                     /locus_tag="TRUGW13939_08968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492093.1"
                     /db_xref="GeneID:55996452"
     CDS             complement(join(1214011..1214306,1214380..1214574,
                     1214629..1214742,1214793..1214933,1215016..1215094,
                     1215148..1215306))
                     /locus_tag="TRUGW13939_08968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347986.1"
                     /db_xref="GeneID:55996452"
                     /translation="MVKTVTFGDIQIPSPGFGAMGLSFGLGSNLTLEQAEPVLLKALE
                     LGCTFWDTAVVYSRGINETLLGDFIRKHNVRDKILIASKCGFNAFGDGSVTNSPSHIR
                     EYIEGTIERLGFTPDLYYLHRIDPHTPLEDSISTMDEIRKAGKTKYIGLSECSAETLR
                     KANSIAKIDALQAEYSAFETGHETDGLIQAAKDLDITYVAYSPLGHGWLVDNFDYESP
                     DDFAPDDFRRKIPKFQGENFYQNKAIVEEIKKLAVKKGCTVSQIALSWVAAQGMIAIP
                     GTTKPQRLEENWASREVELTEEEKDAIRKVIDSVQPRGNRYAPAQQALVGH"
     gene            complement(<1216161..>1217226)
                     /locus_tag="TRUGW13939_08969"
                     /db_xref="GeneID:55996453"
     mRNA            complement(join(<1216161..1217024,1217080..>1217226))
                     /locus_tag="TRUGW13939_08969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492094.1"
                     /db_xref="GeneID:55996453"
     CDS             complement(join(1216161..1217024,1217080..1217226))
                     /locus_tag="TRUGW13939_08969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347987.1"
                     /db_xref="GeneID:55996453"
                     /translation="MQALFLITIFPDANHIVQRIEEHVLEAKEDEALILRKSASEDCT
                     MLAVAAAIVAQVAITALALDKIDQVHWTAKAAFVVSLSTGGLSVFYACLVQQKMSSLF
                     TVEDVKDFFSQPSSSEQLRKLEKELNMLAYQLNKARENERGSEMTTGIYQKLMTIESL
                     VKQFKRDNRWKAASFHSILMVKAPTLLLKYALAAFVIGLGIYYGCLAFNKAEDPGQSP
                     LAIFLFYLISVFLGLLIYYVPAMLKGLETSSLRRYAYLLKDRKRRDTKREEEMLENIT
                     RVINSDQPQTHEDDASEDALSWEERFGDVTRPELSPSHTTEIRPSIHRINSGRRSINS
                     TA"
     gene            complement(<1217926..>1218384)
                     /locus_tag="TRUGW13939_08970"
                     /db_xref="GeneID:55996454"
     mRNA            complement(<1217926..>1218384)
                     /locus_tag="TRUGW13939_08970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492095.1"
                     /db_xref="GeneID:55996454"
     CDS             complement(1217926..1218384)
                     /locus_tag="TRUGW13939_08970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347988.1"
                     /db_xref="GeneID:55996454"
                     /translation="MSSIQQIADKLAVPDALYRFFAGIDHRDKTVLASSLAENAVSDF
                     TRAGAKAGFEYPVLEGRETIISALTTSLASLDTSHNVSNPRVTLNGDKAYLEALVGAQ
                     HVPRDDSSRHYLMMNHYKVDLIRHGEAWVILTCTVDNIWRDGDVAVLSMI"
     gene            <1219052..>1219824
                     /locus_tag="TRUGW13939_08971"
                     /db_xref="GeneID:55996455"
     mRNA            join(<1219052..1219363,1219501..>1219824)
                     /locus_tag="TRUGW13939_08971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492096.1"
                     /db_xref="GeneID:55996455"
     CDS             join(1219052..1219363,1219501..1219824)
                     /locus_tag="TRUGW13939_08971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347989.1"
                     /db_xref="GeneID:55996455"
                     /translation="MTPKIISTDQWLVAAKLRRSVYNLTGTSSVSDSRIENILQQVLS
                     FAPSSYNTQPVRLNLITGEKHKQFWDTIIKTAEPILKDVGEGIWHTMGALMESQKAAY
                     GSVVFWERGDTIREASETHKSAAHMIPQLGDHANGMAQILAWTALELEGLGASLQHMQ
                     AIPVVETALREFCGMPDDCSLKAHLTFGDIAGDHPIMPDKLPFSETLKIIK"
     gene            <1221237..>1222235
                     /locus_tag="TRUGW13939_08972"
                     /db_xref="GeneID:55996456"
     mRNA            join(<1221237..1221508,1221563..1221989,1222050..>1222235)
                     /locus_tag="TRUGW13939_08972"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492097.1"
                     /db_xref="GeneID:55996456"
     CDS             join(1221237..1221508,1221563..1221989,1222050..1222235)
                     /locus_tag="TRUGW13939_08972"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347990.1"
                     /db_xref="GeneID:55996456"
                     /translation="MAELTTTVKMDDGVNLHVKLLGDDSTSTKKPLLVSLHGAPGLST
                     HLEPLASFGHLSNLFRVLVYDARGSGKSDHIGPFTHDRWIQDIENLRQWAGADTFVLA
                     GASYGGFVALDYAVRHGDKLRGLILRDTWANGKVGAMAALANIVTSSRINPDIHRQVR
                     VWSGTLYDDKDFEEAVAEILPFYTPPEDVVSPEDLPESTEFQETIKYHSATQNFAFSV
                     NMPQFDVRDQLKDIKAPTLVVVGRHDYVTPVSYSEDIAKSIPNARLEIFEYSGHSPPS
                     DEPAKFQEILLDYLKTIL"
     gene            complement(<1222414..>1224279)
                     /locus_tag="TRUGW13939_08973"
                     /db_xref="GeneID:55996457"
     mRNA            complement(join(<1222414..1223442,1223497..1223745,
                     1223809..>1224279))
                     /locus_tag="TRUGW13939_08973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492098.1"
                     /db_xref="GeneID:55996457"
     CDS             complement(join(1222414..1223442,1223497..1223745,
                     1223809..1224279))
                     /locus_tag="TRUGW13939_08973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347991.1"
                     /db_xref="GeneID:55996457"
                     /translation="MGIPPNEPDLSEMADSALPSRYQSPEPHTRDNICAQDPLLTIET
                     QEIYHAIEVYKEDIHPIYPFLPLEETRKTLPAVLNYLGRGTDLDTGDRNHRDNSVGQK
                     DVKILKMIVASVLVLQGGGNSMLAQRLVDSVECASSTSPRLVEIDVQELQVLTMISVY
                     YFHCDEPVLAWRTIGTAARMALEMGLHRRESLEKNIPHAATQRQAVIIFWCIYVLDRR
                     WSFGTGMPFVLQDSDIDPSLPIEYCEPYLQCMISYGGICSKVWNAVAGFNTSKTTGKD
                     TVDYLDFQLQQWLKSIPKDLQLIHPRLDDVARDQPRNLQHLRVLLYIRANHLRIFVHR
                     QHILSPARIFQNLESARLVIDIAKDTIRVLVHLRETSTIYETQQTAFNYFLVSAISAI
                     FLGVCHAPAEFSHSCRMEFYSSLGLLSALSAHSSITRRLWKSVKGLHQIAPRLGLAPT
                     GAPAPPSLPSNQNTHSTCQQQNRQQPEEPGHDSHSFVNTNRVEFSSVRGTVASIPMPL
                     PAADKSSRCDNVSLPRIPDNFQIGSDLTALFKAMGHRPQDGLRSSEIATPTWLSEDVG
                     QLQEGREVSQLFEGLL"
     gene            <1225697..>1227454
                     /locus_tag="TRUGW13939_08974"
                     /db_xref="GeneID:55996458"
     mRNA            join(<1225697..1225896,1225956..1226032,1226095..1226373,
                     1226438..1226606,1226665..>1227454)
                     /locus_tag="TRUGW13939_08974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492099.1"
                     /db_xref="GeneID:55996458"
     CDS             join(1225697..1225896,1225956..1226032,1226095..1226373,
                     1226438..1226606,1226665..1227454)
                     /locus_tag="TRUGW13939_08974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347992.1"
                     /db_xref="GeneID:55996458"
                     /translation="MPIQDKSSQEDEDVEEGNASAHSMRRQFSVWSLAALCLCLMATW
                     EALSTVVTTALANGGAPCFFYNYILSFLASVAVASSLAEIASSYPTAGGQYHWVALLA
                     PSRTSALASWFTGWISCGGQIVLTASAAFAAGLEMQALITANHPDSYLPQRWQGMLFY
                     WLVLVYAMVVNMWGSKILPHTNIVSGVIHIVAFIAIVVVLGVMAEKNDSYFVFAQVTN
                     TSGWKNDGISWLVGLLSTVYPFLGYDSATHLAEEMKHPARDVPLAMVLSVVINGIMGL
                     GYCVILLYSMTNLDELLASPTTFPFIQLLLNVTSSKVGATLLTIIWASIPVAATVAGT
                     TSTSRTVWAFARDDAIFCSEYFSHIDTRLAVPARVVVLITILEMLLGLLYLASSASFN
                     AVLSMAILGMYASYILPIIYMLLNGRKEGVRRPGPFSLGRIGGITINLIATIWLAFAM
                     IFSMFPNYQPVTPQNMNYSVVVMGAWCLLGGVYYFGFGRGKYSGPAIEVLEMVE"
     gene            <1228003..>1228395
                     /locus_tag="TRUGW13939_08975"
                     /db_xref="GeneID:55996459"
     mRNA            join(<1228003..1228113,1228183..>1228395)
                     /locus_tag="TRUGW13939_08975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492100.1"
                     /db_xref="GeneID:55996459"
     CDS             join(1228003..1228113,1228183..1228395)
                     /locus_tag="TRUGW13939_08975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347993.1"
                     /db_xref="GeneID:55996459"
                     /translation="MSSGKQITRVTLFKIPDPANQEKLANIYKEMPTKAKKDGKPYIV
                     SVKAGPTIEDQRNQGYTLAAVSTFASLEDMKYYDTGCEAHDALKVEAKKMHQGILVVF
                     YESSA"
     gene            complement(<1228792..>1230154)
                     /locus_tag="TRUGW13939_08976"
                     /db_xref="GeneID:55996460"
     mRNA            complement(join(<1228792..1229135,1229200..>1230154))
                     /locus_tag="TRUGW13939_08976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492101.1"
                     /db_xref="GeneID:55996460"
     CDS             complement(join(1228792..1229135,1229200..1230154))
                     /locus_tag="TRUGW13939_08976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347994.1"
                     /db_xref="GeneID:55996460"
                     /translation="MAFPKSWLPIPPKSPFSIANIPFGIISTAANKTPHPAVAIGDNV
                     LDLRIFAENKGFSASTVIEKEKDVFSKLTLNAFAALGRPFHREVRKYLQEVFTENSPY
                     ASLLEKNESLRQQALIQLKDADTHLPLEIGDYTDFFAGRNHAFNVGTLFRGPENALQP
                     NYEHIPVAYHGRASSVVVSGTALKRPWGQILPDPKAEPKVPIFAPCRRLDIELELGMF
                     VSRGNELGDSIDVNKAHEHIFGYVLMNDWSARDIQTWEYVPLGPFNAKNFGTTISPWV
                     VLADALEPFSSTGLQNTTQLQSYLQENKKNNVIDIDLEVDLKTASGISTTIIRTNARK
                     LLWSWPQMLAHHSVSGCPLRTGDLFGSGTISGEESGTQGSLLEQIQGGKVTLKLNGGE
                     ERKFLEDGDTITIRGWSGEEGALVGFGEAVGTILPAVSRK"
     gene            <1230912..>1232584
                     /locus_tag="TRUGW13939_08977"
                     /db_xref="GeneID:55996461"
     mRNA            join(<1230912..1231280,1231334..1232210,1232262..>1232584)
                     /locus_tag="TRUGW13939_08977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492102.1"
                     /db_xref="GeneID:55996461"
     CDS             join(1230912..1231280,1231334..1232210,1232262..1232584)
                     /locus_tag="TRUGW13939_08977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347995.1"
                     /db_xref="GeneID:55996461"
                     /translation="MAIQEVVERLQDKLTTLQVVFQYIVTGLLLIPVLYVLINEFIRS
                     GARIANLKGPRGLPLIGNLHQIRVNAAEQYRQWAKKYGGVYQIQLGNIPVVVVNTAGA
                     AKVIFGNNALSSRPEFYTFHKVISNTAGTTIGTSPYSDSLKRRRKGAASALNRPAVQT
                     YMSHLDIESKDFVKELLEYGKSGAEGIDPMPMIQRLSLSLALTLNWGIRMDSQQSDLF
                     HEITHVEEEISHFRSTTGNLQDYIPLIRLNPFSLGSVKAREMRNRRDVYLTALNKGLD
                     ERIANGTHKPCIQANVILDKDTKLNSEELTSISLTMLSGGLDTITTLVAWSVALLAQR
                     PDIQNTALKAIQKTYGTDQPLCDAEDDQQCQYIVALVRECLRYYTVLRLALPRVSVKD
                     VIHEGVRIPKGTVIFLNAWACNMDPEVWSDPEVFRPERWFENEDAPMFTYGMGYRMCA
                     GSLLANRELYLTFIRLLNSFRIEKVDDVDVHPVRGNMDPTSLVSMPQRYRARFVPRNK
                     NALRNALDKFVAVE"
     gene            <1234432..>1235712
                     /locus_tag="TRUGW13939_08978"
                     /db_xref="GeneID:55996462"
     mRNA            <1234432..>1235712
                     /locus_tag="TRUGW13939_08978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492103.1"
                     /db_xref="GeneID:55996462"
     CDS             1234432..1235712
                     /locus_tag="TRUGW13939_08978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347996.1"
                     /db_xref="GeneID:55996462"
                     /translation="MKFFSLDREEKGLPPPASNNNNVPRGPPFYTQSNPTQPVPEPEY
                     NVDRDRERLNRVYNVQLNSLVPADNKLLIFRSLTGIDHVPVLSKDGFFHPRNVPNLGI
                     YTRVVKAEQTAAFRYRCFSILINTCLAVQIVVAAALTAIGAAQGPHGVITAFGAINTI
                     MAGILTYLRGSGLPNREKTIEKAWGQVREYIEQREREFCLEGCMLSVDEEVRTVERMY
                     EEVRIQTESGSSEGGGVRGFESLRNIKHKESVLPMGVAKEISQSHMDTAKAAVGAQSD
                     RVEGSVRDRLSHYGDQYRHTSDNVRQTGDNSRHQGEGRFDQLKEGLQQVREHFQHTGD
                     QTRSTGESQAGNIRDELRHAGDLFRHASDNFRSTGENIRNTGENLRHTGDGQIHQASE
                     QARHAGEALQNPEIHVSIQADGNSKQTQTEKDFQ"
     gene            complement(<1236940..>1237482)
                     /locus_tag="TRUGW13939_08979"
                     /db_xref="GeneID:55996463"
     mRNA            complement(join(<1236940..1237100,1237164..>1237482))
                     /locus_tag="TRUGW13939_08979"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492104.1"
                     /db_xref="GeneID:55996463"
     CDS             complement(join(1236940..1237100,1237164..1237482))
                     /locus_tag="TRUGW13939_08979"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347997.1"
                     /db_xref="GeneID:55996463"
                     /translation="MTVKAIALLGVSLISLSVIQPCPAPIPLIVPLVSMVAPIIGEVV
                     QAGVNVAQGKSSKLKRGSDTDPFVDLDVRMELPTGIHQHDVDLCKNANKNSTGVKVIQ
                     ESDTSVRVENVEPECMVLASLFKDEGTPQPCGSDCLKYVNVDPKHVNDFIAEAKKYL"
     gene            <1239867..>1240907
                     /locus_tag="TRUGW13939_08980"
                     /db_xref="GeneID:55996464"
     mRNA            join(<1239867..1240170,1240221..1240661,1240726..>1240907)
                     /locus_tag="TRUGW13939_08980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492105.1"
                     /db_xref="GeneID:55996464"
     CDS             join(1239867..1240170,1240221..1240661,1240726..1240907)
                     /locus_tag="TRUGW13939_08980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347998.1"
                     /db_xref="GeneID:55996464"
                     /translation="MLSTQKSSHPISIRPSRAELDTSKLSPQNLEVAIRSLHQDGLVM
                     IEDLIPHKALDYLNEKMVSDGLALQGRKNEGPYNYNRGNIQQDPPPVRQYFDKNIFLN
                     PMVTQVTSTMLGPMPKWTFCSGNSAMPPTPETPPTSQPVHSDADFEHPKHPFALVVNV
                     PLITMTPKNGSTEIWLGTHTDTGLDVQEGRHGERSSGRINTTALENQRAVRPPCQPVV
                     PKGAVVIRDLRLWHCGVGNQTEDVRVMLAMIHFAPWYRNPMKLELADDVKEIVEKETE
                     LEIPVNWVPREQALHRYLNRGFGNSYDFGQSP"
     gene            <1241765..>1245261
                     /locus_tag="TRUGW13939_08981"
                     /db_xref="GeneID:55996465"
     mRNA            join(<1241765..1241902,1241965..1242041,1242099..1242398,
                     1242455..1242718,1242777..1242792,1242850..1242945,
                     1243004..1243138,1243194..1243863,1243925..>1245261)
                     /locus_tag="TRUGW13939_08981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492106.1"
                     /db_xref="GeneID:55996465"
     CDS             join(1241765..1241902,1241965..1242041,1242099..1242398,
                     1242455..1242718,1242777..1242792,1242850..1242945,
                     1243004..1243138,1243194..1243863,1243925..1245261)
                     /locus_tag="TRUGW13939_08981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035347999.1"
                     /db_xref="GeneID:55996465"
                     /translation="MKLLLTSLAVAYLSAQALGRAVSHKVGSYVLTEHPDSEKRAVLQ
                     DIVTWDNQSLYIHGERIMIFSGEIHPFRLPVQALHLDVFQKVKALGFNTVSFYVDWAL
                     LEGKPGSYRADGIFNLQPFFDAASQAGIYLLARPGPYINAEASGGGYPGWLQRISGVL
                     RTRSDYLNATANYVNNIATIIAKNQITSGGPIILYQPENEYTYFGNGESFDPQYMQDV
                     IDYARDAGVVVPFINNDAAALAHDAPGSGVGAVDIYGHDSYPLGFDCANPSTWPSGSL
                     PTTFHETHLEQSPSTPYAIVEFQGGSFDPWGGVGFDKCNALINDQFASVFYKNNLASG
                     VAILNLYMIHGGTNWGNLGHPGGYTSYDYAASISESRNVTREKYSELKLIGNFLKVST
                     SYLDTVPGNASTTEYTNTSGLTVTPLIGKGTNSSFFVVRHTDYSSTDVTSYTLKVPTS
                     AGTLTVPQLGGALTLNGRDSKVHVADYNVSGTNILYSTAEIFTWKKFADYSALVVYGG
                     QDEHHELAISSKDSVSVVDGSQGGVTTKSVGGQVVIAWDVSSSRRIVKVGDLLVFLLD
                     RNSAYNYWVPQIDSSAQKTDFSTQSSIADSLIVNAGYLVRTAYLQGTKLHLTADFNAA
                     TNVEVIGAPSSAKSLYINGVQHDHKTDSNGFWSATVKYSAPKISLPDFTKSEWKYFDS
                     LPELQSSYDDSSWVAATHNSSNNNVAPLDTPVSLYSSDYGFHTGYLLYRGHFVANGNE
                     SSFTVATQGGTGFGSSVWLNESFLGSWDGNANDANQSSTYKLPTTLKSGSNYVLTVVI
                     DNLGLDENFEVGIDEMKDPRGILDYNLSGHSQSDIKWKLTGNLGGEDYIDLVRGPLNE
                     GGLYAERQGWHQPTPPSKNWETSSPLSTGLSQPGVGFYSTSFNLDLPKGFDIPLYFVF
                     DNNTSTEQPYRVQLYVNGYQFGKFVPHIGPQGEFPVPQGILNYQGENWIAVTLWAHES
                     NGAKLGSFELINRTPVLTALSGITASEQPAYKKRAGAY"
     gene            <1245805..>1246251
                     /locus_tag="TRUGW13939_08982"
                     /db_xref="GeneID:55996466"
     mRNA            join(<1245805..1245819,1245877..>1246251)
                     /locus_tag="TRUGW13939_08982"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492107.1"
                     /db_xref="GeneID:55996466"
     CDS             join(1245805..1245819,1245877..1246251)
                     /locus_tag="TRUGW13939_08982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348000.1"
                     /db_xref="GeneID:55996466"
                     /translation="MADKYDQPPAYPAPVHQDAGPYYNQAPSPAPYVQSPPPQGGYNN
                     NGYSSPAPPNGYHPPGQPYYGPPPGGYYQQGYPPQQPQQGYYPPQGYYAQDPNRGHGS
                     SAAGGICAGISAALALCCCADMCFFLL"
     gene            complement(<1246724..>1247836)
                     /locus_tag="TRUGW13939_08983"
                     /db_xref="GeneID:55996467"
     mRNA            complement(<1246724..>1247836)
                     /locus_tag="TRUGW13939_08983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492108.1"
                     /db_xref="GeneID:55996467"
     CDS             complement(1246724..1247836)
                     /locus_tag="TRUGW13939_08983"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348001.1"
                     /db_xref="GeneID:55996467"
                     /translation="MLINGIKNKIIRHLSKFVWGSTGPRIASFAAFPCVVYTTKPGQT
                     NDIIAYRSPHVVHVVRGGTRRSFFIESSRNYTQKQTVILISGLATTSCSLLDNSNDTF
                     FELPAVARSDPTRLLLLVAITVSTAPETIRDPDRKMAPMSSFTEPIMRAVRNLASAFL
                     SRSIATTTTDPTSLSSPPAHEIKKRAPQILSIPATYALRDSSPEPGVVVGIVLGVVAA
                     VVLVLFILYQGLGLGGDSRGSIDGGGSGVIVVEEEESVRGGSRRRGGLASRSRSTRGG
                     RGRVVEEIVEVRRPHSRTHSLRETEDDYSEDVVEVIEESSATPYDEVEVEEEDESSVA
                     TSPPRRKRTSGGGSYRRVDPLAYGDDGEPYRRSSRR"
     gene            complement(<1247955..>1248895)
                     /locus_tag="TRUGW13939_08984"
                     /db_xref="GeneID:55996468"
     mRNA            complement(join(<1247955..1248738,1248801..>1248895))
                     /locus_tag="TRUGW13939_08984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492109.1"
                     /db_xref="GeneID:55996468"
     CDS             complement(join(1247955..1248738,1248801..1248895))
                     /locus_tag="TRUGW13939_08984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348002.1"
                     /db_xref="GeneID:55996468"
                     /translation="MAGNITVPYVPFDQFHWSMSHVGPLPWNQTVWSLIAVFTALPLW
                     ITIELTICVFYLFRRWSGLYFWSVLITTWGVTLHAIGFVLKVCVPSCNYIFSMVVAEL
                     GWMGMVTGFAMVMYSRLSLIGFVMRNRYILRLALAMIIINAIVLHTSTITIFAIGIEE
                     PGPKYLSYMNSIERIQIVIFTVQEVILSTIYIYGTFKMAQDSFNKRIRATISYLIVIQ
                     VVSILLDVLIVVLDFLDYYILKSFVHSFVYALKLQLEFAILNEFREVLAKMAPQSNSY
                     DLDQEAFRIMDSNTIK"
     gene            complement(<1249906..>1252343)
                     /locus_tag="TRUGW13939_08985"
                     /db_xref="GeneID:55996469"
     mRNA            complement(join(<1249906..1250328,1250387..1251066,
                     1251121..1251486,1251537..1251975,1252026..1252101,
                     1252156..>1252343))
                     /locus_tag="TRUGW13939_08985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492110.1"
                     /db_xref="GeneID:55996469"
     CDS             complement(join(1249906..1250328,1250387..1251066,
                     1251121..1251486,1251537..1251975,1252026..1252101,
                     1252156..1252343))
                     /locus_tag="TRUGW13939_08985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348003.1"
                     /db_xref="GeneID:55996469"
                     /translation="MSKKKSKDQLEEQQIRAQIRRQIRKDMRSMFATQNNVNTQQIIS
                     KFLQSHPGEEDFIKSVVNDYAKAIEETAAKGNANWGKNGGASTQKQQQQQQPNTVNMA
                     GPSKPQEPRLAVKVQVPSQSKSDEGSQYSEDSNAQFLEQLMSDSQPPKLPSANPPNSK
                     KIAKAEKLEARKAEAKKAKAEAKKAKAEAKEAKAQVQERRVESKKPIVESRKANVEFN
                     REEQPNLVNKTNALLETFKEDLASQRMASSPDPGASLNREKTPDLEAQLQFLSLDGQN
                     SIGDSGSSSRSIEQAVLISPTLEEMGEKMPPQFGLLGHLATKQSEDLVDPRVMLNTNI
                     PFSAFVCGLQGSGKSHTTSCMIENCSLPFQALGTLKKPLSTLVLHYNEYSSNVSSQPS
                     EAAFLASIMPEYKKNYKKSIPVRVLTSPSNFHNLEKMYSQIPNVTVRPFLLQPQHLNI
                     ATMLSLMSMGKKDSMPLYMAQLTRILREMALTNKGYFNYFDFRKRVKDLRLDRSQTPF
                     LEQRLDLLDSFLDLKGENRNRGSDYFVDGGVTILDLSCPFMDQSTACILFRIAIDLFL
                     HAHPSRGKMIVADEAHKYMNNTEAANALTETFMNIIRQQRHLGVRVIISTQEPTISPR
                     LIDLCSITVVHRFSSPEWYQTIKKHISIDDKRAANGDDDNMDGLYHISSLRTGEALVF
                     APSSYLLDERQEMIDVKHRSFKMVIRKRITWDGGQSITSVR"
     gene            <1253440..>1254676
                     /locus_tag="TRUGW13939_08986"
                     /db_xref="GeneID:55996470"
     mRNA            join(<1253440..1253474,1253545..>1254676)
                     /locus_tag="TRUGW13939_08986"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492111.1"
                     /db_xref="GeneID:55996470"
     CDS             join(1253440..1253474,1253545..1254676)
                     /locus_tag="TRUGW13939_08986"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348004.1"
                     /db_xref="GeneID:55996470"
                     /translation="MEWDSVVYSRWHRPKPSPYLSRFIKVCFGNSQDRYMVPEDLIRP
                     HRQLSRRLSYISTSDALDLQEADSQVGHTFIHYLYSGTYESLDYNGLNTMYTRGKDFE
                     HGILVYSAAIEYDIAELAQLAKDEVSQAAADLELSSVIRHARKVFDSLPRGNKWIFEL
                     LASLMEERLEKDAHTFLKENFFEGFGKHGTFDPHLCRFIVEIYEKRISDLAEKIEGNS
                     EHDQEESIHENGVSAEASDEEPDLDAGDDAPAIEDLEASDAEPNPGAGDEVLETEDLE
                     AEQPTEPASPIEFDVTDSPPAEEYKPSADLEIPEPQSEDQIQEENAADPETPTFATEN
                     PGILEQNPDLVENTKEDVWEWPSSLAVSKKSKKTKKDKKEKKDRKKSSKVDSSP"
     gene            <1255378..>1259931
                     /locus_tag="TRUGW13939_08987"
                     /db_xref="GeneID:55996471"
     mRNA            join(<1255378..1255560,1255625..1256764,1256839..1256956,
                     1257028..1258647,1258715..>1259931)
                     /locus_tag="TRUGW13939_08987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492112.1"
                     /db_xref="GeneID:55996471"
     CDS             join(1255378..1255560,1255625..1256764,1256839..1256956,
                     1257028..1258647,1258715..1259931)
                     /locus_tag="TRUGW13939_08987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348005.1"
                     /db_xref="GeneID:55996471"
                     /translation="MPEARFSVVASTGTFDFTPAFEDAVLCIAPSALFLVVALQRLFW
                     LARQPRKVAKSHRPLVKGLIGVYTALQLAVLLYWALNAESELRTSAAVLAFVDGFLLL
                     FLSHAEHARSVRPSTIINVYLLFTLLFDCVVARTLWLADHDSTISGLFTSTVAIKLFV
                     LTSEAWEKRPILLSQYQCLSPEATSGILARSVFWWLNSLMRTGFARSLTDHDLLPIHA
                     SLAAQTLLPKARNSFGSSNQSNRHALAVSTLWATKYIFLAGVAPRLALAAFKYTLPFL
                     ITRTTSWTADPSQSDPFGWGLTGAWLLIFLGQAISNGFYYQMTYRFVTSIRGSLCSLI
                     YTKTLDLSSAALDESVAVSLMSTDTESICQSAATLHELWASPIESAVAIFLLYRQLGL
                     AALAPVVVAIIATTGMLQLARFIGMAKKRWMRGIQTRVDVTASVLASMKEVKMLGLSD
                     IVASMIQNLRVTELDLSKQYRKLLSIQIFIAMNTANIAPLATFATFVIVSKSTGQPLN
                     TESAYTSLSLIYLLSDPMVVVFRTIPFISSALACFSRIQNYLLSESCTDYRRPLSERD
                     HHPSQDYEKGDTLVAISGARFGWIPGKPDILNDITVNIRRSYFTFVVGPVGSGKSTLV
                     RAILGEVPLRAGSIHADPGNMAFVGQEPWIQNLTIRQNILGSTSYDAEWYGKVVYACG
                     LEQDIGELPDGDATKAGSAGFSLSGGQKQRLALARAIYSREKIVLLDDVFAGQDAATE
                     EHVFQNLFAETGLFRQLSITVVCVTNAIHRLAYADHVVALDVSGHIMHQGSFAQLQSD
                     TNFLRGLAVEQNGAIDAAKASVPHRHEAVPKGRSETDADQNSDDSESPGRVPGEFATY
                     AYYFGSIPVWHTVLLAALIILYAGGFQMTALVLSFWTDTAKESGQVTNDYYLGLFGML
                     TSLAVVGITGAAYFFLVVMVPLSSESLHARLLHSVINAPVAFFSRTDVGVTTNRFSQD
                     MSVIDTELAFALIDFCINFALILMSVILMCVFSGYFAATLVPFVAFCWFLQKFYVRTS
                     QQVRLFDLEAKSPLFTQFLDLVQGLSTVRAFAWGPRFIERYLELLDASQRPFYLLFCI
                     QRWLGLVLDLMTAVLVTVMMILVVELRVQLSPQYVALAFVQIMSFGQSLAHVIQDWTQ
                     LETSFGAVARVKTFCTDTESENQPNETGSVPENWPAYGHVTIEDLVASYDAREPVLRG
                     VTLDIPAGAKVGICGRSGSGKSSLLGCILRLLEVGSESRITIDGVDITTLPRQAVRAA
                     VAVVPQHPFFLKHTSLRDNLVVLHRQQQQPDDDKILQVLRRLKMDDVVDRLGGLDSPL
                     DADRLSQGQRQLLCIARAMLADKRVILIDEASSNVDERSERLIRDVMRDQFASCTVIA
                     VAHRLGAVVDFDRVAVMGGGRLLEWDSPRALLKRDSEFKRLWDLGAS"
     gene            <1262203..>1263897
                     /locus_tag="TRUGW13939_08988"
                     /db_xref="GeneID:55996472"
     mRNA            <1262203..>1263897
                     /locus_tag="TRUGW13939_08988"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492113.1"
                     /db_xref="GeneID:55996472"
     CDS             1262203..1263897
                     /locus_tag="TRUGW13939_08988"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348006.1"
                     /db_xref="GeneID:55996472"
                     /translation="MPGTDSTSSMSTNISPLENASGHVPNEKELIDTEPQQPSQLESN
                     TTASNKAASEGEPVYPSGLKLAIIVIGLELGVLCIALDNTIITTAIPRISDQFHALSD
                     VGWYGSAYLLTLSSFQLFFGRMYTIFNIKTVFLFSLFLFELGSLLCGVAPNSTAFIIG
                     RAIAGLGSAGLFSGSMIVITFTTPTEKRPLYSSMLMAMYGIASAIGPLLGGVFTDRVT
                     WRWCFYINLPLGGLTAIALIAFFKAPPPVLQGSRTWRESIARFDPIGTVLFMPCIICL
                     LLALQWGGTTYEWSNGRIIALFTVFGVLLIAFLAVQIWAGENATLPLRIIKQRSIACG
                     SLYSMCVGASFFVIGYYIPIWFQAIRNASAMRSGINLLPLMLAMTISTLVTGVFVSIV
                     GYYTPFMYGLAVVSSVGAGLLTTWTVDVSAGKWIGYQVLFGAGIGLGMQQSVIACQAV
                     LPLSDIPIGTSIIMFAQMFGGSLFISIAQNTFTNHLVSGLSGIPGINAAEVLHTGATE
                     ITGLIKDPDMLHTVQVVYNDSIMKAFLVGLIMICISSLGAAGMEWKSVKAKRPRAA"
     gene            <1265454..>1266221
                     /locus_tag="TRUGW13939_08989"
                     /db_xref="GeneID:55996473"
     mRNA            <1265454..>1266221
                     /locus_tag="TRUGW13939_08989"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492114.1"
                     /db_xref="GeneID:55996473"
     CDS             1265454..1266221
                     /locus_tag="TRUGW13939_08989"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348007.1"
                     /db_xref="GeneID:55996473"
                     /translation="MKSNPLLSLDPKASDFWFPRKVYNSKTWQYLCVLSGNVAGIAYI
                     LSFVAIGGFPPVPSYWDADRVHEHYFKHKDGCKAAVFLLLLSGALYLPWGAVISKQMR
                     QIPNVNPVLCDLQLASCAIGVWILILPGLILAVLISRDYGPELTLLLSDLYWMITCMP
                     WTIFWMQSWTLAWAAFADRSKNPKFPKIVGVINVAAPIAASFASGIHIQSLGPMARNG
                     GLAFWTPLGVLTLEYAADTISLLWNIWNEPEVDSESV"
     gene            complement(<1266875..>1268465)
                     /locus_tag="TRUGW13939_08990"
                     /db_xref="GeneID:55996474"
     mRNA            complement(join(<1266875..1267375,1267425..1268079,
                     1268170..>1268465))
                     /locus_tag="TRUGW13939_08990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492115.1"
                     /db_xref="GeneID:55996474"
     CDS             complement(join(1266875..1267375,1267425..1268079,
                     1268170..1268465))
                     /locus_tag="TRUGW13939_08990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348008.1"
                     /db_xref="GeneID:55996474"
                     /translation="MKDQNAPLSVIIIGGAVSGLTLAHCMEAAGIDYVVLEKHNDICT
                     NIGGSLALQPHGARVLDQLGLFEQLEKLTNNITKFHTCNYDDTHTSLFPTWTMESLGY
                     PMTVLRRTNFLRTVYSALKDQSRIKTGTKVVRIRANSTVDAPLIVETEDGTQYTGDVI
                     VGADGVHSITRSEMWRIANEQQPGLITEEEKRRMTVDYMCIFGISTPSRSLFPPGEQV
                     NRFQKDVAVFILQGHDGTVSWFMNIKLDKRYVMPHVPSWSNEETRARGEKLAGLHLSD
                     GVYFRDVWESAETISSTPVYEGMFQVRTCGRIACIGDSSFKVSPDLAHGANLAIESAA
                     AISNTLHRINMNINTLNRRPTNADVEEGLVEWARSCQYRLAETNIYSRFVTKAGVHYS
                     FIHRVLHRAAMQYTLDVQFHRYMTILNKGRTLDFLPFPDRGRDAWEKYKGAGAMRTVC
                     AAAFFPVGLILSICSVFREVVFFPSKEQKKALM"
     gene            <1268956..>1276542
                     /locus_tag="TRUGW13939_08991"
                     /db_xref="GeneID:55996475"
     mRNA            join(<1268956..1275500,1275564..>1276542)
                     /locus_tag="TRUGW13939_08991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492116.1"
                     /db_xref="GeneID:55996475"
     CDS             join(1268956..1275500,1275564..1276542)
                     /locus_tag="TRUGW13939_08991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348009.1"
                     /db_xref="GeneID:55996475"
                     /translation="MAAEPIAILGTGCRFPGDASSPSRLWELLKNPRVVASEPPSNRF
                     DIDSFYHKDPSYPGTTNTREGYFLSDDPRSFDAPFFNISAAEAGTMDPQQRQLLETVF
                     ESIEAAGQRLDQLQGSATGVFCGVMGSDWGEFFPVDFKSVASYAATGGARSCIANRVS
                     YFFDWHGPSVVIDTACSSSMVALHQAVTALQRQECSVAVAAGTNLLLNPSYFITTAKM
                     TMLSPDGRGRMWDSNANGYARGEGIASVVLKRLSDAVADGDPIECVIKATGVNQDGRT
                     MGLTMPSGTSQLELIQNTYARAGLDPRNPRDRCQYFEAHGTGTKAGDPQEASAVHQAF
                     FGPPESGDKLTEDETDLLYVGSIKTVVGHTEGLAGLAGIIKASLSIQNGSISPNLLYE
                     VLNPEIEPLSKHVKVPTQLMPWPSLPPGVPRRASVNSFGFGGTNAHAILESYDPELVV
                     NGVNGISEINGINGVKSHTSISLLPFVFSAAAGRSLVDVLESYERYLQNNPDVDLMNL
                     AWTLLQRRSALRYRLPLWAPNTNELLTKIRTELDTASKDHSVRFIHQRSVNTPKKIIG
                     VFTGQGAQWPQMGIDVISNSPEALDWLQEMQDSLDQLPAKFSPTFTLLEELSNSAADM
                     SNARLSQPLCTALQIILVRILSNLGITFTAVVGHSSGEIAAAYVAGYLTATDAIRIAY
                     LRGLVTSQVGAKSGNSGAMMAVGMSAEEAIALCKQEEYQGRVAMAASNAASSVTLSGD
                     ADAIRELEQKLQEENKFARRLRVDTAYHSHHMYPCSPAYKQALEDCNIRIQPPTGTAW
                     YSSVYDGVQINLDEHENSLTNEYWIENMVRPVLFSQAVQTAVRIVGEPDLVIEVGPHP
                     ALKGPAKQVLADTLTDGNDIPYIGVSARGTGGIEALASAIGDIWGYLGPSSVDISRYT
                     RLFGSSQHFKLIKELPEYPFNHSKLYSTESRLIKQHLHSRGGCNPLIGNLEPTTGDGE
                     WRWHHYLRQKDLPWLDGHRVESQMIFPATGYISMAVEAAGIIAASRPMHLIQIRDFVI
                     HQAIVLPDDVTTSTEVLVQFNEDRLTSKEKADTMSGTFQIHACTGEQFQLRANGSLTV
                     TWGQPETDSLASRSATTPGLTALDVNDVYSFFDKLGYSYTGPFRGIQSISRKKDNACA
                     ELSNDLSSSNILLHPTVMDTTLQTMIAALGTSDDGEVSTLLIPTRIQSLTINPIFCGQ
                     SGVQLAGPTLSSAAVAVKFDADDIIGDLDLFTKQGYGMVQLSGIEVSSLHPLPKDRRL
                     FAEMSWGPYEPDAKWESSTSRSTDITPLIEIAEKATLLCMKFAFEQLTAEDRQGLDWH
                     RATVVAWFERVISMTREGTHPICNRDWLDDTREDLDALFKKGTGLVELEITKKVFDNV
                     VAFIRGEASLLEALREDSLLTRFYCNDTQTKRMNESLGCLVGQVAFRYPRMKILEIGG
                     GTGSATRAVLSEIGFAYHSYTFTDISVAFFEDAKAALAAHEDRFIYEALDISRDPLEQ
                     GFEEHSYDLVVASNVLHATKFMQQTMTHVRRLLKPGGYLAMLEVTNQDLLSTSFIVSG
                     FEGWWSGHEDGRVWGPMLTLSGWDNVLKSTGFSGVDTYTSTVDNPKLSNYSVIISQAV
                     DEHIQLLRNPMTPNDKLVSELVILGGATNWTGCLVSKLSKALESSFIRIHHAQRLEAL
                     DLEQISQQSNPVTVLSLIDIGWPWFQDLSKDRLVPMQGLVTLASKMLWVTAGSEKDCP
                     YMGMSKGWLKSLAYENKHCLYQYLNIEDQKSVDVTLICSTLMRLVHTDKPNDYKLSTE
                     VHSTESELLFKDGSMQIPRIRSDQATNDRYLAARQHISRQVELSNSTVCVIPASEGKH
                     SLRLIETQNKGTVDANHIQIRTRYSTAQAIPVGEGIFLHLVLGEDEATGTRLLSFTDH
                     HASSIQVPAAWTRTVSPKILETEEASFLKATADFVVGGFLIREISPNSTLLVHEAAET
                     LRQAIHEQALEKGIKPLFTTTTQLPSTRDAIFLPPKASPRVLAEYVPQDVSLATCLGS
                     DPEHALIFSHIDRLLPEETLRKSVRDIYKTSAILSKQIRVGMDTLIAHRLESAGALAI
                     KSASGELVNIVEVNSLSTKPAVPGCIVDWVKSTSVSAQIQPINSLVTLSGAKTYLLAG
                     LAGDLGQSISSWMISKGARYIVLASRTPKVDPLWIEAMAKLGATVVPMAMDLTNRESV
                     LNVYRSIQCQYPPLGGVANGALVLEDCEFVKASLDAIERNVAPKVQGSILLDELSGPN
                     VDLDFFILFGSMMGVTGNWSQSAYSAATCFQASLIHRRRARGLVGSIIHLGLVNGIGI
                     IARKGAGHINYVKNTTGSYLLSERDVDKFFAEAIFAGHPQSGRNAELMNGTAMVDPDE
                     YPEIGWFEKPLIWNMISYHAKSNAERSGTAEGPSSVKAQFELATSMAEVLEIVEASLT
                     AKVRSKFSLDADVPLPASTRLQALGMDSLVAVDLRAWIAKEMGVDVPLLEILSGGTIK
                     QLTTEVSSTLPPTLIPNVSDAASIENE"
     gene            complement(<1278629..>1281347)
                     /locus_tag="TRUGW13939_08992"
                     /db_xref="GeneID:55996476"
     mRNA            complement(join(<1278629..1279604,1279662..1279918,
                     1279983..1280806,1280875..1280884,1280937..>1281347))
                     /locus_tag="TRUGW13939_08992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492117.1"
                     /db_xref="GeneID:55996476"
     CDS             complement(join(1278629..1279604,1279662..1279918,
                     1279983..1280806,1280875..1280884,1280937..1281347))
                     /locus_tag="TRUGW13939_08992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348010.1"
                     /db_xref="GeneID:55996476"
                     /translation="MEESPRLQKEISDLVNILSLITKRDSRLEKRNSEPRQSEIACSE
                     DDRIDLSIEEEEGVDEAEFEAPDTSREAEVDAIKRNTLDRLAEVLARFKTANASGPRG
                     KQNWGAKHVTSVIMMENLDGKSVTFLCAKNEGLDGRMARVKDDQPEQLDQVFDAIFDH
                     QGPRVKHYSTMLRKAIERADHTVAPPKTLTSRNVKEGLSQVTSRDWEDENGLQFRFRV
                     GGEGEESISDKSVGCLSDQEEENLVQEVYSEIRRLFGNNRHEFLPIPMKNFLKKVYRV
                     VRHPRQRPALKGLLRQTVHNDNRLFKQAWDSVLYLTRIFYAAATFMDLATKLRPVSIK
                     FQQVPVAVVYRPRIPDRRSPTEVLKSLGHSALPRTWRDFFQTSARVEKFNRLSGLRKT
                     VHGEVQLILHVELMYAREELNGKHGTFQARGTHETLFPLWALPQILPQQSFQILLQFT
                     EILRKFLRKSLNQPYPPPQRDLLRQSSAALSTAKAVQREAPTYSIRPETLRKLMLGPG
                     GVSASEHQVEFLPSPEEPGYATLMGGLEKQKATLVPVEEAEMAKIKHERRTSMFELID
                     EMPHTRFLDQKPCRSCPRAAEYRCSACWTWCCSKACQRRNWALHVFVCRVPNRPNDMD
                     FLRLGIRRFTKNINSGGEEQSQEWLHDAMIYMLADDHICRTFGFNSCENTLDVLNLAC
                     LYSTMLFRVHSPVTSLHKQLETGNLGNFMERFCQLERSIAQVTNTEECDCVTWFLSRR
                     SSESLLIPNVDKTTYDIWVVAEARAIESLDLAHRFDNGYRLSNSQVDVFHLYVANPAN
                     RLASSRYIFFSLDQIWILLLQVVLTTS"
     gene            <1284447..>1285427
                     /locus_tag="TRUGW13939_08993"
                     /db_xref="GeneID:55996477"
     mRNA            <1284447..>1285427
                     /locus_tag="TRUGW13939_08993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492118.1"
                     /db_xref="GeneID:55996477"
     CDS             1284447..1285427
                     /locus_tag="TRUGW13939_08993"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348011.1"
                     /db_xref="GeneID:55996477"
                     /translation="MLANFSQVPSNLFPPRHIFYPPSNTHQNTIIFIHERGSTGEQLS
                     SHLNLAVLPSDKAIYDYFPATRWVFPTAKKKYLYSPHTRSRSRNSNRPSISEWFNMES
                     IAESELGSDKQVDHLRESASYIMRVIEDELKRVNGDPKRIFLGGIGQGMALALVVLLC
                     TPHRFGGFVGVNGWIPFAEILKRCIERGNIDEAKRFFKWNVMIPIHQHAQNFAQSSRS
                     AVSNERGRSQFDPQSAMLGLAMPEEVKQVPILVSHVSAKWLVVKTESTHAVYSLLQNM
                     GFEQLTWDSSSCEQHEDDTPGYDSGGVAFSLVVPEQLECMIKYLKEIGMG"
     gene            <1286102..>1288202
                     /locus_tag="TRUGW13939_08994"
                     /db_xref="GeneID:55996478"
     mRNA            join(<1286102..1286445,1286516..>1288202)
                     /locus_tag="TRUGW13939_08994"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492119.1"
                     /db_xref="GeneID:55996478"
     CDS             join(1286102..1286445,1286516..1288202)
                     /locus_tag="TRUGW13939_08994"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348012.1"
                     /db_xref="GeneID:55996478"
                     /translation="MLSAVRRGPVLARAFRTCAPRTWGSSPIRASPSAVSSFSVPSKS
                     TSGLLSHARLFQSQSALKQDDVPLISEFSELGTQGLVHDSIVSAITSNMKLSSMTDVQ
                     KLTISRGLTGADTLAQAKTGTGKTIAFLLPVLQNIISADPSLAQRRRGPSSHSSDIRS
                     IIISPTRELAEQIAVEAKKVAFNTGIIVQTAVGGSRKMEGLARIKRQGCHILVATPGR
                     LKDILSDPRNGISVPNLTSFVLDEADRLLDDGFGPEINEIHDYLPDPIKVDRQTLMFS
                     ATVPREVLRVVERFMKPDYQFIKAVSEDDVPTHLRVPQKQVVLRGLENVMPSILEITA
                     KYNARREQDPNLRPFKAIVYFNSTSSVQLYYDAFAQLRNDPADRRSGNPFGRGVYCMH
                     SKLSQMQRTMYSESFRRAAGGILISSDVTARGMDFPDVTHVIQVGHPRDRESYIHRLG
                     RTGRANKEGEGWILLHSQEIHPFERALGDLPIKEDRSIESAKVDMSQEGQQVSATSAE
                     NLKRVEAAMKTVDYGSKAAAFRAELSVLSGTFRRRNHVVSALNSLAIHGWKLPEPPAI
                     ARSLADKLGYRNEEELNVSDNVRSSYPDDSGRGRSQSFGSRRSSTFGGGNDRFSRDDR
                     FSRNDRSSRGDRFSRDDRFSRDDRPSRNRRSFDGPSGDPLNGLFDFENVNRR"
     gene            complement(<1289127..>1290609)
                     /locus_tag="TRUGW13939_08995"
                     /db_xref="GeneID:55996479"
     mRNA            complement(join(<1289127..1289834,1289902..1290353,
                     1290428..1290496,1290570..>1290609))
                     /locus_tag="TRUGW13939_08995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492120.1"
                     /db_xref="GeneID:55996479"
     CDS             complement(join(1289127..1289834,1289902..1290353,
                     1290428..1290496,1290570..1290609))
                     /locus_tag="TRUGW13939_08995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348013.1"
                     /db_xref="GeneID:55996479"
                     /translation="MATIVLGSQWGDEGKGKITDLLSQNATLCARSAGGHNAGHTIVH
                     NSVTYDFHILPSGLISPTCINLIGAGTVVHVPSFFKELASLEDKGLKEASKRVFISDR
                     AHVCFDLHSVVDGLEEAKLGGRKVGTTGKGIGPCYSDKAARRGVRVGEIADEEVFERK
                     LRNLETGYRNRFGELAYDVEDEINRFKEYRKLLQPYIIDQLPFLQKYKNDDRILVEGA
                     NALMLDLDHGTYPFVTSSSTGLGGAIQGLSLNPTRIKDIIGVVKAYTTRVGSGPFPSE
                     QLNEFGEKLQSAGREFGVTTGRKRRCGWFDLVLCRYSLAINHYTALNLTKLDILDDFD
                     EIKVAVAYKLPDGTRIDGSYPADPKTLENLEVEYITLPGWKSNTMGATKYEALPENAR
                     KYVEYIEKGLDGVPVKWIGTGPAREHMIIR"
     gene            complement(<1291203..>1294081)
                     /locus_tag="TRUGW13939_08996"
                     /db_xref="GeneID:55996480"
     mRNA            complement(join(<1291203..1292514,1292578..1293925,
                     1293985..>1294081))
                     /locus_tag="TRUGW13939_08996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492121.1"
                     /db_xref="GeneID:55996480"
     CDS             complement(join(1291203..1292514,1292578..1293925,
                     1293985..1294081))
                     /locus_tag="TRUGW13939_08996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348014.1"
                     /db_xref="GeneID:55996480"
                     /translation="MAKIDVRKDYYGDLGIGPSANTEEIKKQFRKLALKYHPDRNPGK
                     EAEYITKFQAIQAAHEILIDSQQRLKYDTERLRAGYGRLYAPPSQSSSRRANTSSAAA
                     YASAAAAAKGSTPKPARPTSFQPPPPSGSAQRYASYAKAAPQQPYEKAYEQQQARADA
                     FRGFQAMPGWAKFNPTNGKPGPPPPPTRSNTTAGSPGQSSRRSAYEHMNNRPHPAAFG
                     RSATTKKKQGFAPGNPGGDEPMARNVSAYLNTPRAERTSAFFDSVPSPTARRTPASSR
                     PATPLEDPAPEFERTSYPYARTGGERTYFNSAGLARAYSMRDSSRVRSRTNPPSPTSP
                     VSSRHRSASPAQKPSFSSSSSSESSEEETDSEADIPTFVPRQKATPRSRLRPSQKKFH
                     FQGSGSGEDIPGHSKAPQFRNTRRLRSHFGEDRRHSDHEFQGHSTDSDHYQGHDSDSA
                     AFVFKAPQYTNSMDPTRQGNSGVFGLNERNQNAEYTANNGTKSRSHDNLSQKFSASAW
                     GNVLNSLNTHEPDLFGPNRANGHRRSRSRTSPTRGRPEMRTNAETSSSEEAARQQASG
                     AWMKSQFSAEAWTQHLQNTTWATLNPNPGAGRSQSQSQPKANTARSGRKISRPTSRTT
                     RPQQPAVSTEAEENEATVPNPPQKVSTPMSDAMDIDEESSQPAKAPVNGVKRSQPLAS
                     KPLRGGVPIGNAGKTSEQASNSLNLGPLHNVAPFTDTNSGGIGDLKDMFTTLPFESRA
                     NDPNAKRGMAQNRKFDLPSPPVRPPKPAIESPNGDPRNMVLPRQNWELYVRQINAYMT
                     EWNNFQRQMMQIFTVRQEAFESGLAPRWVDAIGDSIQLNVGASEPESDSGWGDTDGSE
                     AGNQAEILIPKHPHGGYKAYANALEEHARIRTHWEIAFERHQECIMQLGEIRKWIRTR
                     GKIV"
     gene            complement(<1295429..>1298661)
                     /locus_tag="TRUGW13939_08997"
                     /db_xref="GeneID:55996481"
     mRNA            complement(join(<1295429..1296310,1296362..1296414,
                     1296471..>1298661))
                     /locus_tag="TRUGW13939_08997"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492122.1"
                     /db_xref="GeneID:55996481"
     CDS             complement(join(1295429..1296310,1296362..1296414,
                     1296471..1298661))
                     /locus_tag="TRUGW13939_08997"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348015.1"
                     /db_xref="GeneID:55996481"
                     /translation="MLNPPPRIFFNSTSSTGVKRSHPVDEPTSTTIEPSFPPSQRPSA
                     PVPSQHNKSSAPAMTSFPPGAAGAGGGGGGQSSLAASSFRNVSACNRCRLRKNRCDQR
                     LPRCQACEKANVKCVGYDPITKREIPRSYVYFLEARVTYLERLLLKNGIEFKPSAAFD
                     GETEEAGTNQESEQDAEHDAPANLKAEPKSENLAADTRRDADAPPNPKEHLDQLVSNI
                     GMVSVQGMSDSRYLGSTSGISFARLVFAAVKSSVNTNGSENSSARSSERRPSGSTGST
                     MRDSFFGLQSRPTMKQAAFPERELADKLVGLYFEHANPQMPILHRGEFMELLDRVYTT
                     EELARSPRDLYLVSIVFAIGAGIIFEGRRSAEDENDMNNQGAASPTRSSKKQKLSGFQ
                     FQPEEYHASAVVHLEHFLSSSHLTDAYGGGLDELQAVLLLASFALLRPVAPGLWYIVG
                     VAVRLAIDLGLHHEDGTGIDSIGEEDAPDLNEQISAERGRLQWARDHRRRLWWCVYSF
                     DRLVSTCVGRPFGITDQVITTEFPSILGDVFITKTGFRPPKTDTPSYKHVSYHYFKLR
                     LLQSEIQEVLQFQQARFVRRSGKNSRNQFMHTTLPSPFLDRFDSFRSWRRDVHRRLLE
                     WKDGSPTKKENGVQFSTELFELNFYQALIMLYRQSLTVPAALASELNPTEDVSSPPSF
                     DIDDREDEDDIYLQIAEAGQKVIKIYRQLHRVRLVNYTYLTTHHLFMAGISFLYAIWH
                     SPAVRSRLTLDDVDFTVLAATSILSDLMEVCPPAETCRDAFERMSRATVRMGSSKGFA
                     SQTIGGGSLTSSTRQFPLSPHGKHGSASRGEGRQKTHAQSGQRSQRNPRPPPQFDMNL
                     SDFYQSPPNVQNQSSNKQQQQQPYPPSQSAAAQSDPSRDNFQASPQFTQAYPNYDQSP
                     PHQQQQQRQFYFDQSPQSVTSVAGAPQAFTPPAPSEPPQQQQQSLGDLSLDFLDFVPM
                     NQGPGANNADQNTFNPMGVPSFNPDNQGNGVNMGFGMEADYMRDLTTDGSGYDLMDGY
                     WFGMSGGGSGI"
     gene            complement(<1302083..>1303963)
                     /locus_tag="TRUGW13939_08998"
                     /db_xref="GeneID:55996482"
     mRNA            complement(join(<1302083..1302833,1302887..1303793,
                     1303843..>1303963))
                     /locus_tag="TRUGW13939_08998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492123.1"
                     /db_xref="GeneID:55996482"
     CDS             complement(join(1302083..1302833,1302887..1303793,
                     1303843..1303963))
                     /locus_tag="TRUGW13939_08998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348016.1"
                     /db_xref="GeneID:55996482"
                     /translation="MQRHRFPAMAWALRCWHSIVGSKKPNSDIPPFPYRQFIILALVR
                     ICEPIAFMSVFPYVYYMVESFHVTDNDQKIAVFAGMITSAFTFAEFSSGLFWGRLSDR
                     IGRKPVLIMGLVGTAISMLVFGFSPNLTTAMIARALGGLLNGNIGVLQTTVAEIVTVK
                     AHQPRAYSIMPFVWCLGSILGPMMGGALARPVLSYPSLFKPDTLFDRFPFLLPNLVCV
                     VVLIFGIIIGVLFLEETHSKKKYRRDRGLEVGHWLLAKVSQAHTPAPSDDKAALLDED
                     AYLSEDDPPPVYRSREPSPRSSSIGATRPAELDTDVEQPERRPSVGFNKAFTRQVVLN
                     IIGYGILAFHSVSFDQLMPIFLSTPKSEEPASLPFHFTGGLSLSTKSIGVMLSIQGIY
                     AMFAQIWLFPYAVRHFGALRIFRFVLLIWPPLYVAAPYLVLLPSWLQIPAVYVALLGK
                     ITFHVIAFPATALLLANAIPSKDVLGSVNGVASSVASLSRALGPTITGFLHSKGLHSG
                     TSVIAWWAIAVVATIGAFESFLMEEADAPSPNTSGTVDRNKWTSSRESPSASEMPEEE
                     VGLLSADASSENPDSDEAVNDKFLQG"
     gene            <1308665..>1310275
                     /locus_tag="TRUGW13939_08999"
                     /db_xref="GeneID:55996483"
     mRNA            <1308665..>1310275
                     /locus_tag="TRUGW13939_08999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492124.1"
                     /db_xref="GeneID:55996483"
     CDS             1308665..1310275
                     /locus_tag="TRUGW13939_08999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348017.1"
                     /db_xref="GeneID:55996483"
                     /translation="MLPFLYPFLNTTVRARPAVSRLQKAVRCCRWQSSSPPEEPESEF
                     LHTNPPPSDYSRFIFQDKCLVTVVAGSGGDGCVSFLREKYIEEGPANGGDGGSGGNIF
                     IQAIDGLSSLHKLARQGVIRAGRGKNGQGKSQGGKRGHDVLIQVPVGTVLREVSRFDP
                     VEEKEHEYRTLRGAMPEDQVDAEADPAQRGRFVLYPGSKPSDFLLMSFPSLGPPQRPS
                     IAALEPAAPIHLDLSKNMPEPIVLAAGAVGGFGNPHFVSRSTPKPTFATKGEKGMTLH
                     LEFELKLLADVGLVGFPNAGKSTLLRSLTNSRTRVGNWEFTTLSPNIGTVVLDNGKGR
                     PLVESSDRENPRTGFTIADIPGLVEDAHLDRGLGLGFLRHIERAGILGFVVDLSAGNP
                     IETLQKLWHELGEYDKMRDIKPEIHSEDYLVSWSPEPAGQTEPFVNDASRPTKKLPPL
                     ALPPIYRKPWFVVATKADLPETQEKFIALRDYLSQVQQGTVQHPSGHKDAFRERVVAV
                     PVSAIKAEGVQGIPNLVMTFLEDRKTAS"
     gene            <1310689..>1312398
                     /locus_tag="TRUGW13939_09000"
                     /db_xref="GeneID:55996484"
     mRNA            <1310689..>1312398
                     /locus_tag="TRUGW13939_09000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492125.1"
                     /db_xref="GeneID:55996484"
     CDS             1310689..1312398
                     /locus_tag="TRUGW13939_09000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348018.1"
                     /db_xref="GeneID:55996484"
                     /translation="MENLENLTSSILEAIHNPQSTDSILECFEHDDTASAAVAKLVVL
                     LRDDPAAALGLADARLRVFPFKDVKECWRRLYTDASLVLAVRLIRENTTKQDLEAVRK
                     EQPKNQTRGNGQDRDALHAPWLDSAVRYLDMAIIMAGAPLREDMIDTLFSALKKWTQA
                     QKEASSCETKPQGLEFEETRPPKRRKLSAALFPPDSAPVPRELAHPIPRVSAPSFDAM
                     ENHIQDARTPLVITDAVDYWPAISERPWSSRNYWFEQTLDGRRLVPVEVGRSYTDEGW
                     GQRIMPFGEFVNGFIWRSKEENGAGTRNGNDENRGGRDEGCDQAQTGYMAQHNLLAQI
                     PALRNDITVPDFCYIDPPGPEPGTPVYEKRKQKRDASKTDTGNPARDGRGVQDSGSKL
                     KNLSTKGNHQHLDRDADIGIPSDPIINTWIGPSWTISPLHHDPYHNILVQVVGSKYIR
                     LYSPHTPASQIHPRGMETVDSDSQHNDIESEKGTKQNHQPKETKQDQLIDMSNTSKVD
                     LAAIELSPAESEVWDSMWPGFSEAGYVETVLKEGECLYIPVGWWHYVRGLKAGISVSF
                     WWG"
     gene            <1312654..>1313549
                     /locus_tag="TRUGW13939_09001"
                     /db_xref="GeneID:55996485"
     mRNA            join(<1312654..1312707,1312847..1312950,1313033..>1313549)
                     /locus_tag="TRUGW13939_09001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492126.1"
                     /db_xref="GeneID:55996485"
     CDS             join(1312654..1312707,1312847..1312950,1313033..1313549)
                     /locus_tag="TRUGW13939_09001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348019.1"
                     /db_xref="GeneID:55996485"
                     /translation="MAKKGAGENTKKVAGNAKKAEAAAKKQAVVDAKNAAEEDTQWSQ
                     GAKGASAKKEAAEAKKAEAARKKAEREALLKEEEASQPSKAKGAGAKSAQKKTRGLDL
                     SQLDDSAPASTKASALNASGIENALDALDLTSKGDAMKVDRHPERRFKAAYAAFEARR
                     LPEIESEYPGLRKQQRIEICKKEFEKSDDNPFNKVNVAFDASREEIAAVKEAERKKVE
                     SRLGSK"
     gene            complement(<1313866..>1315015)
                     /locus_tag="TRUGW13939_09002"
                     /db_xref="GeneID:55996486"
     mRNA            complement(join(<1313866..1314772,1314852..>1315015))
                     /locus_tag="TRUGW13939_09002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492127.1"
                     /db_xref="GeneID:55996486"
     CDS             complement(join(1313866..1314772,1314852..1315015))
                     /locus_tag="TRUGW13939_09002"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348020.1"
                     /db_xref="GeneID:55996486"
                     /translation="MLQFRTEGYNGSGVKYSPFFDNRLAVSASANFGLVGNGRLYILE
                     LTPNGIVPSTIFTTQDALYDLAWSEIHENQVLTASGDGSIKLFDTSVNEFPIQAWKEH
                     NREVFSVNWNLVAKDRFCSSSWDGTVKVWSPQRPQSLLTLPTHSCTYSAAFSPHSPDI
                     LSCVTSDSHVRIFDLRTPASASNHLTLQIPIHGASSMLVPMKAGMSPEGAGAPPAECL
                     THDWNKYRSTVLATGGVDRVIRTFDIRAPQQGPAAIMPGHEYAVRKLAWSPHLSGLLL
                     SASYDMTCRAWDDRSESQGDIDPMRMGPSGPVMGQELGRMGQHTEFVTGVDWCLFGAE
                     GWAASVAWDERLCVWDVRNFMK"
     gene            <1315566..>1317020
                     /locus_tag="TRUGW13939_09003"
                     /db_xref="GeneID:55996487"
     mRNA            <1315566..>1317020
                     /locus_tag="TRUGW13939_09003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492128.1"
                     /db_xref="GeneID:55996487"
     CDS             1315566..1317020
                     /locus_tag="TRUGW13939_09003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348021.1"
                     /db_xref="GeneID:55996487"
                     /translation="MGAEASRKRRKLFFESYAEIDAQKARVKHEEDIRKTNQNETEND
                     ENNDESTDVKIARLISLYPRYDEAALLDVLISYEGCVEAASAALDVGSDADQSPSSPP
                     ASLSAREAAAKSVPGIQTSLFSSFTSSSQSSSGWAKPLTKRGKTLYLYSPQDVASNTP
                     CSIIHNFLPPEEANDLLTELLEDAKSFQPETFQLFENQVQSHHTSCRYVSTDHEMMIE
                     HGAEFVYNGIVRTDTRKISSRMNAVSEKVQKAVNQEIQKRIKTHYPEGKKLKYQSPKN
                     WEPNAAIVNCYTGPQENLGWHSDHLTYLGPRAVIGSLSLGVAREFRVRRVVPRDGDEE
                     KEEQVVLKSTKNRFSDKIANAQGQISIHLPHNSLLVMHADMQEEWKHSVPTAQTISPH
                     PIAGNRRINITYRSCRESLHPRNIPRCRCDVPAILRCVQRKQGTQGRYMWMCYAGYSP
                     GSKGCSYFQWAQFDDDGEPLWEKMGVKPYSHGKA"
     gene            complement(<1317263..>1318891)
                     /locus_tag="TRUGW13939_09004"
                     /db_xref="GeneID:55996488"
     mRNA            complement(join(<1317263..1318079,1318149..>1318891))
                     /locus_tag="TRUGW13939_09004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492129.1"
                     /db_xref="GeneID:55996488"
     CDS             complement(join(1317263..1318079,1318149..1318891))
                     /locus_tag="TRUGW13939_09004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348022.1"
                     /db_xref="GeneID:55996488"
                     /translation="MDCYVAPLRIVKRTTSSSEMLKEPKAEESSPVPIPRRSSSISSD
                     AWFTSVSTPTGSFLDISLTPPLDARHNSLEVPKVRQGADKSCLWPRKKNASQRQPDQS
                     ARTSFEGAPDLTDPCLESKSHDDAQVTNCTPSQRASHKLFHFLHTFDKRFSSLPSHGL
                     SKRTLTHSHPIYPVNRNNQFLGSDFTMQNCPAPVTILKMDLQPERFVHNPKDTEFYVR
                     ITISADVDSESEPSTRFNNYTDNVVLLNIRSKSEMEKVVGMAQIVIDTLKPGDSLAIA
                     CVNTERNGRVDVLMPLCQGPNVDLRRLAAGQSSLGRPLWKGAYDGDIISNAIYSVSEI
                     LTCVTRVRHVFLVSVDCDSAVNITGNPIVGLSTVTTSDRHDIGFSARLGWHIRCEMTI
                     NNTIDTTSLRARADKSIQLIRSGLAPGSLSQLQLKLLPGAGCTIQSHGKTTMDSLRPG
                     ESWYLFARVKALKEARIDRLEEGIKSLLRCSDIDEDQDGAVLVAKLGFKHSLLPSCSS
                     VLSKSCHISEK"
     gene            complement(<1319519..>1320786)
                     /locus_tag="TRUGW13939_09005"
                     /db_xref="GeneID:55996489"
     mRNA            complement(join(<1319519..1319614,1319682..1320511,
                     1320571..1320668,1320725..>1320786))
                     /locus_tag="TRUGW13939_09005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492130.1"
                     /db_xref="GeneID:55996489"
     CDS             complement(join(1319519..1319614,1319682..1320511,
                     1320571..1320668,1320725..1320786))
                     /locus_tag="TRUGW13939_09005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348023.1"
                     /db_xref="GeneID:55996489"
                     /translation="MSSHSLPNIPSLRKHQLLLEFASLKHAAPPGVYVSINNPTDPTL
                     WSGVFFIRSGPYASAILRFAIRFPASYPELPPLVTFNTDIFHPLVVPLTTYTFTTGSS
                     NEAPVSATDEERLSPGAFSLRHGFPHWFGRAQRTANNSGTPSRNISGSKIENESKVAQ
                     TDIITEDGGDSNNAANDPVVPVTPKKQTARETPVTSPSPGVKENASPASPAPVSGPYL
                     DKQRSVPVVTLLSYILSTFDDENILDSLPLEAAGNPGAWHAWKAYRRNEKGFKHQSNG
                     SGVATPDKRGTPQARLPGEWNWEGVWAKRVQSGVEASQSHAVLFGNAPRAGDDLMRFL
                     NIDQATLESVREKILPASEETSAQEQA"
     gene            complement(<1320967..>1321887)
                     /locus_tag="TRUGW13939_09006"
                     /db_xref="GeneID:55996490"
     mRNA            complement(<1320967..>1321887)
                     /locus_tag="TRUGW13939_09006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492131.1"
                     /db_xref="GeneID:55996490"
     CDS             complement(1320967..1321887)
                     /locus_tag="TRUGW13939_09006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348024.1"
                     /db_xref="GeneID:55996490"
                     /translation="MLPASIRQRLISRFNSSLPASQDSLDSTPHPVYSLISASEPRMN
                     VYEESTNSPSRPATADSRDSTPSASTQASGTSTPEIDRSAVVSTYEADSGLRWNRVVP
                     AFNLLRNAGFEAQQPNSDTRLIRSLYINGLGYLLEALPSDLTRDEVRSIQERLPETIK
                     PSNATESSENRLQNKPTRQDPPSYLHRIIASVIVYGFILLQFVVPYGKALLQSAYRYE
                     RNHRIAARVLTAALETADGIGKGANDVSSTLLTLSEGRLGAAVINLVAWLIEAVAGGV
                     YDGVGEGLVVLGAIRPHTDLQRGWQASTWT"
     gene            <1322763..>1324339
                     /locus_tag="TRUGW13939_09007"
                     /db_xref="GeneID:55996491"
     mRNA            join(<1322763..1322887,1322947..>1324339)
                     /locus_tag="TRUGW13939_09007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492132.1"
                     /db_xref="GeneID:55996491"
     CDS             join(1322763..1322887,1322947..1324339)
                     /locus_tag="TRUGW13939_09007"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348025.1"
                     /db_xref="GeneID:55996491"
                     /translation="MADLSIALTAPNGQQYTQPTGLFINNEFVKGNGGTIVSVDPATE
                     KEIATVHAASADDVDRAVKAAHAALKHPSWKLLPATERGRLMSRLADLVDEKRELLAT
                     IEAWDNGKPYSVALNEDLNEVSLTIRYFSGWADKTFGQTINTSPEKFAYTLRQPIGVV
                     GQIIPWNFPLSMAAWKLGPALACGNTIVLKPAEQTPLSVLVFAELVKEAGFPPGVINI
                     VNGYGREAGSAIVEHPLVDKVAFTGSTATARQIMKMASATLKNITLETGGKSPLIVFS
                     DADFEQAVKWAHAGIMSNQGQICTATSRIFVQKDIYDKFVEKYKETLKSTSKVGNQWE
                     STTFQGPQVTRAQYERILEYINVGKSEGATVLAGGEPYREEGSSTDFSKGFFIAPTVF
                     TDVNDSMRICREEIFGPVVAIASFETEEEAISRANNSTYGLGAAVFTRDLQRSHRVAA
                     EIESGMVWINSSQDSDPRIPFGGVKQSGIGRELGEAGLEAYSQIKAVHVNMGTIL"
     gene            complement(<1324581..>1325724)
                     /locus_tag="TRUGW13939_09008"
                     /db_xref="GeneID:55996492"
     mRNA            complement(join(<1324581..1325037,1325095..1325124,
                     1325181..1325377,1325440..>1325724))
                     /locus_tag="TRUGW13939_09008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492133.1"
                     /db_xref="GeneID:55996492"
     CDS             complement(join(1324581..1325037,1325095..1325124,
                     1325181..1325377,1325440..1325724))
                     /locus_tag="TRUGW13939_09008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348026.1"
                     /db_xref="GeneID:55996492"
                     /translation="MSKSEVVALDVFDPKGLEYMRTLFPGVIEPGHPDHDSWLDHAVG
                     LFVAKSRVTADLIHRSKKLKFIVRHGAGYDNIDAAACAEKGVVLCNIPGVNAISVAEV
                     TLALTVACAKNLVLIATQMRQGETPNKRVKSLYSASILTGKTFGIIGGGRIGQLVAKK
                     FIGAFEGKIILYDPYISVDSPGPWASIPHVRAKSLAEVLPMVDVLSLHVPLNPATKDM
                     INLPLLKSMKPTSILVNCSRGGVVNEEDLWTSLKEGIIASAGVDVWVHEPPTREFYGD
                     IFDLENLVISPHIGGSPAEVQTATCISMCDHMKEMLDGKPPRDRVA"
     gene            complement(<1326383..>1327423)
                     /locus_tag="TRUGW13939_09009"
                     /db_xref="GeneID:55996493"
     mRNA            complement(join(<1326383..1326645,1326702..1326940,
                     1327008..1327134,1327188..1327212,1327268..>1327423))
                     /locus_tag="TRUGW13939_09009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492134.1"
                     /db_xref="GeneID:55996493"
     CDS             complement(join(1326383..1326645,1326702..1326940,
                     1327008..1327134,1327188..1327212,1327268..1327423))
                     /locus_tag="TRUGW13939_09009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348027.1"
                     /db_xref="GeneID:55996493"
                     /translation="MPNFTSTMSQNVTQNPKLRLLNTLMRGQTVIATFMLLKGVRAAQ
                     VIARTGLDAVVVDCEHGNASDSDMHDMVAAISGSDVSPVIRIPEPSTAYIKRALDTGT
                     HGILVPMISTAAEARSVVSLAKFPPAGVRGQGSPFACLEHGLTTPSDYVNKANESVVI
                     MVQIETAAGVNNIDEICQVDGVDLVFIGPNDLALALLGYTPAKYTEPVFLDAIDKVVA
                     SAKKHCKKVGILAVDGDAAKKAKERFDLVVMSADIRSLQAWYRAELEVARS"
     gene            complement(<1327763..>1328678)
                     /locus_tag="TRUGW13939_09010"
                     /db_xref="GeneID:55996494"
     mRNA            complement(join(<1327763..1327872,1327930..1328256,
                     1328318..1328570,1328628..>1328678))
                     /locus_tag="TRUGW13939_09010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492135.1"
                     /db_xref="GeneID:55996494"
     CDS             complement(join(1327763..1327872,1327930..1328256,
                     1328318..1328570,1328628..1328678))
                     /locus_tag="TRUGW13939_09010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348028.1"
                     /db_xref="GeneID:55996494"
                     /translation="MLQNNLLRNVAQDQICLAVGIKVVNSNEIVQLARAAGYDSVFID
                     LEHSILSQKNASRLCSSSLLSGITPFVRVPHQCGNGYVQRVLDGGAMGIVFPHINTVE
                     EAKSAVSATKFPPKGKRSLTAALPQFDFQRIAAKDLMQQLNSAGSTVFIMVETVECLE
                     NIDAIAAVDGVDVLLLGANDLSLELGILGEWEHAKLQNALETIAAAAQRAVRNLGARY
                     ILGHLDIGLLAMAMNKNVEQLREMNTKH"
     gene            complement(<1328926..>1331294)
                     /locus_tag="TRUGW13939_09011"
                     /db_xref="GeneID:55996495"
     mRNA            complement(join(<1328926..1329443,1329496..1329679,
                     1329744..1329925,1329980..1330241,1330287..1330783,
                     1330842..1331002,1331236..>1331294))
                     /locus_tag="TRUGW13939_09011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492136.1"
                     /db_xref="GeneID:55996495"
     CDS             complement(join(1328926..1329443,1329496..1329679,
                     1329744..1329925,1329980..1330241,1330287..1330783,
                     1330842..1331002,1331236..1331294))
                     /locus_tag="TRUGW13939_09011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348029.1"
                     /db_xref="GeneID:55996495"
                     /translation="MHRQRKTKDRPATAERTVTAHLRDLEHRARHPARLEGREREESH
                     YETPIIDDESFVVHSNLESSDVTQNLNKKGHHLPTWDFSQQLQKILGADLNGHSPHSD
                     SYKVPLGDETFLDSLESAFPPKQYIIHLAHVVDFHVNTNYCLFNITVFIDQLNKVAPD
                     TISGAFKVKLSLIVALGRLFLEKGATVSGPPGITDFLRGVRDFKPHTMTDEDPSIAVE
                     CLCLLATYAQAADMHRMAYLYIGQASRIARAWKLDCGDGDIMTIGIKHTQKLWLTVCT
                     LDQRLSATIGVSPDTGSTEQPFVSSYFNDASNIEIPLNLEIANILTRVVKVLSQHQIE
                     DALTSSFVGKISTELTYLQSLVEHMKNIQPLCSTPSLLTTSRQVATLHLQFYHCIMVA
                     TRPVLLCLLKRGLQEPVSIIEESVSFETLFKIMQTCINAANCTLSIISALYEQNLLET
                     FMFLDMEMTFQASLCLILGNKIFPKATESYYIPLAEKVLQYMCHTGSIPAGLLQKELS
                     FLHGLIADHNILSFHQLFGRNSSFWVDNNFLDKRLSMIQVGLDLTNAILGVIEIPSLN
                     GFSAENAPESSLQATRTELNNNSISHEYQMDGIDPVDTSFSFDMADLQWLDCVQ"
     gene            complement(<1331760..>1334414)
                     /locus_tag="TRUGW13939_09012"
                     /db_xref="GeneID:55996496"
     mRNA            complement(<1331760..>1334414)
                     /locus_tag="TRUGW13939_09012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492137.1"
                     /db_xref="GeneID:55996496"
     CDS             complement(1331760..1334414)
                     /locus_tag="TRUGW13939_09012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348030.1"
                     /db_xref="GeneID:55996496"
                     /translation="MEYFDFEEASFASNSNVQDDVASDCQERDEADAVESFDSLFFDK
                     TFQLHSNNSDAAADNEGPYKDDDLPVAPPVVVPDPVAGGDYPMFRSTEPCDFCRRMGF
                     NCFIIKRGVLNNGCTCCVSLYRECSFTHAKAPGKFLHTLHPVGEDIVTSTGGLTGRRA
                     LKSVGSNKFDDLEARGRKSGARFGRDAIRVLKTWLTEHYQHPYPSEEEKDDLKERTGL
                     KRSQIANWLANARRRGKVRPPTRSTSPVPGAVNISRHSSTSSSSSPSVDISLMTPLER
                     WKHSPPENEPASTSDIIRAMANPPFPASPSQLQLQYLQSRPSLSAHGRSASRKTGSSN
                     DSNSIFQSRSVSSFETENKSSISDFSFASAFSHRSSQPSLNSADRKERRRRRKQMPPV
                     PPFERQKTRSARIFQCTFCTDSFPAKYDWQRHEKSLHLALEKWTCAPQGGTIVTVDGQ
                     KACAFCRALDPTEDHLETVHNFSACQEKTVQERTFYRKDHLNQHLRLMHNVKLETWMN
                     QWRSTTTEIKSRCGFCDTQFTTWKDRVDHLAQHFKNGADMSKWKGDWGFEPYVRRLVE
                     NAVPPYLIGEERISPQPYKATAQRVVGSTSQLPIAQDANCFMRLEKELKLFVQSKLQA
                     GTKPSDQEIQDQARITIYGSDDHWNQTCADNPVWLSILKRDCGVEDVPEAGYLELNDL
                     GMQPPFAGAIQRPPLETNPMAGHLRKSWLSQASLHSRTGSRSGMHSPGFVSSGFHSAG
                     PSMPGSLTGSFVGSTGVSSGANIPALSSGWASSLSAADQSSSAPASAVVDPFAGMDFD
                     MDFLEQFNDPYPAMSQDIAGIDASGLNITSISSHETGHPIPGKDAQTYSISTSETQPI
                     SIPATSASVDPSFQQYPDIPYLARSNFQ"
     gene            complement(<1335306..>1336226)
                     /locus_tag="TRUGW13939_09013"
                     /db_xref="GeneID:55996497"
     mRNA            complement(<1335306..>1336226)
                     /locus_tag="TRUGW13939_09013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492138.1"
                     /db_xref="GeneID:55996497"
     CDS             complement(1335306..1336226)
                     /locus_tag="TRUGW13939_09013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348031.1"
                     /db_xref="GeneID:55996497"
                     /translation="MAPIKNILVIGAGELGNQVLRFLADHPQRQGAVVSVLLRPASIA
                     STKPDKKSDIDTLRELGIQIVAGDVAQDTEQSLSSTFASHDTIISCMGFASGRGTQVK
                     LTRAVLSAGIPRYIPWQFGIDYDIIGRGSAQELFDEQLDVRDLLRAQTQTSWAIVSTG
                     IFTSFFFEPGFGVVDVHKGTVCALGGWENRVTLTTAEDIGKVTADIVFDEQDQFANKP
                     IFIGGDTISYGDLAELVEKVTGKTVQKTVLKVDDAQAALATDPENNLLKYQIVWGQGR
                     GVSWDLSATWNWKRGITMTTAEEWAAKNLV"
     gene            complement(<1336715..>1337916)
                     /locus_tag="TRUGW13939_09014"
                     /db_xref="GeneID:55996498"
     mRNA            complement(join(<1336715..1337247,1337313..>1337916))
                     /locus_tag="TRUGW13939_09014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492139.1"
                     /db_xref="GeneID:55996498"
     CDS             complement(join(1336715..1337247,1337313..1337916))
                     /locus_tag="TRUGW13939_09014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348032.1"
                     /db_xref="GeneID:55996498"
                     /translation="MAPIRVGIIGLTTVTPSDQGYTPGSWGLVHLTALTSSPHYKIVA
                     LCNSTAEKARKSIEQNKLDPATKAYGSPEELAQDPEVDLVVVSVHVDKHYDLAKPALL
                     NKKSVFVEFPLSAKYPEVEELVKLAEQGNVKTIVGAQARGNLAFAKVSELIKSKAIGD
                     VTSSSWVSHMPLSTWDGMLDALKDFTTLEGGPSRVNIALGHGLEPFLHALGEFKTVQA
                     IFKTHGKIIPLFDTTGKVVNPEFKTTAPEYILIQGVLESGAVASINLRFVANSVDDAT
                     IRWIISGTEGELQFVSPAESYVQADLSQSKLRLKKWKGEVEEIDFKREEPAHITSGTN
                     LVINTARLYESFATGNENGYPSFESARKVHNLIEQIKKVAVWAP"
     gene            <1338855..>1340299
                     /locus_tag="TRUGW13939_09015"
                     /db_xref="GeneID:55996499"
     mRNA            join(<1338855..1339493,1339558..1339686,1339740..1339840,
                     1339903..>1340299)
                     /locus_tag="TRUGW13939_09015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492140.1"
                     /db_xref="GeneID:55996499"
     CDS             join(1338855..1339493,1339558..1339686,1339740..1339840,
                     1339903..1340299)
                     /locus_tag="TRUGW13939_09015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348033.1"
                     /db_xref="GeneID:55996499"
                     /translation="MHPPSQPAEAEQQQNDIELDWAAINAVDERSLNTPKLGPSLDVS
                     NLSAPFPVWTGQQGLSEIEEESFDVETIPMAGPPPSISNIWFLGGQVATSRSSHKCTA
                     PASLEPRPPRRIFQRRHILRNCALSSVIVGQLTSFPKMLIQGQHLPPFITPPCHVHEQ
                     LAFDCAKSGRHQCLLKELAICAGLVEMFFSRTPQNADFVWKMIYAERDRLRREHESFD
                     IYHQLAALQAVTIYILLQTQDPESGDSNETESMLRTVLEIAMSASDKNKLDTETLHQT
                     PAREQWVHEESGRRTITVLLMINLMLDCLLEPERNTYETSCRNNIETILLPATRDLWE
                     APTNFIWRTEYERYLSRRKTTKTLKVGDLLRLNEAGNFQDMSVSHGDLDIVPDILAWC
                     EGLDSLGSLLWMIVPFQQWRMNPGVNEVW"
     gene            complement(<1340337..>1342292)
                     /locus_tag="TRUGW13939_09016"
                     /db_xref="GeneID:55996500"
     mRNA            complement(<1340337..>1342292)
                     /locus_tag="TRUGW13939_09016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492141.1"
                     /db_xref="GeneID:55996500"
     CDS             complement(1340337..1342292)
                     /locus_tag="TRUGW13939_09016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348034.1"
                     /db_xref="GeneID:55996500"
                     /translation="MAQYSSEVISAENIALFSLLHGVPVRPSTNKASRNSWNLPAQQT
                     NRQNYSLSFDTERRLADTLAFLSSIKDDPDHIPAICVGEDPDEKNSLNVYIAINKCRW
                     GDGDDLLQTVKDGFEQLFRILEKCSFPPHHKKEDDEYGDRRKVKEQVFSAVVSMCSSR
                     ILARLSLGPRAKLKAKKDFKKGIVEVIDFVNRQRNDRNQSTLSLFTTKARELVKLVDL
                     WTKYQTQTPLEDLVEGVYQLQKTETVQRILDGMSNRDMDPLRRASLLNVVKKVARYRQ
                     AARFLYRLVAKEQHLSKLKAIAVNLPKEYFEKSVPSSVDYYPRLSSVLFRIHPKYAKE
                     KSLGQIRRLLLTKKEKSVDEDFSERVLKTLNEAKIHAEVQLIAHCESQLPGGSMGLPP
                     RVICSSKDACYLCNLAIYLYRGKMHTPRSHGRLYPGWRLPLQQHQQLGVSFNQAIETK
                     IKESLMFLFQKQQRINYPFPMESTLGTLPSSNTTLYGSSIRDESVISRIGLGHEVPVR
                     TLLSVGNQEPTGFKPGEKSKSRDLISDIRSQDSHLSNEDEMLPRGIALKKTIKPQNAP
                     FVYSNGLLEVQMDLEPPDPSKLATNQTSLAYSIEWLDKAAEIQEKCHSGCVIDVGTLQ
                     GEVFHEICGKNSLYMRFENSVFRLRFH"
     gene            complement(<1342847..>1345860)
                     /locus_tag="TRUGW13939_09017"
                     /db_xref="GeneID:55996501"
     mRNA            complement(join(<1342847..1343245,1343301..1345305,
                     1345376..1345713,1345783..>1345860))
                     /locus_tag="TRUGW13939_09017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492142.1"
                     /db_xref="GeneID:55996501"
     CDS             complement(join(1342847..1343245,1343301..1345305,
                     1345376..1345713,1345783..1345860))
                     /locus_tag="TRUGW13939_09017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348035.1"
                     /db_xref="GeneID:55996501"
                     /translation="MAFDSEPVRPSSCPLPGEILRTVISHAEPTQMKDLALVSRDFHD
                     TVSSILYRHIHHTFTEAEDEDGLMPVDLLATVLETLAGGDHNYAKYIKSFTIDAESSS
                     CAKKITHELKYDCSSGKLLNALLLAALKNASTLETFNWDIGVELSQSFLLSLSQKTTL
                     QHLYLRLQKGPSLHSRSIMNTFHSPPPSNHPPINVHHHHHHHHPDYISPNQNLFGHPN
                     PPVPFAANHHTQLNNNARLGRKLGTAKLADVPKNISRFSNLKTLAVLDIDDYEYIPEI
                     AECVANSGPLLQTLKLSFSKSLAWKTRTKTVNENNDSGVSADDDADDFNPSLPHPPPQ
                     FMVVPNESPGSPTQLPTSMAEVRKDRHRQEEALSAILGLAKTGQDPSIDRMFEMAILA
                     AHKDVQRAHETTVARNVAFAKVVGKVADGLLSSSRKIIPREKHALEKISKAADICIRE
                     EELKQSVATASSNSFQPPTATKTTGEDDGTNGEVADVAGTSSPKKEGFFDNKLFDYLE
                     KLCENSSSDPPVFPFEWQDKKLANSGLTSPSQHTEVNNPKSSGPPVFVPFPLLNGEAH
                     LDGPSTAVNGDKDALSDIVDMEHPDIVDESDEDQHSADEDEGWASKEPSQVDSGKGKM
                     PQQSIEPATQKEEKGFGFLRAGQGICLENMYLSLIPVRASVLFKGIDVPRLKHLSLLN
                     VGSQAAFWSMLSKLPDPVQLTSIHTDHVTDAFLHALSGLEWVTELFLFEQNQKTSKVA
                     PLTPPTTVGVEDLRQKVLKSHLTRLRRLVIRNEHNSGWRLGVKSISTLANRGANLKEL
                     MIEVNSEGLHFLMQKITKFRCLSALHILFNIRDNSTTFLREMRYNLADTICHCPSIPL
                     QYIGLSNSNTRAGAMHVTQLQRSRSRLSVISSGEPVSSDASPTDGYDTDDEVERSSPI
                     LKKDLKRSAVEGVKMWQRDAWGMKL"
     gene            <1346749..>1347951
                     /locus_tag="TRUGW13939_09018"
                     /db_xref="GeneID:55996502"
     mRNA            <1346749..>1347951
                     /locus_tag="TRUGW13939_09018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492143.1"
                     /db_xref="GeneID:55996502"
     CDS             1346749..1347951
                     /locus_tag="TRUGW13939_09018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348036.1"
                     /db_xref="GeneID:55996502"
                     /translation="MRFLSALRSLLLLALLPLLAQGEHTSNWAVLVSTSRFWFNYRHL
                     ANVLSLYRTVKRLGIPDSQIILMLPDDMACNPRNAFPGTVYSNADRAVDLYGENIEVD
                     YRGYEVTVENFIRLLTDRLDEDVPRSKRLGSDAGSNVLVYMTGHGGDRFLKFQDAEEI
                     GAWDLADAFGQMWEKKRYHELLFMIDTCQANTMYTHFYSPNIIATGSSALDQSSYSHH
                     ADNDVGVAVIDRWTYYVLEFLETQVTSPTSKLTLGDLFDSYDESKIHSQPGLRWDLFP
                     GGEHEGRLRTVVDFFGNTQNVEVESNSSTGPGSLKEDLAEIARLVEKWQRREEEYYPF
                     FQNTTTTTEKEHVKQPSPPAKSDPYIVKGASQMTDEDSWTKRLVGLVVLGAGTGLWLA
                     GSVLGKRV"
     gene            complement(<1348588..>1355194)
                     /locus_tag="TRUGW13939_09019"
                     /db_xref="GeneID:55996503"
     mRNA            complement(join(<1348588..1350402,1350456..1351275,
                     1352008..1352213,1352398..1352646,1352719..1353274,
                     1353579..1353615,1353666..1353840,1353896..1354949,
                     1355013..>1355194))
                     /locus_tag="TRUGW13939_09019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492144.1"
                     /db_xref="GeneID:55996503"
     CDS             complement(join(1348588..1350402,1350456..1351275,
                     1352008..1352213,1352398..1352646,1352719..1353274,
                     1353579..1353615,1353666..1353840,1353896..1354949,
                     1355013..1355194))
                     /locus_tag="TRUGW13939_09019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348037.1"
                     /db_xref="GeneID:55996503"
                     /translation="MRVSTMSMSALAAASQAAALSQAERAAAVKNTFQIAWDGYYEHA
                     FPHDQLHPLDNTSDDGFGGWGASAIDGFSTAIVMGHKEIVHDILDFVPKIDFTSSNET
                     IVSLFETTIRYLGGLLSAYDLLTGPAAHLVDDKDKDKVKAILTQATSLADTLSYAFDT
                     ESGIPVNNLALANHSDDGSTTAGIAQAGTLVLEWTRLSDLTGNDTYGKLARKAQSHIL
                     DPKPSWAQPFPGLVGSTLDIASGEFTDNYVTWNGGDDSYYEYLIKFWLYDSQYTEYRD
                     TWLSAANSTISELLSHPESRPDLTFVNIWNNGTVIKTSEHLTGFIGGNFLLAGSVLND
                     KKLLDTGLAFTDSWHQTYNGTATHIGPEIFAWDKEGVPADQSDFYEKNGFYITGSTYV
                     LRPEVVESFYYAWRITGEEKYREWAWDAYLAVNATCFGGSGYSGLSDVNAPHGGKQDN
                     LQESFLFAEVLKYMYLAQADDAEWQIQANGSNKQYKMPALTLHLIAFKDPFQDPTAFV
                     DKLKASPGVHVVVASRPRHIVVRPSKLDVNPLTTQRWDVMLLLQQTQGLSSSASPIPA
                     HLQSAISAEYRILAGIPSKLLTTYPERDAKLKQGSQQPPPLTGSLDEIRRSSKETSQN
                     LEVSPELLAFMDQLSVDHDKPVTMLNLLHFHHPDGKKNYFEYGQAFVPVAGKRGGDAK
                     LVGNVVKPPSTQQNDSRRQHDQAEHEWWNEISIVHYPSIRHFCDMLAGQDYQEINEKH
                     RLKVGYIQCIYEFQTLADNVLEMLASVFQYDALPETSGGSKSKDLPYRVGVWDMFRLW
                     PSRFQCYPPLFHRIEAGDRYGKSLAPVRFIHAKMYLPRGLISHLYLQLLRSHHPLSPP
                     VLILVALEPDALCACRILTTLLKRDYIAHKIQPIAGYGDLARAGEELVRPLRTTEGGS
                     GGVVICLGVGGLVDLSEILCLTNADDDEAAASDDTGGVEAWVIDARRPWNLVNVFGGQ
                     WQQQQSRDTLDELDPTARRKTRGVDKGGLTRQYTAGQGGVIVFDDGDIEEELSKERDA
                     YYALEEMPEVDDDGDDLSDSASEDDGDDFGMGSKKRKSWSGREEEDSEDEEDERPRQR
                     RRSNSSSPVPSSPSNRRRAIGHDSSNSSRTPSPEPNIMSPLVSRQPSARTLRRRLLRL
                     KRKHESILQAYYSTGTAYSEPISSMMYSLASELGREDNDLLWLAIVGASSMELSGRTM
                     AGVGISSSSESGGSAGWGGSRGEHVRQILRDEVHRLNPPDSAESGRDVPGSSSDMIPT
                     TARSPTDTSIRLSPEPRFLLVRHWSLYESMLHSHYLASRLHVWTEHGRKRLHKLLAKM
                     GISLTQCHQNYTHMDMELKRVLRSRLLKYAPMYGLDGLVPPPASGHSNNRQGWGFVRS
                     WGWKACLSATDVAVILGSILEVGPGAWEAGSSFRPQITNGTGQSELPSETDPANLHPR
                     FWSAYDALSPTGSDSPTLLVESLPIAKHLHRAILRTGTSLLSKHQIRHLRAFRIAVVK
                     EGPDVKLFTNPGALTKLALWVAEAIQVQERDRSETKMGKKKILGTPLVLAGLDEDRGV
                     YVVVGTGGGGGVVDFAAIAKKQEAQRTKKEAKDKKRKEREERRRKRAAERARQNEDDD
                     DDEEEEDETEDDDSSSGSDSDDGPEDDKGFLGNKNLVRNRFGIAFQEVVQETSARVRI
                     DSFEHCVVEVQKEDLGGFLEALSFRSVVG"
     gene            complement(<1356357..>1356980)
                     /locus_tag="TRUGW13939_09020"
                     /db_xref="GeneID:55996504"
     mRNA            complement(<1356357..>1356980)
                     /locus_tag="TRUGW13939_09020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492145.1"
                     /db_xref="GeneID:55996504"
     CDS             complement(1356357..1356980)
                     /locus_tag="TRUGW13939_09020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348038.1"
                     /db_xref="GeneID:55996504"
                     /translation="MISAEHAKFFTHDWSITIPGRPSVRYSHMSLSCLDEWLAMYTNP
                     ANRPHDKVLRSKVWNEAEMKELRATTIEKHTTAQTKFDGLNIMVMVDGQLVGGGNYTL
                     LSTGEVNIGLLFDESARGKGLGKLTMQVLIQLGRRMGIQRLEAGTMKSNQAMQALMAS
                     LNIPGRDEIKEIPIRGVVAEILWDIPETADWEIDLQLEFGGPLAEKA"
     gene            complement(<1357363..>1358536)
                     /locus_tag="TRUGW13939_09021"
                     /db_xref="GeneID:55996505"
     mRNA            complement(join(<1357363..1358326,1358379..>1358536))
                     /locus_tag="TRUGW13939_09021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492146.1"
                     /db_xref="GeneID:55996505"
     CDS             complement(join(1357363..1358326,1358379..1358536))
                     /locus_tag="TRUGW13939_09021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348039.1"
                     /db_xref="GeneID:55996505"
                     /translation="MSTAQTTTPFPLQQRRPKPKGVQKARMKHRRQTDHAESPGFEAF
                     ENGSTLYQRFFSLPAELRSHIFRLLLVQPCKFDMHHNEGCTRLVHYDVNWPGPYFENH
                     PLADLKLYRCADCTPTSSWQNSTLPVFVSPVRSRWGDAWPNEFLCDDCWHSRFGNVYR
                     PSMETLPCLCTRRQNLDILLANKRINREASYVFWTKNHFAFENSCLLSGFLCNIRPEV
                     RRQMTRISLMAHDFFEANVAGVPDGKVCLPHPTHLKQLWEKLGDCSGLVDLELDSYYL
                     SDMYYVLGMRRLQAKRSVTFFRHPRVQEVGKEHTGPPQPGIPQMIWPALAFRQPIEES
                     TINRSATRKLASELAESIVRGRQLKIRYLKGLCKKSLAT"
     gene            <1359342..>1361999
                     /locus_tag="TRUGW13939_09022"
                     /db_xref="GeneID:55996506"
     mRNA            join(<1359342..1361745,1361803..>1361999)
                     /locus_tag="TRUGW13939_09022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492147.1"
                     /db_xref="GeneID:55996506"
     CDS             join(1359342..1361745,1361803..1361999)
                     /locus_tag="TRUGW13939_09022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348040.1"
                     /db_xref="GeneID:55996506"
                     /translation="MASPLVVAVNLSSPDQDGLAMNEIARVGSAFVKASSNLSQTTEF
                     ISKYSRLLDVFVDVSDVGPDETADILNSGAAKVFLSSKQFAVLSVEHEIPAARLAVQV
                     ASAEDVQAVKNWIANAPDGKDISVSTNGAAIELFETFALARDGSQVYKTFGGDATESV
                     VIENVSQGVVAIVPSSRLALAPQSNDTVSAANVLASKAVADANTGLYATLVTDERGVA
                     LGFVWSSKESLVEALKTGTGVYQSRKRGLWYKGQTSGDTQELQSVGFDCDGDCMVFRV
                     KQQGKGFCHLGTNTCFGRYGGLSRLQKTLQSRKENAPAGSYTARLFNDPKLVEAKIME
                     EAEELCQATTKDEIASEAADLIYFALTRCIAADVNLEDVERNLDMKDLKVKRRKGDAK
                     ARWAEKVGLSQEPAAPPMAAPQETATATPKSDRIEMKRLNTTTTSMTTIKEALQRPSQ
                     KSNDAIVELIKPIVNDVRTNGDAGVLKYTHKFEKATSLTSPVIKAPFPENLMQLSADT
                     IKAIDVSYENIRKFHAAQQDEKPLVVETMPGVVCSRFSRPIERVGLYIPGGTAVLPSS
                     ALMLGVPAMVAGCKKIVLASPPRSDGSISPEIVYAAHKCGAESIVLAGGAQAIAAMAY
                     GTESVTKVDKILGPGNQFVTAAKMMVSNDTSAGVSIDMPAGPSEVLVIADKYANPAFV
                     ASDLLSQAEHGVDSQVILIAVDLDDKELAAIEEQLHQQANALPRVDIVRGSIDHSVTF
                     VVKTLEEAMNLSNEYAPEHLILQIQDAESVVPLVQNAGSVFIGQWTPESVGDYSAGVN
                     HSLPTYGYAKQYSGVNLGSFIKHITSSNLTAEGLRNVSSAVMQLAAVEGLDAHKRAVS
                     IRMDAMSKDA"
     gene            complement(<1363033..>1363383)
                     /locus_tag="TRUGW13939_09023"
                     /db_xref="GeneID:55996507"
     mRNA            complement(<1363033..>1363383)
                     /locus_tag="TRUGW13939_09023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492148.1"
                     /db_xref="GeneID:55996507"
     CDS             complement(1363033..1363383)
                     /locus_tag="TRUGW13939_09023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348041.1"
                     /db_xref="GeneID:55996507"
                     /translation="MFAPKTLITVVAVMAGVASAAPAPSPSTTFTLSSVNITQGAGCA
                     LLIDTEFKGGCQGVAVLDGGENCEDIKTLKSGPACNGSASVDFTQSPPKAQFIAWEYL
                     AYCDLKDDKCVNKY"
     gene            complement(<1365453..>1366395)
                     /locus_tag="TRUGW13939_09024"
                     /db_xref="GeneID:55996508"
     mRNA            complement(join(<1365453..1366226,1366300..>1366395))
                     /locus_tag="TRUGW13939_09024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492149.1"
                     /db_xref="GeneID:55996508"
     CDS             complement(join(1365453..1366226,1366300..1366395))
                     /locus_tag="TRUGW13939_09024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348042.1"
                     /db_xref="GeneID:55996508"
                     /translation="MSSMRNAVQRRQHRERGQLDNRAKWGILEKHKDYSLRAKDYNLK
                     KQKLGRLREKAQDRNPDEFAYGMLSDQNARQGRHGARDTEASSLSHDTVKLLKTQDAG
                     YLRTVGERVRREVERLEKEVQLQDGMAQVLGDDKTTRRGQEDEDDEDLDDLLASAAKR
                     RKIIFAESQEDQKKLGGLLDDSEDEEMSDDDEEDDSFGKRQQQQENKTKQPSKKQLEA
                     ERLALSQKRAARKLKRRAAEGRVRRLAALKKQHAEISTAERQLELQRARMTNSIGGVN
                     KNGVKWKVKERKR"
     gene            <1366859..>1367331
                     /locus_tag="TRUGW13939_09025"
                     /db_xref="GeneID:55996509"
     mRNA            join(<1366859..1367012,1367081..>1367331)
                     /locus_tag="TRUGW13939_09025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492150.1"
                     /db_xref="GeneID:55996509"
     CDS             join(1366859..1367012,1367081..1367331)
                     /locus_tag="TRUGW13939_09025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348043.1"
                     /db_xref="GeneID:55996509"
                     /translation="MSTSSNSPGSSSVTEPKFDLRNPLPLSATQEQQVKEVYYKRVRG
                     YCAEEIKAFAECARNRTFTTTWVCRDQRLAMNSCMLAHAKPEELDRAREEWFSSRDAR
                     RREREEQEAAVEKRRVEVIRLMRADNEKRKAG"
     gene            complement(<1367747..>1368583)
                     /locus_tag="TRUGW13939_09026"
                     /db_xref="GeneID:55996510"
     mRNA            complement(<1367747..>1368583)
                     /locus_tag="TRUGW13939_09026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492151.1"
                     /db_xref="GeneID:55996510"
     CDS             complement(1367747..1368583)
                     /locus_tag="TRUGW13939_09026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348044.1"
                     /db_xref="GeneID:55996510"
                     /translation="MATPRPAQAPASTQPLTPPDDPATTNQASSQNATTSAANPPVPG
                     VPVMPATSLNDSGKSRRPRDARLVHMLLASLGVTAYQERVPLQLLDFAYRYTSSTLQD
                     AAYLSMEGYAGASGPGELHVSSGGGRGGVELNTVTLQSLRLSIASRLHYQFQPGLPKE
                     FLADVASERNRYALPGVARGGETSNNKGAFSNISMGGMRLPPEKFCLTGMGWNLKDEW
                     ESEGEEDSSEENEPTVLADITKNEEDEDAEDEGDGRMEDVFGEDTAMKEGDEDDEDMA
                     DA"
     gene            complement(<1369277..>1371652)
                     /locus_tag="TRUGW13939_09027"
                     /db_xref="GeneID:55996511"
     mRNA            complement(join(<1369277..1370135,1370186..1371068,
                     1371125..1371484,1371544..>1371652))
                     /locus_tag="TRUGW13939_09027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492152.1"
                     /db_xref="GeneID:55996511"
     CDS             complement(join(1369277..1370135,1370186..1371068,
                     1371125..1371484,1371544..1371652))
                     /locus_tag="TRUGW13939_09027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348045.1"
                     /db_xref="GeneID:55996511"
                     /translation="MQYVRSLSGPVSKTWNSINPATLSGAIDVIVIEDEDGSLACSPF
                     HVRFGKFSLLRPSEKKVEFSVNGIKQDFSMKLGDGGEAFFVFETTDDVPAALQTSPLV
                     SPASSPASTSVAELPSLQDPPDLDLDCISTSKSEIKDLEAGPISSNRRSLSHDLGAIT
                     PLSQSPNDSSMHRIGLTIYDNNTPVKFDRSMSDGVLPAGATSLGSEASSTENSPRAAR
                     RTDIHQGQRSTSPPLVSPSEAISRAMALSKKLSGSNIPSQVTETGDLMLDMTGYKTSE
                     DEALRAEVIARNILSEELEGNYDIGALIGADDHGNLWIYSSEEAKLAASRRTTLSAHQ
                     TPFSEDAVSDPGYHSEGEQSTLQPPIQTRHHRAQSDVQPGFPTPPQTPPQDAAFGDLN
                     RNFAKTLRLTSDQLKTLNLKPGANNVTFTVNKATCPATMYLWNNKTPIVISDIDGTIT
                     KSDVLGHVLNMIGRDWTHQGVAKLFTDIVSNGYNIMYLTSRSTGQAGLTRTYLNGVSQ
                     DGYKLPNGPVIMSPDRTIAALRREVYLRKPEVFKMACLRDILNLFPTRENPFYAGFGN
                     RLTDALSYRSVNIPSSRIFTINSYAEVSLDLLSLNKYKSSYVSMRELVDHFFPPISLL
                     VQGGGEEFTDFTYWRDQANLDDFSVTDSEEEDEEDLESEPAYSEEGSDIEEDDDEQVD
                     EMGESYISRDSIDEPGMLNSTESLIDSHLSDDELSGSEEDFPDIGGVSLRDPVS"
     gene            <1372751..>1377808
                     /locus_tag="TRUGW13939_09028"
                     /db_xref="GeneID:55996512"
     mRNA            join(<1372751..1372884,1372945..1373138,1373187..1376061,
                     1376636..1376725,1376791..1376922,1376983..1377027,
                     1377086..1377261,1377317..1377405,1377464..>1377808)
                     /locus_tag="TRUGW13939_09028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492153.1"
                     /db_xref="GeneID:55996512"
     CDS             join(1372751..1372884,1372945..1373138,1373187..1376061,
                     1376636..1376725,1376791..1376922,1376983..1377027,
                     1377086..1377261,1377317..1377405,1377464..1377808)
                     /locus_tag="TRUGW13939_09028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348046.1"
                     /db_xref="GeneID:55996512"
                     /translation="MEFNTGIYEPLHWSFDVYPSVVPRVRVRGVMTLFLAGSILWALV
                     WLLYRAWQVCQTPNDILVDKLGLDIPPSPEVTLEEIAAREIRIAWKQPEFHNSIQKHI
                     IQINSAKVGETKRAETAVTIGNLVPGHIYHICVFAVSAANFQTASAVLHIRTKPLPLS
                     QTQQDGTIDGPTIQASVPRSTVTLVAPSAPVMAREHSGGHPQSKRTGLGRKLSPAADM
                     QPDDSHRVSVSDDRNGTLEQLAVRLKNLQQENENMDKQVAEEDEEHNASLDELAKQRD
                     QLKQRVKEKDEASGDLKKHVNKLESVNRTVQSEKTKRERLLQQKEAERKKRKDDIVRW
                     QDQISQFNKEVARAGEDKNRVEQDATKQANEIREKIASEQAKMKGIDDEIQEKGGRIK
                     KLEDERQGIDGSDNEDGRELDRIDIEKARQWETRLNHLHARYATLVNLHTQAQQQYQE
                     AQERIKWLNNQRTSGNGPFNSLQTIDLELPQPSAIRRPRHRSSLTSNVSSPVAFPQVD
                     TAFPRTLTYNQSNNSPTFAPSSAFFNITNGMTLLGPSDRAETVPTESDTSLPPMSPRA
                     DALLPSDLLGDEESTDLPEPITAPDLPDTTGGDDPRSPSPVSSETRSARFFASPHDSL
                     RDIDLSLPHNEGLSPDDTTNVQSASRRLSGLFNFHRQRGKTMADGPPLLGSLKPGQSR
                     SFPRNYDDMDPIGARRRRLSHAANWANPMSLFPRSNPTNVTADTSSDQAPSRKGPFSN
                     IFSSTKLNADEVIKNDQGYNQFSPSYDPLDPSSLLGPIRRSSLSPRPSSTFSFDKHLP
                     HPSTDPFGWPSSDVSAQRSSLAFDWASPSTWSRNQSRRPSIQYGSSSHLPLGMSPGEP
                     DFLQAPHDKLRPLQAPIGTRPSSSHRPVTPKLNPAAPTFKTLFKKAEKDKDKSTAKDL
                     ASKSQEFEFYTDDLSPPPSRRSRDSRALSGAAESFDSLDLVPSSSPSDNVSTKESFIQ
                     KITRKSSSSKFNLSWKDRGGIFSKKNDSIHSEIDIEGNHNDEAQLGKSVDSTVSSTLS
                     ADRSTTRSGRHFFSRKPKKDKASSEAGETGDEELPEEEYEYVRTFEQPDSLLPESWIV
                     VRIDGRGFHRLSDKYGFEKPNDRRALDLMNAAAVVVMKDLPELSIAYGVSDEYSFAFH
                     PSCQLFDRRSAKLVSTIVSGFTAAYVMQWPAYFPDKPLEISSLPTFDGRAVLYPNARI
                     FRDYMSWRQVDCHINNLYNTTFWSLVLKGGMTNIEAEKELQGTISSDKNEILFTRFGI
                     NYNNEDDIYKKGSVVYRQYQLVDPSTVPTSAGDHEEDQGIANVKELSRTQQEKLRKLR
                     RKAQVVVDHVDIIKDEFWQRRPWILSGKPGKVPAEAAAE"
     gene            complement(<1378019..>1378945)
                     /locus_tag="TRUGW13939_09029"
                     /db_xref="GeneID:55996513"
     mRNA            complement(<1378019..>1378945)
                     /locus_tag="TRUGW13939_09029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492154.1"
                     /db_xref="GeneID:55996513"
     CDS             complement(1378019..1378945)
                     /locus_tag="TRUGW13939_09029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348047.1"
                     /db_xref="GeneID:55996513"
                     /translation="MDAQAYLIRHGWSGPGNPLNPNRRPGAHSGLGLTRPLLISRREN
                     KIGIGQKSTKDPTNQWWLRGFEEALRGVGQDGSATPGEDGNDGNCLTRNGSQLYKFFV
                     RGEVIPGTLDKKKDSTKSAVADDSSKDIKKKERKEKKEKKERKEKKSDEKKAEKKKRK
                     RDQHEDNAKSDDDRKRKEEKRKRRKLKEAEDAAIDSEKKSSKKSKKSKTAQSPSSTEL
                     PNNNDSPDQQSIDKKKRKEKKEKKKRKAEDISAEDDYPTPDSSTNEDSIRTAKISKDK
                     KPKDKTKKSKEEKKEKKSKRRKENKELAESNE"
     gene            complement(<1380496..>1381941)
                     /locus_tag="TRUGW13939_09030"
                     /db_xref="GeneID:55996514"
     mRNA            complement(join(<1380496..1380663,1380726..1380852,
                     1380907..1381247,1381302..1381368,1381420..1381531,
                     1381620..>1381941))
                     /locus_tag="TRUGW13939_09030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492155.1"
                     /db_xref="GeneID:55996514"
     CDS             complement(join(1380496..1380663,1380726..1380852,
                     1380907..1381247,1381302..1381368,1381420..1381531,
                     1381620..1381941))
                     /locus_tag="TRUGW13939_09030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348048.1"
                     /db_xref="GeneID:55996514"
                     /translation="MHALQPTAASSLSLPSGTYIYAIAEAPSSSAGRRQFAAISSDDS
                     LRIFDGRSLQPLTVVSAKTHEGVTSLNGTLPGFLATAGRDGAVRLWDVRSGHASGKAD
                     VEMKVVFSLERNAPILSLAGNPESYTIVAGTELVSSQATVAIWDIRAPGETRQKYVEI
                     HNDDVTELQFHPTRSNILLSGSTDGLVNLYDINTTDEDETLLQVINHGSIHHAGFLSE
                     DAVFALSHDEVFSIHPITNPDSETSDSPAPIQFGDLRKPLGCEYVVQTLTNSNGTYLA
                     AGNASEKRLDILPITSNPKWDFDYSSVWRLPGAHGEEIVRAVHLDEQSQTVFSGGEDG
                     FVRAWRSDSSVGNDMHIEEDPSGINSARSKDKKRVKDEKRFKPY"
     gene            <1385952..>1387095
                     /locus_tag="TRUGW13939_09031"
                     /db_xref="GeneID:55996515"
     mRNA            join(<1385952..1386133,1386207..>1387095)
                     /locus_tag="TRUGW13939_09031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492156.1"
                     /db_xref="GeneID:55996515"
     CDS             join(1385952..1386133,1386207..1387095)
                     /locus_tag="TRUGW13939_09031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348049.1"
                     /db_xref="GeneID:55996515"
                     /translation="MFPSNQNPSGQSPQTAAGPHSPQTAYSSSTEPTATRLNIDAINL
                     PTGNSPHAASIVPSNYKLPEQHPRHVENGRTYHGYRRGVYMLPCDEEEQDRLDLFHKV
                     ITEARVGDGLIYAPHPPNARVLDLGCGTGIWAIDVANKYPEAFVAGMDIADIQPLNGP
                     KNCDFYAPRDFEYPWALGEDHWDLIHMQMGSGSLTSWPSLYRRVFAHLRPGGWFEQVE
                     IDFEPRCEERSLENTSMHKWYQYLKQATEMASRPIAHSVGETMAALERQGFVDIDHQI
                     VGLPLNPWHQDEHEKKVGRWYNLAISESIETLSLAPLHRVFSLTPEQVKSLAVEVKRE
                     AYNKEIKAYNILHIYQARKPGN"
     gene            complement(<1388024..>1389710)
                     /locus_tag="TRUGW13939_09032"
                     /db_xref="GeneID:55996516"
     mRNA            complement(join(<1388024..1389122,1389184..1389324,
                     1389377..1389465,1389525..1389586,1389641..>1389710))
                     /locus_tag="TRUGW13939_09032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492157.1"
                     /db_xref="GeneID:55996516"
     CDS             complement(join(1388024..1389122,1389184..1389324,
                     1389377..1389465,1389525..1389586,1389641..1389710))
                     /locus_tag="TRUGW13939_09032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348050.1"
                     /db_xref="GeneID:55996516"
                     /translation="MNLSLVDPFALAQDYPDTLTATLRSGHASSLRFNSTGDYLAAGR
                     VDGTVVVFDLETNGVACKLQGHTKQIQSLRWSRNGRYLLSSSQDCKCILWDLKDGSRM
                     RMVRFETPVYVAELHPFNHLLFVAALFEDQPVLVDITNPKPIKRLLPSAPLRPHEGLD
                     PAAAARQATQDAKQYTCVTVFTALGNHIIAGTSKGWINIIETQTCRTIHSMRLCNRVI
                     TMIRLAGNGRDLLVNSTDRVIRTVIMSDLSQLGIGLDPSNIQLEVEHKFQDVVNKLSW
                     NYVSFSSTGEFVMASTYMNSDVYIWERSHGSLVKILEGPREEMGVVEWHPSRPMILSC
                     GLESGSIYMWSIVTPQKWSALAPDFAEVEENVLYVEREDEYDIHPAEEIHQRRLDQED
                     ETPDVLSVDHTDRVMDLVDAEAETDAFRMPVLLDLSDSESEDDIIAVGPGTMRKRSPG
                     AGREWMNTNDASSSRGAAAATTNGTSKGQARGRKKQ"
     gene            <1390508..>1400571
                     /locus_tag="TRUGW13939_09033"
                     /db_xref="GeneID:55996517"
     mRNA            join(<1390508..1390636,1390710..1390866,1390919..1390989,
                     1391053..1395923,1396826..1396869,1396956..1397084,
                     1397160..1399109,1399164..1399591,1399867..>1400571)
                     /locus_tag="TRUGW13939_09033"
                     /product="DNA-directed RNA polymerase II subunit RPB1"
                     /transcript_id="XM_035492158.1"
                     /db_xref="GeneID:55996517"
     CDS             join(1390508..1390636,1390710..1390866,1390919..1390989,
                     1391053..1395923,1396826..1396869,1396956..1397084,
                     1397160..1399109,1399164..1399591,1399867..1400571)
                     /locus_tag="TRUGW13939_09033"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB1"
                     /protein_id="XP_035348051.1"
                     /db_xref="GeneID:55996517"
                     /translation="MANVYFPYSKAPLRTIKEIQFGLLSPEEIKRLSVVHVEYPETMD
                     EQRTRPRTKGPNDPRLGTLDRQFVCETCEEGQKECPGHYGHIELAVPVFHIGFITKTK
                     KLLETVCHNCGKIKADISDSKFQDALRVRDPKRRFDMIWRLSKDVAVCEADPPVEDDD
                     PFSKESSKPAKAHGGCGNAQPTIRREGLSLMGTWKPNKANMMEDDVEMPQPEKRTITP
                     SMAHNIFRSISHEDVRIMGLSNDYARPEWMVLTVLIVPPPVVRPSVVSGKSTSGQRAE
                     DDLTFKLAEIIRANQNLQRCEQEGAPEHVVREFEALLQYHVATYMDNDIAGQPKAMTK
                     SNRPVKAIRGRLKGKEGRLRQNLMGKRVDFSARTVITGDPNLSLDEVGVPRTTAMVLT
                     YPEVVTPYNIEFLQKLVNNGPTIYPGARYIIRDNGERIDLRMARKTNANLLYGWKVER
                     HIMDGDVILFNRQPSLHKESMMGHHVRVLPYSTFRLNLSVTSPYNADFDGDEMNLHVP
                     QSEESRAELHELAMVPFQIVSPQRNGPLMGIVQDSLCGVYKMCRRDVFLSKDQVMNVM
                     LWVPDWDGAIPPPAILKPRPRWTGKQIISMVLPSGLNLLRVDKDGAPLSEKFSPLADG
                     GLLVHGGQLMYGMFSKKTVGASGGGIVHTIFNEYGPEAAVSFFNGAQRVVNYWLLHNG
                     FSIGIGDTIPDQDTIERIEGAVRAGKEEVEQIVASATENTLEPLPGMNIRETFESKVS
                     RALNNAREESGSETEKSLKDLNNAIQMARSGSKGSSINISQMTAIVGQQSVEGKRIPF
                     GFKYRTLPHFTKDDYSPESRGFVENSYLRGLTPSEFFFHAMAGREGLIDTAVKTAETG
                     YIQRKLVKALEELMVKYDGTVRNSLGDIIQFLYGEDGLDGAHIENQRVDIIKCSDNQL
                     RDRFRIDLMNPEQTLGPEVLEQATEIAGDVEVQRYLDEEWEAILKDREFLRSVAKGDE
                     EMMQLPINVQRILESAKTTFRIKEGTISDLHPAEVIPQVQALLDRLVVVRGDDLISQE
                     AQTSATLLFKAQLRSRLAFKRLVTQYSMNKLAFKHVLGAIEMRFSRAQAPPGEMVGVL
                     AAQSIGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEILNVATNIKTPSMTVYQEPHKK
                     HNKESAKQLRSAVEHTSLRSVTQATEIYYDPDIQSTVIDNDRDMVESYFIIPEDVTDD
                     AAHQSKWLLRIVLSRPKLLDKGLTVQDVASRIKEQYPKDIAVIFSDNNADEQVIRIRQ
                     LHDVKEDEDDEDMEYDVTLKKLEQHLLDTLTLRGVAGVERAFINEKDNVRLMDDGALF
                     QSKSDPLCKEWVLETSGSALADVLTIPGVDRSRTYSNQFIEVFEVFGIEAARSALLRE
                     LTQVLAFDGSYVNHRHLALLVDMMTVRGYLTPVTRHGINRADNGALMRCSFEETVEIL
                     LDAAAFGELDDCRGVSENLILGQMAPAGTGEFDVYVDQDMLNTVVSSNANLGLTGALG
                     AKDAIINDGAATQYDNNSPMMENGYIGTPDPDARFSPIRQGGSETPGGLTPYQPSGGL
                     GGFSPAPQSPGGYSPTSPFNTSPVSPGYSPSSSYSPASPGMAITSPRYMTSPGFSPQS
                     PNFQPTSPAYSPTSPAYGQASPTSPSYSPTSPRFSPSSPNYSPSSPNFSPASPAFSPS
                     SPTYSPTSPAIGGSRQFSPSSPTSPKYSPASPGWSPTSPEIYSPTSPNIHGSPTSPMR
                     GATSPSYSPTSPQYNPTKMRSWSRFFLPLVLLSLLLGALVECRSHSTSVSTSNGPSEN
                     FGKGTEDNTFAGNDGRDLVESALQKLRELKISPAASSKPSGLVGYGLHYAKHAFYLLF
                     MNGPPLEDQSDSDSQSYRLDPDLAKAVNELEVAATETQNPDAMFLLAEMNFYGNYSHP
                     RNFKEAFKWYHDLALSTGNSSAQYMIGFMYATGIGGAVERDQGMALLYHKFAAEQGNT
                     RSEMTLAFRHHIGIGTHRNCDSATHYYKRVADKAIAYWRSGPPGGYNMPRQSFRWADD
                     EGGVYGEGASVSSSGPNANRDSGQPSAEASLEDIIEYLDLLSKKGNLKATLSLGKWHY
                     DGSRNLPRNYRKAMKYFRAVAKRYWTKDGAIIANHPPEIEAAAAKAAGHIGLMYLRGE
                     GVEQNFATAMAWFKRGLANGDPLCQHEIGLMYLHGYGVTQDAFKASGYFKAAAEQDFA
                     AAETRLGALFLDQGDVQTATRYFELAARLGWMEAFYYLAEIANFGIGRERHCGMASAY
                     YKMVAEKAEQVHSSFAEANKAYENDDHDTALIAVMMAAEQGYEHAQSNVAYLLDEQQS
                     VISLGKILPWAKKRRSSLLRNTALALIYWTRSARQSNIDSLVKMGDYYLKGIGSSVDA
                     EKASTCYHTAAEGHHSAQAYWNLGWMHENGVAVDQDFHMAKRYYDLALETNHEAYFPV
                     KLSLMKLRLRHFWNRITNGKVNGIQDEKENRAPRTFKEWIIAFLENDEEEALYQAQLL
                     REREENGDILGTHHPHRAENDDTGYYDELELDIDESVFEALIIVALAATLLILVYIRQ
                     RNRRDGENAGNGQQQAAGGQNGQGANVAANNNNNNDRGLFPRPDQPEFAQWAAGGFNS
                     PAMGERHANIKRRRLDEATSALARPFKSPLRKDGDVDPSNKNDKEGGMSDADKSFRVA
                     TSEDAMVHKPVLSSAPPRYSITPRQYRAPLKMDPELVALQKEQISLRSRLATLRSQVD
                     TAQQALRIESSPRDEELQALTEKWKKVSQNVADELFVSAKDRIERMGGVDAWREKERM
                     RKVQMSWGDDEGRETEVPDDFERTSSAEITSSSSSTPKEDENASILMATPFHSLIGF"
     gene            complement(<1401022..>1402735)
                     /locus_tag="TRUGW13939_09034"
                     /db_xref="GeneID:55996518"
     mRNA            complement(join(<1401022..1401160,1401219..1401804,
                     1401867..1402339,1402411..1402602,1402659..>1402735))
                     /locus_tag="TRUGW13939_09034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492159.1"
                     /db_xref="GeneID:55996518"
     CDS             complement(join(1401022..1401160,1401219..1401804,
                     1401867..1402339,1402411..1402602,1402659..1402735))
                     /locus_tag="TRUGW13939_09034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348052.1"
                     /db_xref="GeneID:55996518"
                     /translation="MSSAHGSYTTQNKLPADFAWGFATASYQIEGAYDEDGRLPSIWD
                     TFSKTPGKVEDGTNGDVACDSYHRTHEDIKILKQYGAQVYRFSLSWSRIIPLGGRNDP
                     VNAKGLEFYSKFIDDLNAAGIEPVITLYHWDLPDELLERYGGALNQEEFVADYANYAR
                     IVFKSFGHKVKRWITFNEPWCSSVLGYNTGKHAPGRTSDRTKNPVGDGAREPWIVGKT
                     LLIAHGTAVDIFRKEIKPTHGGEIGITLNGDWAEPWDPEDPADIEASERKIEFAISWF
                     ADPIYHGKYPDSMVKQLGDRLPAFTPEEIALVKGSNDFYGMNHYCANYIRHREGEPEP
                     DDAAGNLDHLFEDKFGNPIGPETNCEWLRPNAIGFRKLLKWLSDRYGYPKIYVTENGT
                     SIKGENDLPLEELLKDDFRVQYYSDYIGAMADASAIDGVNVKMYMAWSLLDNYEWSEG
                     YQTRFGVTFVDYENGQKRIPKKSALTLGEIFNNHVSKE"
     gene            complement(<1403559..>1405950)
                     /locus_tag="TRUGW13939_09035"
                     /db_xref="GeneID:55996519"
     mRNA            complement(join(<1403559..1405387,1405453..1405539,
                     1405599..>1405950))
                     /locus_tag="TRUGW13939_09035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492160.1"
                     /db_xref="GeneID:55996519"
     CDS             complement(join(1403559..1405387,1405453..1405539,
                     1405599..1405950))
                     /locus_tag="TRUGW13939_09035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348053.1"
                     /db_xref="GeneID:55996519"
                     /translation="MARQPPSTPSNTVTAASGLSPFHEGGSAASWDAIAAATSHRRST
                     QPMSSSSPLPAREQNAYLMPTSPAKARRGSADYRPCIKKAVGNVPACLVNASVTYCGN
                     DQIYAFGGFDQFTDEVYNHVLRLNLNTLAWDLVDNYGDIPGVRMGHTASLYEGNKLLV
                     FGGENERSEYLSDLVILDIPSSTWTQPDVRGPLPRGRARHASVIYENKLFVIGGVTGI
                     GGVTGEQNNLILDDLCYLDLKTWTWSRTWSFTPRFDHTAWIWGGRLWIFGGLGPDMER
                     TTDLWWLDLKGSPSLGMTTEEPHATLSHATPSPGASLSPPRQLSSRSNGYAANSASVQ
                     IRSFVRRKPTAPGAISSLKFHSGPHVPSLLSGTHFHVYSSGLLLDLITPSETVRPFEC
                     NLSSLELDSLRWQRLADGQEVFRPGYRWHYCTINEDGTKAWLLGCNIEAPTGAGDDNQ
                     LNEILCLDLEKYGLLGNDLVSESSEQNRILASERQGSSPHNVGIGADLLAVFDQAPET
                     DSGTDFIITADSDDQEPDEEAFEPISPRQGQSEPAFISPTASTSAPIHVHRIILQARW
                     PHFKRLYAAQMAEYHTKRMHIPEPYSVVRAFLYYLYSDSILDHPQYCTSILDVAGMLV
                     MANLYDMPKLRLLCVHRLSRELDVENAAIIWERAGRTNEEWLRRRAAQFCLTNWGRIV
                     RTAGFKSLNRQSLIELCEVVDMEGRIIAGPELEFVGALGSGSLGSKRPRLTGNSLVDD
                     MEDLEGDDEDGMELS"
     gene            <1406523..>1410831
                     /locus_tag="TRUGW13939_09036"
                     /db_xref="GeneID:55996520"
     mRNA            join(<1406523..1408386,1408962..1409023,1409351..1409452,
                     1409507..1410735,1410792..>1410831)
                     /locus_tag="TRUGW13939_09036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492161.1"
                     /db_xref="GeneID:55996520"
     CDS             join(1406523..1408386,1408962..1409023,1409351..1409452,
                     1409507..1410735,1410792..1410831)
                     /locus_tag="TRUGW13939_09036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348054.1"
                     /db_xref="GeneID:55996520"
                     /translation="MATASVSTPLKSQRSIFSTKTAGGRLPLTPSPRTRAASNASIGS
                     SPFTPSREVEDTGRGNHQSVYGGNLFGKSAGTKSRGYRESPKSNIARTRKSPKHLELG
                     ISDWTLTGTGPSSHTPSKERARKEATRQRASKHVTSKAATSKTTIRIPHTAGDRFIPN
                     RTASEGLTTAGSAKPDDSQRPRTGGSDGSAVLASAASAFEIGARGSDDDLTAALDNLA
                     LDDNESASTYSRPAPDAVAYESSLADACGVKFNTRILAYKPPPPESSKPIDLRAQYNR
                     PLKPSAAQSAQSRRRVQTAPDRVLDAPGLLDDYYLNLLDWSSGNQVAIGLERNVYVWS
                     ADSGTVNCLLETSPDTYVSSVKWSGDGAYVGIGLGTGEVQIWDVEEGTKLRSMYGHDT
                     RVGVMGWSKHTLSTGARSGLVFNHDVRIAQHKVAELVSHTSEVCGLEWRSDGAQLATG
                     GNDNLVNIWDARSLSAPKFTKTNHRAAVKALSWCPWQLNLLATGGGSYDRHIHFWNTT
                     TGARTNSIDTGSQVTSLRWSNHYREIVSSSGFPDNSLSIWSYPTLVRHVEIPAHETRV
                     LHSSLSPDGQMLATAAADESLKFWKLFERKPGTAASASREGGVGSKAQMSKSMTIRTS
                     LGHRCQDYGDLEVAAAEEGTVYDRVIHDVCEASQVDFEEGGVDQQTLEEMRTSMALMC
                     SFGVVVCIILGRVAKAGVGGIRPPYGGRRFLSHFYTHRQPLPGSAANHRLCTATARIL
                     VVSMFNQMLIPQLQCWQQKLSHLAVAHFPWDPPLQPTPPPAQQHSANQILPPTATVPS
                     NAPRPPPPQQQHQPPPSTLPPQAAIPGPIANNGPTHPNLGPTIKTEPGLNGQHTLPPP
                     AGTPQGLSNAQATARERAASNLHSKYGAAAAGSVSQLQAQSQAAALSLPGQQPPSNGQ
                     LPGNGVQDVKPPQPLQGIAPPQRAPFNPAQTDGASDPLVEWKTEVARRREAAQRNNGE
                     ADRLLYEKLKFDSLRLEGGGLMLPLDEHSTSNGVGRALKREPGSLAQYDGADEEEDED
                     AINSDLDDPDDLTAEDPDGDDSVGQVMLCTYDKVQRVKNKWKCTLKDGILSTGGKEYV
                     FHKGQGEFEW"
     gene            complement(<1411241..>1413148)
                     /locus_tag="TRUGW13939_09037"
                     /db_xref="GeneID:55996521"
     mRNA            complement(<1411241..>1413148)
                     /locus_tag="TRUGW13939_09037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492162.1"
                     /db_xref="GeneID:55996521"
     CDS             complement(1411241..1413148)
                     /locus_tag="TRUGW13939_09037"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348055.1"
                     /db_xref="GeneID:55996521"
                     /translation="MSSIAGDSSTAGGHMRQRSRYACAPCRQRKRKCDGKYPCSTCTG
                     YGYDCQYNSARGSQDSNPAASSNNYTNTSPSQGTKRKSPAADLEEPPTFTYFPQKTLR
                     SSLGRHGFTTGGEALSLKEDRPSTNGFLMPCKGRFIGRHSSVAFPQWVGMNLQSACPP
                     RVHSFAYNTGVRRELPYSVTFKLDEYITWAEVHDSINIYETVIHPVFGFVDIENLRRR
                     SHDHWHDRPQGANFEALISGIVGLASLFSQVLCENRELRVVQHAKDILDDPAIARFPT
                     LYTMSAWILRTIYTRSTSRPGITWQYSCTMMHLCENIGASREPDSMQTANTTTSTTTT
                     LHEARDLRARLAIVARCLHVFISYEHGRSTVEIGPIPEHNVIQRKGDLTMQFNALINT
                     LPPDSRSHHDQLSRRQELCTALTDLLAAPADHEYLTLIKADLCFCVYRRLRLLDLGLK
                     QEPLDQVIRAGKMALPAARSLVLRNHPWWNNVGSVFQYLCVLLAIDNSDSLAAIPEAM
                     ETLETITKHLHTHLADEALNTARLLVRAMKEKKRKEFDILECIAGVETSVNDDNIDSN
                     NDKMAVNEETMGTEQLLQHQQQQWSGMVDFTDPMWNWDAFFEPPMAVGLIASPFAEPG
                     GLQWTSGTDAV"
     gene            complement(<1413344..>1414675)
                     /locus_tag="TRUGW13939_09038"
                     /db_xref="GeneID:55996522"
     mRNA            complement(join(<1413344..1414593,1414657..>1414675))
                     /locus_tag="TRUGW13939_09038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492163.1"
                     /db_xref="GeneID:55996522"
     CDS             complement(join(1413344..1414593,1414657..1414675))
                     /locus_tag="TRUGW13939_09038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348056.1"
                     /db_xref="GeneID:55996522"
                     /translation="MSSKDQDDPDENTLLFDSFRASFQRWSRPAYKKVAQQSQPPKPV
                     AENICLEKSGETAVQETTHSEGEALRPLSPHEPVPSTEGSIRQLSTQSEKASLGHGDE
                     AKSDLGSAAPECLDEASHGSSAKSRDEDNKSIASNETVNGDAAMPPIPIAPASGRHPQ
                     PPPSPITVETEKMMKTEDASPELRSELKAIGDSVRNGNWWIKRAKERRDLRCGSPVGR
                     NYHKKNYVLETNVASQTNNMDKFPKDILDEQKSEMQYTVYRDSARAYPRYKRGKGILA
                     STTKTETEVPVYETVPPIPSFEKMFKILVLKGRRRNPVNQDERAICGANWDCFSAASG
                     AERFELTKRFWSWIDDTIPYGWIVDIYHEPFFDGTAHADGMRGFYIAADVLDEAGHVR
                     KCELEPCRKIEKESLPAKTLPTFSLDTVNW"
     gene            <1414962..>1415506
                     /locus_tag="TRUGW13939_09039"
                     /db_xref="GeneID:55996523"
     mRNA            join(<1414962..1415020,1415072..1415182,1415242..1415258,
                     1415319..>1415506)
                     /locus_tag="TRUGW13939_09039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492164.1"
                     /db_xref="GeneID:55996523"
     CDS             join(1414962..1415020,1415072..1415182,1415242..1415258,
                     1415319..1415506)
                     /locus_tag="TRUGW13939_09039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348057.1"
                     /db_xref="GeneID:55996523"
                     /translation="MLSILRKARLKDKEMRILMLGLDNAGKTTIVKQIMHEDVTTVSP
                     TLGFIIKTIDFQGYKLNIWDVGGQKTLRSYWRNYFEKTDALIWVVDATDRLRIDDCRD
                     ELAGLLLEEASFPPAATTIERK"
     gene            <1416621..>1421643
                     /locus_tag="TRUGW13939_09040"
                     /db_xref="GeneID:55996524"
     mRNA            join(<1416621..1416771,1416982..1421341,1421400..>1421643)
                     /locus_tag="TRUGW13939_09040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492165.1"
                     /db_xref="GeneID:55996524"
     CDS             join(1416621..1416771,1416982..1421341,1421400..1421643)
                     /locus_tag="TRUGW13939_09040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348058.1"
                     /db_xref="GeneID:55996524"
                     /translation="MAENSSEDVNDFLLRIRELGDKRDREDEERTRKLEEEILQGRKE
                     RQARRAERARSISPTKDSPLASVALDVQRSAHESVLHPPQELKPSADTALQNPPSPSQ
                     PESEERATSSFPQKQAPSALADLDTDATAEEEPSDHAQSALSDPTENSGDAIMPTEDD
                     TTTPSRAQISRALGSKDPSWFRQTADREKSSLALRKNAEENVLPEIPSVGSSFKLPGL
                     SRNSTPETDKPNDTAGERSRSPSRASSTAATSTVGYRYSSISSVSTSGLGSPVPLSSR
                     GLAVDSRKPDPPPTMDERTPLSPGRGSPERPGSPTKGLGGFVQSAMMKRSDSISKRWS
                     VQAPGTLSRSNSVISNRSSVSRPGFGDVLPNPVDTRAGRGTSPLTLSRPGSSHSEATV
                     VNYAGGDEKNTSTNTVQTDNGFVRPSLPTHARSNTISSVGSTTDETRGGDPTTPRSPS
                     KTMDPKRWSPTKASWLESALNRPESPRAKNPPATQQPPWLRDLSKARQSRGSVDLGKP
                     TALKEAAPVGLARSSQLPEKDQTSSISTVPETTVTTALAPKEAKETKENEPDVKIEVP
                     KPSSEDTPVESQSEAEKPTTASEPSQQSSPSISKVSPPVPSNKPKLPPPNDPPSQSPK
                     PAPGVIDFRSNLRRRETSQDNSANSEPEFKNVFGKLRKTEQSKYRAPDVFKDNIMKGK
                     AALNTTGGPKKSDRVDEFKESILKRKDEMKAGGGSIRRQSEDDRIPPKPRDSIPEALS
                     RRNNLSRTESMKSSISSISSPVKSPEVGSPSKAVTEAASIVDIAKDPSPKTVVPTPSI
                     SSSEDSKDAPEPPKKLSEPDVVVQKPALQQDEDNESVQPVRPSQSKVFVGATKPSAAP
                     KGPVAKGTIADRLNPALANMLSRGPPGGETSNSPSLNQSSVSATPKEREPGPAAPLTH
                     MTKGRAKGPKRRLPAASKSTPDQSVTKEDTPTPKQSPTKKTATLKTEKTEQKNSQDRF
                     HSSLVITKKIENFPALPQTPDKPLVHRQKPLISSKSPELTKSLVSSRVEHIATPKAQD
                     KIEEKPSEDKLSAPLSKSYSSPEVPPKSGIVRQKVNIEKSRSPDERPTPPPKSKTLPL
                     APSAGNSSTSPSFASRLKETWANSAASPLQTKFGLGLGSSLFPSRPDSPLEKTSPQPD
                     KFSASPPVPSKQGLKISSDVGNKARRPSLTSPVPQTTESGNVISHFFGTPPKSSDRVD
                     IDPQLILTSEIDNPKTRTMRKQIWEITGDGKKQDLPVNQEYILFEGSMYVCIHNFEYE
                     GGNRTEAYLWLGDEVSEAAMEDAQLFARRVARENGARLELVRQGKEPATFIEALGGII
                     ITRRGSSSRSSSSALYMLCGRRHLGQIAFDEVDLSRRNLCSGFPFVISAKFGKLYLWK
                     GKGSGADEIGSARLIGMDLGLTGEIEEIVEGEEPASFFEVFPDGKVAQPPSSTGHWHM
                     KSRHEKYRSRLLRVDHILGQKGGFWNRRGSSSPVTRPNDTVEEIEPFCQKDLRPRDIY
                     VLDVFFEIYVVVGSEAQSRAAEFASALIFAHEYGILAASLEDRPFIPKSFVAIGGIPE
                     QCKVAFRKWDSKIWQSTPRTLPLNAAIEAIRE"
     gene            <1422469..>1424256
                     /locus_tag="TRUGW13939_09041"
                     /db_xref="GeneID:55996525"
     mRNA            <1422469..>1424256
                     /locus_tag="TRUGW13939_09041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492166.1"
                     /db_xref="GeneID:55996525"
     CDS             1422469..1424256
                     /locus_tag="TRUGW13939_09041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348059.1"
                     /db_xref="GeneID:55996525"
                     /translation="MDPAIARELSRLDPDIPFRAATQHVHHTWAKTFYSRPELYLQPH
                     SLAEIEKIVTLARRCRRRLVTVGSGHSPSDLTCTSAWLINLDNFNRITSLSPESGLVT
                     VDAGIRLRQLGLELEKHGLTLPNLGSIDSQSIAGVIATGTHGSSSRYGLLSESIRALS
                     VTLANGQTVRCSATNNPALFRAALVSLGALGIITEVTLQTTPAFRIAWQQGLYPLSTV
                     LDRWSKDLWTSHEFVRAWWLPYMDRAIVWRADKTDLPLRPPPQNFYDGKLGFHVYHNL
                     LALCNWFPRALPWVEWFVFGMQYGFKPGSVVTEAVEDGREGLLMNCLYSQFVNEWALP
                     LEKGPEAITRLSAWIHGDQESSRIPFSPKGVWVHCPIEVRVSDSTLSSSPHPFLDPTC
                     RDGPTLYLNATLYRPYLRDPPCRERYYEAFEWLMRDMGGRPHWAKNFTDTTSPQELRD
                     MYGEDMDEWLQVRHTTDPDGMFIGEWHRRNLLLPSSSASDSISGFPKETDSQLLPLGE
                     RETGRRKFGGLGTGDGVEWIGDRRWEQRGSHTALEEASVDKALLDKVLQHKGLPETPS
                     PPMTSTSEESFDLLAHGEASILIQDNNKH"
     gene            <1428388..>1429450
                     /locus_tag="TRUGW13939_09042"
                     /db_xref="GeneID:55996526"
     mRNA            join(<1428388..1428431,1428499..1428549,1428682..>1429450)
                     /locus_tag="TRUGW13939_09042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492167.1"
                     /db_xref="GeneID:55996526"
     CDS             join(1428388..1428431,1428499..1428549,1428682..1429450)
                     /locus_tag="TRUGW13939_09042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348060.1"
                     /db_xref="GeneID:55996526"
                     /translation="MFSRPVTDAELRSPSAMATSLVVDAWHTTNTAFVEMLISQHAVH
                     LQALQDLYRRCVSCEGLPGSTLEDPVHGLPGTHAILDQLGLIKHAEEMTEDPQAVLAD
                     IIDYLKSLETASDGLDSAESTEPSEATQSGGPSPEPSTPRELPEASEPSIADKWSGST
                     DNYYQYQGLDSHKSAAQPHHHHHHHHQQQQQHSSLTPSMGSFPYQDHVGHSHLLEPSS
                     TQQPRYGPVDTCCQDNELPSEAMWSLPYHHHMPGFLPYGNREHLMTIEQDTYSGMSQY
                     GNGFYGTYLQR"
     gene            complement(<1430020..>1432408)
                     /locus_tag="TRUGW13939_09043"
                     /db_xref="GeneID:55996527"
     mRNA            complement(join(<1430020..1430180,1430237..1431175,
                     1431227..1431884,1431950..1432176,1432238..1432322,
                     1432376..>1432408))
                     /locus_tag="TRUGW13939_09043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492168.1"
                     /db_xref="GeneID:55996527"
     CDS             complement(join(1430020..1430180,1430237..1431175,
                     1431227..1431884,1431950..1432176,1432238..1432322,
                     1432376..1432408))
                     /locus_tag="TRUGW13939_09043"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348061.1"
                     /db_xref="GeneID:55996527"
                     /translation="MSSTDYSYDEQGQFFPYFVLTLTGLVTLPLTYSFLKPPKKPEST
                     APRISSDFKPQQDDLVQGQKRKRLRKERRVKRAIAVLCGWAIMAWMVYLMLVTARTAP
                     KIYDPYEILGVSRSADEKAISRHYKRMSLIYHPDKIRPDPAKNETIEDLNERFVELTK
                     AYKALTDEEIRNNYLQYGHPDGKQSYSIGIALPKLIITEGSGKYVLLVYGGLLGILLP
                     YIVGKWWYGSQRFTREKVLVASAGNIFREYKEDMLGGRVVSALSTGEEFKGLLKGPRA
                     EAGLAKVEKKVLAIDEKILTTVDRETLRKLDDSTRRKTLALLWAYLNRLDLEDTTLNE
                     EKFESGSIALSLNESFTAIALAFGNLLPVIGAYRMSQNLIQAVAPGSSPLLQLPYFTP
                     EVAKAVEGSDAKTHLSVQKYMNLPEEKRRSLTVGPGLLTDQQYQSSIAVAKQLPYLEI
                     SKAFFKVVGERVITPSSLVQLVIKARIVPPGTENVPKVNELDLEDIDPDEGDLDALLN
                     RKPGKARKVKKSDGSIVEEKQDIIQPSLAHAPYLARDYSPRWYAFLADPKQGKIAVPP
                     FPFTTFDKPIFDENGKPTFNVQTLKMQFQAPPQAGDFSFALHLVSDSYMGFDAKQEIT
                     LHIDDPAKAAALEEEDDISEPDEDSIAGQMQALKTGAAPPKKKTKPAHDDSDEESDTE
                     GEVEDTSETDTETDTDEE"
     gene            complement(<1433381..>1433716)
                     /locus_tag="TRUGW13939_09044"
                     /db_xref="GeneID:55996528"
     mRNA            complement(<1433381..>1433716)
                     /locus_tag="TRUGW13939_09044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492169.1"
                     /db_xref="GeneID:55996528"
     CDS             complement(1433381..1433716)
                     /locus_tag="TRUGW13939_09044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348062.1"
                     /db_xref="GeneID:55996528"
                     /translation="MGQRHNRRRTRPRSRNRDNSLRDQQLSDDDFSPVASPTLAPVHA
                     MPLITNPAAPSRHIGVEDWSVSQHTVRSRANGVKTEEYRVFGGVPGDDPSLCYNMLEY
                     FGHLDYINT"
     gene            complement(<1434457..>1436116)
                     /locus_tag="TRUGW13939_09045"
                     /db_xref="GeneID:55996529"
     mRNA            complement(join(<1434457..1435552,1435614..1435890,
                     1435996..>1436116))
                     /locus_tag="TRUGW13939_09045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492170.1"
                     /db_xref="GeneID:55996529"
     CDS             complement(join(1434457..1435552,1435614..1435890,
                     1435996..1436116))
                     /locus_tag="TRUGW13939_09045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348063.1"
                     /db_xref="GeneID:55996529"
                     /translation="MDAFNPLHPTNPASAGPPVEMLQNLHISLTIPAHGGNKYPAKQH
                     ARKVASKLGISHGLIYLIGKPTVLFDDSDQAVVFRQRRYFYYLSGVDNPDCHLTYDVR
                     FDLLTLYVPDFDLRQAVWMGPTLTTEEAMERFDIDSAKYVSHLSFDIDAWLQDQGRKH
                     QIYILHPDHRPPSKGGDQQLESESLVSAMNTSRGVKDATEIELIRRANIVSGLAHTAV
                     LEGIGKMTGESEIAGLFLETCITHGSPEQAYGIIAASGENASVLHYMKNDEPFGSRPL
                     VCLDAGAEFSCYASDVTRTFPIGSTGNWPTLESRNIYRAVERMQEECIQMIKPGVRFG
                     DVHAHAHRVAIEELLKLGIFHTGSVEEIQQARASVLFFPHGLGHHVGLEVHDVSEKSV
                     MAYEETGPEFKLVPGVATTLSTVPLEENMIVTVEPGIYFNRLAIENARKLPIARLINF
                     SLVEKYIPVGGVRIEDDILVTADGYENLTTAPKGDKALEIIRNSSSR"
     gene            complement(<1436421..>1437935)
                     /locus_tag="TRUGW13939_09046"
                     /db_xref="GeneID:55996530"
     mRNA            complement(join(<1436421..1437036,1437099..1437223,
                     1437285..1437568,1437626..>1437935))
                     /locus_tag="TRUGW13939_09046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492171.1"
                     /db_xref="GeneID:55996530"
     CDS             complement(join(1436421..1437036,1437099..1437223,
                     1437285..1437568,1437626..1437935))
                     /locus_tag="TRUGW13939_09046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348064.1"
                     /db_xref="GeneID:55996530"
                     /translation="MDSHFTFLTSTNPALGEADIKQMRAHVTRKNFEKRRERLEGTIS
                     RSNKARRTRHRQPEQPSDKLRLARKDKSPSPDGSEKQFRVTVSPYTLISTEANYASIY
                     QFYRSFRPLLLTLAADQATLIREWSWMQLNYAEPALLEASLALVAFHDSLTGSGSVGD
                     VEMHQVKAVKIINSRLNNPATAVTDGVLAAVLTLAHCERLAKREIGYETHMIGFRHML
                     QVRKQQHNNFDGISWFSHLILSDTTEDIAILPKPSMNISHLFLPKTVPETIDSISQDL
                     SSLRTAIEYSMRYDTAEEFVAREIDQRILEILNNADILRSYPAYISSLGLCIRIFLHL
                     SSDRFPISAADLSVLTSELKAILGESDTRLCTSFELTAWQILTASVATTADSPAGRWF
                     RITLWKVSRAFVLSDWSRVLAYLDKAFIPHTRLLAEFKAVWTEVMENPVFHI"
     gene            <1438358..>1439296
                     /locus_tag="TRUGW13939_09047"
                     /db_xref="GeneID:55996531"
     mRNA            join(<1438358..1438406,1438477..1438710,1438764..>1439296)
                     /locus_tag="TRUGW13939_09047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492172.1"
                     /db_xref="GeneID:55996531"
     CDS             join(1438358..1438406,1438477..1438710,1438764..1439296)
                     /locus_tag="TRUGW13939_09047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348065.1"
                     /db_xref="GeneID:55996531"
                     /translation="MHPFASNLSGNHALVTGGSKGIGRLIVQALLAEGVNVSYCARSP
                     RGDEFSAFNGATDGARAVASAVDIANPSDIKNWVEKSAREFGKIDCVVANASPLFHDV
                     TPEHWEKSFRADIMGLVTLLDATEPHLKERAEAGGSPSVVVITSIAGYELILPMIGSP
                     YTSFTRTKAVIAKDYARKFAPMGIRINTLPLGMVNTPNITHPDGSVEWSSFQTFKKDN
                     SEWMKEAEAKIPLKRVAEADEVANVVVFLASRLSSYICGATIPVDGSISAALL"
     gene            complement(<1439394..>1440438)
                     /locus_tag="TRUGW13939_09048"
                     /db_xref="GeneID:55996532"
     mRNA            complement(join(<1439394..1440331,1440384..>1440438))
                     /locus_tag="TRUGW13939_09048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492173.1"
                     /db_xref="GeneID:55996532"
     CDS             complement(join(1439394..1440331,1440384..1440438))
                     /locus_tag="TRUGW13939_09048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348066.1"
                     /db_xref="GeneID:55996532"
                     /translation="MSATILNKKVGSIGFGLMGLTTRPKQISYDDAVKVMKRSLELGA
                     NFWNAGEFYGPPDANSLQLLEYYFRKYPEDSKKVVLSVKGCFSLTRGPDNSPEGVRKS
                     VENCLEKLQGRVPISIFEPARIDPQVPIEETIKALAEYVKEGKIGGIGLSECSVATIR
                     GAHAVHPISVVEIEMSLFTPDALENGVATTCAELDIPIVAYSPLGWGFLTGQFKSLSD
                     IDEKDFRRAQPRFQPGAFEENLRIAEEVQKISTSKGVTPAQTAIAWVKAQGQKSNMPQ
                     VVPIPGCTTVARVEENLKDVTLSEHELEDLNGLLQRNTVQGDRYGGMMAGLMNG"
     gene            complement(<1440903..>1442402)
                     /locus_tag="TRUGW13939_09049"
                     /db_xref="GeneID:55996533"
     mRNA            complement(<1440903..>1442402)
                     /locus_tag="TRUGW13939_09049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492174.1"
                     /db_xref="GeneID:55996533"
     CDS             complement(1440903..1442402)
                     /locus_tag="TRUGW13939_09049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348067.1"
                     /db_xref="GeneID:55996533"
                     /translation="MTQQFQTETERHAFWSFANFAPSLANFSSAEIWNTYALQISYAE
                     PAIQHIILSIGHLLNIPTADPWSGSNAAPDEQQHIVFYHYGKALHSLINNPNPDVNVV
                     LLSCLIFCLFEELQGNCYAALQHVIAGRDILLRHIRSLKPSAARSNNLGSIKPSSTWD
                     PLLAQLLQLFSYLEMHTPVLEGRSIDSHVRLPLPGFSKPDVTSRQTARQLSWRPHAPS
                     LGSNNESTPSTYILNEAPLEFGSITDASQCLAGLAAACSADMRRDLLSESIPRWRSNF
                     VVPSPETILLNHWLERFNRFMTKFSADDITQGVLIDCHILRTYHGCLTLINRAKHIGQ
                     EIVLDDNLVFFDLTMFRITVLISVAKDELISPLFFVATRCRVTHTRLRAVGFLRQCGH
                     EGQFLADVAERIIENEESNGMKDGEQQATPTGFPIPEESRLRLHGINPPIGDDDVSYL
                     MVSRFPYYPRVPTTPLPVHLSSVRENHFSNKARSCLDRALRFEMYSSVP"
     gene            <1443616..>1445154
                     /locus_tag="TRUGW13939_09050"
                     /db_xref="GeneID:55996534"
     mRNA            join(<1443616..1444030,1444095..1444400,1444457..>1445154)
                     /locus_tag="TRUGW13939_09050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492175.1"
                     /db_xref="GeneID:55996534"
     CDS             join(1443616..1444030,1444095..1444400,1444457..1445154)
                     /locus_tag="TRUGW13939_09050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348068.1"
                     /db_xref="GeneID:55996534"
                     /translation="MAPPDPAMASPTGFATSLRLQPQFTPSPDLDAESQVPRWMDMAA
                     TTPDTDAIAQISSGAGSTGKGILIGILSAFGSAGIAILVLAIFLFFKYTRRGRILLDR
                     IGRPGEFDDEQAFVREEAEALETMDDLTRAEYLRAKAFVQANPPETMHTDISLSQFLA
                     IQEKGVSAWEFEPELEIANCFVEGRTEIEFFDSECSVQTNLPVPKQNDVYYWEAKIYD
                     KPDSTLLSIGMTTKPYPLFRLPGFHKMSVAYQSTGQRRFNQPFKAPPYAPEYTQGDVI
                     GVGYRPRSGTLFFTRNGKKLDDVVHGLKAPNFFPTVGSNGPCTVHVNFGQMGFVFIEA
                     NVKKWGLAPMTGSLAPPPPYGSEQGSILLESGRETAAPRGYLDAGYHGSRLIAPTSPG
                     PIRSPTDISLAQLAHIPSHEDIGVGSSRLAVASPPPEYSSPNLSRRNSSDSDEDRSSL
                     YPPGYTAVVTDEEDSRDYEPQR"
     gene            <1446559..>1448197
                     /locus_tag="TRUGW13939_09051"
                     /db_xref="GeneID:55996535"
     mRNA            join(<1446559..1446591,1446639..1447324,1447381..>1448197)
                     /locus_tag="TRUGW13939_09051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492176.1"
                     /db_xref="GeneID:55996535"
     CDS             join(1446559..1446591,1446639..1447324,1447381..1448197)
                     /locus_tag="TRUGW13939_09051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348069.1"
                     /db_xref="GeneID:55996535"
                     /translation="MDQAAFQVIVLGPTGGPKEDAVTGLLVRSTSTEWSKSSVVAVDA
                     GTLLAGIIRTLSEHISIDNNGKAVVKDGPFVGMKLRHITAQANAAYIFREVIASVLIT
                     HPHLDHLSGLAINTPLVEASNGPKTVAALPSAISAMKNHMFNDVIWPNLSDEDGGAGL
                     ITYQRLVEGGNPRFGRGESRGYVRACDGLVTKCLSVSHGRCRQQFNAETGRHHRVGSS
                     VFAADSVVMPARTLSLDHGDGSFYSPARSPHLGASVTASPAKDNNWAVVESSAFFIRD
                     DVTGSEIIIFGDIEPDSVSLEPRNKRVWEIAGPKIAAGTLRAIFIECSYNDSVDDETL
                     YGHLCPRHLIAELKVLATKVDEAQSPHTRGRSSKRKRKDSVPSHDQVSPRSVRPLAHL
                     AKSNTMSSPRGAPANSSDANVGDSSDKIADGYTKNISEPGNIDVLPAAGSKSNNTDAA
                     VSDSEQLPLAGFTVYIIHIKDTLTDGPHPSERILQELRQQSEEAKLGCKFFVPKQGEG
                     IWI"
     gene            complement(<1448475..>1449470)
                     /locus_tag="TRUGW13939_09052"
                     /db_xref="GeneID:55996536"
     mRNA            complement(<1448475..>1449470)
                     /locus_tag="TRUGW13939_09052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492177.1"
                     /db_xref="GeneID:55996536"
     CDS             complement(1448475..1449470)
                     /locus_tag="TRUGW13939_09052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348070.1"
                     /db_xref="GeneID:55996536"
                     /translation="MAGEPDSSGDTESRPGQSLEATRAERRRRQNRLNQQAWSESHAI
                     LSPDLCEARHFANPVWYWTIGQRQRCRREAERQQDQADMGMALPPDPVQHSTPALSTL
                     LELIRDAREPEELQKARSCRLTDQNLYQLLAVFESAAYRSYREDPRVDHRLTLGKLNV
                     FRAFVRNIAALGYTREWMTDDALSYFSIDGPHHPPGALVTSWASLPASLRPTKLQQSQ
                     PHHPWLDFFPFAQLRDNLIHNEDTMDDSSFCRDLMGFWNMPEEDNCILVWGNPWDPMC
                     WEITETFLRKWGWLIKGCPEIIWSTNYWRQIRGLKRLNWRSSFDRLIEGGIATSQ"
     gene            complement(<1449953..>1451146)
                     /locus_tag="TRUGW13939_09053"
                     /db_xref="GeneID:55996537"
     mRNA            complement(join(<1449953..1450719,1450777..>1451146))
                     /locus_tag="TRUGW13939_09053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492178.1"
                     /db_xref="GeneID:55996537"
     CDS             complement(join(1449953..1450719,1450777..1451146))
                     /locus_tag="TRUGW13939_09053"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348071.1"
                     /db_xref="GeneID:55996537"
                     /translation="MPLKTTLAATMRAVAWFGQPYNVSVIDMPVPSIVNQTDAIVRIT
                     ASAICGSDLHFYHGFMGSPDVPWGLGHEAVGYVSEVGSAISGLRVGDYVIIPDNGHDG
                     HYGQQHPISFGTGRPGYGGLQAEYARVPFADETLIPIPFNNHTDNATKELDYLMIADI
                     FTTGWQALTYSGFQPGDSVAVFGAGPMGLLAAYSALLRGARRVYSVDKVLDRLALAAS
                     IGAVPIQFNSSEPVQQILDLEPNGVTRALDCVGFESVNATGQRDVGLVPRNLVAVTAD
                     QGGIAIAGVYTGGQNSTRGAPFADTIPAEVPLSISSLWSKALTVGSGIVLPLEHAQPL
                     VDLVASSKATPSFVVSSAISIEQVPEYYRRFSDHLEHKVVIRFP"
     gene            <1452589..>1453649
                     /locus_tag="TRUGW13939_09054"
                     /db_xref="GeneID:55996538"
     mRNA            join(<1452589..1452628,1452700..>1453649)
                     /locus_tag="TRUGW13939_09054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492179.1"
                     /db_xref="GeneID:55996538"
     CDS             join(1452589..1452628,1452700..1453649)
                     /locus_tag="TRUGW13939_09054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348072.1"
                     /db_xref="GeneID:55996538"
                     /translation="MKVIFGAMNIGEPGDDRTRVHSVDEAQHMVDTLLEYGHKDIDTA
                     RVYGDGSSEQYLGKMHLTGVTLDTKLFPSAANLKVANAAHAYRHTANDLRRGLMDSLE
                     ALQVSKVHIWYLHSPDRTVSLEETLQEVNKLHEEGYFEKLGISNYQSWEVAKVCAICD
                     KNGWIKPSVCQGIYNAFHRAVEPELLRCLRNHGISFYCFNPLAAGMLTGRYSHNDNDS
                     TAGGRFDSSTAPGRLGRIRYYHDLYFDALDCMRPVAKNHGLSEIECALRWLKHHSQLK
                     EELGDGIVIGSSNIQQLKENLDALQGGPLPKDVVDALNEGWKIIRGKELIYWH"
     gene            complement(<1455642..>1456676)
                     /locus_tag="TRUGW13939_09055"
                     /db_xref="GeneID:55996539"
     mRNA            complement(<1455642..>1456676)
                     /locus_tag="TRUGW13939_09055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492180.1"
                     /db_xref="GeneID:55996539"
     CDS             complement(1455642..1456676)
                     /locus_tag="TRUGW13939_09055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348073.1"
                     /db_xref="GeneID:55996539"
                     /translation="MKYVQLGSSGLRVSPIAVGCMSYGNPQGRYPWAILEEDALPILD
                     HCYQSGLNFFDTANAYSNGESEEILGKAIKKYKWRRENIVIATKVWAAVGRGLEQPLA
                     MSDDEKEQNGYVNQFGLSRKHIFESIDASLERLGLPYVDLLQIHRFDPRTPVKETMEA
                     LHDVVKSGKVRYIGASSMRTHQLLEYQYTARMNGWTEFISMQNLHNAVYREEEREMYP
                     ACQKFGIAGIPWSPVSMGFLTRPWKSFTNTTRGNAQGLSFQGHPYTEVDKNINERIEE
                     IAKKHGVSMAIVAIAWSLSKPFITAPILGMSKKERVDEAIKAIEFELTAEEVKSIDDL
                     YVPKQVIGHF"
     gene            complement(<1457211..>1460722)
                     /locus_tag="TRUGW13939_09056"
                     /db_xref="GeneID:55996540"
     mRNA            complement(join(<1457211..1458584,1458649..1458716,
                     1459080..1459756,1459809..>1460722))
                     /locus_tag="TRUGW13939_09056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492181.1"
                     /db_xref="GeneID:55996540"
     CDS             complement(join(1457211..1458584,1458649..1458716,
                     1459080..1459756,1459809..1460722))
                     /locus_tag="TRUGW13939_09056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348074.1"
                     /db_xref="GeneID:55996540"
                     /translation="MMSDFDQATQACLPCRQKKRRCDKALPSCTLCSRLSRECTYPEG
                     ASSPTAENVLFLRQRIQELEDQLAIASSTNTNSNTNNTDSIWTTPPGSSRTNSSISLT
                     ESAVHNHAPFISLFFLDGEAFGHVRPSLPKPSLPIPVDVGLILGGAAGVQNLLDVFFS
                     TAHVWFPFISKARLCKQPLDPANLPADFVVLFLSMRMFCQSPRGNDSITIGGMSLYSF
                     VKQLLAAVQGSDLLTLNLMQTAILIALYEISHAIYPAAYLSTGHCARLGYSLGLHSQQ
                     APQVLPKPATWGGNEEIKRAWYAVMILDRYVNIGNEKHPLASGDFDSNGTLPADDHAW
                     NHGEVEATQPIFITSSAPVKAGGYARSCQAGHLLGRVLEHRDDDAMQGSFRFTSAMQI
                     HSTLDALVSSITREAETTPEQLGTAFGLLASARFTLYDPYSCTASNHGRATVEEMQMQ
                     TISLDGLKATASDVLQYLQDLHELVKFDLTLASPLLCDCIYQASATFLWLEQENGDPQ
                     MTIALTILTDILRDWSTRWELAEAFVSDHLGGSIGEINLVTLVASASALLWAALQSRL
                     SFFTPSSPAALFTDFLLNACAILFATTLYSASPLLLNILLVSPAVLLALTSKSRAPQK
                     ARPPRHDEKKTENDLDPFPVHPFLTTYRAAMMVATCSAILAVDFPIFPRRFAKVENWG
                     TSLMDLGVGSFVFSAGLVSARSVLKSSGKSSTLIHRLAASIRHSIPLLVLGFVRLYTV
                     KGLDYAEHVTEYGVHWNFFFTLALLPPFVEVFHSLYKVVGSYELLALLAITIYQVALE
                     STDLKAYILVSPRGPDLLSKNREGIFSFIGYLAIFLAGRGTGLRVIPRGTSATVSPQQ
                     ARRGVLRSLAIGAVGWSVLFIFNSTAAFGYGAKINVSRRLANMPYVFWIAAFNNAQIF
                     LFCTTETLFFPGVHKATDKATEAERTKFATSRVMTAFNKNGLPIFLVANLLTGAVNLT
                     FNTLDANTWQAMAILTGYVAAVTGVALTLGAFNLRLRL"
     gene            <1464562..>1465622
                     /locus_tag="TRUGW13939_09057"
                     /db_xref="GeneID:55996541"
     mRNA            join(<1464562..1464877,1465048..>1465622)
                     /locus_tag="TRUGW13939_09057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492182.1"
                     /db_xref="GeneID:55996541"
     CDS             join(1464562..1464877,1465048..1465622)
                     /locus_tag="TRUGW13939_09057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348075.1"
                     /db_xref="GeneID:55996541"
                     /translation="MAEKAPSPSNRRRESASSSAGKKRESRAGTRKVTSLTAEQLERK
                     RANDREAQRTIRARTKEHIESLEHQVAELSAKGDQVDRVLQRNAALEAEIAHLRQQLA
                     IMTADDERRSSTSSNPASVISSPFNSPPVTDSLSSASSIPPVPNHRMSMSHGTWHSYA
                     PATGPDQQPGGQIYAMADPIAAAAAAAAAAAAGSTMHRHQPHAHAHGLAYTIPHSAAA
                     QYPTADAYHHNQMYSPRAAHPQQSQQPPPQQQQHQAHVAGMGYDSGFHLPQNPNQSAH
                     AYPHPPPPSSQIQFQWDSRG"
     gene            complement(<1466079..>1467510)
                     /locus_tag="TRUGW13939_09058"
                     /db_xref="GeneID:55996542"
     mRNA            complement(join(<1466079..1466445,1466501..1467349,
                     1467413..>1467510))
                     /locus_tag="TRUGW13939_09058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492183.1"
                     /db_xref="GeneID:55996542"
     CDS             complement(join(1466079..1466445,1466501..1467349,
                     1467413..1467510))
                     /locus_tag="TRUGW13939_09058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348076.1"
                     /db_xref="GeneID:55996542"
                     /translation="MATLSRTLRPLCRTATSRLASTRTTASAQTLRSARAFSTTPRRK
                     DVDLTDVTPTPITHMSETETMMAEAVSKFAQEQIGPKVRDMDEAETMDATVVEQLFEQ
                     GLMGIEIPEEYGGSGMNFTSAIIAIEELARVDPSVSVLVDVHNTLVNTAVMKHGTADI
                     HRKWLPQLASGTVGSFCLSEPASGSDAFAMQTKAEKTAGGYKINGSKMWITNSMEAGF
                     FIVFANLDPSKGYKGITAFIVEKDTPGFGIAKKEKKLGIRASSTCVLNFDDVEIPKAN
                     LLGEEGKGYKIAISILNEGRIGIAAQMTGLALGAWENAAGYVWNDRKQFGQLIGTFQG
                     MQHQLAQSYTEIAAARALVYNAARKKEAGQDFVMDAAMAKLYASQVAGRVAGSAVEWM
                     GGMGFVREGIAEKMFRDSKIGAIYEGTSNIQLQTIAKQLQGQYTR"
     gene            <1468850..>1470166
                     /locus_tag="TRUGW13939_09059"
                     /db_xref="GeneID:55996543"
     mRNA            <1468850..>1470166
                     /locus_tag="TRUGW13939_09059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492184.1"
                     /db_xref="GeneID:55996543"
     CDS             1468850..1470166
                     /locus_tag="TRUGW13939_09059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348077.1"
                     /db_xref="GeneID:55996543"
                     /translation="MPCLQAAPHQGEEAIRGGYNKILMVEKTQCDERKPICTNCSKKS
                     IECSFIRLVPAPVLKKLQFQRSQPEGLSIQKQPTDLRLALFCRPHSLDFDLFNHYITH
                     TSVLISSRQHGVEIYTSVIPRMALSNPSLGHAVLATAYGHLARTMPHTEMAAKYITES
                     AFHMNTTLGCYSQAIHKLSKENTPIVFANSVLISLYVFLSAGIEYEEILSGLNPLNRD
                     PKLLNQLLCIAVRMIHGTRGVFSVFWKTQEWIATSYLSPVIKRHNPIRDTAPHLFWAQ
                     IEDRQLAGLESLWESDTSVSDQRSYVLSQALQSLRDTFFLSTRLYAMPPGTNQQCSSI
                     EPISLKEIHRLLRDAQLDDLPSVFTWYIKASAPYISILQQGDPFAVVIWAHHAILLDR
                     ACGRNWWFCDLASKFISAADLMLGEERRGWLEWPLSIVGTGSRLAV"
     gene            <1470848..>1472479
                     /locus_tag="TRUGW13939_09060"
                     /db_xref="GeneID:55996544"
     mRNA            join(<1470848..1471478,1471539..>1472479)
                     /locus_tag="TRUGW13939_09060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492185.1"
                     /db_xref="GeneID:55996544"
     CDS             join(1470848..1471478,1471539..1472479)
                     /locus_tag="TRUGW13939_09060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348078.1"
                     /db_xref="GeneID:55996544"
                     /translation="MSSIQQDPRILYSINNIRAFHIQNGEESELTSSGPQTLSLLMVP
                     TASPPHGEESDSSGSSTPEEDFYLHLHLPPELDMALPATTQIYHQPPASYLIPRWDLG
                     PDAGAFIRLQFPGIGSGPGKASQEDVDTFETILAQCTAFLERAALPQNHATYNPADYA
                     PGEGYISSDEKKGSHPGQIVLVDEEDGSVVGELGEGYQVEEKPGVQPGSKNPVEIQLP
                     QDGEGNKISITNVSEEYLRMARHPAYKNSTIVQTSATASRLIVTGSSYLANALNSGAD
                     SFTQRTKPNPKPVVFTPTAHARIRKVHNLSQSAAGLSSRTAGQIGRVAQNLGATLARR
                     KEAGKKSPHGYDKNGNQLEFKAGVMNKSLIAFSTLMDGIEESARTVLTSGGTAASTVI
                     GHKYGAEAGSVASNLTSGFKNVGLVYIDASGVSRKAVLKSVAKGMVVGRMHNGEQVVV
                     GGGDGGQAPEGSAKAEYSYYGSNNSSSSNVPGPSQRGPREPVNRRPSPSHTPPPAYGA
                     AGTYSLGGAPSGGKS"
     gene            <1474979..>1478298
                     /locus_tag="TRUGW13939_09061"
                     /db_xref="GeneID:55996545"
     mRNA            join(<1474979..1476466,1476517..1476811,1476875..>1478298)
                     /locus_tag="TRUGW13939_09061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492186.1"
                     /db_xref="GeneID:55996545"
     CDS             join(1474979..1476466,1476517..1476811,1476875..1478298)
                     /locus_tag="TRUGW13939_09061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348079.1"
                     /db_xref="GeneID:55996545"
                     /translation="MSSAAMQTAPAHTSAAPTTSYTTSHPQNAYPSRASATHHQQQHS
                     RSSQSVDRSARGSPPSRRSNPQSTTNGVNPNSTLAPQQAPYGSASPTMNASVQQSPNL
                     ANSQSPVSADHSQSRSNVPEGLAIPPRTSSHQRPRNHASSHSRSRGDETSEGRSRRRA
                     QQSSETPSDTNDSRSQRRQKSTDNTGTGSSTEVDALNPILNHVEITDPAEDIEREHER
                     QVDAQNSAAVGSSSTPVFGASGEEGVDENNRGAMKSRHDYSNQSSRRKETTFGKYILG
                     QTLGEGEFGKVKLGWRREGGVQVAIKLIRRESLGANPSRLPKIYREISILRDLSHPNI
                     VRLHEMVETDRYIGIIMEYASGGELFDFILNNRYLKDHAARRLFAQLISGVGYLHKKG
                     IVHRDLKLENLLLDKNRNIIITDFGFANTFNLGDELSDEIEYNLTNREFVKRMRLDKL
                     DANGLRRGDLMQTSCGSPCYAAPELVVSDSLYTGRKVDVWSCGVILYAMLAGYLPFDD
                     DPANPEGDNINLLYKYIVSTPLTFPEYVTPHARDLLRRILVPDPRKRADLFEVARHSW
                     LSEFSHVVSHITSSTTNISDIATTTVPAEGTQEGPTLARSASVREPQKSFQTGTSTLG
                     GLTHQQGKVAQDESAEKTKTSREQKRRTVQVEYVAPQSQTTRGESSSRSAANSAADVS
                     TSTPRAAVPAGPRAPPDQNKPLPSEPRGEASRTDYSSSSQDNRPGVPRSTSETTGAVY
                     NTRPNTGHSMASLSAGRLPSRGSYGQPVAPTVAATNAQGRLAQPKNGKQYNISAPIPQ
                     EADISIGRPSTHQLPSNYSPNPPADIPRGHKRSSTVSSIGEKIFGRSGSLFGNRSSQG
                     PRSKPSKRYPPTSMKEPYAGDDSRASIDSRQSTSRMSRSEGRPRRFSLINSLKGLSSS
                     GRSEQHSETDSQEHNFSRPATGPSGSIGRGNTYEAYVTTRASERPTETDYSAHIDRQF
                     AELQEYQTDAYAEGPNEHANNDFYGYPNHNNGGYDSRSRPSMQISRPKPGVLQKSNRK
                     FADAYEYERDPSHHSGSSGAARKVMDFFRRRGKARAGE"
     gene            complement(<1487386..>1487688)
                     /locus_tag="TRUGW13939_09062"
                     /db_xref="GeneID:55996546"
     mRNA            complement(<1487386..>1487688)
                     /locus_tag="TRUGW13939_09062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492187.1"
                     /db_xref="GeneID:55996546"
     CDS             complement(1487386..1487688)
                     /locus_tag="TRUGW13939_09062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348080.1"
                     /db_xref="GeneID:55996546"
                     /translation="MEGGRREALGRGRLPPCDYRPCFDWHLQYTAYPSHIHAQMACEE
                     LESTRLVKGAGIRQYHSSAPSKVLRTLDRLEQNGTDNSHAASLEIVIRSLELSSIP"
     gene            <1488946..>1489768
                     /locus_tag="TRUGW13939_09063"
                     /db_xref="GeneID:55996547"
     mRNA            join(<1488946..1488966,1489025..1489159,1489223..1489326,
                     1489393..>1489768)
                     /locus_tag="TRUGW13939_09063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492188.1"
                     /db_xref="GeneID:55996547"
     CDS             join(1488946..1488966,1489025..1489159,1489223..1489326,
                     1489393..1489768)
                     /locus_tag="TRUGW13939_09063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348081.1"
                     /db_xref="GeneID:55996547"
                     /translation="MTLYYSLVFLLLVFEMVVFMGLIVPLPYAVKRKLFAFISESPLI
                     AKLQYGLKITFIFILILFIDSVNRVYRVQLEMAAYSKDTTGVGAAALGTERMEVQARK
                     FYSQRNMYLCGFTLFLSLILNRTYIMILDVLRLEDRVKLLEGDKKAGGKDAARVAEAG
                     SVGEIGRLRKELEAKDRDIETLKKQTEGLQREYHNLGDKVSGSDSAPKKDR"
     gene            complement(<1490161..>1494096)
                     /locus_tag="TRUGW13939_09064"
                     /db_xref="GeneID:55996548"
     mRNA            complement(join(<1490161..1491538,1491782..1491844,
                     1491898..1493811,1493879..1494021,1494082..>1494096))
                     /locus_tag="TRUGW13939_09064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492189.1"
                     /db_xref="GeneID:55996548"
     CDS             complement(join(1490161..1491538,1491782..1491844,
                     1491898..1493811,1493879..1494021,1494082..1494096))
                     /locus_tag="TRUGW13939_09064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348082.1"
                     /db_xref="GeneID:55996548"
                     /translation="MEGNPETTNNASDRTPIDGPPAKRAKLDDSANPEANAPAPTERK
                     RGIAPIKAEYIVNHNGDQRDASTSVQDDDTAEGAAHQERGEGKDAKYKRKGKNSGQNT
                     GRKFGRSRDEKGLCSSRANHPEFSPSECNYGAKCKFEHDIRVYLKEHKREDLHTFDDV
                     CPVWQVRGTCPSGWKCRFVSSHMTERDTPDGRRELVLVEDEERKQKPQPSVSVANEDG
                     LVNVVSTEAKDSLKKRNHKTPRADEYASWIELNTKELDKHLHGGNKHDNQDAANNEQS
                     TNPEEAQEENRAQYTEPPFLPSEKRRIYFGPETPALAPLTTQGNLPFRRLCTDLGAQF
                     TYSEMAMSMPLLQGQKGEWALMRAHQSEMAPPTLSSKANVVQGYDHSRDFKFGAQIAV
                     NKPQYAVKTAEVLTALAPSLRVIDLNCGCPIDLVYREGSGSALLDSPGKLEKILRGMN
                     AVSGEIPITVKIRMGTKDNQPTALKLVERLTLGGSDAQTTGIGPPGIAAITLHGRSRQ
                     QRYSRSADWGYISECAALVKRLREQSDELADTVREPDERQQPNGGKVYFLGNGDCFSH
                     EDYNDHVQNANVDTVMVARGALIKPWVFEEIQAGQYLDKTASERLSLVEKFARYGMDT
                     WGSDEHGLGTTRRFLLEWLSFAYRYVPVGILDYLPPRIQDRPPAFRGRTELETLLASD
                     NYKDWIKITEMFLGPAHPDFRFAPKHKSNAHQNTHVMSIDLNWEAATSGPDGEELAER
                     IRSFIHDKFQQVPLPRFIRSVQVHSFEFGDIAPELEIKDLCDPFPDFYEEDDDDGSTT
                     TSDTSSSDAANRRSMTSHAGTSTEGFDGYTGPSEFTARSSTLDLRHQASLRSPIGLGD
                     HLNSQFRSGSPSILPGGTSNLGYHLMLGNLSGAQTPLAAVASGSPFHPGWPDAMGDTR
                     SMADSTAYGGGRGGAGVRRNSEIEVDNHSPSRPSTANTNPTHFSQGPSIEGNSSTVTS
                     NDPTVIYNDHASSSTAHTTTHATRDDHPPSIMDEPHEPPQHIRERRPEDFQVICRVKY
                     AGDVKLSLTAEILLDYPMPSFAGLPLKLNITGVTFDGIAVVAYIRRRAHLCFLSPEDA
                     DAFDEEEQPRPAASDDGESQIPTRRRFGSLLQQIRVDSEIGRNESGKQVLKNVGKVER
                     FVLDQVRRIFEDEFVFPSFWTFLV"
     gene            <1497173..>1499364
                     /locus_tag="TRUGW13939_09065"
                     /db_xref="GeneID:55996549"
     mRNA            join(<1497173..1497813,1497927..1499001,1499056..>1499364)
                     /locus_tag="TRUGW13939_09065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492190.1"
                     /db_xref="GeneID:55996549"
     CDS             join(1497173..1497813,1497927..1499001,1499056..1499364)
                     /locus_tag="TRUGW13939_09065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348083.1"
                     /db_xref="GeneID:55996549"
                     /translation="MSDDSETTPPSLHYSPSISDLDHASSTGASTPSSIPVGFGTTSS
                     FSRKPLSRGKDPISWARKPADRALYLGSTTLVETDDDTIQPFPLFLSSPADAYTMSGQ
                     SMPFDIAARQTSVSPPGQQASNLTSALQKAASNDRQGSFSNPAATSASAVYKAAAARK
                     DSMGASMAQWGNGTKPISVMGSNREKPRRESLAGSLVGGMSWGGVSVGSWIRDDIIMT
                     GTSPFTFQSPSFHSSSYLPKLEANFMRDFSCCGITLPTLHDLLQHYEEAHAQKSPQHS
                     QRPSQGDNRSAMAAAAAAVAQSQGHGQDRGMPSGSSANGQPKFNPNQTIDTSNFAPSQ
                     QHLDLDTIDDMDMDDAMGVGDSSSQMFSQIPTTQSGFGSPNQRVPQLNLNLSMLQGQG
                     LRGSQPGTPVAPGHTVLQNNPTVSSVNTPTLSSNPLQNAQFRNTPDSSGPGTPAELDE
                     SVIGGFNDLNMQAGGLAANGQFGFGGANDMVDLCIDEPAKRLFSPGGGFGSGGSHAHM
                     KLGNSQYGPNSDIARRIREQQMLAGVPDTSLGMLPNEEPKPFRCPVIGCEKAYKNQNG
                     LKYHKAHGHNNQQLHENGDGTFSIVNPETSAPYPGTLGMEKEKPYRCEVCGKRYKNLN
                     GLKYHKSHSPPCNPDLQLGGRNLNLGGVMQGQNINVAGAGLPGIGEEGLL"
     gene            <1500483..>1505868
                     /locus_tag="TRUGW13939_09066"
                     /db_xref="GeneID:55996550"
     mRNA            join(<1500483..1502264,1502332..1503041,1503841..1503985,
                     1504043..1505620,1505680..>1505868)
                     /locus_tag="TRUGW13939_09066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492191.1"
                     /db_xref="GeneID:55996550"
     CDS             join(1500483..1502264,1502332..1503041,1503841..1503985,
                     1504043..1505620,1505680..1505868)
                     /locus_tag="TRUGW13939_09066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348084.1"
                     /db_xref="GeneID:55996550"
                     /translation="MAPSRRKPDDDFVLTLSDDEAGPIEDTEEVADTSSKSQSSKKRK
                     REVNNEAPAKQKKQKKSKKNGAGKDNAGDSLNSHEDEEGGDEDEQGALDDSKDDGALD
                     PAFEFDIGGNAARDTVEDFDGWEIDDKKRHANGNKKAVDIDDIIARRKLKKVDDDERK
                     NKKAAKKKDDFEVFDSDDAEEEEEEEEEEEEEDENELEMSEMPNFDDDELLAADGFGM
                     GVNSEDEDDKEDKAAAKKDNDGSEDEKDGADEDDEGSDSEGSVASPVAHPDDIASDQE
                     SESEIENEEELEKRKAFFAPEDASTAKDTEDSASGSFQNYNLSRPILRGLAAVGFTNP
                     TPIQRKAIPVALMGKDVVGGAVTGSGKTGAFLIPILERLLYRPRKVPTSRVAILMPTR
                     ELAVQCYNVATKLATYTDITFCQLIGGFSLREQENILKKRPDIIIATPGRFIDHMRNS
                     ASFTVDTLEILVLDEADRMLEDGFADELNEILTTIPKSRQTMLFSATMTDSVDKLIRV
                     GLNRPVRLMVDAKKQTVGTLVQEFVRLRPGREDKRLASLVHLCQQIYMSRVIIFFRQK
                     KEAHRVRVIFGLFGLKAAELHGSMSQEQRIKSVEDFRDGRVAFLLATDVASRGLDIKG
                     VETVINYEAPQTHEIYLHRVGRTARAGRSGRACTLAADPDRKVVRAAVKAGKSQGAKI
                     ISRVIESNIVDELGDQIEGFADEVEEVLREEKEEKQLAQVEMQTTKGENMLRHGAEIM
                     ARPKRTWFETEQQKQDARKRGLVELNGSDAAKKEKRKLSGKEKKRLDDTRDRKEGRGW
                     KKGKKEREERNGRSKAGPKKAHAKGKGKPKSRKLKDPSKKYKRFQPLHLPDRQWPNKT
                     IDKPPRWLATDLRDGNQSLVDPMDGEQKFKYFNMLVELGYKEIEVSFPSASQTDFDFT
                     RRLVETPGVVPDDVWLQVLSPCREDLIRRTVDSLKGSKKAILHLYLATSDCFRRIVFG
                     MTKEQSLALAVKCTKYARSITKDDPSTAGTEWQYEFSPETFSDTDPDYVVQVCEAVKA
                     AWEPTEEHPMIFNLPATVEMSTPNVYADQIEFFCRNMTEREKFAVSLHPHNDRGCAVA
                     AAELAQMAGADRVEGTLFGNGERTGNVDLVTLALNLYTQGIHPNIDFSDLNSVIKVVE
                     ESNKIPVNERWPYGGQLVVCAFSGSHQDAIKKGFVAREAGGSQDDERWQIPYLPLDPQ
                     DIGRTYEAVIRVNSQSGKGGAAWIILKSLELDLPRGLQVEFSRIVQKETETLSRELRP
                     SEIVTLFENAYHLKTNPRFTLIDYNITTDRSNSPVPAEPGKAPDTRNLKRRFTGIVEI
                     DRIQHPITGVGPGAISSLAQALSSLGIDLDVQDYKEHSVGVGRDVRAATYIQCTAAGS
                     REVVWGVGIHQDVVQASLIALLSAASSFLTSRAGSPAPFRPVRSNTLTDEDIQAIEQL
                     SASAIEKGTAAQGVNQQKVDVEKLEKRVEAL"
     gene            complement(<1506567..>1512445)
                     /locus_tag="TRUGW13939_09067"
                     /db_xref="GeneID:55996551"
     mRNA            complement(join(<1506567..1507521,1507582..1508185,
                     1508236..1508445,1508504..1511987,1512044..1512206,
                     1512296..1512318,1512386..>1512445))
                     /locus_tag="TRUGW13939_09067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492192.1"
                     /db_xref="GeneID:55996551"
     CDS             complement(join(1506567..1507521,1507582..1508185,
                     1508236..1508445,1508504..1511987,1512044..1512206,
                     1512296..1512318,1512386..1512445))
                     /locus_tag="TRUGW13939_09067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348085.1"
                     /db_xref="GeneID:55996551"
                     /translation="MADRNPELQHALHNLDRELEDGDITRKGYQKRRTVLFSQYLGSD
                     YDALQGPTVNIHGPLADASSEIYPSMGSDGGSSGMPRQDSPALQLPDRAASRASVDSL
                     FLPKQPQQPPVGVTLEDSRSATMASQNYAFNPHTQYEQRPPSIYEQGYYEPDGVTRQS
                     TLVDSQAYFSDFAGHQNDDYRDSYGGGFHRYSQSDAFSPTANIAPPLMPATEISHGNM
                     LTHLIPLEPRDVPFAVHDPHDPSTLMSKFDNLPAVLRHRAKIHAKQPAYWVMDQKGKE
                     IASITWDKLASRAEKVAQIIRDKSSLYRGDRVALIYRDTEIIEFAVSLMGCFIAGVVA
                     VPINNIEDYTSLNVILTSTQAHLALTTENNLKNFQRDISTQKLQWPRGVEWWKTNEFG
                     SYHPKKKDDFPPLVVPDLAYIEFSRAPTGDLRGVVMSHRTIMHQMACLSAIVSTVPND
                     AKNAAQQQARLLAHGETMFSYLDPRQGIGMILGVLLTVYGGHTTVWLEAQAVETPGLY
                     AHLITKYRATIMAADYPGLKRVAYNYQQDPLTTRHFKKNAEPNFSTVKLCLIDTLTVD
                     SEFHEILADRWLRPMRNPRAREIVAPMLCLPEHGGMVISVRDWLGGEERMGCPLTHAF
                     EPEKPKEDEAAKKKNDNDGFGSSLIGGTPVTAPKEITKTELAEVLLDKEALKSNEVVV
                     LAMGEEARKLAETRPNSVRIGAFGYPIPDATLAVVDPETNLLCSPNIIGEIWVDSPSL
                     SGGFWALPKHTETIFHARPYKFEPGNPTPVLVEPEFLRTGLLGCVIEGKIFVLGLYED
                     RLRQKVEWVEHGQELLEHRYFFVQHLIISIMRNVPKVNDCSAFDVFVNEEHLPIVVLE
                     SYTASTAPVTSGGPPRQLDTALLESLAERCMDVLYHEHHLRVYCVMITAPNTLPRVTK
                     NGRQEIGNMLCRREFDNGTLPCVHVKFGAERAVMNLPLGVDPVGGMWSPTSSASRQEI
                     LALEEKQYSGADYRDVVMDDRTSTPLNNFTNIVDLLQWRITRQAEELSYCSIDGRGKE
                     SKGITWKKFDTKVAAVAAYLKNKVKVRPGDHLVLMYTHSEEYVYAVHACLCLGAVAVP
                     MAPIDQNRLSEDAPAFLHIVSDFRIKAIIVNSDVDHLMKQKVVSQHIKQSAQVLRIGV
                     PAIYNTAKPPKQSHSCRDLGFTMNKAWLLPSHPAVIWTYWTADQRRISVQLNHDTLMA
                     MCKVQKETCQMTSTRPVLGSVRSTIGLGFVHTCLIGCFVGAPTYLVSPVDFAQNPMSL
                     FVALSRYKIKDTYATGQMLEYAMSSIAGKGFSLQELKNLMISTDNRPKVDMYQKLRLH
                     FAATALDRTSINTIYSHVLNPMVTSRSYMCIEPIEVWLDLRALRQGLVYPVDPDIDPT
                     ALRLQDSGMVPVNTQIAIVNPETCTLCHVGEYGEIWVQSDACAKSFYGSKQEFDTERF
                     NGRLFDGDPSVQYVRTGDIGFLHTVTRPIGHGGQPVEMQVLFVLGGIGETFEINGLNH
                     FPVDIETSVEKCHRSIVPGGCAVFQAGGLVVILVEVTRKSYLASLVPVIVNAVLNDHQ
                     IVTDIVAFVSHGDFPRSRLGEKQRGKILGSWVTRKMRTIAQFSIRDADGGTDPQLAEH
                     ARMSRVSKAGSIMGSSLRHSTLVPDSDSSTRTPALHEGRELVDDPYEDEEEKHYQELL
                     NNAALEPTNSLSPQQEPGYSRMAEHSRSLPPVNTSNLSIKSDNPTPVLTPDHGFDFGT
                     GFGSQNGSEFHETVVPSVAVAPPSTAGSQESRHSYAPLQVRNTDRESLPSRQSQNSIP
                     TGAGGPQSWFSGHSSRPGSAEDWPEEALLYQSHFDGYASHGHRGGPSR"
     gene            <1513290..>1514315
                     /locus_tag="TRUGW13939_09068"
                     /db_xref="GeneID:55996552"
     mRNA            join(<1513290..1513394,1513458..1513489,1513608..1513706,
                     1513774..1513858,1513945..1514168,1514222..>1514315)
                     /locus_tag="TRUGW13939_09068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492193.1"
                     /db_xref="GeneID:55996552"
     CDS             join(1513290..1513394,1513458..1513489,1513608..1513706,
                     1513774..1513858,1513945..1514168,1514222..1514315)
                     /locus_tag="TRUGW13939_09068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348086.1"
                     /db_xref="GeneID:55996552"
                     /translation="MSDNGEVEVENPGFYPALPKDVQTDSVKLFGKWSYDDVEIRDIS
                     LTDYIQIRSPVYLPHSAGRYAAKRFRKAQCPIIERLTNSIMMNGRNNGKKIKAVRIVA
                     HTFEIIHIMTDQNPIQVAVDAIVNCGPREDSTRIGSAGTVRRQAVDVSPLRRVNQAIA
                     LLTIGAREAAFRNVKSIAEVLAEELINAAKGSSNSYAIKKKDELERVAKSNR"
     gene            <1514863..>1517298
                     /locus_tag="TRUGW13939_09069"
                     /db_xref="GeneID:55996553"
     mRNA            join(<1514863..1514909,1514967..1515002,1515067..1515351,
                     1515417..>1517298)
                     /locus_tag="TRUGW13939_09069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492194.1"
                     /db_xref="GeneID:55996553"
     CDS             join(1514863..1514909,1514967..1515002,1515067..1515351,
                     1515417..1517298)
                     /locus_tag="TRUGW13939_09069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348087.1"
                     /db_xref="GeneID:55996553"
                     /translation="MAKRKLAALEKVEADLPNLQQKIRRDSKSYIEDFRAQYYQYESH
                     REIFMAAPASTETGLISLHDLIDFISHVADCYPDITKDFPQQLMDMIMQHHVDLTPEL
                     REKIVGSLVLLRKKEVIDSVSLLHTLFPILVSTPSKTLREILFQKILSDLRASNAKTT
                     NHKLNRIMQTVLFNLVTSDRESSKGLWAIKITRELWKRQVWTDAKTVEIMKEASLADN
                     EKVATGGVRFFLGGDKEREDMEDESSDDDGIDVAKMKHQVGITKKSKKKSRQIEKAVS
                     TVKKKERKKKQPHPLNFSALHLLHDSQGFAENLFAKHLQSTKSKLNLEQKLLALQLVS
                     RLIGLHKLTLVHFYSYFQKYLTPRQPSVTSFLASLAQATHNLVPPDVLEPLIQKIANE
                     FVSEASAAEVASAGLNAIREICVRQPLAMEETLLQDLVMYKKSKDKGVMMAAKGLLGL
                     YRDVGADMLKRRDRGKDASMALRSGERKDIRFGEEAVGEIEGLELLEQWKEEERKRKR
                     AEQGLPSDAEDEGDLEADEAAGWDNWDVEDDDSDDSGGWINVESDAEIELSDSDDEKP
                     AAKKTKQENGEDAKDTEKDQEEKKKPSNFATTRILTPADLAKLAELRSSAAVNSLLPT
                     SKSKRMQNAQKIAADRHADDPLTAAEIEGLALLSKGRLTREEKIAHAKETKTDRDEFK
                     SKTARKKERKIEDGKSTTNKEKARKKNFLMTLGKARSKNKRSLVETRATLKAHHDRQK
                     RGGRRGNQG"
     gene            <1517764..>1518636
                     /locus_tag="TRUGW13939_09070"
                     /db_xref="GeneID:55996554"
     mRNA            <1517764..>1518636
                     /locus_tag="TRUGW13939_09070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492195.1"
                     /db_xref="GeneID:55996554"
     CDS             1517764..1518636
                     /locus_tag="TRUGW13939_09070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348088.1"
                     /db_xref="GeneID:55996554"
                     /translation="MASTAHDSSKKRRFQPPITNFFTSTLEEESTGLSHNSYAAPTNT
                     PTPALPTNILSSLLGVGARVRKSVPEGYKTEQKKMTQYTIPAPVQSRREETSSSIQSH
                     STQVYAELEPFCGLHKIGNHAVQTFPRPIEEYQNAVHVDELETISIPNSSQDSSGSSS
                     FSTNLNKRSFDADIEEDDDIEFPATVFHSSGDFWQRPLNGNFNSGSAPAVNMRSQRTI
                     LSPKLGQQRRQRTAQNHSWKSNAEQENQDPFLTAENTRLDLDDFDEATFLRRRDEVDA
                     DHLWSGSDVEMDVA"
     gene            <1519397..>1519662
                     /locus_tag="TRUGW13939_09071"
                     /db_xref="GeneID:55996555"
     mRNA            join(<1519397..1519435,1519486..>1519662)
                     /locus_tag="TRUGW13939_09071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492196.1"
                     /db_xref="GeneID:55996555"
     CDS             join(1519397..1519435,1519486..1519662)
                     /locus_tag="TRUGW13939_09071"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348089.1"
                     /db_xref="GeneID:55996555"
                     /translation="MTKSDSSRIQSSQAKTGDDMSSKGFAARALSAGDRWANSNSTAT
                     NPSHSSEASDNRGYIESLHLFLPSIYR"
     gene            complement(<1520061..>1523030)
                     /locus_tag="TRUGW13939_09072"
                     /db_xref="GeneID:55996556"
     mRNA            complement(<1520061..>1523030)
                     /locus_tag="TRUGW13939_09072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492197.1"
                     /db_xref="GeneID:55996556"
     CDS             complement(1520061..1523030)
                     /locus_tag="TRUGW13939_09072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348090.1"
                     /db_xref="GeneID:55996556"
                     /translation="MACTSRRRNMSFVTYSPFFTLVLAPFLLFLLCLPAPASAAGSAV
                     LGIDIGTEYLKAALVKPGIPLEIVLTKDSKRKESAAVAFKPSRENGAPFPERFYGGDA
                     LALAARFPDDVYANLKVLLGISFGDGNEAVQTYSDRYPALQLEQAPGIRDTVGFRSKK
                     IGDGEGTYTFLVEEILSMQLKQLRANAEALAGNGATIQDAVITYPAYYTAEEKRSVKL
                     AAELAGLNVEAMISDGLAVGLNYATSRTFPSVSDGQKPEYHLVYDMGAGSTTGTVLRF
                     QSRNVKDVGRFNKTVQEIHVLGAGWDRTLGGDALNELIVNDMVNKLLENKKLSEGTTA
                     SKIKSHGKTMAKLWKDSERIRQILSANTETGSTFEGLYEEDVVFKYKITRSEFETLAK
                     EHASRVGKPIEDALAAANIKLSDLDSVILHGGAIRTPFVQKELEKECGGSSLLRTSVN
                     ADEAAVFGAAFKGAGLSPSFRVKDIRAVDAATYAVKVKWDSDGKERQQKLFTPTSHIG
                     VEKHLTVKNLDDFEFSFYQQIPFGDDENDAPVLGVATQNLTESVKKLSDEYSCAPANI
                     TTTFSVRLNPASGLPEITSGSVSCEVDASKKGSVVDDVKGFFGLGKKDEQKPLQEEGE
                     SVESVTLQEEPSTPTEASSSTTQTSDASSAQETKPAELKVKIETIPINLKSTLLGRPT
                     LSSEELTRIRDHLAAFDASDRSRALREEALNELEAFIYKGRDLVDDEEFVKTLKGDQL
                     SLLKERVEAASEWLYGDGADASTKEFKEKLGSLNEIVNPALRRKKENSERETKAKILK
                     ELLSGSKSVVDLVELQIKSDEDAFSSLVAESSTSTVESSETSSTTATASATDGGIDLD
                     DDPYSSSTTITATSANAVPTAPTYSMYTPQDLASLKTVLESVNEWFDTQSALQEKLTE
                     SDDPALTVADMDSRLQEVERKLQHIYGKMGAKKSGSDSSGSKKKKGDGKKKNGGKSKS
                     KTEKTSSKAKPTAKDEL"
     gene            complement(<1523572..>1525325)
                     /locus_tag="TRUGW13939_09073"
                     /db_xref="GeneID:55996557"
     mRNA            complement(join(<1523572..1523833,1523897..1524432,
                     1524489..1524927,1524990..1525192,1525254..>1525325))
                     /locus_tag="TRUGW13939_09073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492198.1"
                     /db_xref="GeneID:55996557"
     CDS             complement(join(1523572..1523833,1523897..1524432,
                     1524489..1524927,1524990..1525192,1525254..1525325))
                     /locus_tag="TRUGW13939_09073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348091.1"
                     /db_xref="GeneID:55996557"
                     /translation="MHEIVTLQLGQRSNYIATHFWNLQEAYFTYSDNSEPLINHDVHF
                     RPGIGQDGSETFTPRTVIYDLKGGFGTLRKYNELYEVEEPSGMPQGLWDGNQMVQTQP
                     NIPQSEYQKSLYTGAPPPNLTSQSVRYWSDFNRVYYHPRSIVQLNEYELNSSLMPFEN
                     WSSGEDLFGDLDKEHDLLDRDVRPFVEECDQIRAFQLFTGSDDAWGGFAARYMDRLRD
                     EYGKTSIWVWAIEDGARLQRQKQILRMTNTAKTLSSIAPLSTLYCPIVDLPQNLPSYL
                     AVDLQSEWSKSALIASAIETATLPARLRSYRNFESSLMGHGGGTQTIFELQSSVIRSH
                     ARRPRWATDEDELNGLDEDAKLDFDLNLTIPQPMRDDTTVFTQSQVYRGEREKPADDD
                     NNSPVGEIGLARKMRLYASKPALTRYSTTLRFPLPDSYPQNLFSGYDAETGVEFLTAL
                     SSTSRIGEKLKDLQTVASRVVGVDEREALTNELGELREAYEKSWVSDTDSGDD"
     gene            <1525759..>1527681
                     /locus_tag="TRUGW13939_09074"
                     /db_xref="GeneID:55996558"
     mRNA            <1525759..>1527681
                     /locus_tag="TRUGW13939_09074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492199.1"
                     /db_xref="GeneID:55996558"
     CDS             1525759..1527681
                     /locus_tag="TRUGW13939_09074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348092.1"
                     /db_xref="GeneID:55996558"
                     /translation="MDSSPSLKPHSPTKTPLYPASPDRINQQRLVGSPSLPSDLHPKS
                     SEVQARIAFLNGLARSGSPAPNGQHSSSASATAALQRAILGREEAESALARADAELSE
                     AQSRERRISERLESLLEELQTTRERQAHERTLFEKEVRKARKEAFRAGSTLVKIQEEL
                     KLSKSENRTLKDDVRAEREAKENAKQEAFERAYALAGITEELQSLKDQLRAMEAANQS
                     SLQLEVDPIYENNEKPQVDYADQATCTTPVSRRPKRSADASELLITASQNIHEEETPT
                     KKPRLSRRVSNKENEDPEELQRKTDIIEDLKAEIKFAQRQREKADEMIHFMKMECQFK
                     RCSCRIAESQGYNYVHDKEWHKRSQERSASQPSEEQQIHARDETPARSAHSPFESPAT
                     AMTPPTPEYREPDLAKDMHSTEDPEIAFCPTTGTFVSIPSPHAEMPDRPSEGPLVLPN
                     ADEIASPRFENPAVPTIEHDDLRPDIAHESYEVDPVESEIPLDEPLEYDPVDPIDPIQ
                     NDDDYVTESQPSEKLPQPLPITPTEQSTNMREESITRTIPLQTEPRRSQNLSAVIPGT
                     PVTREEALAQIRARRGRARSIVKRSASTSEATARAQVQGSTKTKRIPGMTHSDTRSEP
                     DVGDRRDYSAPVRRRY"
     gene            complement(<1528105..>1530189)
                     /locus_tag="TRUGW13939_09075"
                     /db_xref="GeneID:55996559"
     mRNA            complement(join(<1528105..1529177,1529232..1529791,
                     1529848..1529917,1529980..1530014,1530074..>1530189))
                     /locus_tag="TRUGW13939_09075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492200.1"
                     /db_xref="GeneID:55996559"
     CDS             complement(join(1528105..1529177,1529232..1529791,
                     1529848..1529917,1529980..1530014,1530074..1530189))
                     /locus_tag="TRUGW13939_09075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348093.1"
                     /db_xref="GeneID:55996559"
                     /translation="MASQQRRRTSLRLDLSQNSLESPPGIAALFLIRFDIKKGYVISW
                     KESLPDLDIESAVEYKSLPSGLHNVQEDLVYFVHDQYAGISAFINQPAAEAERNALML
                     SVGVLVPLSFGRLGKSWRHAIGLKELAKLVKDTLVILNETDKTSRKCADDVTNTQALT
                     EYWEKHHVRDDDAKPSDSPPDSPAVFRMQPKPSRPERSSIGDATGLETTRPVLAPFHP
                     ALSLPEFVGTFGPLIFPLFRASLLRKRILIMSEAPVQPSCDFVYGLSLLSSLPQSLLP
                     LLNPDGTPPLRPRPLFNIGIHDIPFLSDASNASSGWIACTTDNVLAMKPDLFDVLVQL
                     PPSYSKTATPRVYPTISVVQQFAGQSKPAKLVPLRATQRDARRFVILSDGLRRLSSAE
                     SQTLENAHEDLDSASTFSSSPIIEPLSWPRLAYTSFLWWASAGEKRDVLSEDEGEQDE
                     QDTNFLANTHAGQLSHPGLHLDESNQPQEIALIAYFRRLTTLTFTILADAVARQDEAD
                     ESDEIPAEYRDEPPDEAEEDETIDTGPVSSHETDEDPLLPDEAIESEHSRKESHDPGR
                     VLITSPDMTEMGLDVWSGADRIFLEELLQSWWGRTAYVDSTRIRCCGIPIY"
     gene            <1530983..>1531543
                     /locus_tag="TRUGW13939_09076"
                     /db_xref="GeneID:55996560"
     mRNA            join(<1530983..1531093,1531169..1531403,1531461..>1531543)
                     /locus_tag="TRUGW13939_09076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492201.1"
                     /db_xref="GeneID:55996560"
     CDS             join(1530983..1531093,1531169..1531403,1531461..1531543)
                     /locus_tag="TRUGW13939_09076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348094.1"
                     /db_xref="GeneID:55996560"
                     /translation="MGPSQDLLGQLWKEYAKSDSRYLISDPFVVSIEAVTVAVWGPLC
                     LSVAYLTAVQHPLKHPLRIIVCVAHLYGDVLYYATSLFNHYVNGISYSRPEVLYFWVY
                     YFFMNFVWIVVPAGLLYSSVCTVSNALRAAERTGEQKKVK"
     gene            <1532419..>1537698
                     /locus_tag="TRUGW13939_09077"
                     /db_xref="GeneID:55996561"
     mRNA            <1532419..>1537698
                     /locus_tag="TRUGW13939_09077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492202.1"
                     /db_xref="GeneID:55996561"
     CDS             1532419..1537698
                     /locus_tag="TRUGW13939_09077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348095.1"
                     /db_xref="GeneID:55996561"
                     /translation="MPSPATPRRDAVRGSAKSTPTKSKTLDIGKPLGLYDTNSVREKV
                     RVWQQKGGGVVASKDALADDENDVKIHEAEKERGEQDEENKPIRSKLEEPTEPPKTPR
                     PTARKTSKNIKGAENGGIRKRSQSTPRKRVISDQHWRKQRSPPTAGRKAAKEPPKRIT
                     TYKTNEQYTSSTSSLPEKKSARKDHIPDDGIRVYAHGQTPRNKSRTVKTTRYVYKDDD
                     SFLEKESSKDAESVVTSAISKESEENEPTVAGRLRRNTPPPEDDDGWARSEADFSELS
                     RRRRRGVTEPRNLRKTKGGLLNQVLDESRKMFAKPAPPPPPPVNNRGDKIAAWLSGQP
                     DPFVDGGDDRMSVEIPAPLKTRSETTKRSVRSLESSAIEEDSQFSESWHDHRRDSKTS
                     DEKSRRRRRSSGSLTVCEDTETLRKSPLSETSVSETRKGRPVSSHSHSVKNPRTPDPT
                     TPTRTSRLKNVAPSRDSIISDESSEVSASDIILPLRLKRPFPSTGIHRLSTIASEETL
                     STRDDRSFLERESQSSELDSTTTRSLNDEERDYFDPNSLSRAGHGLKRKLTKHDDLMS
                     VLSEPTSRRHSVRSSRSIRSNRTRLGKATMEDLMNELTSDEAKYLRELRTLVGGVIPV
                     LLSCVLSRSDSAIAAGLFRPSADPKDEMTFTRPIVDMGVALERLKTLHKRIPLEDCDA
                     LLNWAQGAQRVYRDYLKAWRMGFQDVVVNLAPLDEEESAKLETQSLDQGMDRDESGDV
                     IDSNGEKVDVAYLLKRPLVRLKYLSKTFKGIDYIAHSPKAEKVAENYQELVEHARRRS
                     NDERARLEDESAACIDGTRIRDPETLKVLTDVTVNKTRRVLARDFFNLSLLHSSGQTI
                     DCHAELLLRDNAPGTESGGDLLICEIDDTDRWLLFPPIETNWISARSGSSKGEIVVMI
                     RGKSAVEDREWRELLSLTIPGEDVRSEWIHMIGLDPVPPTISRSHSFLERARKQRRKS
                     VDEKSEKPASLKLRLPSPSEVDVPIGEQGSVVSRTGNSFVTNSSGPSSLSNNSEAVSG
                     VSLASAITRASDYSEAAQPMTPTSPNARESLPSAKELSDRKVLEGKASPGLKRTKAKR
                     RSRHAEEMSPSENSPKASSVSVPEQQPESPPKPSPKTPGRFYESTKPIIKPKASISRE
                     KGEAPLHAKRESPNEHRLSSVPSMKMPTIPKIRQESGSSHSNTSVDTTSDDEEWPDLG
                     SNTHSPETDTSESEEPPAPPPHRSPSQTQLKNVPTLSPSANRQKRRSSSPLKHEYEPS
                     TASDTSSESDSSTVRHYDMGYSSSGSSDSSDEELEDDDILLPIPPTRSAQFSDPSPPA
                     SLPALDGDTLSPSNSASQGPYRSVPSQPSKSSKAIASIFYWAEQGKWEPLLPAECSIV
                     VTPGLIEAYEISNGPESDYHTGHKNRPLIALELTPLVPIRRGTAIDISIRSPPTERSR
                     IRKSNNIMFRSRNLEECEALYGLINQARINNPTYIALQNARGPFDGQPAALSRYNSTD
                     NNKTASWFGFPRRKNSYRASKRAPSIGMASDSSVGTMSSAFSALKRFGTGNKLFSIAR
                     STITSRTGSRDGSLYSSSGGSGLAALAEAIKGADGIGLSNAKIRFYLRESTTKWRDLG
                     AARLTIMPATPKSSRPTTSSDTSAGDANPGSSRSPSEVPSDSVNEPLPDGVSTPTPAA
                     SPRRVVMSQEKRIIVQGKTVGEVLLDVCLGESSFERIARTGIAVSVWEDRAGGTVQHK
                     GGVTGGAFRIYMIQMKSEAEAAYTFGLVGKLRY"
     gene            complement(<1538280..>1541318)
                     /locus_tag="TRUGW13939_09078"
                     /db_xref="GeneID:55996562"
     mRNA            complement(join(<1538280..1540959,1541014..>1541318))
                     /locus_tag="TRUGW13939_09078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492203.1"
                     /db_xref="GeneID:55996562"
     CDS             complement(join(1538280..1540959,1541014..1541318))
                     /locus_tag="TRUGW13939_09078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348096.1"
                     /db_xref="GeneID:55996562"
                     /translation="MHFKPFRPPLIRKNLASDVSSDSPNSDINTPRPFKRPRLESKHD
                     DEADSDVISKPSDGNITKKPASQRPLNPVRNSSSDGDNSTDKQNAPADDVEAYYNVLW
                     RKFTTKKHKTWDGDGILSIRGGYGYLRDVSGRDMGRIVINTPLEPGASLSISGKDVEI
                     ESSISKEDYLSGRDFLGGAKKLATSPPVRSKAATSVTPSNLQRAKVEASSVNKAAKKD
                     ISNETDSTQPGKQMFSVKHLNTASSRSAGLGSIFKNPLKDKTISTPQITGQPTPRHDP
                     NAPGALVMKRPTSVPKGKAVVDVVVDPLLSKHLRDHQREGVKFLYECVMGLRDFNGEG
                     AILADEMGLGKTLQTITLLWTLLKQNPIYESSPVIKKALIVCPVTLINNWRKEFRKWL
                     GNERIGVFVFDDKRKRLTDFTMGKAYSIMIVGYEKLRTVQEGLTKGHGVDIVIADEGH
                     RLKTVQNKSGQAIQALNATKRVILSGTPIQNDLSEFFAAVDLINPGILGTYKNFMREF
                     EGPIVRSRQPEATKKDIEKGESRSEELRDLTSMFMLRRTAEVLSQYLPPKTEYVLLCE
                     PTSTQANIYRHVLASPIFQTALGSTDGAFSLLTILKKLCNSPSLINPKTNDESSKNNT
                     ITALLSTLPPNLIRHFSPSSSGKIRVLDQLLYNLRTTSSEKIVLVSNYTSTLDLLATL
                     LTSLSLPFLRLDGSVPTAKRQSLVDDFNRTPADACFAFLLSAKAGGTGLNLIGASRLV
                     LFDIDWNPATDMQAMARIHRDGQKRHCYIYRIMLKGSLEEKIWQRQVTKIGLADSVME
                     SKGGVAQFSREELKDLFRLHEGEGCQTHELLGCSCGGKGTPILAEGDDESDSLEEPRS
                     QSPFFKEDSTSSEAEEEIEFPDLPTLMKASQVDMEEQEKRILQGIHALQQRNNKRTAR
                     GKKDSGSKGKSDGTSGTNKIQQFLSQYLHIDPAAFTDQDSELQSQIGDSVLQSLFKDG
                     DHGVGFIFEKTAFPTTPVGASS"
     gene            complement(<1541900..>1543682)
                     /locus_tag="TRUGW13939_09079"
                     /db_xref="GeneID:55996563"
     mRNA            complement(join(<1541900..1542659,1542717..1543209,
                     1543261..1543340,1543396..1543442,1543497..>1543682))
                     /locus_tag="TRUGW13939_09079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492204.1"
                     /db_xref="GeneID:55996563"
     CDS             complement(join(1541900..1542659,1542717..1543209,
                     1543261..1543340,1543396..1543442,1543497..1543682))
                     /locus_tag="TRUGW13939_09079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348097.1"
                     /db_xref="GeneID:55996563"
                     /translation="MAANIPDEKMNAVEGPISDNGSEEVVNASGHKQELQRNFGLLSI
                     CAIAVTTGNTWIAQGGSVTINISNGGPAGVIYEFIAVSICYWFVAASIAELASAMPSA
                     SGVYHWASITAGKYGRACGWFAGYWNTLAWVFGAASMSSILGNQTVSMYALFHPQFTP
                     QPWHVFVSMLICTWICCTIVLFANRLLPQIGNLGMVLIIGGVFVTIIVCAVMPYVNGV
                     GYASDEFVWRSWTSDTGYSSQGFVFVTGMLNGAYSVGTPDVTSHLAEEIPHPSRNIPK
                     AILAQMTVGFITGFLYMIAMFYSIQNLDDVVGSVFGFPLAEIYRQATGTRGGALGLLI
                     VAFLPTLVTCVGCYITAGRTLWTLARDNATPFSGFVGRINNKMHNPFNATLICGCLIT
                     ILACIYVGSSTAFNAFVGSYVQLSTLSYFTAIFPHVLSRRSSITRGYFWMKGAVGYIV
                     NIVSCIYILAFIVIFCFPYTLPTDAKSMNYASLITGGLTIFIAIWWFIHQRHYVGPQA
                     IPLTDRKVADDAK"
     gene            <1545521..>1546889
                     /locus_tag="TRUGW13939_09080"
                     /db_xref="GeneID:55996564"
     mRNA            join(<1545521..1545609,1545660..1545941,1546001..1546134,
                     1546195..>1546889)
                     /locus_tag="TRUGW13939_09080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492205.1"
                     /db_xref="GeneID:55996564"
     CDS             join(1545521..1545609,1545660..1545941,1546001..1546134,
                     1546195..1546889)
                     /locus_tag="TRUGW13939_09080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348098.1"
                     /db_xref="GeneID:55996564"
                     /translation="MSFQPGFGESFKRETWILYSVGMAGAALRYVARVRRLGIRHLQI
                     DDFIMMFGMVWYTILCVALNEVASGGGSNLMTDEDIANLTPSIHAERVRGSKWVFVSE
                     HAFILTIWSFKSCMLVIYSRITDGLAQKRLINYCAIYVALGFVGTELGLFLSCIPLSN
                     YWAAPTPNPQCSNYQHYEIIQGCFSITADVFMLAVAIPLLLKIRLPTKQKLILVVLFG
                     MGIFVIVSAILTKVYCLVPHLISYVYMNWYFREATVAILVTNLPLVWSLLRDVFPGIL
                     RSWTGGSKKASDRYYPSTPWSNTHKSRGSRGFGVASHVRSTRSHYDIEEMGPMPQKED
                     SSVSISQRSGDSPNSISDDGSARALRIRQEITVTVEEEARRESKLISSAHGWSDNQID
                     GRKRSSA"
     gene            <1547949..>1549888
                     /locus_tag="TRUGW13939_09081"
                     /db_xref="GeneID:55996565"
     mRNA            join(<1547949..1548045,1548171..1548926,1548975..1549286,
                     1549413..>1549888)
                     /locus_tag="TRUGW13939_09081"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492206.1"
                     /db_xref="GeneID:55996565"
     CDS             join(1547949..1548045,1548171..1548926,1548975..1549286,
                     1549413..1549888)
                     /locus_tag="TRUGW13939_09081"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348099.1"
                     /db_xref="GeneID:55996565"
                     /translation="MDQTAYLAISGRHVFITGAAGSIGSQAVREFLDQGCNVTAHDLS
                     PVQLQTSETDRLHTVTGDISDEDSIKSCMEQAQQRFGPIDILIANAGIADESQAYPIW
                     DLPVDIWDKNYRTNARGTFLTIKHFLRAAKSAQENQGGRELDNLAIVITGSEYTKEAG
                     YSDYASGKAGLQYGLIQGLKNETVRLNRKARVNAVAYGPENVARAMAFLASHRVAGHI
                     SGQCISVEGGIDGRLVWKENEVVNTSDLSVSSSVQMIPQSMPKPPRNKIRVAVSIDLD
                     AVSGWLGTGYSPDNVLADYSAGFFAARVGVPRLLNMLKRVGIANKVTWFIPGHSAESF
                     PQEVQQVVESGCEVGLHGYAHEGAYSLTVQQERDILEKCIEIATKITGKRPVGYHASL
                     TDHDCHPFFAPRRPPLQPIDYTKPASSWMHPIPSSSSLDQNISSDCRPLVEVPCNYYM
                     EDMTPMQFLPHVHNSQGYVDVRVIEQMWRDRFLWIREHESEPIFAMLMHPDTSGMAHV
                     IGMVERMIRWLQSWGEDEVEFMQTGEIARWWKEENLRK"
     gene            complement(<1550164..>1552935)
                     /locus_tag="TRUGW13939_09082"
                     /db_xref="GeneID:55996566"
     mRNA            complement(<1550164..>1552935)
                     /locus_tag="TRUGW13939_09082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492207.1"
                     /db_xref="GeneID:55996566"
     CDS             complement(1550164..1552935)
                     /locus_tag="TRUGW13939_09082"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348100.1"
                     /db_xref="GeneID:55996566"
                     /translation="MNGAQFTDRANKALLDANDLAEQYAHTQILPLHLAVSLLNPPAG
                     NLDDEEQQTDSSSVPLFKQVIERAHGDPQLLERSLMKLLVRQPSQDPPPERVAVSPAL
                     SKVIRSSSDLSKTQKDSYVAIDHLISALAQDGQVQKALAEANIPNVKLIDNAVSQIRG
                     TKRVDSKTADAEEEHENLKKFTIDMTALAREGKIDPVIGREEEIRRVIRILTRRTKNN
                     PVLIGDPGVGKTTVVEGLARRIVNADVPANLAHCKLLSLDVGALVAGSKFRGEFEERM
                     KGVLKEIDEARETIVLFVDEIHLLMGAGSSGEGGMDAANLLKPMLARGQLHCIGATTL
                     GEYRKYIEKDQAFERRFQQVLVKEPTVPETISILRGLKERYEVHHGVNILDGAIVTAA
                     TLAARYLTARRLPDSAVDLIDEAAAAVRVTRESEPEALDNLERRLRQLQIEIHALERE
                     KDAASKTRLELAKQEAANVAEELRPLREKYEQEKRRSKEIQDAKMKLDSLKVKRDESM
                     RSGDTATAADLEYYAIPETQALIQRLEAERAKSDAEERARAGDQGETTLMPDAVGPDQ
                     INEIVGRWTGIPVTRLKTTEKDKLLQMEKHLGKIVVGQKEAVQSVSNAIRLQRSGLAN
                     PNQPPSFLFCGPSGTGKTLLTKALAEFLFDDPKAMIRFDMSEYQERHSLSRMIGAPPG
                     YVGHDAGGQLTENLRRRPFSILLFDEVEKAAKEVLTVLLQLMDDGRITDGQGRIIDAK
                     NCIVVMTSNLGAEYLARPTAKDGRIEPQTRELVMGALRDYFLPEFLNRISSTVIFNRL
                     TKREIRSIVDIRLNEIQRRLEANDKDIKIECTEDVKDYLGEAGYSPAYGARPLSRLIE
                     REVLNRLAVLILRGSIKDGEIAQVVMKDGRIDVLPNHTDSDMDDEDMVDSDDALAEIE
                     EGGDMDLYE"
     gene            <1555146..>1556771
                     /locus_tag="TRUGW13939_09083"
                     /db_xref="GeneID:55996567"
     mRNA            join(<1555146..1555208,1555299..1555481,1555797..1556564,
                     1556628..>1556771)
                     /locus_tag="TRUGW13939_09083"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492208.1"
                     /db_xref="GeneID:55996567"
     CDS             join(1555146..1555208,1555299..1555481,1555797..1556564,
                     1556628..1556771)
                     /locus_tag="TRUGW13939_09083"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348101.1"
                     /db_xref="GeneID:55996567"
                     /translation="MSNKPIFVATHPRACSTAFERVFMTRRDSLQCIHEPFGDAFYYG
                     PERLGSRYEDDEEARLASGFSQSTFKTVFDRIERESTEGKRVFIKDIIHYLVPPNGKP
                     ASIAPSLLKLKRGIGTSEHVNGQSNGHANGVNGANGAAVNGVSVHGESSRQKAPYPYD
                     TEAEPGNPTVVPTELLSKFHFTFLIRDPHYSIPSYYRCTIPPLDEVTGFYNFSPSEAG
                     YDEVRRVFDYLRQVNIVGPRMAAAGGSANGISHSAASNGVNGHHSKKGGIEICVVDAD
                     EMLDNPAEMIEGYCKSVGIPYDPELLTWDTKEDHEFARAAFEKWKGFHNDAIESKGLE
                     ARCHPKEFKSEEEFDAEWRQKYGEKGAKIIRETVDRNMADYHYLKQFALKV"
     gene            complement(<1557578..>1558804)
                     /locus_tag="TRUGW13939_09084"
                     /db_xref="GeneID:55996568"
     mRNA            complement(join(<1557578..1557773,1557830..1558472,
                     1558534..>1558804))
                     /locus_tag="TRUGW13939_09084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492209.1"
                     /db_xref="GeneID:55996568"
     CDS             complement(join(1557578..1557773,1557830..1558472,
                     1558534..1558804))
                     /locus_tag="TRUGW13939_09084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348102.1"
                     /db_xref="GeneID:55996568"
                     /translation="MRVLTQPSLALLTAVLSSSPSLTSALGFSCADIRVDDVHFDLSP
                     LGGVHEIYNATHLDGYTQNTTYLINICNILGGASHFEGAYCGTSKNICGFERTIYDDD
                     EDEDEHPVEVRPLPIAGLDPAGGGSKDPEVTRLKKQDADTEGVRVKIAGGEIHEHGQK
                     KGKPASAVIEFQCDPDRTGLEGLTTEKSEDSDKNKEDKDKDEEESKKRFRREDDEDKD
                     DDEKEGDDEEEEGDDKDKDNSGDKADGEQDTSDRSLQLKSFGLVDDKYYILRLDWKTK
                     YACENYLSDNPSDSNGSGHWGFFTWLIIIVFLLVATYLIFGSWLNYNRYGARGWDLLP
                     HGDTIRDVPYIFQDWLRRVINTLQGPGTRGGYAAV"
     gene            <1559558..>1560187
                     /locus_tag="TRUGW13939_09085"
                     /db_xref="GeneID:55996569"
     mRNA            join(<1559558..1559575,1559646..1559780,1559865..1559932,
                     1559995..>1560187)
                     /locus_tag="TRUGW13939_09085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492210.1"
                     /db_xref="GeneID:55996569"
     CDS             join(1559558..1559575,1559646..1559780,1559865..1559932,
                     1559995..1560187)
                     /locus_tag="TRUGW13939_09085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348103.1"
                     /db_xref="GeneID:55996569"
                     /translation="MLQHRMLSKDDEATAGGEDNEVRREDQDKINRFSRLHQRETVLE
                     ERLKAKQKDKEDIDEVSTELELADEDELVPYKIGDSFVHLPLEEAQSLLTASSEEIDA
                     EVSRLEDSLGELREELTQLKGALYARFGKAINLDV"
     gene            complement(<1561703..>1564281)
                     /locus_tag="TRUGW13939_09086"
                     /db_xref="GeneID:55996570"
     mRNA            complement(join(<1561703..1562819,1562873..1563646,
                     1563718..1563815,1563871..>1564281))
                     /locus_tag="TRUGW13939_09086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492211.1"
                     /db_xref="GeneID:55996570"
     CDS             complement(join(1561703..1562819,1562873..1563646,
                     1563718..1563815,1563871..1564281))
                     /locus_tag="TRUGW13939_09086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348104.1"
                     /db_xref="GeneID:55996570"
                     /translation="MNTYPRQSSSQTLPVYEPTSSMASSLAPQGPFPPPSALAAAPPS
                     RPGSGLQMAHLLHPPPSQIMSMPTSSPYAHSYDSASGSPADRASILTDATGSLPDAPS
                     LLPVVGGPGQPQQKRAYRQRRKDPSCDACRERKVKCDASESSSCTECSNRKVRCQFTK
                     ETNRRMSSIKQVQDLEKQLTSTKQQLHQLRSGVMRPDTAMDIDFDISGQPVLKLPDVG
                     YRPPRRNRPPVPQDLSGARSSIRKYGRGIIKVPPPYRQAASSNVIAENAPVLPPKPVA
                     DRLLGQFHACIHSVLPIIHWPSFTVDYEQVYQAGTLRGARREWTAVLFGVFACGSMHT
                     LEPNKEKETREFLLTSQTVADTWLDDFTLDQARVALLTSIAFYEMNSRSASWVWLGTA
                     VRIAQDIGLHMESGPWPAVEAEMRKRLWWGIYAWDRLLSLELGKPISIHDQDCDVDLP
                     CPVDEQFISEAARVPEGSQTNPLLAIIHVVRSIGQLTKTLKSPVISAATLEIFDRHFN
                     ACLATFPINYHPKSDHYLDPSSLAPIIYLQNARLILHRHNISPHCPAEIRYPAFDHCL
                     AIAIDTTRVLQRCMHPSSASSTYTSTRGDWQTLFASSATTLLCTHIWRCLLVLIFRED
                     FATASVCIQACKAIGNSHVVMNSHGRYVSFFLKCLLERLQHGNSQPLDQDEEIIAYVS
                     GDMQGTTDGSWIWQGSETGSKLEAIPSQTSPNLTAQNGGHGSDRDVDWEGWDWVERTV
                     DYLANELHRRNQERREVPAVVPRPIEPQHKLSPDSMTSTGSAIPRSSPSSSRMTIANI
                     I"
     gene            complement(<1568253..>1570151)
                     /locus_tag="TRUGW13939_09087"
                     /db_xref="GeneID:55996571"
     mRNA            complement(join(<1568253..1569042,1569110..1569371,
                     1569428..1569541,1569599..>1570151))
                     /locus_tag="TRUGW13939_09087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492212.1"
                     /db_xref="GeneID:55996571"
     CDS             complement(join(1568253..1569042,1569110..1569371,
                     1569428..1569541,1569599..1570151))
                     /locus_tag="TRUGW13939_09087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348105.1"
                     /db_xref="GeneID:55996571"
                     /translation="MKSIYTLVPFFCVAGATSLNYCPFLGAVYPSPKTLCNDTAFQTV
                     KHNISLSLDAIISGNSSLLGSTYVSNTTSLSVQIWSTSNTEPEFEYYYTSPLTKNATT
                     GVTEVDEDTVFRIGSASKLWTVLLLLIEKGDAILSDRVVKWVPELADAAREIGDDFNR
                     INHLDWSEVTLFELASQLSGIARDYAFGDLITLGLDLTQDGFPQVSEVPPCGTLAAGA
                     CNRTQYLQGILQAHPTFPTAYAPSYSNANFQILAYALEAMTNETYDTLLSRDLVKPLG
                     LEHLTSTAPADKYGIIPWDAITSYWALNTGDEAPAGGLYASTKDMVKLGRAVLNSTLL
                     SPAMTRRWMKPATHTGSLTASVGAPWEIYTIPTSRAVDVYTKSGDLGSYSSMTALSPD
                     HGVGFTIIAAGNDTTAVVQTLTQAMMEMLVPALDAAAKEEAVVRFTGTYAHHGSNNKP
                     NSSISITTDGGPGLRVEDWVNDSVDMIATIEALTGYTSTPSVRLYPTGLESSGQVSFI
                     AIIQQLENMSSSSDVPCTTWFQVDSQVYGNVGVDEFLFEVDGRGDAVGLSPRALRTVL
                     PRVSKI"
     gene            complement(<1571395..>1571972)
                     /locus_tag="TRUGW13939_09088"
                     /db_xref="GeneID:55996572"
     mRNA            complement(join(<1571395..1571619,1571745..>1571972))
                     /locus_tag="TRUGW13939_09088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492213.1"
                     /db_xref="GeneID:55996572"
     CDS             complement(join(1571395..1571619,1571745..1571972))
                     /locus_tag="TRUGW13939_09088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348106.1"
                     /db_xref="GeneID:55996572"
                     /translation="METEAPATIASLLEPASPSVKPIEISFPLPRTPHTNVHVHLTAM
                     ATSTMVFLSTTNAGDAGSTVKPMGSFVYAMPDRTNSRSTISTTLYTSPGSIDYATRAA
                     KILARRMNVPVYVGCNIDPVVTGATVEEEMEGFSKMIDTIMKRWDSRE"
     gene            <1573089..>1574460
                     /locus_tag="TRUGW13939_09089"
                     /db_xref="GeneID:55996573"
     mRNA            join(<1573089..1573216,1573296..>1574460)
                     /locus_tag="TRUGW13939_09089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492214.1"
                     /db_xref="GeneID:55996573"
     CDS             join(1573089..1573216,1573296..1574460)
                     /locus_tag="TRUGW13939_09089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348107.1"
                     /db_xref="GeneID:55996573"
                     /translation="MAEDNYPGQMAAADENQSWQGDFDPFADQEERRVLFAALDSFRQ
                     YRRTAHLNITHRRRQSFYALPSAHWKILAERPFSILETFNQVDDAIDTNADIADAILE
                     TGLQSFGLPATPDENDAGQNWHGTATNTDVGKAHSTIRQFYRDWSEEGKREREVCYDP
                     VLAVLDQSLANDPDRPRSDIRVLVPGAGLGRLVFDICAAGYTVEGNEISYHQLLASSW
                     MLNHSRGIRQHALYPFALHFSNLLSRKQQLQKVMIPDAHPASAMALAQKEDGSSTFGN
                     MGMSAADFIPLYSQETQKNTFDAVATVFFIDTSPNLIRYIETIKNCLKPGGLWINVGP
                     LLWHFENDDRRYSQNTSRQTAKNEEHALSLQNNGIGEPGNVELTEEEVFHLVQRMGFT
                     IEVRQPPADRPYCGYIQDPDSMLQNLYRPSIWVARKAT"
     gene            <1575224..>1576169
                     /locus_tag="TRUGW13939_09090"
                     /db_xref="GeneID:55996574"
     mRNA            join(<1575224..1575504,1575555..1575736,1575790..>1576169)
                     /locus_tag="TRUGW13939_09090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492215.1"
                     /db_xref="GeneID:55996574"
     CDS             join(1575224..1575504,1575555..1575736,1575790..1576169)
                     /locus_tag="TRUGW13939_09090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348108.1"
                     /db_xref="GeneID:55996574"
                     /translation="MQWLITGCSSGLGLHLARMVLSAGHKCIATSRNPDATPEYVVEI
                     EKLGGIWVPLDVSSNNLENLIQEITEKHGFIDVLVNNAGFGDGGPLETYSTEAARSIM
                     EVNFFGPMRLMKALIPHMRERKQGVIVNVTSAVFWAAHPGVGMYAASKFALEGLSESL
                     SGELAPFGIRVIIAEPGEMRTKFVDTDKVSHVHVPEAYKATPAEFVLNFITQRDGKQD
                     IDPERVANAIVQQVVSSPNPDPPLRLPLGTECLELLITKTSTLSKLADASISLAKDCD
                     FPKN"
     gene            complement(<1576547..>1578317)
                     /locus_tag="TRUGW13939_09091"
                     /db_xref="GeneID:55996575"
     mRNA            complement(join(<1576547..1576776,1576832..1576986,
                     1577057..1577988,1578052..1578240,1578300..>1578317))
                     /locus_tag="TRUGW13939_09091"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492216.1"
                     /db_xref="GeneID:55996575"
     CDS             complement(join(1576547..1576776,1576832..1576986,
                     1577057..1577988,1578052..1578240,1578300..1578317))
                     /locus_tag="TRUGW13939_09091"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348109.1"
                     /db_xref="GeneID:55996575"
                     /translation="MKRTYENALKLLESRRRTARPKGVAARPITPAPQPGNPTHTSTP
                     NGSNALRGVPSLVGMREWLQLLGHSDDDINKLNIIHITGTKGKGSTCAFTRSFLRAHG
                     LRTGFPSRIGLYTSPDLRCIRERIQINNKPIGEDLFTRYFFEVWERLTIPSSSAVSIP
                     EAVREKGPRFLQFLAIVAFHTFINENVDAAIFETHHGGEHDATNFVQKPVVTGITSLG
                     MDHIAQLGPTVEDIAWYKAGIFKTGAPAFSVPQKEAGPASEEVMRRRAAERGTTLEFV
                     PVNKTQLPNNDRVLSVPVQKINCSLALELASAFVKIKTPENPITADDITQGVTNFSWP
                     GRFEIISDGDSQWFLDGAHNTLSLKQAAEWFSKNVNTTTDMSAARKYRILVFSHFSDS
                     RDGEALVDCLGNALLENDAMPDHVIFTTYHEREDGSTRFDKFLKVPETPFPDFRGIYS
                     DIWKKLDPKATISSEPTIEEALNLAKSVARNHGGMDVFVTGSLHLVGGVLNVMQPDI"
     gene            complement(<1578500..>1580070)
                     /locus_tag="TRUGW13939_09092"
                     /db_xref="GeneID:55996576"
     mRNA            complement(join(<1578500..1578860,1578911..1579026,
                     1579083..1579211,1579265..1579958,1580045..>1580070))
                     /locus_tag="TRUGW13939_09092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492217.1"
                     /db_xref="GeneID:55996576"
     CDS             complement(join(1578500..1578860,1578911..1579026,
                     1579083..1579211,1579265..1579958,1580045..1580070))
                     /locus_tag="TRUGW13939_09092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348110.1"
                     /db_xref="GeneID:55996576"
                     /translation="MGTTVGLEKCAAKAVECHYPTSTKSREPKPQIQHNYNDTLELQR
                     VSPSLVTAFPGIENREETSTNDDILHGISDPEFANFSQQNLDWTVPDINFSEFLSPQA
                     NDEAIQYLSSESSALIRHSTTQINRVQEFAFSPNISMSIQPSGTPRSLVLRTGMKPSA
                     QRTANLMFHTLKSYPLMILRHKTLPPFIHSHLISSNTKNVDMEPLNNCISLLHMISSG
                     VQGSRKLFWKNVRLECERLCENILNLNKWEILAAMQAIAIYILIRLDEGETDYNNFDL
                     LLLKTITVLSKRFTNFKMTHGTQSEHYDYGLDSSWKDWIFEESCRRICVIFQTVNMLV
                     YFEPAALCDPNTDLIFAPLPAKKQLWEAADKFSWKAEHDREYGALNYFGLATNGDLVR
                     LDVGKAYCGDASLLHQPLSSNKTTTNWEEWCSGMDGLGGLIMLAASLVA"
     gene            <1580926..>1581898
                     /locus_tag="TRUGW13939_09093"
                     /db_xref="GeneID:55996577"
     mRNA            join(<1580926..1581622,1581687..>1581898)
                     /locus_tag="TRUGW13939_09093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492218.1"
                     /db_xref="GeneID:55996577"
     CDS             join(1580926..1581622,1581687..1581898)
                     /locus_tag="TRUGW13939_09093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348111.1"
                     /db_xref="GeneID:55996577"
                     /translation="MAAPFPSPTKKWHSNIYQSISPTRLELSAKGKTVIVTGGGTGIG
                     AETARYFAQAGASRIAILGRREQPLLDTKALIERESAGVEVFAASTDVTNKTEVDTAF
                     SKFVGDGKIHVLVSNAAIIGPQDSVRDADGEKFLDAIHKNLKGTLNVAQAFLRYAAPD
                     AVAIDVNSSAAHVNFAPGFASYSVAKLGVFRLWNSLGFAHPEMSIFHIQPGVVDTAMN
                     KEAGGVAAMGFSDDVSLPASFNVWLASPEARFLKGKYLWTNWDVDELKAQAKEIEESG
                     QLSIGLGGWPFGNSEWKSNWNSPTDS"
     gene            complement(<1582150..>1582833)
                     /locus_tag="TRUGW13939_09094"
                     /db_xref="GeneID:55996578"
     mRNA            complement(join(<1582150..1582456,1582505..>1582833))
                     /locus_tag="TRUGW13939_09094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492219.1"
                     /db_xref="GeneID:55996578"
     CDS             complement(join(1582150..1582456,1582505..1582833))
                     /locus_tag="TRUGW13939_09094"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348112.1"
                     /db_xref="GeneID:55996578"
                     /translation="MSNDWEVLEMFHDKKEPIIFNNKIQAYGDLRESMRKFNLAILNN
                     HAESNSIAWIEGINAELLKLQPLFDKIREHNPWSSFLEVFGDAKTLAHVKQRDLKDDW
                     GYDFKKIQEWKELHYGELQRDGLPPLEADFFVEYKRSPYGVWKEKYDDYIYPGPPGNN
                     SFDFAGNGSEDDPRWKDTVSRFRDKKTVCRCHPSSLNQERHRHWLNTDEYM"
     gene            complement(<1584168..>1584523)
                     /locus_tag="TRUGW13939_09095"
                     /db_xref="GeneID:55996579"
     mRNA            complement(join(<1584168..1584368,1584440..>1584523))
                     /locus_tag="TRUGW13939_09095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492220.1"
                     /db_xref="GeneID:55996579"
     CDS             complement(join(1584168..1584368,1584440..1584523))
                     /locus_tag="TRUGW13939_09095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348113.1"
                     /db_xref="GeneID:55996579"
                     /translation="MKAFLFAVLLTLLFLQTLAAPVTTNTEDATTIHKKEHNPRNSHG
                     YMVIRRGNIMPRVRKLLPFLSAFGNFGQSGHKKGGKTPTSKAPACFEWGF"
     gene            complement(<1585352..>1587659)
                     /locus_tag="TRUGW13939_09096"
                     /db_xref="GeneID:55996580"
     mRNA            complement(join(<1585352..1585551,1585603..1586041,
                     1586100..>1587659))
                     /locus_tag="TRUGW13939_09096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492221.1"
                     /db_xref="GeneID:55996580"
     CDS             complement(join(1585352..1585551,1585603..1586041,
                     1586100..1587659))
                     /locus_tag="TRUGW13939_09096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348114.1"
                     /db_xref="GeneID:55996580"
                     /translation="MSSSSMTSRLKLFKRSKDSSTSIPSQQSSPSGTPYVPPPLSTAS
                     ASPPPPSSSSTTSLPMNGQNPPGRPPSYSHAGRPTSPMPPTAQQVAHHPPPINTSAPY
                     GQPPQQQQLGVGGPPPPGYGYQPQQPPVQSTQPLHQHGIPSSLGPAQGVRNPAAEVDG
                     TNRNKAQLIVGIDFGTTFSGVAFAFATNNEAREDIITEWPGAGTHTKQKIPTVLYYDQ
                     YQKVVGWGPDIADALAHTGYPKLGVQKVEWFKLQLMLSGNTYIDPINLPPLPPGKSEI
                     DVAADYLFKVRQAMRAQLQKTLGEVFNREERNIRYYLTVPAIWNDAAKAATRAAAIQA
                     GYLRDENDNRLTLITEPEAAAMFCAKSGLLNLKVGDAILIVDCGGGTVDLIAYEVEEE
                     NPFTVAECTAGSGDSCGSTALNRNFSNILRAKIRKMKLPDGSRTAGRVYAKCIMDFEN
                     RIKADFRNNGQKWAVDVGIEADYPDAGIEDGYMSFTNEEILQCFEPVVNRILELVRNQ
                     IIAIQAQNRQLQNVLVVGGFGASEYLFQQIKLHVPPQFQSKVVRPMDSVAAIVKGAVT
                     AGITERVVTHRIARRHYLMATLQPFKEGYHPEQYRVPSLDGKDRCKYTRQIFVQKGER
                     VKIGEPVKVSFFRQVAPGATLMYEDILYACDEDVCPEYVKDPRIKEVVTLTSDLSRKN
                     LEKDFERMDTPNGTFYRVYFDIYLTLDGSEFNAELVCQGDVMGRCTARFK"
     gene            complement(<1589275..>1591206)
                     /locus_tag="TRUGW13939_09097"
                     /db_xref="GeneID:55996581"
     mRNA            complement(join(<1589275..1589339,1589392..1589732,
                     1589782..1590041,1590102..1590198,1590265..1591002,
                     1591106..>1591206))
                     /locus_tag="TRUGW13939_09097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492222.1"
                     /db_xref="GeneID:55996581"
     CDS             complement(join(1589275..1589339,1589392..1589732,
                     1589782..1590041,1590102..1590198,1590265..1591002,
                     1591106..1591206))
                     /locus_tag="TRUGW13939_09097"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348115.1"
                     /db_xref="GeneID:55996581"
                     /translation="MESDADPVLYACAPCKKNKRRCDKRVPSCGSCLKTGRVCDYSSP
                     PQVTPESEISALQRRVQELEEHVRQFPVQMPSVSSTSGPVDSNLSIQAFYLDSEVWSS
                     LKFPDRPAQILAPDDICAALGDQADIDSIKTGYFQSIHVWLPFVSKIRVSRLTQVPQS
                     CPKTDIALLLLCMRLIQEVPDRYGPHSLDLYNLAKEFSKRLELEGLLTLSTVQAGVLL
                     LLYEIGHGIFPAAFMTISYCARQGVALGLHNKFAPQLYGKPRFWGDWEERQRVWWTIM
                     ILDRYVAIGGGYRPLCTDDPGRDTFLPVDDDAWNSGEMVPPERVSLSSKTITKEISSF
                     ARLAQASNLLGRVIRHCGDSSLEINFMLDGFETLCQANYSLLELLQNQGPLTGLDAVI
                     ARTICYSALFKLSDSYSCELFYEETQYDAQTAPRVRQCLERSLHIMNDICGQVTTLIQ
                     EVRGLLTPETLKTASPLMLECVYTCAQSILWISQETNNQQLASAKMVSEDMLRFLDGR
                     WKVADLLRIGVYLELTKRSEVGQDE"
     gene            <1591641..>1592465
                     /locus_tag="TRUGW13939_09098"
                     /db_xref="GeneID:55996582"
     mRNA            <1591641..>1592465
                     /locus_tag="TRUGW13939_09098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492223.1"
                     /db_xref="GeneID:55996582"
     CDS             1591641..1592465
                     /locus_tag="TRUGW13939_09098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348116.1"
                     /db_xref="GeneID:55996582"
                     /translation="MSKVWFVTGSSRGLGLSIVKAALDSGASVIATARKPEQLNGLVE
                     KYGHDRILPIALDVSNNDQVIQAVQAGHAKFGRIDIVVNNAGYANTASVEDITIEDFR
                     AQIDTNLLGVVYVSKAVLPILRQQRSGHIFQVSSVGGRVGVPGLSAYQSAKWALGGFS
                     TVLSQEVAPFGIKVTVLEPGGIRTDWAGSSMGVPPVSEPYQSTVGAVVENHRKRSGSE
                     PSLPEKIADIVIKLTDEAEPPLRLLIGPDAVDYAGRAAEALAASDTQWRALSVTST"
     gene            <1596062..>1599022
                     /locus_tag="TRUGW13939_09099"
                     /db_xref="GeneID:55996583"
     mRNA            join(<1596062..1596609,1596670..1596792,1596855..1597214,
                     1597811..1598240,1598307..1598844,1598898..>1599022)
                     /locus_tag="TRUGW13939_09099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492224.1"
                     /db_xref="GeneID:55996583"
     CDS             join(1596062..1596609,1596670..1596792,1596855..1597214,
                     1597811..1598240,1598307..1598844,1598898..1599022)
                     /locus_tag="TRUGW13939_09099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348117.1"
                     /db_xref="GeneID:55996583"
                     /translation="MVHSLSLTIFTIIGVFVQWLVKHVYLSHRGAASSKPDELDVTLT
                     APYPCNAIKGSRKFRITMGLRKLDERNWLTVDKNYIKEHDIRNSLLKNERRKVFQCLP
                     ESREACAEILEIVSDFLCERYPSMFQMKKDGGKTEIQNIKTGETFVSGGSDSTMEPLE
                     IAVRLAMEDLNVLMMNSEGEYYLAASATLFPVGWAVQQRIGWTISQVHGPVPQWKEKI
                     GHSVNKLTPESPMERSNYFMETKESNEGLGNTLFRPEGLTEQEPGSLMDNVLLRRERQ
                     TFRRLPRSGALVFSVKTTLNTLDELPPDQLRALATEIESWPEDMAKYKGRNVWGQAVL
                     GYCDQMGISTLSVTDKILNLVLVTMTMLSSASTMSWVSSFLLILQSADAIHHMKLKPM
                     MLATADSSHRPIRITNLCPSDIYPAIQTQAGTGPSTGGYHALPGNTTSFDVSPDWQGR
                     IWGRTNCSFNSNGASLNASAPACLTGDCGGLLDCKGTGQPASLAEFTLATSMSLSFYD
                     ISLVDGYNLPIGIVSLHNESTNADLRNIPSNTTNPVCIGSADFLTSVSQMNATTVPIN
                     TTIGSITYVTPLEEALEAHSVSRWCPWPLQMQKPWKPGDGVFPYPDDGIKRPSFDPCL
                     SMCSKYGRASDCCSGSHSTPETCSPNMYSKAAKKVCPDAYSYAYDDTTSTFTIKQGAG
                     FEIVFCPSGRSTDIKKNMGNSSTTS"
     gene            complement(<1599239..>1602258)
                     /locus_tag="TRUGW13939_09100"
                     /db_xref="GeneID:55996584"
     mRNA            complement(join(<1599239..1600682,1600958..1601004,
                     1601058..1601590,1601665..1602079,1602154..>1602258))
                     /locus_tag="TRUGW13939_09100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492225.1"
                     /db_xref="GeneID:55996584"
     CDS             complement(join(1599239..1600682,1600958..1601004,
                     1601058..1601590,1601665..1602079,1602154..1602258))
                     /locus_tag="TRUGW13939_09100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348118.1"
                     /db_xref="GeneID:55996584"
                     /translation="MASKGVTMFDPPPLDDKKAPIENVLELTPILDIGPDVFTNTRPL
                     WHPPGARGVYGGSVIAQCLSAAQRTVPEQFFVHSMHCYFVLAGDSELPIAYHVERVRT
                     GKSFATRTVQARQRGRPIFTTTLSFNRINSGGKKRVEHSTRMPDVSPPKDLPTSRDPK
                     SPFEVQNPGRDTISKDIPLDEKRVGHWVRFRGHISELGGRQAHLAALAYMTDNYFIGT
                     VSRVHNIPRFSSPTALHRALKALKNPSDLDSEGISRYFKEFAEEEASEIRASTRDGTL
                     TANKLSSIIKRRDDRQIGMMVSLDHTIYFHDPLGFRSDDWLLCQMESPWAGEGRGLVM
                     QKIWSRDGVHVATCVQEGVVRLQQDEETRESKLARKNIEKNAARCFFLWESRLTTSMG
                     TLTNLPTELILIVTRQLRNIEDFLALRSTCRLTYDILSENTAPHTILDLLAASAPTFC
                     SPHPYFLVAALARQTSEWALADPAARIPPLRKAFRGGIDALFAFCLEHAPRGLTLDEI
                     RHLHSLRFSVLNPLTDAIDRMAGPQYNATPDFWEGGVSEPNTLYTEPSRATMQILIYG
                     ELFGTSFDHFLDRPLRFADTSVPASPASLSPPPSASSSVSFFSTSSDPRLPKEYPVFT
                     IQDRLDFVKYCIPDWNCSAWGPFEVDRIGPYQVREVEGDHTSNLPADQTALRHVLTCR
                     RWRRMWREGMAKVDKDDFSPPPPTRRLSIISIMSYEDRSSPSRPAPEDIGPRAHYWAD
                     HFSWVGDEGKTDIPNLSTENWRQKLYRDALVFQGIEGMQLITLPTHKISPRVLEKARW
                     IRQKISELQVPIEMTTFGRLTPMLVSSAPDLSQELWLGVRGRWRPSVNV"
     gene            complement(<1602742..>1604714)
                     /locus_tag="TRUGW13939_09101"
                     /db_xref="GeneID:55996585"
     mRNA            complement(join(<1602742..1603382,1603451..1603498,
                     1603552..1603927,1603981..1604394,1604454..>1604714))
                     /locus_tag="TRUGW13939_09101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492226.1"
                     /db_xref="GeneID:55996585"
     CDS             complement(join(1602742..1603382,1603451..1603498,
                     1603552..1603927,1603981..1604394,1604454..1604714))
                     /locus_tag="TRUGW13939_09101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348119.1"
                     /db_xref="GeneID:55996585"
                     /translation="MPEVDEIQAASTSTQAIQVDTKTMPVPPHNDSEATLQGIAEQED
                     DMMHEAVQERYQNPSSYRFRRIASKTLVSFGPGDPEDPVNWGKGKKMFVLCSGMMQVM
                     NSTIGSSLPSGAIQYIAKYFDIVDEEKLVLPISLFLVGYVLGPLLYGPLSEQYGRRWP
                     LVIGYILFCFFSLGCALAPSFPALLVLRLLNGMAAAAPISIISGVYADINDDPIQRGR
                     TMAWFMSCTAVGPIISPFMSGFISTVNWRWAFWLGLIIAGASFPCVLFFPETYGPVLL
                     QRRARKLRKETGNKGIVAPLDLMPHDLRATLTVTLTRPLRMILNEYMVSLTCFYLALA
                     YAIFYLYFQAYPLIFEGIYGMSPGIAGLTYLPISLGCFIACGIFIWYDGYLERAKARG
                     AAWAHNEDYRRLPLACIGGPLYVVSLFWLGWTASPNIHWAVPMTSGVMFGLAYELIFM
                     AMLNYLSDAYETFAASAQSASSCCRSIFGAVLPLAAKPMFNHVGINWGCSIIAFISLG
                     VSVIPFAFIYYGKTIRQNSKMCQHLKMLKEEERRAWAEEDAAHASAADPNADVEKGPS
                     VRDSEEVTEKHLQ"
     gene            <1607232..>1608967
                     /locus_tag="TRUGW13939_09102"
                     /db_xref="GeneID:55996586"
     mRNA            join(<1607232..1607271,1607326..1607363,1607425..1607857,
                     1607932..1608005,1608065..1608185,1608307..1608503,
                     1608572..1608659,1608726..>1608967)
                     /locus_tag="TRUGW13939_09102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492227.1"
                     /db_xref="GeneID:55996586"
     CDS             join(1607232..1607271,1607326..1607363,1607425..1607857,
                     1607932..1608005,1608065..1608185,1608307..1608503,
                     1608572..1608659,1608726..1608967)
                     /locus_tag="TRUGW13939_09102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348120.1"
                     /db_xref="GeneID:55996586"
                     /translation="MADSDFHVLIVGAGATGLLIAQGLKKAGIRATIYERYSREEYEE
                     RAGKWTVALHWSIPFIEACVPLEISAKLKSTETHPWTDNDSTEAAYIPLVNGLTGDLM
                     AKMPMPSGRRVSRGKLRNLLSTGIDIHFGMKLSEVRSESAAGEKPAVTVLFNGGSVVA
                     KGSVIVGADGARSVVRNYLVGKEAGELQAAESLSLNVFATFTAEQALFIRNNSHLIGQ
                     ACLLEKYQIEFYTNRLSVADVVDPEKPETWVFQYSFSNLTKDDPPADEEEQRKLFKTY
                     MATYCEPYKSIGLWVTDDTPISAERFNFWGNIVPWDNRDGKITIAGDAAHPMLPFRAQ
                     GLNNAAEDAKLYVDAIKGVVYDNKDLKSTIDAYDESSYTRGKTDIISSHEQMKAYHNW
                     DIVMNGPLMKSGGYGKPR"
     gene            complement(<1609279..>1610073)
                     /locus_tag="TRUGW13939_09103"
                     /db_xref="GeneID:55996587"
     mRNA            complement(<1609279..>1610073)
                     /locus_tag="TRUGW13939_09103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492228.1"
                     /db_xref="GeneID:55996587"
     CDS             complement(1609279..1610073)
                     /locus_tag="TRUGW13939_09103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348121.1"
                     /db_xref="GeneID:55996587"
                     /translation="MKTEMIAAAGLLATAAKADSIFSGNGFGTYYYDIDSPSACSTDF
                     SVANTGQVECSLTQVYTLEDVGSEYLVAMNHSQLISDMGKYCGKKVEVTVNGVKSDLP
                     LFIGDGCYRCSQGTPDQDTWQPDGSPGLDFSFSVLDKLSSEACTDGHIDISWEIVDES
                     LYTFDYDGSGTPQGPVSGVTTTAITTTTSPTTSPSGSASPTTLATTTSPASASATPTS
                     SSCSSNTWQCNSDSTALEQCVNSSWTTVETCGTGTTCQGTSNPYCA"
     gene            <1612666..>1614617
                     /locus_tag="TRUGW13939_09104"
                     /db_xref="GeneID:55996588"
     mRNA            join(<1612666..1612741,1612807..1613217,1613282..1613877,
                     1613945..1613968,1614029..1614049,1614111..>1614617)
                     /locus_tag="TRUGW13939_09104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492229.1"
                     /db_xref="GeneID:55996588"
     CDS             join(1612666..1612741,1612807..1613217,1613282..1613877,
                     1613945..1613968,1614029..1614049,1614111..1614617)
                     /locus_tag="TRUGW13939_09104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348122.1"
                     /db_xref="GeneID:55996588"
                     /translation="MELSVKSLFPCFFRQKPQEPWKEIEEEAERIEKFPSWDSSDENP
                     LMMEAFEWYVPHDGRHWQRLQQALGDLKEIGVDNLLLPPGCKAMNPAGNGYDIYDLYD
                     LGEFDQKDSVATKWGTKEELSSLAKAAQMLDMGIIWDAVLNHKAGADDGEKCLAVTVD
                     PHDRNLDLTKPEEIKAWVGFEFSGRGETYSKMKYHWQHFNGTDYDELDKKNGIYKIFA
                     PGKDWAKDVSTENGNYDYLMFANLDHSNPEVKQDILNWIDWIGHQLPLAGMRLDAAKH
                     YSSGFQMTLVDHARQKFGKDWFVVSEFWSGKMTELKKYMEDMEERVHLFDAPLCNRLS
                     AISQTRGGDLRLILDNTLVDYKPEQAVTFVMNHDTQPSQALEAPIAPFFKPIAYALIL
                     LRKQGYPCIFYGDLYGISSGGKKSPPIPPSCEGRLPTLALARKLYAYGEQRDYFSDKN
                     CIGFVRYGNARHPWGMACVMSNGLSAKKKMFVGKRHAGEKWTDVLEGCTTNNTINQPT
                     ITIDSKGYGNFPVLEMSVSVWVNARADGRERFDRHL"
     gene            complement(<1615036..>1617054)
                     /locus_tag="TRUGW13939_09105"
                     /db_xref="GeneID:55996589"
     mRNA            complement(<1615036..>1617054)
                     /locus_tag="TRUGW13939_09105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492230.1"
                     /db_xref="GeneID:55996589"
     CDS             complement(1615036..1617054)
                     /locus_tag="TRUGW13939_09105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348123.1"
                     /db_xref="GeneID:55996589"
                     /translation="MEDSTNEQPIDREKQRTASDGELLTTFATAEIPPDVLDTADSAT
                     HDASQLLNDNASDTTSSSRRHSTNDRMLDDDLTDGRLAGAKSESSRSSLSSVPDSVVV
                     HSKADMVRNQAPPSTGDVYDSDVSYNTFNNQIPQKIRDRNSPFRHPSSVRAMQMYTED
                     EEDEYMTPSRRRGPAYRGSPSSVMRSPGSPLARLQGYNSTGGTPKKPAIKTENPLVLL
                     HCTVLPPTVILAPGIQLPDRKVLETVLPLQFWRRWKLLEEKIVGSGLLRDRGVLLQHP
                     QEDYGLLEERLLESLELQRPRIEHGHFVGEHDCGESGNESNNEDTESRLSSDNSHERS
                     CPDCGCHVGQHTSHKRWNVRFYAANGLMKEGAWTAAWKEIERIDVQVSLWLPYEVKVE
                     VERRIQEEQTALVTENQLKAAQIASSEKCLPQEEIDGLAYAPQRDRDIPESRLTPFDI
                     STDRKFEPLSPNPYRKPNQQIDLHTLLFNYIRIVASDTRNIITVASILVATLALAYSS
                     QTRRNMSDAIRFGDFPAVSTRVYHTSFASVLTQVSTEVPTIEVEKYVEGISEVQRVAQ
                     EVNHSEPPIYETTSTAPSVQATETLVEKVVEPPIESAEPQSIDHEPNPVPDNFGPEEH
                     LPTEDEILSEYPSPDNQETVTPTETNLHTGLEAESITSSRHGVDVEVT"
     gene            <1617814..>1618350
                     /locus_tag="TRUGW13939_09106"
                     /db_xref="GeneID:55996590"
     mRNA            <1617814..>1618350
                     /locus_tag="TRUGW13939_09106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492231.1"
                     /db_xref="GeneID:55996590"
     CDS             1617814..1618350
                     /locus_tag="TRUGW13939_09106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348124.1"
                     /db_xref="GeneID:55996590"
                     /translation="MATEKLQFRIATPDDAERIQQLVQSAFRTEDSRPDWTGHIELAT
                     NFRIDVQEVLDKIVSPENVVLIALDSSNSLAASIEVAKRGSDYGRLSMIAVDDRYQRG
                     GVGRQVLAYAEDYCRRTWGVEKFSLNALSTRKALIEWYMRRGYHKTGETSPFPRERFS
                     NLALPADMCFVELEKNFS"
     gene            <1619754..>1620498
                     /locus_tag="TRUGW13939_09107"
                     /db_xref="GeneID:55996591"
     mRNA            join(<1619754..1620290,1620343..>1620498)
                     /locus_tag="TRUGW13939_09107"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492232.1"
                     /db_xref="GeneID:55996591"
     CDS             join(1619754..1620290,1620343..1620498)
                     /locus_tag="TRUGW13939_09107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348125.1"
                     /db_xref="GeneID:55996591"
                     /translation="MYTQAILYALAIVPLVSAHGKIAVVTGDLGGNGTGLGIRGAAVA
                     GAGPNYLTEVDTTVFWSSDITTDDDIGYTDEAGKNHLSDLDKAMELSGNTLPQVSSGG
                     SIKGTYHIVTSDGAGPLEALVDETATAKWSEAKSADVTTQVPGDDGWISTSNKRDLMS
                     RMVGSLAKRRNAVNVNKDYPFAIDIPSGTSCSGTVNGLKNVCLVKVSNNNENGPFGGV
                     FAVQMPSSSSSK"
     gene            complement(<1620946..>1623834)
                     /locus_tag="TRUGW13939_09108"
                     /db_xref="GeneID:55996592"
     mRNA            complement(<1620946..>1623834)
                     /locus_tag="TRUGW13939_09108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492233.1"
                     /db_xref="GeneID:55996592"
     CDS             complement(1620946..1623834)
                     /locus_tag="TRUGW13939_09108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348126.1"
                     /db_xref="GeneID:55996592"
                     /translation="MASRGSLFSQTLLDITNTKLDELAKGRASFQAHHDQILSLLNGP
                     NDDPIARLSAIVDGLKTCFGVVISDGRVVRGGTGNEHLEITLRNLDRFLAQAKYDPSV
                     SPRILSRWQDLLLSHLENQSQKYKYASLYAQLTTEWLSAKNEPTATHQGDGDVSMDEF
                     EHISSSQKLEAREAWEKSVFEAPNIDTDAIQRVLRDLFEATPDDVKNLPNALQALRWR
                     TAKFEQALASPGIFNTASLQESIKSLLASDLLDDEKKDVLKDFLNNSITLKEISDVLD
                     RRLKSVQEWSWGSEVLLEQRRQVNGSFKIYMHEDLLQAIFLQHIGLKWSVFWKSSLSQ
                     FQQSEGIWKSPGSSISSLEKMRRQYFLGPLNSNDSVASSKEGIYSEKYFLYNLPTSMS
                     LDVSPEQGEEEAQVARSKKAKKGLMSVQMQQQYVAQIPEPVIRRRVLPKPQQALDSYD
                     SHNNRPPTQRLSPMATKQKLLHLLSTDILIQTRLQGGITCFRTQVANLFASLPHATIS
                     TILSYLGVSQKWISFFKRFLSAPLKFMDDSSSAPPRERANGTPGSHVLSEVFSEVVLF
                     CLDFQINQATDGEILWRLGDDLWFWSADHEICVKAWSTINNFVGLMGLEANESRTGSA
                     RMCRNPKDKYSIDPVECNGLPAGTICWGMLQLNPKSGRFEIDQEMVNEHISELSRQLK
                     GQENSVFAWIQAWNTYAATFFTSNFGKSANCFGRSHVDNMLATHERIQRQVFSSAGGI
                     ESSMSVESKSNGSVIEYLKWAIRTRFGVENIPDGYFYFPTELGGLEVRNPFIGLLQIR
                     DSVLGDANKLLDQFEYAEREDYQTLKVNFESGRVPQTDRHFRPNDGNTFFSFQEYIKY
                     RESLPPYFTSNMTLLSVRNKFLEEPKQEAVETAYNGDIQTAISALDADSKGILQNWDS
                     MEPYWKWVAQLYGPDVIESFGGLRIVDSGLLPIGMVSLFRSGRVKWQE"
     gene            <1625124..>1626252
                     /locus_tag="TRUGW13939_09109"
                     /db_xref="GeneID:55996593"
     mRNA            join(<1625124..1625729,1625791..>1626252)
                     /locus_tag="TRUGW13939_09109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492234.1"
                     /db_xref="GeneID:55996593"
     CDS             join(1625124..1625729,1625791..1626252)
                     /locus_tag="TRUGW13939_09109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348127.1"
                     /db_xref="GeneID:55996593"
                     /translation="MALFTARASRASVLRKPFLSLPQTTARTLTTRATSYTLNTGAKI
                     PALGFGTFQDPDSQEDTVNRALQRGMRLIDTARVYNVEEQVGKGIKKSGVPREDIFLG
                     TKLWCNDYHPEDVERALDDSLRDLDTPYVDLLLMHYPCTFQRGPDRFPRDADGRMIAG
                     ETTYLDTWKAMEKLTKTGKVKSIGVSNFSKGEIETLVNESSTIPAVHQMEVHPYLQQK
                     GFNEWLRTKGIHVVQFSPLGNMNDFYRQTGWSKDVAHMMRVIDQPILKEIGEKYGKSA
                     VQVVLAWGINSGRSVIPKSVVDWQIDQNLEADFELQPEDLAQIATLDAKARFNDPSLD
                     YEWRLYSDLEGIDGTVRGRTH"
     gene            complement(<1626686..>1627703)
                     /locus_tag="TRUGW13939_09110"
                     /db_xref="GeneID:55996594"
     mRNA            complement(join(<1626686..1626769,1626828..1627025,
                     1627084..1627458,1627523..1627581,1627628..>1627703))
                     /locus_tag="TRUGW13939_09110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492235.1"
                     /db_xref="GeneID:55996594"
     CDS             complement(join(1626686..1626769,1626828..1627025,
                     1627084..1627458,1627523..1627581,1627628..1627703))
                     /locus_tag="TRUGW13939_09110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348128.1"
                     /db_xref="GeneID:55996594"
                     /translation="MVLSKPNDAPVPKLFDLSGKVVAITGGGGGIGLAVATAYAEAGA
                     QVAILYRTTTTAPGTAETFTSKYQTQCRAYRADVTIQTEIAAAIDAVVKDFGKLDVIV
                     ANAGICSEHAGDEYTPEEFQEIMDVNVNGAFYTAQAAARVFKRQGFGNVVFTASVSAI
                     LVNTPQRQAAYNASKAGVLQLAKSLAVEWVDFCRVNCVSPGYIQTQIMEYASKDMLDK
                     WLAQIPARRFASPYELKGVYLFCASDASSYMTGSNLVVDGGFTLP"
     gene            complement(<1629083..>1629811)
                     /locus_tag="TRUGW13939_09111"
                     /db_xref="GeneID:55996595"
     mRNA            complement(<1629083..>1629811)
                     /locus_tag="TRUGW13939_09111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492236.1"
                     /db_xref="GeneID:55996595"
     CDS             complement(1629083..1629811)
                     /locus_tag="TRUGW13939_09111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348129.1"
                     /db_xref="GeneID:55996595"
                     /translation="MQLKAFIICLMATGAYACTDGQLPSNQQAHAANNITKPEFGGQT
                     PPKGTGATYCGNHGNPYGSNILLIDKKWVSSFKYVAQFYSPPETTESWNIVVWNKCGK
                     DGGVDGFFGEWVQNFQIAPSETKYVVFDEDSQGGWGAAPGTSPVLNSVGSCASTWGEF
                     DFANAANNASGYDVSSIAAQNATLTVQGMQICATQSNNCSSISNSGTVINAYTEANQD
                     RNDIAPWLIGDGPVTLDVTINFSG"
     gene            <1631537..>1632786
                     /locus_tag="TRUGW13939_09112"
                     /db_xref="GeneID:55996596"
     mRNA            join(<1631537..1631679,1631873..1632292,1632346..1632680,
                     1632737..>1632786)
                     /locus_tag="TRUGW13939_09112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492237.1"
                     /db_xref="GeneID:55996596"
     CDS             join(1631537..1631679,1631873..1632292,1632346..1632680,
                     1632737..1632786)
                     /locus_tag="TRUGW13939_09112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348130.1"
                     /db_xref="GeneID:55996596"
                     /translation="MASSAPSPVAVEAAQPPKLSGVALYSRFAFAGAVCCSITHGALT
                     PVDVVKTRIQLDPVTYNRGLFGGIRQVIQNEGAGALLTGFGPTAAGYFLQGAFKFGGY
                     EFFKQQCINQLGYETASNNRIAVYAVSSAAAEFFADIALCPLEATRIRLVSEPTFANG
                     LLGGFSKIAKTEGLGGFYSGFGPILFKQVPYTVAKFVVFEKVVEAVYGVVDKDSLSDG
                     TKTFVNLGSGLMAGFAAAIVSQPADTMLSKINKTKGLPGEGTMTRLVKIGKELGFRGS
                     YSGIGARLFMVGTLTAGQFAIYGDIKRILGATGGVEIGK"
     gene            <1636702..>1638306
                     /locus_tag="TRUGW13939_09113"
                     /db_xref="GeneID:55996597"
     mRNA            join(<1636702..1636754,1636821..>1638306)
                     /locus_tag="TRUGW13939_09113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492238.1"
                     /db_xref="GeneID:55996597"
     CDS             join(1636702..1636754,1636821..1638306)
                     /locus_tag="TRUGW13939_09113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348131.1"
                     /db_xref="GeneID:55996597"
                     /translation="MNSRRSMPKVRSGCQTCKSRRVKCDEQKPSCARCIRAGRECKGY
                     PPPDKNSQLHNGELSLNIPIKAYSIPFKVPGSRTDRQLLHFYCSDAAGNLSDFYHREL
                     WTRIILQRCHDQSIIRNAVVTLSSLYLDYVRGENYYADIGWSPPAKSLEQITKCHRQL
                     MTHLSSPNASLEIALICSLFFHAFETILGNQQQSIFHLDQGILLLKRYQADKNYQLAP
                     ASEELCTHLTAQFSRLDVRASRCDPTRVPLLNLVSPAEISGTVSLVPDVFFSPTHAEA
                     VYLKLENWSEHRKRAQETYIPESIENMHLQTIYENKIFAGELKKYCDNIEKLVYYCRS
                     QDPSWTSHALMLQISSRVCYTAFQNTPSPDPSLPRQNREELEESLKEIVSDMDCLLSS
                     FKEPYQFADSRYFTLSSNLIMILTFVIIKTTNRDTLEKSLSLLKHNRLPSREGLADSE
                     AMGYVFQKLRSQLLKEHIRGDDNQYFDTTMEQLGANILTRPRTFYEMFVNMKNEEAGN
                     EQWQ"
     gene            complement(<1638714..>1640612)
                     /locus_tag="TRUGW13939_09114"
                     /db_xref="GeneID:55996598"
     mRNA            complement(join(<1638714..1638865,1638940..1640239,
                     1640301..>1640612))
                     /locus_tag="TRUGW13939_09114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492239.1"
                     /db_xref="GeneID:55996598"
     CDS             complement(join(1638714..1638865,1638940..1640239,
                     1640301..1640612))
                     /locus_tag="TRUGW13939_09114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348132.1"
                     /db_xref="GeneID:55996598"
                     /translation="MGSASYIDISARKWEQLNSLIPSEWRLQDRYIPSAMRLSPFDSV
                     YKLDCFDEGDTGTLLGVPRACGILSTKEIEITEKWDIQGLLHEIAERRLSSENVALAF
                     CKRAAIAQQLTRCLTEPLFTSALEQARQLDHHLQKTGRLYGPLHGLPVTVKDTFDIKG
                     VDSSVGITALAFKSAGQDAALVQLLRSLGAIIIAKTNVPQTMAFLDSVNHMFGRTLNP
                     LNRLLTPGGSSGGEGVAVAMRASMIGFGTDVGGSIRIPAMCNGIYGFKPSVGRIPYGG
                     TTSGQPNGKLRVALKPVAGPIGRSIQDIDTVMRELVPRAEFFGHDCIPALWPSLSAPK
                     KTLRIGILGSDGLVNPVPVISHLLKEVSGILARSKEYDIEIVNISPPAVMKKCMITGA
                     RLMDVDGAGPLLDLLAQTEEPLMPYLQGRTVRRSPTSIDKLYALCAERDQIEIEMRKD
                     LWSWPLSTAYASESSGNPLDAIICPIAAHPVPRHDTYGNLSYTTTFVLLDYPTGTIPV
                     RNLTEADLKLDYSDEYKPLSKWDEQNRKFWKADRKVYLNTPLSVQVVVPRLHDHKLCQ
                     VMDTVDTAFKIHYQGSNKAML"
     gene            complement(<1641910..>1651674)
                     /locus_tag="TRUGW13939_09115"
                     /db_xref="GeneID:55996599"
     mRNA            complement(join(<1641910..1642602,1642672..1643450,
                     1643513..1651260,1651331..>1651674))
                     /locus_tag="TRUGW13939_09115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492240.1"
                     /db_xref="GeneID:55996599"
     CDS             complement(join(1641910..1642602,1642672..1643450,
                     1643513..1651260,1651331..1651674))
                     /locus_tag="TRUGW13939_09115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348133.1"
                     /db_xref="GeneID:55996599"
                     /translation="MATGQQTLSLVFNHLAFPPKLPGSRDTDEEIELLQKDLTSRLIN
                     EVGILKQKTDNEETGAWSSVDVSLKTCKLLNETQFINQETLLGHIENLQPDGAVILNI
                     ASQNACVFIRKCLDTQDIIFEAFETSQTAEQTLASKGALQWDFPGMAVALPTCEFENP
                     VFQKSLATFIEKASIETVDEFVPKTRKSGAEVSEFRDTVDPAIITQFLMTLLETNGNV
                     VNPPLLRKGIKDDVCWDSAELPWRRSPFWLILRVCTQRILYLRLGAERGRIQYKLLMI
                     LVLVKLLEDCFDQLSLEDSNFLKTKICRRFAKLEFELGNSSQTVRDTYAGLAANITRV
                     CQKTIDTATIHFEKTWSTFKHEIRRHVPRLPYNAQQEDLRLRMPNSSSYLREVLRIEN
                     KRRSSYLQATDQSIPGPSTRQAVSEQFESLSEQYSSLANREISIKADARDTPIETDAC
                     ESRCKEIAGEINSYMSLVGTAYKNHPEDMGIFILCLLELWTRMDKCAVAAYPFLAGLH
                     PWFQAEMLDVLLLTQRQDLERLQKIQLYLYRRCVQAQDKGTTIFSDPSPECVADRYFD
                     STIGGRIHQLQRKIEAASLDSSNGRKAQLDKVNRTFQELTERKAATACTQRKRPDGSH
                     DDRGCEHCYCGRRRYGLKIKVHEEFLPANVFQKRAVVFELGMPQSFDAYRDATWRIID
                     TICVSSSPRESLQTQKVQPQKLLPQYGPLNTFNSRRNTGRITLASSTKSYLGTHYRWQ
                     KLPAKSSKILLPFGMKMAYYDTVSQMWLKDFPRTPSLAHHFALKLPPHLPFSALYATA
                     AFRADGPGPSSYETAASVPQCPSTLTVHEFVASQQLVSGTQRRWLSILTELGAANVNF
                     SLLDTTYLFRLLAMQVGPRRPDSALRVAHAFFDDPHSCHRLVDQIDQHVEIIAANWRE
                     TNYMETMLILAIQLCALCCREASPRAYKLLLNIRHVTRSWVSTLRHEMRTALDGDISE
                     KAARYCFVSALLCRRTFVLESSRNHDLDADGFQCFVEVTSAMQEALVVDMSKFSTATR
                     NMLTRDIKASVTLCSLLRQAVQTLPAILGCAIDVVWPNPDGGARIYSAWSLIDSSNGL
                     WVTSKLSATQSSVQQVIQYHLLEGHLLVNGRPVGKLPADIRDSEILKELFGNQRLISF
                     PSSMPGMSYMLAAAKEGNYIHLGYRNDRLVIQAQNSRSVFEIIPRNVFVASNSNFDLP
                     GSLVDNCLHWLDLQSGMLEIRRHPRIWGGNTCLVNVKNQTAYRRQDALVDPHSKLFKL
                     IASIFRHFEEPGMLTVVQPPSRPLRVELRRMDLTFYVNRRSLLQCRQLSAEIDPSQDG
                     GTFYGLQSMIILRSIHNRTQRSIITPLGNIRCQRHGMHVNVTIANDGSHARFGVDNIL
                     GRLSSPAEPRLLYHKALLHALTSCFIPDPLTHRTGTEEALSALQSGAYQPWVPLDKDR
                     CQVLRMIANLSPQRKYYPEEKRLQQKVHWHPDLTTTIQHDSLQGAVNAIILKSQRLDN
                     FNAQDSKNEASETTTVPHLRERAICRRFIYERPGIIFPDPSPGIDTPCTRRDTLSSSS
                     RRLSNVREIISLLRHRPTRLRTTKNLKKLLDGQPVIGGYTAGLSPSSLEESLSAEISH
                     QWGRLARLCRDSEPKNAYHLMFEVGILAFGEDVNMDLLRTIVAFFLLDDLKDVDYPGY
                     SSFGEFQANASPILESLKDLMVPCCEDHVRSSLFKTNKKKKKNLVAQLFSDEQVTNRE
                     QECLELTRSLLNEWPCPLPSGANFNPTYIDISVALKAIIPEWTRLYQNLQLSDHIQDV
                     QSILTRYYTPKNDITVPEPPRVSNIFGGTSKRYFTIPHLGRDLLRQLGPRINADTTSN
                     GLDQFMAKKKSHPLVDSQAIQSRLRLSEITELERITEPFVNSSCLVESRYGKDLWKSI
                     AALKTVKAPAIQEADLDIEYIPGVMWLNGLIDEALEVVDHAYGQITESLVSRHPSFTW
                     LQKGNLWPSMAPISIIEQLKSTSSCLFGRNMKEALIAYGLSIVNVQRLMRIKEAFGKG
                     DNARLHEEYRDRGHLNWNPFSYPDWLLLEIDGNFQIREEQVTVAEEMIYPSSGSNSAL
                     QMNMGKGKTSIIIPMIVSVLADGTSLSRVLIPKALLSQTAQILQTRLGGLLGRDITHI
                     PFSRRTPTTTHAVSEYLGLHEEARLRSGIMLAVPEHVMSFKLSGLQRVSDSQITEAAE
                     MVSTQQWLEKNCRDVLDECDFTLAVKTQLIYPSGAQLAVDGHPDRWGVIMIVLGLVVH
                     HLVDLARDFPQSIDVMQHTYTEFPVAYFLRDDIATTLLQRVVDSIFSSQTTILPMANF
                     TNAEITAIRQFISLETVESPVSDQISALLSDKPKLSKNVHLLRGLFVHGILLLCLKKR
                     WNVQYGLHPNRDPMAVPFHAKGVPSEQAEWGHPDVAILFTVLAFYHQGLSVAQLRQGL
                     QAVLNSDDPSTEYNRWIQTSYTLPEPLRYWNIINVDDEGQVLEIWRHLRLKMIVINHF
                     LSKFVFPIHAKQFNIKMQSSGWDIPLSGGLTGQSLSNGTRPLSLTTGFSGTNDNRRLL
                     PLTIQQRDLPGLVHTNAEVLTYLLQTRNREYIRTTHANGKRYSEIDLLKRLGADGIQI
                     LIDAGAFILEMENKTLVKEWLEQGNTMAQAAVYFGPDNKPWVLYKAGKTVPLIATPFV
                     DNMENCLIYLDEAHTRGTDLKLPPSAKGALTLGLNQTKDHTVQAAMRLRQLGTTQSIA
                     FIAPPEVHQSILDVRQKPLDIPIDSSDVIHWLLVQTCATNRDLQPLYFAQGMDFCRRM
                     HGASKYYQFLTRPKHRVAFVKVLQRREHQTLEELYSPLIHTNSDRELSMVNSFAELKG
                     NLSSFAHELEESFRLMGLNPGSVQSSSLEEVEQEREVAFEVEEERQLQRPGALKAHQF
                     PGLHPAIQKFVDTGVFDTDEKGFDAAMVLQSMQLGARYDTRAASLVSHLYVSPEFLRT
                     AHRKNGIKLGHYLRPVNWLLWSQKSEQALIIIPEEAEIIIPRLDKSQAPKVHLIIYAA
                     PVTKRMLHFNNLDYYSLPRLPKNWSPPSWLPFEVGILAGRLYFDFSEYDRLLDILQCR
                     VGKAMDNSVSKIDSVSVGHKNSQNDGLLTFLQEWLAFRRQGQDISHTPMGYICQGLPL
                     RSDHPFWAFKQIEEPNGNANSQFFAQGEGSANDQQEEEYYDSDDKGAFIADHADLIDF
                     DEEHETVQASA"
     gene            <1652338..>1653003
                     /locus_tag="TRUGW13939_09116"
                     /db_xref="GeneID:55996600"
     mRNA            <1652338..>1653003
                     /locus_tag="TRUGW13939_09116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492241.1"
                     /db_xref="GeneID:55996600"
     CDS             1652338..1653003
                     /locus_tag="TRUGW13939_09116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348134.1"
                     /db_xref="GeneID:55996600"
                     /translation="MAATSSAKPQILLISLDLQPWFDDMYSSLIDQLHDKATIQRARK
                     GHSAIRRLSDDPPKAVLVTDAAITTKRYANVWDALLAYVRDGGIAVCMGLFSSFVPPL
                     KIKPFFQKTGLPWEAGSYHRTTVVLDKDNVPVDAVDFLAESYSQKAVFLKNVDNSVAW
                     YRQNGDSVIESSVFPPTHVEDISEVPIALANVGEGKLGYIGDVNTEEPSNAAILAMCG
                     LHG"
     gene            <1653986..>1654897
                     /locus_tag="TRUGW13939_09117"
                     /db_xref="GeneID:55996601"
     mRNA            join(<1653986..1654422,1654480..>1654897)
                     /locus_tag="TRUGW13939_09117"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492242.1"
                     /db_xref="GeneID:55996601"
     CDS             join(1653986..1654422,1654480..1654897)
                     /locus_tag="TRUGW13939_09117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348135.1"
                     /db_xref="GeneID:55996601"
                     /translation="MSKEAEAQVQLDKFSSIFSLEGKVAVVTGGSRGLGLHVASGFLQ
                     AGCSKVYISSRKAAACDEAVAALNALPNKRPGALAISVPADGSKVSELDRLAAEVKKT
                     TDHVDILFANAGATWGATFDEYPEQAFSKVMDLNVKGVFYTVQKFAPLLEAQATVENP
                     SRVIITASVAGLGTGTTGKNATFAYSASKAAAISLTKTLAVDLGPRHILTNAVAPGFY
                     PSKMANALIEIQGGSKSLAQQSPNGRLGQPEDIAGLVVFLSSRASAHVNGAVIPTDGG
                     RLLAAERL"
     gene            complement(<1654980..>1656435)
                     /locus_tag="TRUGW13939_09118"
                     /db_xref="GeneID:55996602"
     mRNA            complement(join(<1654980..1655380,1655447..1656118,
                     1656180..>1656435))
                     /locus_tag="TRUGW13939_09118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492243.1"
                     /db_xref="GeneID:55996602"
     CDS             complement(join(1654980..1655380,1655447..1656118,
                     1656180..1656435))
                     /locus_tag="TRUGW13939_09118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348136.1"
                     /db_xref="GeneID:55996602"
                     /translation="MSLDLTRAPVHQTALRLKNGQLRVEQYAKALLARIAARDPEVHA
                     WAYIDHEYVLAQARKLDKIPAEKRGPLHGVPVAIKDIALTKDMPTRYNSDIYRGTTAS
                     SIDAACVATLRASGALLLGKTHSTEFAATTEGGPCVNPHNVKHTPGGSSSGSAAAVAD
                     FQVPLALGTQTGGSVVRPASYTGVYGFKATWGAISREGLAQYSITCDTPGFFARNVDD
                     LELLAKVYDLEDIPSTKFQLQGARIGFLKTHVWDLAPAGPSLQVAWEKAKDLLTQHGA
                     KVEEIEWPDADFEKLTKWHLAIMNGEGRSAFYGHYVLDKDNLPSFLIDQVENNNNISR
                     LDFLEALDGSARLRPIWDRFSTQYDAIITPSVPDIAPEGLEFTGDASFCQPWSLLHAP
                     CINLPGFAGEKGLPIGLTLVAGRYHDRQVLDTGKTIGNIFEKEGGFNSSL"
     gene            <1656893..>1657854
                     /locus_tag="TRUGW13939_09119"
                     /db_xref="GeneID:55996603"
     mRNA            join(<1656893..1657267,1657319..1657561,1657618..>1657854)
                     /locus_tag="TRUGW13939_09119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492244.1"
                     /db_xref="GeneID:55996603"
     CDS             join(1656893..1657267,1657319..1657561,1657618..1657854)
                     /locus_tag="TRUGW13939_09119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348137.1"
                     /db_xref="GeneID:55996603"
                     /translation="MSPSATVLDSSKANATVGALGTSASGKKLKIRKYPEFETLEGER
                     QYRKQHLAAAFRIFADRGFDEGVAGHISVRDPILTDHFWLNPLSQHFATITVSDLELV
                     NEEGQVVIGDEPINAAAFAIHSEIHKARPDIHAACHAHSVAGKAWSVFGKPLDMMTQD
                     ACRFYKSHAVYDNFGGVVLDREEGKNIAQALGNGKAVILQNHGLLTVGHSVDEAAFWF
                     ISMDKTCQAQLLVDAAASGSGHKKIMISEEEAAFTAEQVGSPEKGWLAFQGYYDEIML
                     RTNGHFLQ"
     gene            complement(<1657914..>1658697)
                     /locus_tag="TRUGW13939_09120"
                     /db_xref="GeneID:55996604"
     mRNA            complement(join(<1657914..1657946,1658002..>1658697))
                     /locus_tag="TRUGW13939_09120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492245.1"
                     /db_xref="GeneID:55996604"
     CDS             complement(join(1657914..1657946,1658002..1658697))
                     /locus_tag="TRUGW13939_09120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348138.1"
                     /db_xref="GeneID:55996604"
                     /translation="MAITISPVRIADVRGSFDVTARALARTSEVIYEMPLTEEARDIH
                     VAHRTKKMLAAEAATANRGEEPTEKAFSFKAVDTATGEIVGVSRWTIYYQDEPVTKTI
                     EEEAMSFLTPALPQVRTKALYAFRMCLERIGRKSVALPPVKEGEDLNSVKMLSKRVYL
                     DVLAVDPSHQGQGIGKALLQWGLDEADRLGLVTFLESTNQGRPLYDKYDFEPTTSDTL
                     DVTPFGLDGVLTHTGMVRQPKIKN"
     gene            <1659527..>1660918
                     /locus_tag="TRUGW13939_09121"
                     /db_xref="GeneID:55996605"
     mRNA            join(<1659527..1659674,1659743..1660250,1660316..1660425,
                     1660490..1660637,1660688..1660767,1660821..>1660918)
                     /locus_tag="TRUGW13939_09121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492246.1"
                     /db_xref="GeneID:55996605"
     CDS             join(1659527..1659674,1659743..1660250,1660316..1660425,
                     1660490..1660637,1660688..1660767,1660821..1660918)
                     /locus_tag="TRUGW13939_09121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348139.1"
                     /db_xref="GeneID:55996605"
                     /translation="MAKDETFETFPLGDWDLQSGGKIYDAHIAFKTFGHSKLPPIVYP
                     TWFSGTISDNFWLIGENMTLNPENYFIIIPALFGNGQSSSPSNQGSESKNVPFPKVSM
                     YDNVRAQHKLVVEHFGITHLRAVLGWSMGGAQTFQWASQYTDFMDLAIPFCGAAKVAL
                     HNMVMLEGVKGALLSAKSIPPPKIGDIAWPTTKGESYRTWSDQEKSIGLKAFGRAYAG
                     WGFSQAFYRAKVYETTLGYKDLEDFMVNFWEKWACSKDPENMLVMLQTWQHADISKQE
                     PYNGDFELALASIKAKTLVLPGKTDLYFPPEDSEYEVKCMKDGVGELAVFPSIWGHWA
                     GGPGDSKEDVAWLDQKLAKFFGSDELCIR"
     gene            <1661370..>1665281
                     /locus_tag="TRUGW13939_09122"
                     /db_xref="GeneID:55996606"
     mRNA            join(<1661370..1661667,1661722..1662096,1662144..1662355,
                     1662421..1663142,1663200..1663320,1664617..1665108,
                     1665168..>1665281)
                     /locus_tag="TRUGW13939_09122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492247.1"
                     /db_xref="GeneID:55996606"
     CDS             join(1661370..1661667,1661722..1662096,1662144..1662355,
                     1662421..1663142,1663200..1663320,1664617..1665108,
                     1665168..1665281)
                     /locus_tag="TRUGW13939_09122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348140.1"
                     /db_xref="GeneID:55996606"
                     /translation="MATQQVRQWGVTPPISMTLPAPEEVAANDELIAELKAQNNFELP
                     SETERRKQSLQLMQRVTIEFIKVVSKRKGLSQAAVEASGGKIFTYGSYRLGVYGPGSD
                     IDTLVVAPKHVLIEDFFSDFPPILERMSPPGAIEKLTPVPDAFVPLIKLEFSGISFDL
                     IFARLIIPSIPLNLDLKNNDYLRGLDDKEVRSLNGTRVTDQILELVPQQKTFRLALRA
                     IKLWAQRRAIYANIVGFPGGVAWAMLVARVCQLYPQATGSVIVGKFFRIMNKWAWPQP
                     VLLKPIEDGPLQMKVWNPKIYHGDRFHLMPIITPAYPSMCATHNISMSTKAVILRELQ
                     RGGDMVDKIFAKQLTWNDLFTIHTFFSKDYKYYLQITASSKTKDAQSVWSGLVESKLR
                     HLVGALDRKSTIAIAHPFPKGFERTHVVKDDAEAEQVKNGSTKFQAQGTSTETTDQTN
                     DPNHNAAAENGAQDAQVPDTASNGESDSRTIYTTTYYIGLDLKPLEPGASRSLDISTD
                     ANIFKSTCTSWQGFQQGINELSITHVRNFDLPDDVFRPEETKPTRPKKKVAKKASAAV
                     THKRNIDAVDALEPVISAQIMTLHHQKHHQAYITNLNAALAAHQTATASNDIPALIGL
                     QQKIKFNGGGHINHSLFWRNLAPAGSAETDIKSAPKLGAAIVERWGSVDAFVDKFKQT
                     LLGIQGSGWGWLIARDSGEKRRLEIVSTKDQDPPASDGTGEAVPLFGVDMWEHAYYLQ
                     YLNNKAGYVSEIWKVINWKIAEERFLGGIEKEVTLKL"
     gene            <1668733..>1670633
                     /locus_tag="TRUGW13939_09123"
                     /db_xref="GeneID:55996607"
     mRNA            join(<1668733..1668851,1668924..1669249,1669311..1669789,
                     1669906..1670210,1670273..>1670633)
                     /locus_tag="TRUGW13939_09123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492248.1"
                     /db_xref="GeneID:55996607"
     CDS             join(<1668733..1668851,1668924..1669249,1669311..1669789,
                     1669906..1670210,1670273..1670633)
                     /locus_tag="TRUGW13939_09123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348141.1"
                     /db_xref="GeneID:55996607"
                     /translation="HFSDTSMMKLILQKPEGVAGASWPAIVIGLFVSFGGVLFGYDTG
                     TISGILAMPYWQSLFSTGYRDSTGHLNVTSSQTSAIVSILSAGTFFGALGAAPIADRI
                     GRRWSLIASSCVFIFGVILQTAATAISLFLAGRFFAGLGVGLVSALIPLYQSETAPKW
                     IRGSIVGAYQFSITVGLLLASIVNNSTKDRNDTGSYRIPVAVQFAWAIILITGMLVLP
                     DTPRFMIKNDDYDGAAKALGRLRRLPVDHIAIQEELGEIQANHNYELSLGKATYLDCF
                     KGNLLKRILTGCGLQALQQLTGINFIFYYGTQFFKNSGFKNSFIISLITNCVNVGSTI
                     PGLWAIERLGRRPVLLWGAVGMCISQFLVAILGTTTTSQDATGAIIVNNEPAQKAAIA
                     FICIFIFFFASSWGPSAWVVTGEIFPLKVRAKSLSMTTATNWLLNWAIAYSTPYLVDY
                     GPGNANLQSKIFFIWGSCCFLCIAFVYFLIYETKGLTLEQVDELYAEVSDARHSLNWV
                     PSITFKEIQEGKGDVVHQEKA"
     gene            complement(<1673329..>1674217)
                     /locus_tag="TRUGW13939_09124"
                     /db_xref="GeneID:55996608"
     mRNA            complement(join(<1673329..1673957,1674049..>1674217))
                     /locus_tag="TRUGW13939_09124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492249.1"
                     /db_xref="GeneID:55996608"
     CDS             complement(join(1673329..1673957,1674049..1674217))
                     /locus_tag="TRUGW13939_09124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348142.1"
                     /db_xref="GeneID:55996608"
                     /translation="MLTMSKPKKYRGITQYLVSDIDTQRADIVLIICGLISGLVDGIS
                     FVAWGSFASMQTGNTVFIALGVSGQPTYPAYLWVKSLVSVSTFMISNIFFGRFMNFLG
                     TKRRLTYVICFMMQSIALLGASLLVQLHVVSPRPEDPRAPIAWNQVLPISLLAFQAAG
                     QIVASRALEHDELPTLVLTTLLCDLLIDPHLFRKVNPKRNRRVACFVTLFMGVMIAGG
                     LFKLTRMSLGLWLAFALKMAITVSWLFWKGATFKDGRDGNQRAGEHV"
     gene            complement(<1677790..>1681208)
                     /locus_tag="TRUGW13939_09125"
                     /db_xref="GeneID:55996609"
     mRNA            complement(join(<1677790..1680251,1680311..1680359,
                     1680410..1680504,1680567..1680875,1680934..1680983,
                     1681057..>1681208))
                     /locus_tag="TRUGW13939_09125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492250.1"
                     /db_xref="GeneID:55996609"
     CDS             complement(join(1677790..1680251,1680311..1680359,
                     1680410..1680504,1680567..1680875,1680934..1680983,
                     1681057..1681208))
                     /locus_tag="TRUGW13939_09125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348143.1"
                     /db_xref="GeneID:55996609"
                     /translation="MSNPSPTKKSGAFSTDPTNTSSSTAPPQPRQIRFVSSDGQPQTK
                     RRRVTAACRTCRKRKIRCSGEQPVCKTCSDYGHTCLGYNDPDKSDKPFTQATIKDEPA
                     ASADVDDDEPPLPRSPTTPRVPTSMAPPDTVKSPKGPKSAAVLPLTKDTLIKATKEND
                     RLGVVDSPESTGRTSLSSINRTHVPYFRYFGPTAIVPGFKQMVVRVRDGRKGNPSQSS
                     GSAPSILSPQLDAPRPLLTSALADGESNSIPFYDRDDNLPASNLITHLCDIFFVHLAC
                     SFPFLQRDRFMKDLKDKRVDTILVDAVCTLAARFSPHPLLSPPRARPIDGEDNQPDVK
                     QSNNGQPFAHRAMTAVVDALSCPTLSVVQACLLLAYEEFGSNHDSGLWMYLGIAIRMA
                     QDLGMQKLQGLKHNYGRTGLRPKAVIIGEAGRLSVEQSESPQTSKSSDTIEGTDEGGR
                     AVERERVDTFWSIFFLDRVISSGTGRPVTLRDEDIELRFPLQSESILSIGWPAPFPPL
                     IRIIHLYGRATDLLNAIQEDNHVDAETLKRLAGMESDLTGIYQRLSPKLHFNTFNFQT
                     YVKAQEGTNFILLHFWFHTLIVLLHQPTLLNSFGGRIQQLYPNSRELSMSSAKTIADI
                     LSFSELIDAKSFIGNPFTSQPMYIAACAFLMEIAYYSSPSSRSGSPGILVTDQTSAFT
                     IPHVDSSSGAERKTTTKHSLLASVAKENYQRCYRALQSLQTYWEGTKYILTVLDQKAK
                     GIGDPLLYTTEEMQSTTEAQPAQPLSSPNWQQPPSRRVSLDPTSWRLDEACSPRMDPS
                     QGKKRGCTTFHCLLTFIFTAIGWALTGEINSSQPNLSLLYQLPAPQMGEPSETQMPGQ
                     GLAAGGASHSGAPYSQALPAYSSGAMTRPANIPTVIPKYHQPPNEAMLSTNPYTPPGP
                     TTPTGPQTVYNNLASSQLASYGYTAPGASTSQPISNNLHMVAPPMMQHISDMLIESQD
                     IDMTSFHNQEAFPFTFSNEFNPWLEYLPADVVNYFGDPSQNYGTTALMSPANGDEQHP
                     QSRQRQRQ"
     gene            complement(<1682576..>1683539)
                     /locus_tag="TRUGW13939_09126"
                     /db_xref="GeneID:55996610"
     mRNA            complement(join(<1682576..1683425,1683484..>1683539))
                     /locus_tag="TRUGW13939_09126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492251.1"
                     /db_xref="GeneID:55996610"
     CDS             complement(join(1682576..1683425,1683484..1683539))
                     /locus_tag="TRUGW13939_09126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348144.1"
                     /db_xref="GeneID:55996610"
                     /translation="MPLLTRFSAASRAVLNYVPRTTTTAAIFGSRGKTTTTTSHHFAA
                     GPDFEQTKASRPDFNPSEPIKYIKPPNGAWQKGDGASDGGASLSAKHVAIDPYAPGRS
                     IASNYKLLVSGIVPRPIAFISTRSKDGTSVNLAPFSYFQVINHDPPLFTVSFVGSIAT
                     AKDTLKNLLETKECVINVISEHFMDAANATAVNAPYGVSEFGLAGLHQAESSTVAAPR
                     VRESVFSIEGKLFETKEFESRAKPGKKTSVLAIIEGTRFWVREDAINEGQDLIDLEVL
                     RPVSRLGGIRYGRTTEVVELERPAF"
     gene            <1684012..>1684299
                     /locus_tag="TRUGW13939_09127"
                     /db_xref="GeneID:55996611"
     mRNA            <1684012..>1684299
                     /locus_tag="TRUGW13939_09127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492252.1"
                     /db_xref="GeneID:55996611"
     CDS             1684012..1684299
                     /locus_tag="TRUGW13939_09127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348145.1"
                     /db_xref="GeneID:55996611"
                     /translation="MPQTTFSSFTSSSTASYTSKTGETKTWGHRNAQQSHRDAEGNTY
                     ERSLSQNLGEDPVYEERQFDSQGHQRLEDGGNHHDLRHQQGRRIEDVSGEK"
     gene            <1684898..>1685260
                     /locus_tag="TRUGW13939_09128"
                     /db_xref="GeneID:55996612"
     mRNA            join(<1684898..1685152,1685201..>1685260)
                     /locus_tag="TRUGW13939_09128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492253.1"
                     /db_xref="GeneID:55996612"
     CDS             join(1684898..1685152,1685201..1685260)
                     /locus_tag="TRUGW13939_09128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348146.1"
                     /db_xref="GeneID:55996612"
                     /translation="MFGRRSRHTTTKTTKPTLMTRLKGPNAKNKTYKTEVTRHDGRHH
                     PHTTSRTAPVHHRRRKPSMGDKFSGAMMRMKGSLTHRPGEKAAGTRRMRGTDGRGSRR
                     VY"
     gene            complement(<1685414..>1687177)
                     /locus_tag="TRUGW13939_09129"
                     /db_xref="GeneID:55996613"
     mRNA            complement(<1685414..>1687177)
                     /locus_tag="TRUGW13939_09129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492254.1"
                     /db_xref="GeneID:55996613"
     CDS             complement(1685414..1687177)
                     /locus_tag="TRUGW13939_09129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348147.1"
                     /db_xref="GeneID:55996613"
                     /translation="MRYLAARSFPTLGAGQQCYFLQTRIHISRYQSCWNHHHTPNTAT
                     RPFSSRQTPETPLDPAPPKIQASVQPRQTHKDREKVVVLGSGWGGYTLSRKISSSKYD
                     CTIISPRSYFVFTPLLTDTAAGNLDFSSIVEPVRDHKTKVDFIQAAARSVDLKKKVVM
                     CEASVVKSGVTESPRVEESERTYEEGPETGSMRGKEHLRQWEQGQMFEIPYDKLVIAV
                     GCVSQTFDTPGVRENALFFKDIGDSRRVKRRLRECFELATLPTTTEEMQRHLLHFAIV
                     GAGPTGTELAATLRDFIARNMDELYPSLKGKARMTLYDIAPTVLSMFDKSLSQYAMET
                     MSKEGIEIRTSHHIEELRWGVPNSCAPHEMDPKGCLTLKTKEEGEVGVGMCVWATGNT
                     MNKFVKNALNGVDEFPEQSVHLNNTNGSTPETRTGWHVKKAPKVGALLVDGHFRVQLE
                     NEESKQTAVLQDVFAIGDNAMPETGAPPATAQATNQEAKWLADRFNQGDIDRVGDFSF
                     RNMGTLAYIGNANALMQIPHEKKDGGRRNPYLPEGLTGRMAWLVWKVAYLSMSISWRN
                     RMRIMFRWANNRVFGSDVSRF"
     gene            complement(<1687909..>1689759)
                     /locus_tag="TRUGW13939_09130"
                     /db_xref="GeneID:55996614"
     mRNA            complement(join(<1687909..1688198,1688276..1688477,
                     1688531..1688969,1689022..1689154,1689202..1689315,
                     1689369..>1689759))
                     /locus_tag="TRUGW13939_09130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492255.1"
                     /db_xref="GeneID:55996614"
     CDS             complement(join(1687909..1688198,1688276..1688477,
                     1688531..1688969,1689022..1689154,1689202..1689315,
                     1689369..1689759))
                     /locus_tag="TRUGW13939_09130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348148.1"
                     /db_xref="GeneID:55996614"
                     /translation="MARDPVSSVFSSAAVDSHTPQEMPSPTHSLPDQGTPLLSSPAPN
                     EETAEEIEAASRARNKHIWRLCFAIFALVQAANVVLRAPFIQLREDSVCMAEYGTAGS
                     LGEDCKVQAVQDEVTTLTQWQQLFDTGPGILFGVFYGMAADRYGRRPILALALAGMTM
                     ATIWAQIILFWPRVFPTRLTWLSVIFQLVGGGNLVVNAMIFAMVSDVTPEEKRASKFF
                     RLYGVALLSDMILSPASEALTGMQPWWPARFGLIAFIMALLATWLVLPETMEMSEVVH
                     SIRLEEEEPEEEDDPVVYSDVRKSTFWRRSRKIVSRLQDLRLLIASRQLLLLVPLLSV
                     GQLYDQSADFFKNYISQRYGWRMSQASFWLTYRNVVNLILLSTILPAVSEMLLRRNFN
                     GGQKDKWISRASIVCLALGAFVIGLAPIMSIMVTGLTIFALGHGFVPAALSLATPFIE
                     PGHIGMLYTAMTIGEAIGKLANEPALMGAFELGMRVGGLLLGLPFVATGIMLTIAGIS
                     VFAIQPPLPATHLD"
     gene            complement(<1691240..>1694782)
                     /locus_tag="TRUGW13939_09131"
                     /db_xref="GeneID:55996615"
     mRNA            complement(join(<1691240..1694296,1694447..>1694782))
                     /locus_tag="TRUGW13939_09131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492256.1"
                     /db_xref="GeneID:55996615"
     CDS             complement(join(1691240..1694296,1694447..1694782))
                     /locus_tag="TRUGW13939_09131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348149.1"
                     /db_xref="GeneID:55996615"
                     /translation="MSKLYRARPENYTVGWICALPIELAAARRMLDEIHKDSYRHVND
                     ASIYTLGRIGEHNVVVACLPYGQTGTSSASAVATRMMSTFPSIEFGLMVGVGGGVPSQ
                     DVDIRLGDVVLEARFMKCFSTLNTWPEFSQEDVGPDVLFEPSYDHISGETCVNCDQKK
                     VIKRNPRGRDFMVHYGTIASGNQVMRDATERDKVNSELGGVLCFEMEAAGLMNTFPCL
                     VIRGICDYADSHKNKRWQAYAGGAAAVYAKQVLSVIPSTDVSRLGLVNHDFAEENGSS
                     IPRGANRFRGESLDRNTELWREQTRKAKEIELLKKLNVCPYRAQKERNPDRIQGTCGW
                     FTAHRLFRDWKDSSTSRILWVSADPGCGKSVLAKYLVDDVLVANKSRTICYFFKDDFD
                     DQRIIVSALSCILHQLFMQKRILLSETILEQFEVSGENFTSSFDELWNTFISIAEDEN
                     AGGEIIVVLDAIDECEECGRSQLIKSLCKLYGKKRNFNLKFLLTSRPYGDIRRGFQPL
                     EIPEFPIIRLSGGGEVESKKISQEIGIFIEVRVSEIGAKLKLKHEEQELLLQKLINVP
                     NRTYLWVHLTLDLIENNFNIDKAGIVDAISHLPHTVDEAYERILSRSRDSDQAKKLLQ
                     IVVAAIRPLTLKEMSLALTLTENHHSYSDLDFKSEERFREDVRDLCGLFVTVIDSRIY
                     LLHQTAKEFLVQGPLGSVREDFKWKHSLQPQESHRILTDICIRHLNFTEFETNPLSED
                     AIPEYIDSHTFLDYSAKNWVTHFHESHIKDGTVIQSLLRLCDTTSSRCLTWFRIYWTS
                     THTDFPKSFTTLMVASYFGFRIVVNILLESNDIDLNLKDGTYRRSALSWAARNGFAPV
                     VQLLIRGTGSYLKSIVKLAFRKGAQVDSVDRYRRTPLLYAAWNGNVAVVKVLLNAGAR
                     IDVADEIDGTPLSYAIFGGHKAIVHLLYRNATQVHSEYMISENLLFPAVEKGHEDVVK
                     LLLETAGANPNLRDNNGQTPLWWAAWNGDEAIIKLLLEIGRADPDPKDNNGRTPIWWA
                     SWYGHEAIIRLLLETGKVDPDLKDNNGQTPLYWAARNGRKAIVKLLLETGKVDPDPKD
                     NQGYTPLWWAIQNNNKVIIKLLLETGRVNPDPKDNHGRAPLQ"
     gene            <1697278..>1698376
                     /locus_tag="TRUGW13939_09132"
                     /db_xref="GeneID:55996616"
     mRNA            join(<1697278..1697383,1697450..1697642,1697694..1697741,
                     1697829..1698100,1698192..>1698376)
                     /locus_tag="TRUGW13939_09132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492257.1"
                     /db_xref="GeneID:55996616"
     CDS             join(1697278..1697383,1697450..1697642,1697694..1697741,
                     1697829..1698100,1698192..1698376)
                     /locus_tag="TRUGW13939_09132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348150.1"
                     /db_xref="GeneID:55996616"
                     /translation="MKSAILLAYFALPWAFATPQHAIDSPHWKPAGPNDFRGPCPMMN
                     TLANHGYLPHDGKGLTKEVVTNALKSGLNFNTSLGNLMFEMAIVVNPEPNATFFTLDQ
                     LNRHNVLEHDASLSRSDAYFGNNHVFNQTIFDESRAYWTAPILDAKMLANSKIARQVS
                     SRASNPNYTFTTKTEAFSVGEVSAPIIVFGDMDTGVVNRSLVEYFFENERLPTELGWT
                     KKADPISLDKITQMSQLITNATSLLTGSVDIKALKVRDLHSGFIPHGEH"
     gene            <1699136..>1700059
                     /locus_tag="TRUGW13939_09133"
                     /db_xref="GeneID:55996617"
     mRNA            <1699136..>1700059
                     /locus_tag="TRUGW13939_09133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492258.1"
                     /db_xref="GeneID:55996617"
     CDS             1699136..1700059
                     /locus_tag="TRUGW13939_09133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348151.1"
                     /db_xref="GeneID:55996617"
                     /translation="MSPKQGRKIALVGASGNVGSQTLSALLSQNIHTITVIQRPESTA
                     EFPPKVILNKGPLDDEAFLAGALNGQDVLVLQLPRPVTDIRPGLIRAAAKANVKYILP
                     VEFGTDPEAKIVDEFDHLAQKRETRKLVEDLGTSSWIAVVTNPWLDLGLSVGGWGIRV
                     KERKAALFEGGNTKVNTSTLKRSGEATAELLSLPETELVKFRNRAFFISSFYVSQQEI
                     FESVLRATKTTEKDWDVTTPTVNDVTKESDEALKAGNFMKSFLDKYYMTHLREGFGGD
                     YNDKVDSKNLRLPEEDFDKVVAETLKSAGLA"
     gene            complement(<1700730..>1701488)
                     /locus_tag="TRUGW13939_09134"
                     /db_xref="GeneID:55996618"
     mRNA            complement(<1700730..>1701488)
                     /locus_tag="TRUGW13939_09134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492259.1"
                     /db_xref="GeneID:55996618"
     CDS             complement(1700730..1701488)
                     /locus_tag="TRUGW13939_09134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348152.1"
                     /db_xref="GeneID:55996618"
                     /translation="MSTSNNKEATQDGTVLHSLFGRTVVRVDNNLVIKSGRLRSHEAQ
                     TLRFIAANTTIPVPKVHGIRWKDGQVVAIVMDYVPGRRFDEAWATLDTKQKLSIADEL
                     HSYINQLRNLKGDYIGAVERGKAVIGQIASIEGGPFDSEQEFNDFILGDIVKAAPDIL
                     RHYAKFALTDDHEIVFTHSDFAPRNILVDEGRVTGIIDWEYAGWYPEHREYIQALKYL
                     KPMPDWPEYLSRILPPRFVREYIGMSFLGRILTH"
     gene            <1702151..>1703176
                     /locus_tag="TRUGW13939_09135"
                     /db_xref="GeneID:55996619"
     mRNA            <1702151..>1703176
                     /locus_tag="TRUGW13939_09135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492260.1"
                     /db_xref="GeneID:55996619"
     CDS             1702151..1703176
                     /locus_tag="TRUGW13939_09135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348153.1"
                     /db_xref="GeneID:55996619"
                     /translation="MTMPPQAPPFLGIMGFPPGFEEGPFGGPGRHHGGGRGGHPCRGR
                     HHPGFGPRDFEEPLSHGHGRGGMFGSRGHHHGPHGHHGHHRGMHRGRGGRGGRGGMPG
                     SFDFSFLQNFAAEMDPANAWFGPRDGRGRHQSDNPVDFVPRADVFNAPTEYVVHVSLP
                     GANKADVSVDYDPEESTLRLSGVIHRPEFTEELHRAMVIEERHYEVGVFERNIPLGTR
                     EAPASVDNENISAKFVDGILVVRLPKNQNNPAQFHKKVYIEGDGSDNVEKETEPETSY
                     VNEKHASVLEVADETDTMHLDTDTEPGDLLKEVEEHSSYTPSHDSEEEDLYDIVKSKE
                     NIKVNVE"
     gene            complement(<1703574..>1704353)
                     /locus_tag="TRUGW13939_09136"
                     /db_xref="GeneID:55996620"
     mRNA            complement(<1703574..>1704353)
                     /locus_tag="TRUGW13939_09136"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492261.1"
                     /db_xref="GeneID:55996620"
     CDS             complement(1703574..1704353)
                     /locus_tag="TRUGW13939_09136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348154.1"
                     /db_xref="GeneID:55996620"
                     /translation="MFTQAKSETSYLTFLELRKHKMARFDGKTVVVTGAGSGIGREVS
                     LCFATEGATVIALDISCPMPFEESNIHYRKHDVRLEEDWNSLVTELSTKEGADCLVNS
                     AGIMDYAPLDEVDLSSWRRTMAVDLDGVMLGMRAIIPLMKERGGSIVNISSVWGLVAV
                     SGCAAYHAAKAAVTHLTRNAAVTYAPHNIRANAIHPGIIATPLVLKQPDEFNQAMISR
                     TPLGRMGKPVEIAKCVLFMASDDASFMTGAAIAVDGGWTAQ"
     gene            <1705009..>1706398
                     /locus_tag="TRUGW13939_09137"
                     /db_xref="GeneID:55996621"
     mRNA            join(<1705009..1705111,1705178..1705500,1705562..1705841,
                     1705894..1706051,1706114..>1706398)
                     /locus_tag="TRUGW13939_09137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492262.1"
                     /db_xref="GeneID:55996621"
     CDS             join(1705009..1705111,1705178..1705500,1705562..1705841,
                     1705894..1706051,1706114..1706398)
                     /locus_tag="TRUGW13939_09137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348155.1"
                     /db_xref="GeneID:55996621"
                     /translation="MAHAPPAPKSLLGRHRLLAPNASVRISPLCLGGMSLGDRWKAGL
                     GDFNKEGAFELLDAFYDLGGNFIDTANAYHGGQSEEWIGEWLQKTGRRDEMIISTKYT
                     MGYKLGQPVQQSNFGGSGTKSMHIAIQDSLKRLQTTYVDLYFVHNWDYATSIPELMQS
                     LNTLVQQGRALYLGISDTPAWIVTKANAYARQHGLRPFSVYQGRFGAHARDLEREVIP
                     MCLDEGMAIHVWGVLANGFFQPPGSTKEDGRNTAFIKNGREAQVSETLDRVAKRLRVP
                     LTSVALAYALHKAPYMIPIVGGRKVTNLKTNIKALGLELSSEDIAEIETGYAFDLGFP
                     HNFINMEGKPPTGPQDATILKQLGYFDYVQPPHPIKPHKDQLDAQWKP"
     gene            <1706924..>1707499
                     /locus_tag="TRUGW13939_09138"
                     /db_xref="GeneID:55996622"
     mRNA            <1706924..>1707499
                     /locus_tag="TRUGW13939_09138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492263.1"
                     /db_xref="GeneID:55996622"
     CDS             1706924..1707499
                     /locus_tag="TRUGW13939_09138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348156.1"
                     /db_xref="GeneID:55996622"
                     /translation="MKTSSALLFLAGIFATPSYGTTCPILSTPSYGVKDAIFTACSNT
                     TIEAPASLVYKILTDYDTYHEWNTFVVDVELLTSPPYQVGSRMHFTEAQLLPLFNTTS
                     NEIITSLDPENTTAVWRFDSPTPALILAEHVSQVVSLGDNRSWYNSWETYYKSASILV
                     ETTLGEKLISAFEIQGEDLKKRAESLAQDSN"
     gene            <1709260..>1711026
                     /locus_tag="TRUGW13939_09139"
                     /db_xref="GeneID:55996623"
     mRNA            join(<1709260..1709652,1709703..1709819,1709871..1710242,
                     1710296..1710407,1710456..1710578,1710631..1710819,
                     1710869..>1711026)
                     /locus_tag="TRUGW13939_09139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492264.1"
                     /db_xref="GeneID:55996623"
     CDS             join(1709260..1709652,1709703..1709819,1709871..1710242,
                     1710296..1710407,1710456..1710578,1710631..1710819,
                     1710869..1711026)
                     /locus_tag="TRUGW13939_09139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348157.1"
                     /db_xref="GeneID:55996623"
                     /translation="MAFNVLTTNATELQRLLQENKITSVQIVHEYIAQIDRHEPALNA
                     LISAAKRDNVLAIARSLDQERQKGKLRGPFHGIPIILKDSFVTASDLGMSTTVGSRAF
                     IGSKASKNGVITQQLIDGGLIILGKGNMTEFAGMKMTTMMPGWSAHGGQTLSPYVGKL
                     EENEKLLGHSAPGGSSTGSAVAVAAGFSPLAMATETIGSIVTPSTRAALYALKPTTGI
                     QDVTGLHTMTDFFDSAGPMAKSAEDVRVLSEILLDRTFNFSPSGSWEGLSIGFLDPKV
                     WTMASDFCTQFEGTAEQMVDEYEDTVSSLKSHGCSLKYPIDLKDVSTLSDILPIAYWD
                     FKNVCIPRFIKAFDECPVSSVADIVKYNRDNSKTALPAPFTEQNDLEGAMNSNDEKEK
                     IDALKLDLRNAAKDILDDAFDKEKINIIAAPGDSPLCVHAAAAGYPVATVPIGQLRYN
                     NRPFGLCLLAKANEEETLLRFMNAYERVGKPRPVPNI"
     gene            <1712854..>1713588
                     /locus_tag="TRUGW13939_09140"
                     /db_xref="GeneID:55996624"
     mRNA            join(<1712854..1712900,1713114..>1713588)
                     /locus_tag="TRUGW13939_09140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492265.1"
                     /db_xref="GeneID:55996624"
     CDS             join(1712854..1712900,1713114..1713588)
                     /locus_tag="TRUGW13939_09140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348158.1"
                     /db_xref="GeneID:55996624"
                     /translation="MSSTYGPITSAGTVTSSVHYCVFLGYLCESSIPTGTITIVQAAE
                     TWDVYTTTTTSLSTPTVIWGVQVNGFRIQPPKTSAATTTSGGDGGVSPSTQTGDGSGA
                     TSSSSTSTSESSKSSSSDLSTGSIVGIVMGTVSAVAAVLGLLFRVYTYKKTQKRQQQQ
                     QLAQEGTQSIKET"
     gene            <1715711..>1717003
                     /locus_tag="TRUGW13939_09141"
                     /db_xref="GeneID:55996625"
     mRNA            join(<1715711..1715974,1716038..1716218,1716273..1716445,
                     1716511..1716610,1716705..>1717003)
                     /locus_tag="TRUGW13939_09141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492266.1"
                     /db_xref="GeneID:55996625"
     CDS             join(1715711..1715974,1716038..1716218,1716273..1716445,
                     1716511..1716610,1716705..1717003)
                     /locus_tag="TRUGW13939_09141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348159.1"
                     /db_xref="GeneID:55996625"
                     /translation="MVQEFAIPKGSTVVITGANGYIASHVADILVGLGYLVRGTVRSE
                     KPWLDQLFEEKYGKGKFQTVVLPDLAAEGVYKDVIKGAAGFIHVASDVSFDTDPNQVI
                     PVVINLTTNALNAAAQEASVKRFVLTSSSSAALWPTADNEGLVVDENSWNETAVKAAW
                     DPNTPEGEKPLNVYGASKTEGERTAWKWVQENKPGFVFNSVLPNFNTGPTLHPEIGGS
                     TMSMIRSLLKGDDMFVKMIPPQYYIDVRDCARLHVAALLDTSIKDERIFGFVHEFNWT
                     DVITLLRALRPDNKLIPDPPTNERRDRSLVKSKVRAEQILHFFSGRAWTGFNASVEAG
                     IAGF"
     gene            <1717882..>1720541
                     /locus_tag="TRUGW13939_09142"
                     /db_xref="GeneID:55996626"
     mRNA            join(<1717882..1717959,1718023..1718322,1718381..1720334,
                     1720396..>1720541)
                     /locus_tag="TRUGW13939_09142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492267.1"
                     /db_xref="GeneID:55996626"
     CDS             join(1717882..1717959,1718023..1718322,1718381..1720334,
                     1720396..1720541)
                     /locus_tag="TRUGW13939_09142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348160.1"
                     /db_xref="GeneID:55996626"
                     /translation="MASTPHSRAYRKVSKACQRCRRQKLKCDNQRPCVPCTRTGVDCR
                     PPSPEKWKIYGTCMSSALDPQPKRARMGDPPPENNQSQDNGDISRHGDDSNSIILEDG
                     SAQANDQIADNSDRPWRSSSTMSLAFRFYNANSPGFSVTAAIAREQRNFVSSGERLPN
                     EGPGTAFENASTLNPSNEKLGTIRGVAHSSRLAVSDLLELLPDFGVAALLVDTYFDRV
                     HWFMLIFHQDEFRKRWQNLYEIANNRTALKNSDIGFLSVFLMVIAIAMQYVGTHRKRL
                     LARRNFDYEKFGGRIFAAIRSKLLDIVSLESLEAVQTCVLLGTYYLFHGSPGLAWPVC
                     GCGLRIAQALNLHRKISRSGSDSALSVDLRNQNETRKRCWWAIYEIETFCSMSYGYPH
                     SIKDTDCDVEPLDPSAKLQFVQSPTSFDEPLKCDVTLLSYKYFMSKLSVLIKAILADL
                     YGIGSVSNVENPTSSVGSTDDLRCLMKQVVGFDTKLRLWNAEIPSRLQFRGNTGVQTS
                     YSSLDDMDTDIGASSPRFEEHIFQLQALALKLAYENTRILVHRPLLSYKLVSKQKSTQ
                     PTAPSWDALDYADPFLLSLKSCREAALNTSEIAWMPISGLVSGTYAATFVSIHAFTSG
                     VTLGILSSVEPLSQESHESKSGLHRLMNIQTRLKDRSPSAVQGLEILQRLTRHVMEKE
                     LNAMLDISRPLKSKNLIAGTSSYGSNSPTPRQTVPPAELQQFVQLSPSATQQPSVEPS
                     SQNASDLLSGAESTRNIPSLQNGTDYALSQEVSELDQVMPTSTIQFESQLEQTFIDSS
                     LDWLATDDFSGCEQAWIWCLDNRAFAD"
     gene            complement(<1720657..>1721448)
                     /locus_tag="TRUGW13939_09143"
                     /db_xref="GeneID:55996627"
     mRNA            complement(<1720657..>1721448)
                     /locus_tag="TRUGW13939_09143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492268.1"
                     /db_xref="GeneID:55996627"
     CDS             complement(1720657..1721448)
                     /locus_tag="TRUGW13939_09143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348161.1"
                     /db_xref="GeneID:55996627"
                     /translation="MAAKESIKVTLHQLAKMIDHSLLHPTMTDADILNGLKIAREYNV
                     ATACVKPYLIPLAKKELAGTGVLVCPVVGFPHGNSTTEMKVAEATDASKAGGAEVDMV
                     VNIGKVLGGDWEYVTREIGQINDAVTANGAILKVIFENDYLKPEHIARLCEICTQLGV
                     AFVKTSTGYGFVKQADGSYNYRGATVKDLKLMREKSGSKVQIKAAGGVRTLDDLLHVM
                     SIGVTRIGATATVAILEDAKKRGIGNEPVEVSFELMPEDGDAGGY"
     gene            complement(<1722110..>1723325)
                     /locus_tag="TRUGW13939_09144"
                     /db_xref="GeneID:55996628"
     mRNA            complement(join(<1722110..1722395,1722471..1722597,
                     1722659..1722679,1722746..1722911,1722977..1723162,
                     1723248..>1723325))
                     /locus_tag="TRUGW13939_09144"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492269.1"
                     /db_xref="GeneID:55996628"
     CDS             complement(join(1722110..1722395,1722471..1722597,
                     1722659..1722679,1722746..1722911,1722977..1723162,
                     1723248..1723325))
                     /locus_tag="TRUGW13939_09144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348162.1"
                     /db_xref="GeneID:55996628"
                     /translation="MANSKLLREAVVILGAGTQGRRLAYMWSSTGKPVHLVDQQESQL
                     SQGLDHVHQLRTSSSSISTNWGKITTSKPSSLKEELEKAWLAIECVPENFALKQSVIS
                     QLDNLAPDQTILASNSSSYVIGEIIENLSLNNPRRVLSAHCYWPPETPAIEIMGYEQT
                     DPSIIDLLVKKSEEHGFTPYRVRKPSVGYIYNRIWAAIKRETLLTLSEGVASPNEIDA
                     IFRDVLKTPKGPCELMDVVGLDVVLDIEKHYAETRKNLPSEPQKYLQDMIDAGNLGVK
                     NSRGFYKYPRE"
     gene            complement(<1723745..>1727170)
                     /locus_tag="TRUGW13939_09145"
                     /db_xref="GeneID:55996629"
     mRNA            complement(<1723745..>1727170)
                     /locus_tag="TRUGW13939_09145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492270.1"
                     /db_xref="GeneID:55996629"
     CDS             complement(1723745..1727170)
                     /locus_tag="TRUGW13939_09145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348163.1"
                     /db_xref="GeneID:55996629"
                     /translation="MSRSRSMSTAGSDRGDRLEPKLLRAAENNDIDGLKHIVEVARDK
                     GQLSPAFLELGLMRSCDRGRVEATRFLLEEGASFEGAGNRAPPVFRATERNQVQIVKL
                     LLDAGATPEFRDKKGRTALMTAAWKNHWHVLQLLISRGADVNATDNRKRNILHNLAAD
                     KQCDWGDDVVNMLLRTTCDLGARDELGRTPLHWACATGKTHFAELLLECPHGCPSTYI
                     DAVDLRNKTALHMATAHDREDVVELLVENDADVNARSDGGWTPLHNASDKGFQNIVRL
                     LIKEGADVNSQLLNGITPLHLAAQAGHTDVVECLLERPELRRRTRDTFGSTPFLRAAQ
                     FKRKDIVRLLAPFNHVEALSEDAIGACKGFDATIVDFGNFHNENRVKKVSVYELLYGR
                     DSKNPRKQAIATLPTNVKATEFRWIHLPANNMAWVEALMTKSFIEEGAGDIEGFKGLE
                     KSFNHQHRGQRPHSHFMRPLCQSTPRAPRNRDEDEEGEDQKSPEKEEDPLPRLVINGP
                     AITKPPDTPPPSFKKRETGLSKESQSQDDDSASGRKSRGQSKRNKSGKDASKSEKNKP
                     SHGVDKKMRPSLSPSLREPTPTVRSNICMFMPYLHFETTECQQKMREAIIEAEKRITP
                     LPRLTRESTRDEMLIRAHVNSSNASLHVRRTLDQFFYPNIDTKTRDTDQVVYRYQKRW
                     DEQITRDPKIFMVDQLWMWILGKNLIVTSFPQRWEQPKNDPLNVLDGIIEDINSKTRE
                     PVRSVYELATIISGRCSGVFDRHRMGDEEYQFLDMFESSIGTATDRETVLFREFNIAS
                     AQASEWLKHHRQLNLGRGSYLSGDNDDDDDDENTQPLFVDKLLDIGQETDLLAEAKDI
                     RDELNMIRTVLEYQKQVLIDLQDAICEIYLGQHKSQSELKKKFREQQRIVEMHVKDVD
                     RMDKQTERIYHSITDLLDLKQKHANAFEARFARDQAAGTARQGKTIMMFTVVTIVFLP
                     LSFIASFFAINVEEFPHEPSGNTNLPISYVSKYIFGIGFAISIPLVLLALSVDDIRHG
                     ARAVYRRIREWRLRNRQGPKSLLQTRHQQQHTLDLTNNKQGSMAAQALEIERILSGAK
                     VRQSVESDYFGGGLLPVATRNTARRGATTTPLHIYANNLAAEKGFSMRGTNMM"
     gene            <1728456..>1729799
                     /locus_tag="TRUGW13939_09146"
                     /db_xref="GeneID:55996630"
     mRNA            join(<1728456..1728610,1728664..1729001,1729101..1729550,
                     1729615..>1729799)
                     /locus_tag="TRUGW13939_09146"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492271.1"
                     /db_xref="GeneID:55996630"
     CDS             join(1728456..1728610,1728664..1729001,1729101..1729550,
                     1729615..1729799)
                     /locus_tag="TRUGW13939_09146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348164.1"
                     /db_xref="GeneID:55996630"
                     /translation="MSTKPTVLIIGGGIGGLALGQMLRKNSIPFRIFDRDASSTARRQ
                     GWCMTLHWVINDIKANFPEDILPLLDTVSHLDNYGTACDAALYNGGTGNKNIHLSPTE
                     SNPFIRANRAKLRGMLSTNLTVEFDKQFEHYEETDSGVTAFFSDGSLAKGDILVGADG
                     SHSLVRQQLLGSEHSKNYSLPMEVCMGETTLTKPQYEKIFTEFAKSWYAAETRANFFC
                     GLHGVSDDKETARYYWMTVQQKNTRDKTSVSNLEYYHRATQAVKGIHSKFLMPLYNTT
                     PEGMVNPPLSLEDFIPPKEGLPKGRVTLLGDSLHLMTPFKGSGGNLAIKDGLDLASLI
                     ANSGENIPALLQEYASLAIPRATELVLESRTRTEVWTGDNN"
     gene            complement(<1732051..>1733690)
                     /locus_tag="TRUGW13939_09147"
                     /db_xref="GeneID:55996631"
     mRNA            complement(join(<1732051..1732387,1732453..1732799,
                     1732889..1733466,1733528..>1733690))
                     /locus_tag="TRUGW13939_09147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492272.1"
                     /db_xref="GeneID:55996631"
     CDS             complement(join(1732051..1732387,1732453..1732799,
                     1732889..1733466,1733528..1733690))
                     /locus_tag="TRUGW13939_09147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348165.1"
                     /db_xref="GeneID:55996631"
                     /translation="MAETVVDRVARHPALNLKVIIVGAGVGGLLSALECWRKGCDVVV
                     LEKNKDISLLGDFVTVPPSGISTFKLYPTMDEQYQKNFYDCTISIWNPEGKCLKRMFP
                     EWRHVAEKGELPRASLLSRRSDFTRMLYDQCIRLGIPVYFSQAVQEIVEHDDHVVINT
                     NQPGITLTADVCVVANGIGYPSTKDITGIDLPVLDSGYAIARMAFPRSSIPKGSLAHQ
                     LVENVDTQPEFRVYLSNDIHLIIWLTKDSGDGKAIESWHNLRESAVLVDQLEQKCSSW
                     DPAVIDFMRRIPGQVVDWGLRSRDPVEQWTSAGGRIVMLGDAAHTFLPTAGNGAVQAC
                     EDAISIAECLRQGGKQGAPWSTRVYNKLRFERTSILQQTGFTNREELHYANLDEIARN
                     PEISDIGFFKIGRWVWAHKPEAYAIENYQKCLDYLQTNGSSEFRNTNVPPGHVYRPWS
                     MESEHARMTAGIRSDLKSNGDWSV"
     gene            <1734098..>1736026
                     /locus_tag="TRUGW13939_09148"
                     /db_xref="GeneID:55996632"
     mRNA            join(<1734098..1734100,1734160..1735107,1735172..1735299,
                     1735365..1735666,1735722..>1736026)
                     /locus_tag="TRUGW13939_09148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492273.1"
                     /db_xref="GeneID:55996632"
     CDS             join(1734098..1734100,1734160..1735107,1735172..1735299,
                     1735365..1735666,1735722..1736026)
                     /locus_tag="TRUGW13939_09148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348166.1"
                     /db_xref="GeneID:55996632"
                     /translation="MIPLVYLAKNFLKLSEMQLALQLVAIVAGALCYVGYFHHGEHHL
                     HALTYIQVHTVAFLGLAALLYLDGFLLVEAVLQTCVYDALFLAGLYASLLVYRVFLNP
                     LNTFPGPKMARITSFYMPFRIQKMQMYKALHELHRDHGYFVRIGTGELSITHPRAIQE
                     IFGADSVCEKSPWYDISRPQDSLLLRRSFAGHAELRSVWSHAFSVKAVKGYEDRVQKY
                     RTKLISGIDAHNGQAVDVNNWLGLYSWDVLSDLSFGHPFGMLDSKERHWALKILDHGM
                     SVIGPHLPMWWLRLMIAMPGGKEDMKLMLKYCQEEMLLRWKNEPKQPDVMSHLFVPYR
                     RNEKPWNDEAVNLLAGEAHLLINAGSDTTRVTMACALFALTKQPELAKRLREALEPHV
                     SQSPDAVILDDKISNIDLLNGIISESLRMYPPSPSHPTRVTPPEGTMIAGKFIPGRTQ
                     LIAPQYVIGRDETIFPRATEFIPERWYSSPHLVKDKNATAPFSLGPMNCVGKQLAMTN
                     VRVTLATIVMRYDLSFAPGRANPTTDFVEGMCEHFSLQPGPLYLRMEKRQVPK"
     gene            complement(<1736346..>1737095)
                     /locus_tag="TRUGW13939_09149"
                     /db_xref="GeneID:55996633"
     mRNA            complement(join(<1736346..1736941,1737008..>1737095))
                     /locus_tag="TRUGW13939_09149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492274.1"
                     /db_xref="GeneID:55996633"
     CDS             complement(join(1736346..1736941,1737008..1737095))
                     /locus_tag="TRUGW13939_09149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348167.1"
                     /db_xref="GeneID:55996633"
                     /translation="MSQVSQSITLEQLSDHNTLQSLWTAVHGHVYDLTAFSSDHPGGI
                     EALENCAGTDGTESYDYAGHSESNMAKMQQYRVGTLAGSFEQQASPISHNNTFPVESK
                     RITSATSRPKQRKFRCWTSLAVTTVSTTSLVVALSYQRSDSGFGYISSTLGISQLRFR
                     NISDQNTGYAFWAGIAIASSISCVGFSYLYKLFLSTLNYENDIFSFPPTIPRKTKKNL
                     NHHASKQST"
     gene            <1737565..>1739302
                     /locus_tag="TRUGW13939_09150"
                     /db_xref="GeneID:55996634"
     mRNA            join(<1737565..1737694,1737768..>1739302)
                     /locus_tag="TRUGW13939_09150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492275.1"
                     /db_xref="GeneID:55996634"
     CDS             join(1737565..1737694,1737768..1739302)
                     /locus_tag="TRUGW13939_09150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348168.1"
                     /db_xref="GeneID:55996634"
                     /translation="MQKEFYIGAKGGEDSHTLDVSPFTSLEQLTRALADIFAFADTRS
                     LWLIDQQGNHISTLKDVQETNDLIELRVTRYESIREPPGPRSLPFVGNHYELYPDVLG
                     NYDRLFSLYGPMIKTVNMGTTIFHTNDPEIARHLLREDKLFTKTTSDVTHPLYYMNDQ
                     DALFTCDTASPAFAPSHKFVPPTMSPRAVAHFMPLIQEATQSIFTAFDELAESDRAIN
                     VYQYMFKLASQIIWRVVLNQDLKHFESTKTPPSLPIRLLGQYLSLMKKASLQPQWFKY
                     LPFGDAAKVKQVRQQVLDICEDAMSSCIKKDGPPLYLSDPTALQSATCVADFLYRARD
                     KEGQGLPYDLVLGNVVSTAGAGFTTSSSLLSWAIYALVRYPGNQERLFEEIVGHRGGN
                     GIDNCWTYDEIHSMKFLDCFIKEVLRLHSPSFQTARNAKKDAILPGGYLIPKGSIVIA
                     CFPSIHKNPAHWENPLRFDPDRWMEEGLAAQMGRQGSYTPFAAGGRGCVGFNLALTQV
                     KVVVAELVYRYEFEDSSPEPVVYDPEFLVVRPLNFYAGITRRKESP"
     gene            <1740069..>1742336
                     /locus_tag="TRUGW13939_09151"
                     /db_xref="GeneID:55996635"
     mRNA            join(<1740069..1740818,1740875..1741130,1741186..>1742336)
                     /locus_tag="TRUGW13939_09151"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492276.1"
                     /db_xref="GeneID:55996635"
     CDS             join(1740069..1740818,1740875..1741130,1741186..1742336)
                     /locus_tag="TRUGW13939_09151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348169.1"
                     /db_xref="GeneID:55996635"
                     /translation="MCGISTCILINGHSNNTACNVETNGDHTTNDVAKELAADLKASV
                     DIINHRGPDDSGIWISANEQVGLAHCRLSINDLSSAGRQPLHSSDNQLHAVVNGEIYD
                     YARLRHECETIYNYPFQSDSDSELVLALYKIHGAPEFLTHLRGEFAFVLYDGRDGAQR
                     LIAARDRYGIKPLVYTRVGSKLLVASEAKAFLPLGWKPRWDVRAIADAGWMFDGRTLF
                     RGVRKVLPGHYLDITEQGVRQVKYWDAEYEDKSKPETRTIDEMISGVRERLVESVRLR
                     LRADVPIGIYLSGGIDSSAIAGIVTDLARKENVKIGNEETARVTCFSVAFPETSGYDE
                     SHIAERTADWLGVKTIKKTITEDTLAEDFADAVFHCEHHHFDLNFVAKFALSTLPQEH
                     GIKVVITGEGADEHFAGYPYFPAEFLREADESLPDSPLSQNSDLRNEMFQAVQREMKG
                     IWRNGGATAYEDRPALPSIAGVGATAMSDNLLPWHPTATIFAPWLQNRQGAEYDCRRT
                     VLASYASDVQARMRSRWHPLHTSMYMWNKNSLANVLLSCLGDRTEMAHSVEARTPFLD
                     HHLTEYVNRLPPSVKLHYAGWNGAKGGKLGPIWNKSNMALQSLSEKWILRQAVRPYIT
                     DELYTRKKQPFLAPTRWAKEGPLHQMFKLLLTQQVVEELGFVNYTTVQEAMEIAWGEK
                     ADPKAFRLLVYCGAWVVLGQRMGVAKADVSDWEIIV"
     gene            complement(<1742480..>1743478)
                     /locus_tag="TRUGW13939_09152"
                     /db_xref="GeneID:55996636"
     mRNA            complement(<1742480..>1743478)
                     /locus_tag="TRUGW13939_09152"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492277.1"
                     /db_xref="GeneID:55996636"
     CDS             complement(1742480..1743478)
                     /locus_tag="TRUGW13939_09152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348170.1"
                     /db_xref="GeneID:55996636"
                     /translation="MRAARVRATSPDGTPYGFPGNPAPSSAIEVHDDIPKPQISQPGE
                     FLIRVKASTVFKDNLEWNELYPPNHALLGNDFSGVVVAVHEDEQEFRIGDHVYGMTHA
                     KRGGTWAEYAVVTSEETVKKPDNLSWEEAAALPGSAITADQALFVHAGLEATAEKGVK
                     QVLITGASGGVAMYLVQFAVAAGHFVVAATSSKERNESFLRSIGAHEVVEYNEFNALA
                     DRFDLVIDSVGFQVLSDCWGVVKPDGTLISFDACSWGYIEEHKSKGISKGKEGVQALY
                     FIAEPSRVSMARISEHVSKRNIKGLVLKTVSLNDVREAYESVHSRGIGQGKVVVLP"
     gene            complement(<1744213..>1745109)
                     /locus_tag="TRUGW13939_09153"
                     /db_xref="GeneID:55996637"
     mRNA            complement(join(<1744213..1744910,1744971..>1745109))
                     /locus_tag="TRUGW13939_09153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492278.1"
                     /db_xref="GeneID:55996637"
     CDS             complement(join(1744213..1744910,1744971..1745109))
                     /locus_tag="TRUGW13939_09153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348171.1"
                     /db_xref="GeneID:55996637"
                     /translation="MKILCLHGVGSSGAILEAQMANLRRELDPSFELVFVDGPFECDR
                     GPGITEYQTGPFFSHTQGYSPVEMAQAFDYLEDILEEEGPFDGIFGFSQGAALTLSYF
                     YERQLAATGPLPVKFACLFSTAIPCSADVGMGDTIISRLRALEYDITDRARCRDEDLL
                     TIAEQEFVELLQKTVVDAAIHDPRFPWTDMNVYRYGEYGAIPRVMYPSILAQKIQIPT
                     IHVWGQNDFEYMIKMAELARSICDESMVKTILHGGLHDIPKKQLEIKAVLRTIDWAMA
                     QA"
     gene            <1745697..>1753101
                     /locus_tag="TRUGW13939_09154"
                     /db_xref="GeneID:55996638"
     mRNA            join(<1745697..1746005,1746052..1746360,1746416..1752860,
                     1752941..>1753101)
                     /locus_tag="TRUGW13939_09154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492279.1"
                     /db_xref="GeneID:55996638"
     CDS             join(1745697..1746005,1746052..1746360,1746416..1752860,
                     1752941..1753101)
                     /locus_tag="TRUGW13939_09154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348172.1"
                     /db_xref="GeneID:55996638"
                     /translation="MDCSDKQEPIAIVGAACRFAGEASSLGSLWDIISRVKTGYCPVP
                     RDRWDSNNWYHPDPDRKGGISSQHGYFLQQDISHFDAPFFSITAKEAAAMDPMKRMLL
                     ESFKKSLTLIYKAIAGIPVEDLMDSRTGCYVGCMTNDYEMISLHDIYDIGHPAATGLS
                     EAMTANRVSWFFGFKGPSLTLDTACSSSLYALHLACQSLRLKETNMSLVAGVNLMINP
                     NTSHQLTAMHMLSPEGISHTFDDRANGYGRGDGIGAMVIKRLSDAIRDGDTIRAVIRG
                     SGINADGKTPSITQPSSTAQAELITQTYEDAGLDLSETGYFECHGTGTPVGDPLELTA
                     IASTLGAARRAAGKTPLYIGSIKPTVGHTEGCAGLAGVFKSILLLETGMLVPTYGVER
                     VNPKLKLNEWHLALPQDVARWPAQGLRRVSVNSFGFGGANAHVILDDAYHYLQERGLT
                     GKHNTVIHDEDSDSPLALPNAPLENGLLHDVSKKVFVFSGKDQAGAKRVSEGLNTWLQ
                     RDSKHTHAPYFLENLAYTLALRRTHLEHRTFVISSSLSELTERLSKGLPTATRSQRHG
                     DNLVMVFTGQGAQWPAMGRELFENPIFRQSVQVSQSHLESLGCQWNAMEELSKMPNPN
                     INLPEYSQPLCTVVQVALVDLLRFWGISPTATIGHSSGEIAAAYGASLLTHYNAIKLA
                     YVRGLSSASVSKQGAMMAAGISHDDAEMYLSQVAPGSAVVACINSPSSVTLSGDVDAI
                     EKLESLISGDGKFARKLKVTTAYHSPHMREVSPSYLEMIGDISLKQIEEAKDRRSNST
                     VMYSSLTGSMISSAKELNAQYWVDNMQNPVQFSQGLLALLKHKKVAPGGTRSVAVQWG
                     GFLEVGPHAALQGPLRQIIDVSNNKFAKSAPYISMLVRGKDALETSLNVAGVLWTAGY
                     KVDMGAVNDNNNKSSTPQMLCDLPSYPWNHTRGFWHESYLSRSYRFPPDVRSDFLGMP
                     EDSQSSYEPRWRNYLRVSENPWIEDHTITGTVLYPGAGMLVMALEGVLRTSDSSKTVE
                     GFRMTDVTFERGLVISLDDGSPVETRTSLHPHSMKPDSWTFTVYSMTNGSPWTKHCTG
                     TIALVYKQEASEVEEESVDASWQRQLGLYKALLSEADDSAATIDVNEFYQNLDSIGMQ
                     YGPAFRNVKTLTAVPSKNASYGSVAVPDTRSTMPKHYESPHVIHPATLDSIFHLVIAS
                     LDAGWPKQSAVPYSIEEVYIASDQPQEPGALYSGYGRVLSKSGHEINTEMFVSDQEWE
                     KPKLTIKNFALRQVTSGEGSETAGTALSRAIKNCARITWVPNLAFLTGNEDLTKFISL
                     SSSSSGKATVLIDTWLDPVFLKSSNSTVLVAMFDESESSIDILLGLKNRTYGPKNIIA
                     FATSELGLQLMRATLGEGVEEGTTITYKWLPESELLQTLGPEANDIVIGLGVPDMAQN
                     AATLAKLAPLACLTAHAASQSDKGVVDVTVPRSVCVGHLAEEDATYVLFALRTTSSPS
                     VELPGSVVLLLPTSPSDALGIFASTIQTKLESSGVSVSRTNLTTSGVATLGGKSVISL
                     LEIDRPLVYAWDEEQFRAFKTLVSTVRHLFWITHGSVLESWANGVEFAASQGLFRVMR
                     NEYPMAILPSLDLSAVADISSVQYTDIVLNVWRATLAEDVEEMEYAEGNGVIYVPRAT
                     EDASFDYELQLASNTAKPILSTLGSLGKPLKVSESTNDAQGCIWIPDEDAELPLEVGQ
                     IEVKVEYAGVGTSQTINSVHHAVGVVTRRSDSVVKALDIGQRAIVFSYATSRTHVRQN
                     QDLVAPLPDGLEPQEAVALVEPLMAAQYALVEIARLGHGQALLLDNAASAVGQALIQV
                     AKTIGVRDIFVLAHGRAERDMLAGRLGIPTDHIFDPALGNFVPLIQSATQNRGVDVVV
                     SQQSGSHVSRAMSILSDFGQFIDINNYNKETFNRALLPASKTNVTLARIDMAAVIQGR
                     PTIVSKLFQQAFTKYILQGPCPLTVLPVTNLLTSMNNSIQTEKAVVVSLNDTSPVLMY
                     APPAKELKLDSEATYVLAGGLGALGLDITNWMIECGAKNLVFLSRSGGSKNQKDLQKF
                     AERSVRAEAFKCNVNDAASVAKAFETLKASGRRVAGVIQLAMVLEDGIFDNMSFGQWQ
                     HAIEPKTKGSRNLLANLWPADKPFFILLSSITGVIGNTAQANYASGNTYEDALAHHAR
                     THLGINATSIDVGLVSDSSHFTTAGEFGDLASYLGRYQHGWRGLQTNLEELSIVMRTI
                     MRGSTTNGQGTIPAQVVLGLGDRIEHNESNTGGFSRDKKFELRVIKIGEQAGGSNGKQ
                     DVGTLLSIAKSMAEAASAVEENIKELVAAAMGVSLDEVDSQRPLYDYGVDSLQAVEIR
                     NRAQKNMRSDISVFDVLSAMPLADVAAKIASKSQLVKVTASED"
     gene            <1754842..>1756677
                     /locus_tag="TRUGW13939_09155"
                     /db_xref="GeneID:55996639"
     mRNA            join(<1754842..1755284,1755356..1755424,1755496..1755570,
                     1755639..>1756677)
                     /locus_tag="TRUGW13939_09155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492280.1"
                     /db_xref="GeneID:55996639"
     CDS             join(1754842..1755284,1755356..1755424,1755496..1755570,
                     1755639..1756677)
                     /locus_tag="TRUGW13939_09155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348173.1"
                     /db_xref="GeneID:55996639"
                     /translation="MGLEIESMPVIDKYGSTTTTEQEAGDSAAEVVQISNPRWLSVCI
                     GLYLTSFLYGLDSTITADVQGPILASLGDLPLLPWVGTGFLLGSVATTSLFGSLYTKL
                     EVKWLYVGSIVTFEIGSAICGAAPNMNAMAVGRVVAGIGGAGMYLGGMTYIAIFTTPA
                     RRSLYTALVSAFWGLGCLLGPVIGGAFAQSKATWRWSFYINLVLAAVTAPIYIVSFPR
                     HGAHCDEKILPRIKDLDWLGALLNATTYALFITACTYSGAEWPWGSGSVITLWVMTGV
                     VTIIYMLQQWTAFLTTKEDRVFPVWCLKSRSLVLLYIATAGGSAVLNFNIYYLPLFFE
                     FTKGDGAIKVAGRLLPFLFLMIFSALLSGALLPKLNLYAAWYVISGILALVGSVLMFL
                     ISTTTPPGNIYGFEVLVGAGCGLSLWVAYSIALVKSPADKVTSALGFINVAQLGGGAL
                     ALAIAGTIFQNVGFDNLQSALDGKGYSSSEIRAALAGGYSSIISDSTPEVRAIASDAI
                     GRTIAHTYGISISGAATVLVVGLLMRWEKVKMV"
     gene            complement(<1757761..>1759312)
                     /locus_tag="TRUGW13939_09156"
                     /db_xref="GeneID:55996640"
     mRNA            complement(join(<1757761..1758590,1758652..1758886,
                     1758949..1759068,1759175..>1759312))
                     /locus_tag="TRUGW13939_09156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492281.1"
                     /db_xref="GeneID:55996640"
     CDS             complement(join(1757761..1758590,1758652..1758886,
                     1758949..1759068,1759175..1759312))
                     /locus_tag="TRUGW13939_09156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348174.1"
                     /db_xref="GeneID:55996640"
                     /translation="MFGTLVSAAFDRGTLEYIENPDPVAAVSRNLRDKIHISCMFCRS
                     RKVRCSGGRGGCQRCVAMGFECVYPENQKRNKRQEKNKRSRTAIQRNENTSTRIVSDE
                     ADLCSRNDHGKHGEQLALHDLQNSMFDNSCIENSFFAPWVVDSPRQHGFDCGSSSSSS
                     SCPTSAVGLTRSESPFSARSGSDTAAASRGQALELSTVDTSLLGLSAIDSVPDLSWGE
                     EPDIAHVDIAWEMNTDGHDMAGSALESLSLEPRGKPCAEFDSCCCLLSSISILERLVS
                     RSTSSENRIDLLLGEVRSSIEMLAIFMACERCATRVEQNMLLAMVARQISVILEKTAN
                     CCKDMHLSGLGDTNSPQQIPELNTSTINPVDISVSTYRVNRRERRHLLRSLVTLQIVE
                     FRQQINTIKSRYRNRPNQGQMEALIEAENHIKLAQVAISSHSNIHDSL"
     gene            <1761747..>1763370
                     /locus_tag="TRUGW13939_09157"
                     /db_xref="GeneID:55996641"
     mRNA            join(<1761747..1761998,1762051..>1763370)
                     /locus_tag="TRUGW13939_09157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492282.1"
                     /db_xref="GeneID:55996641"
     CDS             join(1761747..1761998,1762051..1763370)
                     /locus_tag="TRUGW13939_09157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348175.1"
                     /db_xref="GeneID:55996641"
                     /translation="MASERSPLLLPSGSSTANNHYNHSQQEETSDNMTESDVDAAAVR
                     RALRKVDWRLIPLLFVTYMLNFMDKAILSSASVFGLIDDTHLVGQQYSWVSSIFYFGY
                     FFWQYPTNILIARLPVAKYLAINTFFWGAIVALTAACVNYGGLLAVRFLLGVAEATIT
                     PAFMFITTTWYTRDEIPFRTGIWFSGNSIGGLVASLLAYGVGHIEHPLHPWMWMFIIL
                     GLATFLWAFALLFLLPDSISNAKFLTPHEREIMTNRAIIAGTGRTEQTHWRWDQTREC
                     LVDPKTWHIFALAILTQIPNGGTQNFGNLVIKSFGFTSLQSTLINIPSSVISAITIAL
                     TGYLAGRFRQVNCILIVAIVALSVTGSAIIYARSHHVTKGAQLFGYFLLATGPSVLPL
                     VMSLVQANYKGVTKKMTMTAMMFIAYCAGNIAGPQFFKTSEAPAYQTAFRAILICYII
                     SAALAVSLRVYLQFTNARRDHEEGVVGNAGSSSGVVAGGKVADVVEAVRDASLQPEDF
                     DDVTDWQTVGFRYRL"
     gene            complement(<1763953..>1766614)
                     /locus_tag="TRUGW13939_09158"
                     /db_xref="GeneID:55996642"
     mRNA            complement(join(<1763953..1766016,1766072..>1766614))
                     /locus_tag="TRUGW13939_09158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492283.1"
                     /db_xref="GeneID:55996642"
     CDS             complement(join(1763953..1766016,1766072..1766614))
                     /locus_tag="TRUGW13939_09158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348176.1"
                     /db_xref="GeneID:55996642"
                     /translation="MLSAPNTARRISSLFNLKSNRDSAASSTSSGSPKLSPDSRLTTD
                     NRLAADHRRVRSQSRPAVRHASSPQPNSADARPRTSNGPIEPLDLEAPLPPPPSLLAI
                     NQDLDDPSSQRTSHSRQGSASHNRRRSWMPSRASMSMPRQDMNAAQTEPEDPYGGFDS
                     WIAGLEQKIPYDLDALTRGDQVPELWNEQGDTFVYLFPQNTNRPPSFKVDSSVFSDSP
                     SLTFLARGTDPKVEALRQSTRTLTVTDPDGATAPEDQWMNDSASSGTGRMAFVDEPVE
                     EVQDINLYLPIPLSGDVSSPSSSLEPDDIDALVLFRNLFAFLLGQALVATPRHPSLFS
                     ILMEVSALLSRFHFSNFDGSNFGEVANSSFANYCSELHLADIRKSREKTIEAVILGER
                     LRYYPLYLEGFVHSVGKMAELRYMQSPKYALISPVTQKRLERSYIDLGNRLTVLRGKL
                     DEFDFPAMFSGIANSTTSVEGKTVRFKSWRLSFLAFRKHVLGYYRQKYGSWPPKANSK
                     KNEFEGSGLNRLLLNEVYEDLTDLYDMLVDRTQLTTRTTDMATEDLDVPDPAEAVLRA
                     MRRMMSEYDRSTPPVLPPIPFDVPQMPSVQVLHRKTLDAKKEAKERQKKLSDSDINAV
                     LMASYTRESLKPTPFVESFMQFERRNAHGKTVDEILDNRIGQWLFLYAVIQSLPLLVI
                     DVSDLRFTHGVEYFLCVAPRGGAPWVQNDAKAGRSWFGVAGGQGVVSLPSDVVNNAVD
                     TVYRRSHCWQIATQWAEKSQILGSPITTEDGSSVFSSPAPVPQSSTGSMSDAPSMLSP
                     SGMSSMGVPRTGSPGFISHNNRASIYNTLEALPLPAGVMPVEPPTKPFTRMNPTMSFD
                     DILKDIPNGKKK"
     gene            <1768773..>1770196
                     /locus_tag="TRUGW13939_09159"
                     /db_xref="GeneID:55996643"
     mRNA            join(<1768773..1769243,1769295..1769680,1769740..>1770196)
                     /locus_tag="TRUGW13939_09159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492284.1"
                     /db_xref="GeneID:55996643"
     CDS             join(1768773..1769243,1769295..1769680,1769740..1770196)
                     /locus_tag="TRUGW13939_09159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348177.1"
                     /db_xref="GeneID:55996643"
                     /translation="MATSIDLFRGWPNPALLPVQSIAKASSIALSTPSIFQPGLQYGP
                     DEGYGPLRQHLADWLTSFYRPKEPISEARICVTGGASQNLACVLQVFTDAAYTRNIWV
                     VAPTYYLACRIFHDAGFMNRLRGVPEDTEGIDIGFLEKGLQEAEAKANAEGNTQPRYK
                     LPRPWSKIYKHVFYLTSTFANPSMKVVSVRRREQLIRLARRYDVLVISDDVYDFLQWP
                     SDMSATISPSDKAAVPRLVDIDRYLDGGPVDDFGNSMSNGSFSKLVGPGVRTGWAEGT
                     YKFAYGLSQAGSSRSGGAPSQLTATFVDQLVSTGTLQRHISSELIPTYQARYREVMSA
                     ISAHLVPLGFSVPASAQPIVGGFFIWLDLPAGLTSSVLADRAAAEENVKIGSGTLFQV
                     EGDCTEGRQDFEDGIRLSFGWEEFGLLSEGVERLGKAARRILNTR"
     gene            <1771890..>1774775
                     /locus_tag="TRUGW13939_09160"
                     /db_xref="GeneID:55996644"
     mRNA            join(<1771890..1772082,1772146..1774348,1774406..>1774775)
                     /locus_tag="TRUGW13939_09160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492285.1"
                     /db_xref="GeneID:55996644"
     CDS             join(1771890..1772082,1772146..1774348,1774406..1774775)
                     /locus_tag="TRUGW13939_09160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348178.1"
                     /db_xref="GeneID:55996644"
                     /translation="MIFIRLFLLLGLSTLLAAAPTPQASAASSSSGFWMANIKRQGTV
                     AFGNATDYQIFRNVHDFGAKGDGSTDDTDAIQKAISSGNRCEENCDSSTVTPAIVYFP
                     PGTYVVSRALNQSYYTQMIGDATDLPVIKAARSFSGMAVIDADPYIMGANWFTNQNNF
                     FRQIRNFVIDLTSMDMSSGAGIHWQVAQATSLQNIRFEMVKGGGDGNKQQGIFMDNGS
                     GGFMTDLTFNGGNYGMFLGNQQFTTRNLTFNGCNTAIFMNWNWAWTFKSVTVTDCAVA
                     LNMSNVADANNQTVGSVMLLDSSISTTDTAIVTAWSKDSIPIGGGALVIDNVDFSGSK
                     VAVAGIGGNTILAGGSIVDNWVQGNTYTTSGASSVKKRDIESVASLEADTCPAPEVVT
                     VTVVQGAGTNPTVPASHASDRIAGSTGTDAPGGLATTIPGTDIPDPVTTVTPTVGATT
                     ATGTAPQQTTGTPAPPASNPGSGDGTTSPVSSPSAATSTPSSQHSPSSGHASGTPSSG
                     TCAASPVSKARTQATLAKSSKPSVLVEGSGKVFERSKPLYETVDASSFVSVKSAGAKG
                     DGTTDDTDAIQKVLDSATSDQIVYFDHGAYIITSTIKVPKDIKIVGEIWPLLMASGKA
                     FSDEQNPIPMLQIGQAGDSGDVEISDIMLETKGPTPGAILMEWNVAGSSQGSAGMWDV
                     HFRIGGSAGTELQSDKCAYNPNATHNANPECEGAFMLLHVTEKASAYVENAWFWVADH
                     ELDLADHSKIDIYNGRGVLIESQNAVWLYGTSSEHSQLYEYQINNAKNVFMALIQTET
                     PYWQSNPTALEPFTPQSKWSDPDFSTCTTDSCRKAWGLRVLSSSDVLMYGGGLYSFFE
                     NYSQTCLDSEDCQENMVEVDCSSVSLYGLSTKASVNMVTSTDGKGLVAQSENLSNFCS
                     TIALFQQ"
     gene            complement(<1775044..>1775901)
                     /locus_tag="TRUGW13939_09161"
                     /db_xref="GeneID:55996645"
     mRNA            complement(<1775044..>1775901)
                     /locus_tag="TRUGW13939_09161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492286.1"
                     /db_xref="GeneID:55996645"
     CDS             complement(1775044..1775901)
                     /locus_tag="TRUGW13939_09161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348179.1"
                     /db_xref="GeneID:55996645"
                     /translation="MAPHAPFKEVEASRPPWDSSAHPHYTQTINPGYTIGSGAYGEPN
                     TSNHISIDPNADSRGFLANYKLLISAIVPRPIGFISTRSGDGSSTNVSPFSFFQIIAA
                     DPPIFVFGVNGPKVGSPGTRKDTLTNLLETGECVINIISEDYIDAANMACIDAPYGVS
                     EFDVSGLTRGEDTKQVRVPRVKEAVFSIEAKVVEKRDFTSKRDPSKVTATMFTVEGVQ
                     FWAREDALDEERGVLEIEKLRPVSRLGGISYGRVTDIFELPRLSWETDLSAEEKQLIA
                     DRAKENAAK"
     gene            complement(<1776333..>1777196)
                     /locus_tag="TRUGW13939_09162"
                     /db_xref="GeneID:55996646"
     mRNA            complement(join(<1776333..1776542,1776594..>1777196))
                     /locus_tag="TRUGW13939_09162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492287.1"
                     /db_xref="GeneID:55996646"
     CDS             complement(join(1776333..1776542,1776594..1777196))
                     /locus_tag="TRUGW13939_09162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348180.1"
                     /db_xref="GeneID:55996646"
                     /translation="MTRFNNVTGYVALATSLLITSTAADSWPKRGLAANDDVPISQFG
                     GSWNNHDSQVNWQYNWDSTTSQKQSFAEYVPMLWGTANYHTDQWSDNAWYWINNGGTG
                     HLLAFNEPERGDQANLSPQQAADAWNQYMEPFTGHAQLGAPSVSNDGYDWLNQFLQAC
                     SGCHIDFVPIHWYNDHTLESDFENWVNSICSLTGRQVWITEFQAFGSIDDQSNFLRSA
                     IPFLDNNPCVYRYSYFGTADNSKVLLQDDGPSLSGLGVQYAFSPYGSGDGPN"
     gene            <1778865..>1779683
                     /locus_tag="TRUGW13939_09163"
                     /db_xref="GeneID:55996647"
     mRNA            <1778865..>1779683
                     /locus_tag="TRUGW13939_09163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492288.1"
                     /db_xref="GeneID:55996647"
     CDS             1778865..1779683
                     /locus_tag="TRUGW13939_09163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348181.1"
                     /db_xref="GeneID:55996647"
                     /translation="MARLTFYISMLVGAVAALPSPGRTSKAPPSLPNADPIAVMSVPQ
                     SNFKSYQTGGLVRYNSTEDAKLSKRWDCSSSPTLTYGDTDDGGPGITIDNDASDWRGF
                     YFYHNSCDSVPWKYIWIAGKSTQFVSIPTGWEGRVQRGVDDTMLNGQPQLLGSWLEIS
                     WDINNGNTGWADVSLIRGCDGAILVWNPDGNWKGFTQWVLDGAPDGAYDQKNDGQWVI
                     KATEGENAAINTIPRDWDIQQIGSDYVYVDDSHGSPVISTSNQRFSSFWPDGRP"
     gene            complement(<1779991..>1781783)
                     /locus_tag="TRUGW13939_09164"
                     /db_xref="GeneID:55996648"
     mRNA            complement(join(<1779991..1780998,1781063..1781452,
                     1781520..>1781783))
                     /locus_tag="TRUGW13939_09164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492289.1"
                     /db_xref="GeneID:55996648"
     CDS             complement(join(1779991..1780998,1781063..1781452,
                     1781520..1781783))
                     /locus_tag="TRUGW13939_09164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348182.1"
                     /db_xref="GeneID:55996648"
                     /translation="MAKDNESKAPRPYRSRYLDDQSISHSGDSHYPEKGDSSLDSKDV
                     KQDGPIREGIGDIAKEQDVDLESQQPLEKLGAAGSNTPQQDSKLVTWDGPNDPEKPKN
                     WPSSRKWSVMLIVSLYTFISPVSSTMVAPALTYIGDDFNIKSEVLLELTLSIFILAYA
                     IGPLFLGPLSETYGRAIVLQLANLFYLAFNIGCGFSQSKGQIIAFRFLSGLGGSVPLA
                     VGGGVLGDCFTAEERGKAMAVFSLAPLLGPAIGPIVGGFISENTTWRWVFYATSIATG
                     VIQIAGLFLLHETYAPRILKVRAKRLRKNSGDHSYQTEEERQNKTLSQSFQMSLVRPF
                     RLLFTQPIIQVLALYMAYIYGLMYLMLSTFPSLWTDPNYYGESTGIGGLNYISLGLGS
                     FLGAYLCAFLNDCFYRHFKARNNDIGKPEFRVPLLAVTAIVVPAGLFIYGWTAQTHQH
                     WIAPNIGTCLFAVGNIITFQCMQTYTVDAYTKYAASAMAAVSVLRSLAAFGFPLFAPY
                     MYDALDYGWGNSLLAFIAIGIGIPAPFLLWKFGEKLRRASPYATG"
     gene            <1784760..>1788416
                     /locus_tag="TRUGW13939_09165"
                     /db_xref="GeneID:55996649"
     mRNA            join(<1784760..1786894,1787265..1787417,1787491..1787769,
                     1787831..>1788416)
                     /locus_tag="TRUGW13939_09165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492290.1"
                     /db_xref="GeneID:55996649"
     CDS             join(1784760..1786894,1787265..1787417,1787491..1787769,
                     1787831..1788416)
                     /locus_tag="TRUGW13939_09165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348183.1"
                     /db_xref="GeneID:55996649"
                     /translation="MTINDKAVNLISPASGVSGIGLSAYEWWSEGLHGVAGSPGVQFQ
                     TPNGSDFSYATSFPLPILMGASFDDDLIQNVARVIGKEARAFANAQKAGFDYWTPNIN
                     GFLDPRWGRGLETPGEDIFHIQNYVKQLVPALQGVDNKEDLRQIIATCKHYAVYDVET
                     NRTGQNYDVTQQDLGDYYLPAFKTCARDALATSIMCSYNAVDGVPSCASEYLLQMVLR
                     DTWGFTAADNYVVSDCDAVNNIWDSHGFTTDVDSAAAVALNAGTDLNCNGAYKNLVGS
                     VAGNMTTESAMDQSLTRLYHALFKVGYFDGAPDWDGFSWADVSTSDAQTLAYEAAVEG
                     ITLLKNDGLLPLSADTYSSVALIGPWANATSQMQGNYYGVAPYLISPLEAFQASFDKV
                     QYAEGTAISGTTDAGFSEALSAAQSSDAIFYMGGIDTTVEAEGMDRTSVEWPGNQLDL
                     ISQLGALGKPLVVVQFGGGQVDDTVLLQNSSVNAVVWAGYPGQNGGNAVCDVLTGKKA
                     AAGRLPVTQYPADYTNEANIFDPTIRPNITFPGRTYRWYTGEPVLPFGYGLHYTNFSL
                     SWETQPQSTYSIQNLVDSGGDGSDYLDLAPFVNVSITIKNAGGPANVASDYVGLLFLS
                     SSNAGPEPIPNKTLVSYSRAHDIPVDESQVLSLPVTLGSLARADENGDLTIYPGDYVF
                     SLDTDAELSAGFQLTGDSAIVDTIPRQAAHTPRSSNPLCQSKYLGVAESQTMSTAMLT
                     VALAGSCLARTSATFNWDSTKHLVAFGDSYTYVQGTHGYPDYSFIGDYLPGQFAFTPE
                     DLLSNKIVQNFSGTAEGGPNWVEYLTGCALEEGLTSPETCKLQLWDFAFAGADISQEF
                     TPLHHNFTIPLVNQTKQFLTYAQPVLSKQKSFNLNQALIAIWIGINDIGDSSKYNVSF
                     PNFYEKLWDTVFTESVQPLYHAGYHNFLFVNLPPLDRAPGNVNSVSPLPNKTMIGWFN
                     DEIERHSTAFGAAHPEVKSMVFDATTLLNYVLDNPSKYNIRNTTSYCSGYTDPDVVVD
                     PGKYGCIPIEEYFWFNTGHM"
     gene            complement(<1789347..>1792903)
                     /locus_tag="TRUGW13939_09166"
                     /db_xref="GeneID:55996650"
     mRNA            complement(join(<1789347..1790633,1790775..1790949,
                     1791000..1791612,1791695..1791957,1792025..1792377,
                     1792430..>1792903))
                     /locus_tag="TRUGW13939_09166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035492291.1"
                     /db_xref="GeneID:55996650"
     CDS             complement(join(1789347..1790633,1790775..1790949,
                     1791000..1791612,1791695..1791957,1792025..1792377,
                     1792430..1792903))
                     /locus_tag="TRUGW13939_09166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035348184.1"
                     /db_xref="GeneID:55996650"
                     /translation="MHLKRLFKKSPGRNDTKAPPAAAASPTLPTGNGELQLPTKPHTT
                     ETTSTLTGPSTIPRDLWREALETLPKQIQQELNTEGTEQKPLGIQISELLEVTRKRQE
                     ECERKFWKFRVGDHEIVLRDYAVKTVGCLQQIGDIAVMFAPPQASIPWSVIKMVMQTA
                     VVESAQMCALLASVEKIVRIVNRGQVYELVYTSENTPKLAFENLQSVLVELYGACMEL
                     LANSSKLFTKNTAERTVRSILHPGDTADIFSKLVQLETKLSHEVQVCESGRSAATDAD
                     YNLIIRNIIISCFLTRLDERVCTLLEKVNEKEQLEILEWISPIPYKKHHDTVKEARTS
                     DTCEWLLQNKRFREWEDTSSSVILWLQGSPGAGKTFLTSKVIDHVQSRLELSPNHEAF
                     AFFYCNRNESERRDPLYALQSYVRQLSTTARNSGDIRSELRALRHEVRSKGGSDLSFN
                     TCKEQLLESVNLYPKTTLVLDALDECEPDSRSRLIDTIEFLLSESKRPLKIFISSRPD
                     GDIRARFLSRPNIEIQATDNQNDIEKFVNAEMVKHPLWEKISLSLQEEIIQTLLKRSN
                     GMFQWAYLQTKQLLKLKTRQDLKVRLGKLPIDLKDTYDEIYCKIAESEHGKDIADRAF
                     MWRKVWRFSHLSVTEYFEKHHWGVHQAHGHIAKVCLKFLIQTYNEIDSGSKIDSLDNE
                     DTSEQEDEIPDLGSLEIFDLRHPFQMYIGHHWIVHVQTQEGKGADPILTRLLKDFLGS
                     PNESSLQYRAWYRQIASDKWPEPSTSAFYHINEEEISPESAAILSMCRFSLYTPLLDW
                     WDNAEIVFGTIEIVNFLIEKGADVNMPLQSGKYGSALVVAAYGEKLEIIEFLLQKGAD
                     INMQVQTGYYSSALAAAAWSGKTEIVSFLVEKGADVNTILQDGEHGSALAAATYMGEL
                     ETVVFLVQKGADVNMSLQVGDYGNALIAAVEGGVFEVTKYLLAAGANANQHTLIGRYS
                     TPLVAAAYLGRKKCVEALIEAGAEVNVKLESGSFRTCLQASQSDVSP