GenomeNet

Database: RefSeq
Entry: NC_049566
LinkDB: NC_049566
Original site: NC_049566 
LOCUS       NC_049566            4978393 bp    DNA     linear   CON 05-AUG-2020
DEFINITION  Talaromyces rugulosus chromosome VI, complete sequence.
ACCESSION   NC_049566
VERSION     NC_049566.1
DBLINK      BioProject: PRJNA645155
            BioSample: SAMN15229550
            Assembly: GCF_013368755.1
KEYWORDS    RefSeq.
SOURCE      Talaromyces rugulosus
  ORGANISM  Talaromyces rugulosus
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae;
            Talaromyces; Talaromyces sect. Islandici.
REFERENCE   1  (bases 1 to 4978393)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     A chromosome-scale genome assembly of Talaromyces rugulosus W13939
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4978393)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-AUG-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4978393)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JUN-2020) Faculty of Electronic and Information
            Engineering, Xi'an Jiaotong University, Xi'an, Xi'an, Shaanxi
            7120000, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP055903.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: NextDenovo v. 2.0
            Genome Representation  :: Full
            Expected Final Version :: No
            Genome Coverage        :: 526.0x
            Sequencing Technology  :: PacBio RSII
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..4978393
                     /organism="Talaromyces rugulosus"
                     /mol_type="genomic DNA"
                     /strain="W13939"
                     /isolation_source="air"
                     /db_xref="taxon:121627"
                     /chromosome="VI"
                     /country="China:Beijing"
                     /collection_date="2015-07-23"
                     /collected_by="Long Wang"
     gene            complement(<2125..>7110)
                     /locus_tag="TRUGW13939_10355"
                     /db_xref="GeneID:55997835"
     mRNA            complement(<2125..>7110)
                     /locus_tag="TRUGW13939_10355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493467.1"
                     /db_xref="GeneID:55997835"
     CDS             complement(2125..7110)
                     /locus_tag="TRUGW13939_10355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349360.1"
                     /db_xref="GeneID:55997835"
                     /translation="MYNTFFEQLEEFPIVVCRECRHAVWPSQIETHLRRAHRYVSTTM
                     RVTLADDVRTWPNIAHDPIELNIPATRTTAIQQLVAPVDGYRCQLSSHSCQYICTTMP
                     TMRQHWIKHHQWSRTRKIGQPTHMEQKQIQHEQDQACRPVQCQRLFPVKANSQYFAII
                     PETDEAVAPDGDACETLIQNMQAHWRSVQEAADRKIQAGQVDEANPWLRRTEWVKYLG
                     EFDIPDLIQSVSPPPADIDGQPSIEPEAHAIWTAMARLATISQLSVIHQIGVFVRLEA
                     IRTEQHQTRYTPLEAYQDEESIVKQVRPWQEMLMFFWRTQQPHEWTSPPYRFTRRQRM
                     AWERLVDAVRIPPTRQVSKGKVITRSGATRAPWVEEEEEEEGEEEEEEEEERDTMSID
                     SLSVDSNEPDFFNDRSDGIEKTMEETAMGRTVDVDAIFDIERPPENEEEASNITVPPL
                     SPVERACLDFCIELLNQRITRREYDSALVCAAAVLGVREGGFRTPEDYPPILSRVIKV
                     ARFMVVKKAVELSDEPEEEDAAELPSSMDHTDWDSAYGGSPPPSSPGRKGCLQWVTQM
                     MDRFMVRGSQGPTQWMLDLRTYGLKIHYNTTSAGHVQWQNGDELCYKDRQFTMNEFRG
                     MVHAVVQDARRILIDDILGCPSDAVPAIPWDRLYDDPSNNQARWSFLQDTRTQWPVDG
                     EHWMWHRIRQDPAVRRRFIQADGQGFHPARWMAYQNRITAFLEKLLVAIQFTWGQPAR
                     APELLSIRHENSPMGGIRNMFIEDGMVVLVAQYHKGYQLSGDVKIIHRYLPREVGELL
                     VWYLWLVQPFERVVSGNIYQRDQVSSHIWTAHPHQAKWNSERLRHILQRESAMGLRGQ
                     SLHIASYREVAIAISRRYLRNKYRFAADDGDDPEAMDEVQLLADAADRQAGHDPHTAG
                     GIYARESRELFGAMASMRERYRGSSQDWHTWLGFASCQPPSDPDADPFSAPPASSTSW
                     FTDEAQRSREERWQRMQRMDVDQALRDMMGPDAAFRGPQKQIVQAVIQGQSPVIGVMP
                     TGGGKSLLFMLPAWMARGGTTVVIIPLVSLRDDLQRRCAELDIQCVAWNNRQPADGAS
                     IVLITPESAVRDETFSTFLNRKQFTGQLDRIVIDECHIALHDQYDFRKSMTQLGQLVR
                     YRAPMLLLTATMPREDEERLCQRMYFPPSTVHWIRARTSRHNIAYRVVRIARPQEHGR
                     RGDVGAAIMAWIEQEIPRYSPGKVVVYANSRHQTEQVAEALGCGAYHSHTIDRAGMLS
                     TFRQTPSGVIVATSALGMGIDIPDIRCVIHVGRPRSLLDYAQESGRAGRDGQGSTAVM
                     VLDGSGGGWGDPVTDRDAGSLRALEQVQRYIDQPCRRGVFDPYLDGEVDGYQRQQCEE
                     GEAACDGCCAAAIPVETQATSPTTQSETPAISPARRVQVQARSPVPAPARSPKRKLSE
                     AFTMVTMPHARRRGYNEPWEQLRSHIEREARTVDSIREHFDRWVGRCRICAMHEAPSE
                     HFTYQCPRAEGQQAAAWIEETIRKVTGNQREDGRNGYEDYAVCFQCHSPQWICPRWVR
                     VDHGGYQRTKEACRYLETAAHTMAQLLHGPMREVIQPAWERRLAQMPGGGVPHENQAA
                     LIRHFQRKFGKRGEERSGLVEEMTWMCSWVDDTMQVDVESSEDSNSIISHM"
     gene            complement(<19466..>22636)
                     /locus_tag="TRUGW13939_10356"
                     /db_xref="GeneID:55997836"
     mRNA            complement(<19466..>22636)
                     /locus_tag="TRUGW13939_10356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493468.1"
                     /db_xref="GeneID:55997836"
     CDS             complement(19466..22636)
                     /locus_tag="TRUGW13939_10356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349361.1"
                     /db_xref="GeneID:55997836"
                     /translation="MAGNSNAPAAGPATPRPPARQARPVDQDSDDEPDEQTQQRFTTL
                     ERVIDQMNEHIQRLQAAIAERDDHVNQLEAQVMAIPPGEAGTAGNRVKLPKPMTFDGT
                     RSKLKTFLVNMEMHIEANQITHDKKKMIFVASCFTDAAAEWIQPMLSELYTTDRSSWG
                     TITRELFSNYGMFKQKLGEAFGNIDELRTAERQLRYLRQTGSAQQLATKFRQIVTPLH
                     YDDAIQIATFENMLKEEVQTELIKLDRPDNIDRFIEMAVKIDNKLFEIKQKRQEFQRW
                     KKVGGFPQYANTSAKRGTQYDKDGDVKMQLNNVISKEEMAKRKENKACYKCGRKGHFA
                     RQCRSGQNKQNGNVSPQKITTVHQQVAAIHQTIVTPSDSEEEESENEQVDEVKDFWGP
                     ILEKEIYESLKKFEQEDSPGQSKGRLRQSSEREPPQEEDANPEEAQPHLRRGQEKGPI
                     REPRREDQYSKTAGRRIDDLSSGSESRHPLTFRDGGKDREVDHEDSDRESDTPQHSQL
                     TRTTNLRRDAARAIDQANETIRLFQKRPPITKKEWDSVLGTSTTVPGIKIEIPETSKE
                     ELKTDSEDSETTEEFPEIDYEEPKRECSCKPPKPVCWEDSIQTYRQHILECEKCHEWT
                     FHKCDMHGKKNIALANEFEYVSLTKGTRLCHPMLGHTERCSCMYYPQYGGHHHKKIHW
                     TQCYESKCPTHLEEKEKNKWKPTAPMIIYQPIPDCPKGWNECWCYAEEIWHPFHNSIE
                     TDQCYAKKCPYHEGRVIYTDEDWTEIVLSQKRYLERHRKGHHLIATTIKTGETVIIIK
                     GTINGHEAKLLLDSGASTNYISEAYVKKNRIQTHETNLWHTVQNFEGQITIEGFVRRT
                     GNITLKSGEHEESIQLDLSPFERKDFDIILGMTWLRKHNPVIDWKHETVSIDLKTLQT
                     EQMGIKPNQQLKVKHAEEINEIGRQIETRKKPKEIYEKELKEVLDKLPEKYRDFTELF
                     VKKEYRLPQHETEYEAEIPLKEGAQVPQVKQRQISQDELRTTKEFIEKFLAAGYIRES
                     KAKASAQAMFVPKRDGSPRMVIDYRN"
     gene            complement(<25116..>25595)
                     /locus_tag="TRUGW13939_10357"
                     /db_xref="GeneID:55997837"
     mRNA            complement(<25116..>25595)
                     /locus_tag="TRUGW13939_10357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493469.1"
                     /db_xref="GeneID:55997837"
     CDS             complement(25116..25595)
                     /locus_tag="TRUGW13939_10357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349362.1"
                     /db_xref="GeneID:55997837"
                     /translation="MAWEQLIDAVWIPPTHQVSKGKVITQSGTTWAPWVEEEEEEEEE
                     EEEKEEEEEEEEEKEEEEEEEEEKEEEEEERDTISIDSLFIDSNEPDFFNDRSDGIEK
                     TIEETAIGRIVDIDTIFDIKRPPENKEEASNITMLLLSSIEQVCLDFYIKLLNQYIT"
     gene            complement(<28992..>31605)
                     /locus_tag="TRUGW13939_10358"
                     /db_xref="GeneID:55997838"
     mRNA            complement(join(<28992..29524,29577..31020,31078..>31605))
                     /locus_tag="TRUGW13939_10358"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493470.1"
                     /db_xref="GeneID:55997838"
     CDS             complement(join(28992..29524,29577..31020,31078..31605))
                     /locus_tag="TRUGW13939_10358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349363.1"
                     /db_xref="GeneID:55997838"
                     /translation="MSQSQLSDFTSSLYSGDIDDLPSLSTQQITPSASHHTIDSGFHR
                     PDDLLVPPSLIRVGPDRRNRFVLYDKMSHNEFIDWWLQTDYGRKRKINWDSHRHTVIW
                     NSYNQVAEGVDGTPKVMCKRCGKILEHPYSLSLNSSGKAQYHGTSTIQKHLKTAGCLR
                     SEKGKKAEITKFLQKEGEISADIPFLQEDWEDDILQFLTLNRLPFHLIEHPSFKRIIY
                     KARSALVAPVIPSADTIRRRLGSLVKDRQQRVLRTLPAGSKISIALDCWTSPFSQAFM
                     AITGYFIDSDWVYREVLLGFKPLHGTHTGSYLSGVLMETLVENNIEDRVFGLTTDNAS
                     NNKALAASLQQALSDGVIITRIPCLAHVIQLSLNQLLVRIKAVPSNESAETKWTESQS
                     RLVQENAKQCQISSTLNKVRYLAIYINASPQRRETFYNLQTTNVKIVPIQDVKTRWNS
                     TFLMLRRAKRLRAIFSLFCAEYDCEEMLLSEHEWRQIDYLLCITEPFFDYTTQLSKTR
                     DVTAHYVFKIYNRLFDHLERSQTQLQRKRVPWKKQMLDALDAGRTKLDEYYAQTDTIR
                     GHIYAVSTMLAPVNKFRFFLSSDWDQKWRDIYRNAFQQALIPYQAQVKSQSQDAYSSH
                     TAAQPSSRLEEMLDGKDIQPRAMTDEISQYLDSDTVSVGPLIFWKEHQYRFPAIAALA
                     RDALSFPATGAGVERLFNTARDVCHYRRGRMKTETIEELMMFLCTSKFDIEAQEAKLL
                     EKFFSQDELEAAKEEREEKLNKDEINPISDTEEQEDELENGPENEMEDIGLDTTFLSA
                     AEPDSPGSPSLPPTCTQTRVSGRKRKSREDDIFEYH"
     gene            <33382..>36046
                     /locus_tag="TRUGW13939_10359"
                     /db_xref="GeneID:55997839"
     mRNA            join(<33382..33560,33618..33825,33878..34308,34365..34723,
                     34797..>36046)
                     /locus_tag="TRUGW13939_10359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493471.1"
                     /db_xref="GeneID:55997839"
     CDS             join(33382..33560,33618..33825,33878..34308,34365..34723,
                     34797..36046)
                     /locus_tag="TRUGW13939_10359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349364.1"
                     /db_xref="GeneID:55997839"
                     /translation="MAPPSLPPANPQDHQYWTDPILCEETRARLEYFRSLGRLPPNYK
                     PKTLEGIAVVERYWRKFCIQSKEEYVDYLLSEDQTIYMNFFDWMYNTSRKKLLQSYDE
                     YWRRLGQYFILFAERPMNNDVHEQMRRFLNQRFPAEHKISRRMKKKNTLDVGAFCVLY
                     RHHWVHSRYFRHGSMVLQFATIQLWSSITGTRPGVLLPQKAFLPSNTSLGKRKRDLSI
                     KSDLPQYISANDLPDSVCYRDIELFYLKDPDSNRDVLCAIIEFRNLKGRPEGADGTKF
                     FMHGDYQLSYCPILQIVSYAFRDNAFVNTTLSPDIIWRIKVPGRLTCLPLRWKPELLD
                     TPLLRHVHRTEYGYEVDPSLPMAYASSRDGLRELGRDAKFEDDVVHYNYRRWAANEVN
                     RNFTSQERQRVLGQSGDGVFERHYQSQYIQRDLQHVVLLRPSQESLHQVGGSMLRKWD
                     PSAPSSELTEAQRRTICQEPRILELRRTKREVMEEMRSLAGTKTKAKHLFPHLYQQHD
                     SLSKELSQLRKNLAKETKETTRKDYFYNAPIFEVDRQINQLLGQADPEDSDGDSPDHK
                     KWELPIPKYIFPERARLVENFYGPEAENFEDDKLLARRIQTTKDMVALSKLCEPNRRG
                     NRVNWNFDGDESEKSEEPWIPEEETLDCPTDVCIICYGLSRRSESNPPPHRFPPKRQD
                     SLRRHLIDCHLANAHGGISCTWEVCCDVPKFVEITDFMAHALYVHAYDVNMQQKHLPA
                     KHPVGGSEHSSLDDSEYLSEPDLHSGIGTPASSISSGMANIDPRLVESSPSPPTKLSP
                     RRSKRIKTSP"
     gene            complement(<36440..>38392)
                     /locus_tag="TRUGW13939_10360"
                     /db_xref="GeneID:55997840"
     mRNA            complement(<36440..>38392)
                     /locus_tag="TRUGW13939_10360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493472.1"
                     /db_xref="GeneID:55997840"
     CDS             complement(36440..38392)
                     /locus_tag="TRUGW13939_10360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349365.1"
                     /db_xref="GeneID:55997840"
                     /translation="MDNSHETTGAKTKRETDAFTSSEGYTSTETDEYGSSEDSSDDEF
                     TSDRKDKTTLIESEFLLNGTNQAVKIEIWISSRAWRDDITAKCTHKGKAIGHAFARFI
                     YRGMVTKNFWEKMDECSQDVGEIAWRVFDRYGFLKDKFKSHPVHRGTGVWRSELDNGP
                     LLLIEKVFITDVECRRKGVGGAMVRQLLAVGEKCGASAKPRDMSPGLIALEFGSVTQF
                     QKLTRAHAIVIPGWLTEDVEPQYVGKSKRQKNEIDLQASNTAVSFYRSLGFRRIGSSP
                     CFAYAFHPNHRARSIIPDRDFDPQIEPLDDREDEPGMGDYIIPYGVEIQLGQRTLSTL
                     QTEFPLHYAATTLPDLECVEYLKKVATEDGVNLTMVDRTHRTLLHTLARKLKPKSITW
                     LLANVDAAESWKTARDINGDSPLDVLKDFLEDIRTKRNLFMGNLHVSDDFQGFSPPAV
                     ECLSLLDIDRMGEDLGLSTSRLKYGCTCGQCIEGFLSSRMKLALLDQAGTIYDFLSDG
                     VDDGRYWVSDNKFWFRYVAYDVQQNFKTNKSIRQGYTNIFSRVRDCLESSIAPSVENI
                     LQVVRQWSEWPPVTRNYLTRAGDLSGVKAVLACIFNEARNRDDRTGDGEFQIMYASEY
                     SSLSDCRNDREFKFVARACGLDLELE"
     gene            <39039..>40863
                     /locus_tag="TRUGW13939_10361"
                     /db_xref="GeneID:55997841"
     mRNA            join(<39039..39524,39574..40366,40410..40477,40524..40716,
                     40766..>40863)
                     /locus_tag="TRUGW13939_10361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493473.1"
                     /db_xref="GeneID:55997841"
     CDS             join(39039..39524,39574..40366,40410..40477,40524..40716,
                     40766..40863)
                     /locus_tag="TRUGW13939_10361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349366.1"
                     /db_xref="GeneID:55997841"
                     /translation="MDITSIYAVTAGGVCATLFFVSILPYVAPLASKTSTFISKHFIF
                     PFLLHRHSFVGPWTRGAVLVHTLYVATNLFCLCFRAMSRIDAARRAGALSMINMVALF
                     ATGNLTICTDIFRISRHLSLQIHRATACMVASLIGLHIVLVMTTQRSFPLTESDNLFG
                     LIGAGCVAGTFLFSLPYIRRQVYEIFLRTHQIQGYAFLYALWRHIPSTTLLPRLYTIL
                     AFAFVLVALLLQTLVIIYRNGIFSSRGCPRALVACGNLEIHGKNYVSPVIKVRVALSR
                     PMKIAAGQYIHLWMPSVSWWSWAQLHPFTVISWSDGAQETLDLLVEPQRGFSADLLRH
                     ATAASPGSASFLALISGPHGISEDVRRYESVVFLVDGFGIAAAIPYLKKLICSYNTSV
                     AEKVDHESSDHLLRYFFVYSRTRRVHLVWQVETLDIAIAIQSVLNGLLDDDLLKKSYL
                     LTISIHVKSGGIIGDKLTFGNHKRAVVYKGSADYEQILPAELSGEFIQRLPGAQEERG
                     EMLVMVAASNEVHDRTQVILRDYVHQKVAMAVLEYQP"
     gene            complement(<41077..>42337)
                     /locus_tag="TRUGW13939_10362"
                     /db_xref="GeneID:55997842"
     mRNA            complement(join(<41077..41749,41860..41875,41929..>42337))
                     /locus_tag="TRUGW13939_10362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493474.1"
                     /db_xref="GeneID:55997842"
     CDS             complement(join(41077..41749,41860..41875,41929..42337))
                     /locus_tag="TRUGW13939_10362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349367.1"
                     /db_xref="GeneID:55997842"
                     /translation="MAYSVTDKRRVYLACRPIFAGSNALLRKTKKVRELVTKHRTRLH
                     QLIQDFTLDKVVDILKALLEEQIFQSDVKAKIEFPELFHSSPARDVQRAASEDDAARS
                     AADALEEVASQEEGDESNDEEPISVVQSSQKIPNGHRRKRKWKPSILEEHAWDCAAAV
                     ELTKWTKLFAKSSEKLPQHAFKLCGTSLKETLFATNKLRHTAVHRLPTSCRGVEALVN
                     SARILAETLQDPLRTAQLEDLQHELNSKIKAMELNKNVLEDTYSLELQKIQRQREELD
                     MQETQLTARIIHDDCENKILIGNLLEESVNRLFDEKAGLFNGVSDGADHTPDAEERQP
                     STDLKEDNVNDTFYEVDDEKRGNPSYQHVQD"
     gene            <43957..>46200
                     /locus_tag="TRUGW13939_10363"
                     /db_xref="GeneID:55997843"
     mRNA            join(<43957..45339,45401..45928,45979..>46200)
                     /locus_tag="TRUGW13939_10363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493475.1"
                     /db_xref="GeneID:55997843"
     CDS             join(43957..45339,45401..45928,45979..46200)
                     /locus_tag="TRUGW13939_10363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349368.1"
                     /db_xref="GeneID:55997843"
                     /translation="MESTTEVDWTLLDWERVGDGLHLQTSRTSERLNQIDRVRANGIG
                     DHVALPQLVVCGDQSAGKSSVLEGISGIPFPRQDGLCTRFATEIILRHDPSEQRATAM
                     IIPHSSHTADEKTRLSAFRRQIRDFSELPGIIEAAAKLMGVRGHGAETDAPAFSADVL
                     RLELVGKTGLHLTIVDLPGLISVSEVEEDVQLVENLVDSYLENSRTIILAVVPASSDI
                     DTQGIIQRARHYDKAGHRTVGIITKPDLINAGTEARVARLANNSDATKLRLGFFLVKN
                     PSPAELENGVSLSDRQKAELAFFSAGAWKKQNIDRSRIGIDNLRQFLQDLLDSHIERE
                     LPTVREDVRRLLVEINNEIVDLGMERSSPSEIRVYLTRIASDFHNLVKAGVDGAYAGR
                     DPAFFHVNSDEIYVRLRAAIHKENEEFAAYMRQHSERRTVVTEEQLETAEAEDGQLLL
                     TDDEMMTWVRKIYHETRGRELPGNHNYSLLTELFHAQSERWGSISRRHVDTIVSLVSR
                     FIHSALAFVAKDPNVRKSLTEGIKLTLQNHTTEAYKELEKLLLDEARHPVTYNHYYTD
                     NIQKARLDRSKQDLKSSMDDAIHEDWNDKFHVSNSQVEIKKLLYSLQGRIMVDMTERA
                     CMDARTDLAAYYKVAMKTFVDNVCRQVIERHILSNLPSVFDPTTISMYTDEDMVRLAA
                     ESGQIRDRRVEMLRLQGALEQSLRDLGV"
     gene            complement(<47781..>53071)
                     /locus_tag="TRUGW13939_10364"
                     /db_xref="GeneID:55997844"
     mRNA            complement(join(<47781..47877,47942..48865,49130..52269,
                     52317..52606,52657..>53071))
                     /locus_tag="TRUGW13939_10364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493476.1"
                     /db_xref="GeneID:55997844"
     CDS             complement(join(47781..47877,47942..48865,49130..52269,
                     52317..52606,52657..53071))
                     /locus_tag="TRUGW13939_10364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349369.1"
                     /db_xref="GeneID:55997844"
                     /translation="MEFMLTDTELRLDTERNEKYQGTAKIDLDRISFHPNLSRPIEQR
                     NIDRLCEIFRQEGCRRLKVQNHITAVVSRESLQAALRAARKTPEDLLATDPKKFSHLR
                     FSTGQVLCLHGQHRIQAGAEVLPEGDRWWTVDIYLDDISPTLRTSLVEEYTNEQQPSD
                     GEIYRKINQYQREDNAHFQERWWARLSGTKAKRLRALRKNIQLSTAFNALLPIPGIWG
                     GMSIGNLPKVLALKCDEEIVHYLTMHVKKFWVSLVSADAHHPDRAAMMKIDAHTVEKL
                     ELMAPGISRQDARTVKGWVLSGEVLRAFSETERNRMAEKLERFDGIIPSLHTFFKDVT
                     YLEKCAHAVKQLFPLSLNYATIQKAMSYHRAPTDSEGCLIQTSESGFERRPGRRADYL
                     EVACRQIWLYAMRHYPQLAKETENDDLLAKPENEKPDGAVVYEMAILAQKLGFKSTAI
                     DKIINGSPDWQIARDCLLKARKPDCYEFTADDFDTSIRGIVEFFSKARLRTHPLPPGP
                     LVHLPADQKGRCGLPSKGAQKQDRRFLFLDHLHQSAAAPTEKLSTMAVRRCVYFAFFG
                     KPVSRLPNPAIDPLSPGPAPSSTPMSPLFFSDHEPLGGSSPDIDMPLAHEPEEAGGPQ
                     TEGTQRAAEQSRQQEAERENSRREAEERAAAAAAEQQRLHQEAAERAVVAEQVRLRQE
                     ADANAITEAEARERAAAENARLQREAEAQAAAVAEQERLQRDAEAAEQSRLQREAVEQ
                     AAQQERLRREEQEREAIAAEQERLHREAEERAARERAEQAAIAEQARQQREAEEQAVE
                     QERLQREEEREAAAAEQERLYQEAMAAEHSRLQSEVAPAAEPEEPPADEDEWISRERA
                     AALAQLEPDGPNIHVPPETQPSETSRPDPPLDLPGLIAQLRKRSSLGDDASILPDREL
                     PAHAFPDDQSATVTETPTATPTHGVSISGPAVAELEPIPEESSSVPPAVVNEEDRRRQ
                     ENRQKVANARRAAEETEDEFTQTRHVEHQDLFVNESDEEPAPEAVMIAPSERHAGPGI
                     PPQGPSDAVVQEASPHAGVARPVDVAIAPRPPIPTARRKSRPVGINQARKSAIGARNT
                     AKRRRAAGDVSLIAARRQTQLDLVSTMSLRPDDGGHDSGATAETSTTATGLSRLWRRR
                     KNPRADPASSRRPDPAPIPEPARPAPPPLSDHEPDSIIFRVWRGGEWREIQRVAIDPS
                     DAFGVARVAKRYERDEYAMHHDKAMRNIKAAQCLRAAQDDGKNSIFMIFRNSPVDPII
                     ITPAMVTAADAVTARNSDTAEPCLKVIHRKAEKWALQHGSQFAPAKYELVHFSRDPKA
                     NTTHSLRLPHATIKASPSCRYLGVQMDSRLRWDFHREVVEAKATKRLSALSALASSTW
                     GTGVINLRQVYKAMIIPQMLYGCSAWHTLGKKEKGRGRAMVAAISRIQRRAAQIITGA
                     FRTTAGAAVDIEAQLLPPIQQLEQTALEAAMRIRTTPLYAEMAPPHNGNTTHSPLNQL
                     SSILESKFNIKLDQLEKRQPHIVPPWWTPPYTRIAESPEAAVKEHNATERTTLSIYTD
                     GSGIDERVGAAAIAPMLQFRDIQTKRTEYMGASTTSTVRTRLENVWSLPTIKPPFKQW
                     PTRNVPRDSIS"
     gene            <53252..>54346
                     /locus_tag="TRUGW13939_10365"
                     /db_xref="GeneID:55997845"
     mRNA            join(<53252..53803,53849..53948,53998..54197,
                     54248..>54346)
                     /locus_tag="TRUGW13939_10365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493477.1"
                     /db_xref="GeneID:55997845"
     CDS             join(53252..53803,53849..53948,53998..54197,54248..54346)
                     /locus_tag="TRUGW13939_10365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349370.1"
                     /db_xref="GeneID:55997845"
                     /translation="MAQSNKHQSHFAFEQVLSQNASTPTIPPLPTQFSQVRKDIKLPN
                     TPKASTARDAPREAFTKGPGSYSGTNSKARRNLPLPRKGSPWDTYRKEFSCDLAGDAA
                     VVVHRTDPSKVLLLRSFPGDIAEKVLQWLNQLQHPNIMGAKMCYSAENSLYALCEDLP
                     LTLEHLIVCGARLTEVQLSAILSQILDALSYLAAEGFEHRSVKSSNVLMGLDGVVKIG
                     YLQDIHSQSQTQDQTNTLKALETITMELMGGTAGMNDVKQWPLDSDAVTFLLATASVG
                     GSVGELRKHRLITKYADSKGELIGLARFALISARTFYSYP"
     gene            complement(<55392..>57269)
                     /locus_tag="TRUGW13939_10366"
                     /db_xref="GeneID:55997846"
     mRNA            complement(join(<55392..55650,55703..56906,56989..57145,
                     57195..>57269))
                     /locus_tag="TRUGW13939_10366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493478.1"
                     /db_xref="GeneID:55997846"
     CDS             complement(join(55392..55650,55703..56906,56989..57145,
                     57195..57269))
                     /locus_tag="TRUGW13939_10366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349371.1"
                     /db_xref="GeneID:55997846"
                     /translation="MFREQENTHGYLPEYLVRSIKANPEHEWAVHQYLEASERLIQVA
                     GENADVHFYFFQQYIENPSNIQPTNHLQDTLLAEPHQEQQDILSVDPKMIQKRNIPLD
                     EALPSESIEMSDYLDLDMFKDGFADETPVYPTNTTSGASFRLTEGSESEYPATSLPSS
                     AGLINSPWENTKETTTLADAQQTVEDVANKDDNPPLQAHQNTSQTRDHAKVKENGLTP
                     SGYPAKKIHTAEGLTKPRKRKLSIRSKKAEYRQSAHSMSGQRLLKPKSPGINNTDSVV
                     TTQKHDCPYWMKINSSYAPMWFLFGPGHDKALTEDNFKDIFKLVTDITGHDQARFLEI
                     QSNLWQTNRFWNPDPLCFPVTENLSIVRLCLSFFHYLQNLGEGTMIDAVRGRFARIRL
                     HLSFNRLFNEEYQQRPADHKRSPNKREVASHVINDLVNVEQYQEDSLKEKDRQKFKTH
                     KTHGKKWFLIAHYIGWGALIIWDNDNSKIGKMSYTMLKAFITYIVNARPDIVALCREY
                     EGPVKALLAGKNPTHILRQEDVRETIRRVSQEAPSSSWKKVDVDTEVDESDFIYSG"
     gene            <60152..>64741
                     /locus_tag="TRUGW13939_10367"
                     /db_xref="GeneID:55997847"
     mRNA            <60152..>64741
                     /locus_tag="TRUGW13939_10367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493479.1"
                     /db_xref="GeneID:55997847"
     CDS             60152..64741
                     /locus_tag="TRUGW13939_10367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349372.1"
                     /db_xref="GeneID:55997847"
                     /translation="MASLTHNDYTIAWICALPLEATAARAMLNKTHSPLPKPSTDPNA
                     YDLGELNGHNIVITYLPAGIYGKVSATAVVSHMHSTFPRLQYGLMVGIGGGVPGRNND
                     IRLGDVVVSKPMGRYSGVIQYDYGKAVRGGKFEPTGTLNKPPQALLTHMSQLQTKYMS
                     GDQDDVLKIVWETLERNPGMKDRFSPPEQQTDFLFHSSYHHADENDSCRKCDKEKLVK
                     RLPRATKTPCIHYGLIASGDQVIKDSETRDRLAQQHGMLCFEMEAAGLMDELPTLVIR
                     GICDYCDSHKQKQWQGYAALTAAAYTKLLLSMIPVRNVNMGHMKSKKMRHWMVSLPRN
                     PKFVGRQDEVTKLEGLITKQDGPRRIAVTGLGGVGKTQVVLELVHRIRDHDEECSVFW
                     IPCTSHAMIEQTFLHIAQILGLHDMNPAVVKEQIHKFLRSERAGKWLLIFDNADDAEM
                     WFAPNQTATPLEDFLPESEQGRILFTTRNRKLGMKLAPFNVVPIPDVDKETAVKILEK
                     MLAHEDLLRDTPMTTTLLEELAFLPLAIAQASAYIIENNIDLTTYLTLLQEQEQDAVE
                     LLSEDFRDPGRYKTIENPVITTWLISFKQIQRRDQLAADYLSFMACIDPRNIPQSLLP
                     QPRSRKKKIDALGLLNAYSFTNGQDMDIDMHRLVHIATRNWLRKNALFSQWIHKVANQ
                     MQNVFPDNHYTNRELWQKYLPHALVLVREIEFNVQENSYPDLAQKIADCLASDGRYQE
                     AEELYDKLMRINLEKAGSEHPSTLSSMANLASTYRNQGRWNEAEKLGVQVMETSKTVL
                     GDEHPSTLTSMANLSSTYRNQGRWNEAEKLDVQVMETRKTVLGDEHPDTLTSMANLAS
                     TFWYQGRWNEAEKLGVQVMETSKTVLGDEHPDTLTSMANLASTYRNQGQWNEAEKLNV
                     QVIETSKTVLGDEHPDTLTSMANLASTYRNQGRWNEAEKLGVQVMETSKTVLGDEHPD
                     TLISMANLASTYRNQGRWNEAENLNVQVIETSKTVLGDEHPSTLTSMANLASTYRNQG
                     RWNEAEKLDVQVMETFKTVLGDEHPDTLTSMANLASTYRNQGRWNEAEKLDVQVMETF
                     KTVLGDEHPDTLTSMANLASTYRNQGRWNEAEKLGVQVMETSKTVLGDEHPSTLTSMA
                     NLASTYRNQGRWNEAEKLNVQVIETSKTVLGDEHPSTLTSMANLASTFFNQGRWNEAE
                     NLNVQVMETSKTVLGDEHPSTLTSMANLASTFFNQGRWNEAEKLNVQVMETRKTVLGD
                     EHPSTLTSMANLASIYRNQGRWNEAEKLDVQVMETLKTVLGDEHPDTLTSMGNLAETF
                     WYQGRWNEAEKLDVQVMETSKTVLGDEHPDTLTSMANLASTCRNQGRWNEAEKLDVQV
                     METLKTVLGDEHPDTLTSMNNLAYTWQFQGKLHDAVSLMKECSDLRNKVLGPNHPQSM
                     LSSRALNDWMDEDNALTDQTPLTGDKTPQPRRDVSAGSSAAVVTTSSAYEGHINLSYP
                     QRRPAATLLLKNHPLIIAARTPSPAPEGQNLQDVD"
     gene            <66334..>67937
                     /locus_tag="TRUGW13939_10368"
                     /db_xref="GeneID:55997848"
     mRNA            join(<66334..66507,66558..>67937)
                     /locus_tag="TRUGW13939_10368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493480.1"
                     /db_xref="GeneID:55997848"
     CDS             join(66334..66507,66558..67937)
                     /locus_tag="TRUGW13939_10368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349373.1"
                     /db_xref="GeneID:55997848"
                     /translation="MKRAQSPCLHDNGHDERPAKVRRQESLSTPSGSLKREQEEQIKV
                     QHPPSPFSPNPDGENPVNLEREATTRPSLTNTATEHTNEIFDWIPAPSEIGELDDMSQ
                     PASKRSRSRSISTDRGRARSLSSDSDRSSARDAKSSAYKAVNYVTILETKGCFMRQSS
                     SSPHPDDIALCERLLHQPIEPPQGTLFDDEYITDFHNALQNRSEARLFVDLHPLLMPS
                     AENQFIQGKTRLKDVIDGYNDLWVKTEPIYGPKPQPDHARGLKWSTFSESQRRRLGIK
                     PDEKSPYTAREDMYFPYVTAEIKCGNQALELADRQNMHSMCIALRAVVSLSRAAGCPE
                     KVHRRILGFSLSHELEGLRIYGYYPEIDGGNTSYFRWPVAQLNIWTKEDKWACYRFME
                     NVDREFLPIHTDRLIRLLEDVPDLEEYSLSDDVEIESQVSRIGSQDRSGLRRTTSSLG
                     RGLQPELRMMVQTLQQQLAEQKEREDKLLTQLERQREREEKREVEQKAREDRLLAQLE
                     HLTQKLTDK"
     gene            complement(<69079..>72369)
                     /locus_tag="TRUGW13939_10369"
                     /db_xref="GeneID:55997849"
     mRNA            complement(join(<69079..69512,69563..70157,71082..71391,
                     72175..72261,72311..>72369))
                     /locus_tag="TRUGW13939_10369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493481.1"
                     /db_xref="GeneID:55997849"
     CDS             complement(join(69079..69512,69563..70157,71082..71391,
                     72175..72261,72311..72369))
                     /locus_tag="TRUGW13939_10369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349374.1"
                     /db_xref="GeneID:55997849"
                     /translation="MTDFLVQLEEGELGIWLMDGYMPKIFWDTLEDSKVVSSDERLGD
                     PSVTVAQFHPIHSRRQEVNTLKKWIAEENEDPQGPISAVKNLDEASVVELDFELASLE
                     LRFRDIVVSRLKGTSGWKREMKSLPLFQLRNMRASQLSAPFTIGDASESEGTPQVWVA
                     MYSDEHGQVRQASNTGAEFFDLQVQTRFLDFALVHQNESMQPVPLNIGNKDEVNTFYF
                     DAFDRLQQSNCRGIAVELIKAVEPRKQAMHPYRSGEETKPGWWPADVPHKEPAHLRKE
                     RRFSPHLKAYSLTDLDRMKLLLHIMQDLHLPNINAEILHEAAKRAVIQPPEKSKLLDQ
                     VFRVRKKAEELMMCQNDPTVFDGSEAKPKHLKREYSEDPALQPSSYTSEDTNYKRRRW
                     QTSQLDHADSITSTPGETVAFPQGAFEYGNNASSRLVNLNEQAPLHHSVQSLSCSQDI
                     VPQPTSYHAFTPFYGSQYPTYGASQALLPTGPSVDFYQRAHAQP"
     gene            complement(<73216..>73699)
                     /locus_tag="TRUGW13939_10370"
                     /db_xref="GeneID:55997850"
     mRNA            complement(join(<73216..73515,73571..>73699))
                     /locus_tag="TRUGW13939_10370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493482.1"
                     /db_xref="GeneID:55997850"
     CDS             complement(join(73216..73515,73571..73699))
                     /locus_tag="TRUGW13939_10370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349375.1"
                     /db_xref="GeneID:55997850"
                     /translation="MASLSEIFACLGWYQSSNSSQSQGDDDDQKDKELGTSGSSKYEG
                     TTFIEVIFAHTDLVVTIFDRTQWAIKCHPWRKFTKFPDAVDAVTEAGYSYEQLQIASN
                     AVYEGRYKNGTVEKLCAAAQQKRSERRHAEDSRLTVQCPD"
     gene            <75574..>76542
                     /locus_tag="TRUGW13939_10371"
                     /db_xref="GeneID:55997851"
     mRNA            <75574..>76542
                     /locus_tag="TRUGW13939_10371"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493483.1"
                     /db_xref="GeneID:55997851"
     CDS             75574..76542
                     /locus_tag="TRUGW13939_10371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349376.1"
                     /db_xref="GeneID:55997851"
                     /translation="MSVYPVMLRPEGGSSIVAFGTTGIVCRNSRRPEQVLKAPLLHKV
                     EGCSADIIETTKHRDEFARSCFEREKIIYGILPKHPNILDCIEITDHCISFPFMRLGN
                     LREYLQSHNQKISSQTRGQWVEMAVTAISLVHSFGVVHADISARNFLVADDLSLKLCD
                     FSGSAIGENGSLVEEEDRYRITPDCPRSKTTDIFALGCLIYEISNGLRPYDDIDDDDC
                     EEIENRYSIGQFPCLDGLPHREIIHKCWTCVYANVDELNDEVQNKMRVGRSLLPALFS
                     RSVSTISTRQLSFVTTTIFVIAISSMLFLYPRRGYWRAQWLGWILR"
     gene            complement(<77504..>78187)
                     /locus_tag="TRUGW13939_10372"
                     /db_xref="GeneID:55997852"
     mRNA            complement(join(<77504..77769,77819..77899,77954..78022,
                     78073..>78187))
                     /locus_tag="TRUGW13939_10372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493484.1"
                     /db_xref="GeneID:55997852"
     CDS             complement(join(77504..77769,77819..77899,77954..78022,
                     78073..78187))
                     /locus_tag="TRUGW13939_10372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349377.1"
                     /db_xref="GeneID:55997852"
                     /translation="MNKANRKQLLYEIKIRQKEFDDPSLRALASDNGILCSAVQVDSE
                     TQQQNRDQMRNESYATQGRVMSSIPPLEFQQPSTEQIQTMQNSRQIDFLFSNGPVNHM
                     SQLRNYVDNAMQSSHHWRAEREAEEPTTECLTAMIPRDENADISITIWVGQTAGMELL
                     EILRLQPTWSSSQGHL"
     gene            complement(<79465..>80703)
                     /locus_tag="TRUGW13939_10373"
                     /db_xref="GeneID:55997853"
     mRNA            complement(<79465..>80703)
                     /locus_tag="TRUGW13939_10373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493485.1"
                     /db_xref="GeneID:55997853"
     CDS             complement(79465..80703)
                     /locus_tag="TRUGW13939_10373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349378.1"
                     /db_xref="GeneID:55997853"
                     /translation="MAVTLTKIPCYSPTPTLPALPAIPRKNTTPNDHSKRPDSVSSLH
                     SNLPPSSFSQPVIYHSLPPRPPAVIPSSTTNRINSHSSYANDFDRAFDGLVSVTGGAK
                     DRDGVSSICVPAKGSPPRCPCLSFVLSLHETENTGRTDSHVPLPDQHSLWRTTPIAAS
                     ADPTPSSTREQSQPRDQLDPTPEVGMPSPRAVHADPNLGSADSEMELSVQRLSTVNRE
                     HPLVTPPAASSAPSCSASLRRSYTQTDLTPPDSGQPGSIISVEPSPDSMTDPAIRDLP
                     LLFSGEAVGQSRENLQARSDRYDLGRNSHTHAKSPPIASGSEQLRLDIEDFESVSDTD
                     DNALGSGDRWEYRRIKARRIDSSGRRMARVEWKDTWEPEDELDGLKMALRRYARERRA
                     KRDSEGTCLKYGARKRSCPV"
     gene            <85533..>88146
                     /locus_tag="TRUGW13939_10374"
                     /db_xref="GeneID:55997854"
     mRNA            join(<85533..86060,86118..87561,87614..>88146)
                     /locus_tag="TRUGW13939_10374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493486.1"
                     /db_xref="GeneID:55997854"
     CDS             join(85533..86060,86118..87561,87614..88146)
                     /locus_tag="TRUGW13939_10374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349379.1"
                     /db_xref="GeneID:55997854"
                     /translation="MSQSQLSDFTSSLYSGDIDDLPSLSTQQITPSASHHTIDSGFHR
                     PDDLLVPPSLIRVGPDRRNRFVLYDKMSHNEFIDWWLQTDYGRKRKINWDSHRHTVIW
                     NSYNQVAEGVDGTPKVMCKRCGKILEHPYSLSLNSSGKAQYHGTSTIQKHLKTAGCLR
                     SEKGKKAEITKFLQKEGEISADIPFLQEDWEDDILQFLTLNRLPFHLIEHPSFKRIIY
                     KARSALVAPVIPSADTIRRRLGSLVKDRQQRVLRTLPAGSKISIALDCWTSPFSQAFM
                     AITGYFIDSDWVYREVLLGFKPLHGTHTGSYLSGVLMETLVENNIEDRVFGLTTDNAS
                     NNKALAASLQQALSDGVIITRIPCLAHVIQLSLNQLLVRIKAVPSNESAETKWTESQS
                     RLVQENAKQCQISSTLNKVRYLAIYINASPQRRETFYNLQTTNVKIVPIQDVKTRWNS
                     TFLMLRRAKRLRAIFSLFCAEYDCEEMLLSEHEWRQIDYLLCITEPFFDYTTQLSKTR
                     DVTAHYVFKIYNRLFDHLERSQTQLQRKRVPWKKQMLDALDAGRTKLDEYYAQTDTIR
                     GHIYAVSTMLAPVNKFRFFLSSDWDQKWRDIYRNAFQQALIPYQAQVKSQSQDAYSSH
                     TAAQPSSRLEEMLDGKDIQPRAMTDEISQYLDSDTVSVGPLIFWKEHQYRFPAIAALA
                     RDALSFPATGAGVERLFNTARDVCHYRRGRMKTETIEELMMFLCTSKFDIEAQEAKLL
                     EKFFSQDELEAAKEEREEKLNKDEINPISDTEEQEDELENGPENEMEDIGLDTTFLSA
                     AEPDSPGSPSLPPTCTQTRVSGRKRKSREDDIFEYH"
     gene            complement(<93170..>98533)
                     /locus_tag="TRUGW13939_10375"
                     /db_xref="GeneID:55997855"
     mRNA            complement(join(<93170..93365,93522..93609,95958..96452,
                     96505..97948,98006..>98533))
                     /locus_tag="TRUGW13939_10375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493487.1"
                     /db_xref="GeneID:55997855"
     CDS             complement(join(93170..93365,93522..93609,95958..96452,
                     96505..97948,98006..98533))
                     /locus_tag="TRUGW13939_10375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349380.1"
                     /db_xref="GeneID:55997855"
                     /translation="MSQSQLSDFTSSLYSGDIDDLPSLSTQQITPSASHHTIDSGFHR
                     PDDLLVPPSLIRVGPDRRNRFVLYDKMSHNEFIDWWLQTDYGRKRKINWDSHRHTVIW
                     NSYNQVAEGVDGTPKVMCKRCGKILEHPYSLSLNSSGKAQYHGTSTIQKHLKTAGCLR
                     SEKGKKAEITKFLQKEGEISADIPFLQEDWEDDILQFLTLNRLPFHLIEHPSFKRIIY
                     KARSALVAPVIPSADTIRRRLGSLVKDRQQRVLRTLPAGSKISIALDCWTSPFSQAFM
                     AITGYFIDSDWVYREVLLGFKPLHGTHTGSYLSGVLMETLVENNIEDRVFGLTTDNAS
                     NNKALAASLQQALSDGVIITRIPCLAHVIQLSLNQLLVRIKAVPSNESAETKWTESQS
                     RLVQENAKQCQISSTLNKVRYLAIYINASPQRRETFYNLQTTNVKIVPIQDVKTRWNS
                     TFLMLRRAKRLRAIFSLFCAEYDCEEMLLSEHEWRQIDYLLCITEPFFDYTTQLSKTR
                     DVTAHYVFKIYNRLFDHLERSQTQLQRKRVPWKKQMLDALDAGRTKLDEYYAQTDTIR
                     GHIYAVSTMLAPVNKFRFFLSSDWDQKWRDIYRNAFQQALIPYQAQVKSQSQDAYSSH
                     TAAQPSSRLEEMLDGKDIQPRAMTDEISQYLDSDTVSVGPLIFWKEHQYRFPAIAALA
                     RDALSFPATGAGVERLFNTARDVCHYRRGRMKTETIEELMMFLCTSKFDIEAQEAKLL
                     EKFFSQDELEAAKEEREEKLNKDEINPISDTEEQEDELENGPENEMEDIGLDTTFLSA
                     AEPDSPGSPSLPPTCTQTRVSGRKHALSTKHQVPNVINQIGYRYYTLNPTNTNNTNSA
                     LEAQYRDSANVSSGRNFYSVSGCTVTYFCNLTRSNQLCFAQDMIDAQVAITNVYDSYT
                     GG"
     gene            complement(<102471..>103228)
                     /locus_tag="TRUGW13939_10376"
                     /db_xref="GeneID:55997856"
     mRNA            complement(join(<102471..102728,102791..>103228))
                     /locus_tag="TRUGW13939_10376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493488.1"
                     /db_xref="GeneID:55997856"
     CDS             complement(join(102471..102728,102791..103228))
                     /locus_tag="TRUGW13939_10376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349381.1"
                     /db_xref="GeneID:55997856"
                     /translation="MLPRPYLLPIVSLALLFTVAVVLYSWDGSFSHIQRQICSKVSSC
                     ETQQTQRTFRPIKLLEKVDEEGTKTTNTFRSSLLPQNGGLLRVRMSDDTEKVGDYGVS
                     MFHQLHCLVVLREIIFPGGSPVHTEHNSSMARVQWAHCFDYLAQAILCAADDTLEPPK
                     TAVNEQGQNIKIIDGVGHIVHQCRDPASLWRVVEEGNARPYDQAIIGHSVRASGLFPG
                     TGYHEMPDLYRAD"
     gene            complement(<103711..>104701)
                     /locus_tag="TRUGW13939_10377"
                     /db_xref="GeneID:55997857"
     mRNA            complement(join(<103711..104387,104440..>104701))
                     /locus_tag="TRUGW13939_10377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493489.1"
                     /db_xref="GeneID:55997857"
     CDS             complement(join(103711..104387,104440..104701))
                     /locus_tag="TRUGW13939_10377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349382.1"
                     /db_xref="GeneID:55997857"
                     /translation="MYPIKYEAVDSSDAEVSEHDATDSSNLNYEIEESPGNKGLPMKR
                     EKLLLWLNGLIFCISLYLLFVTVILTRRNNDDLNDLLRMTSEYSPIFDRIDIPLVTKK
                     MNATLLEPDPSPIYRRPPSPEVDEAWNRLANIKPIVISRSDVIQLGRDPSVAAKWPES
                     FGFGSDAYIGRIDMFHQIHCLDWLRREANFDHYYGKKWPPGTPPSDMHRTHVSHCIYL
                     LLQNLMCNANVDIYTHYWADAQLNAFPDFSVNHKCRDFDAILKWQEDNSVDVDLFAAI
                     RKPPQYEAKIMSHRFKELFGWFDSHPDNGSDSGEIG"
     gene            <105284..>105612
                     /locus_tag="TRUGW13939_10378"
                     /db_xref="GeneID:55997858"
     mRNA            join(<105284..105362,105440..>105612)
                     /locus_tag="TRUGW13939_10378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493490.1"
                     /db_xref="GeneID:55997858"
     CDS             join(105284..105362,105440..105612)
                     /locus_tag="TRUGW13939_10378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349383.1"
                     /db_xref="GeneID:55997858"
                     /translation="MKLSLSLHVAYALIMSEIVVTAPLPDATSLSKSDPASGEGDATA
                     LYAYIAEDSELDGKKAKRDGDATALYAYIVEDSDVEDQK"
     gene            <106158..>106682
                     /locus_tag="TRUGW13939_10379"
                     /db_xref="GeneID:55997859"
     mRNA            <106158..>106682
                     /locus_tag="TRUGW13939_10379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493491.1"
                     /db_xref="GeneID:55997859"
     CDS             106158..106682
                     /locus_tag="TRUGW13939_10379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349384.1"
                     /db_xref="GeneID:55997859"
                     /translation="MVATCFATSILLLITITSFTGHKPGSYVRLYTVSQQNAFQPEHL
                     DSFGGPMELGGTYRCGSYPSEAKSLGCVFDLMNFGWTAPECYYEGVSVPGIAEGPYKF
                     YLDKNLTVEIPQDVALSGRVVDVYTTRHYHGEHCKWSQAVVALAKEDGNILIPQVIAQ
                     QNHTIHCQHYIEES"
     gene            complement(<106884..>107602)
                     /locus_tag="TRUGW13939_10380"
                     /db_xref="GeneID:55997860"
     mRNA            complement(join(<106884..107131,107203..>107602))
                     /locus_tag="TRUGW13939_10380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493492.1"
                     /db_xref="GeneID:55997860"
     CDS             complement(join(106884..107131,107203..107602))
                     /locus_tag="TRUGW13939_10380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349385.1"
                     /db_xref="GeneID:55997860"
                     /translation="MMGARLTDPHWAHLWEDPSSENITAKATDRVPWNLVTGRDIKRH
                     QKVINRETGQVVGYARWILPPILAKNNDVWLEAQVAEVTAAERAAYEKQYQACTKNGR
                     PTGMKSGSMMSYRSAPLEAVDARIRRDGPFLSLDYLTTNPVFWRRGIGSMLVQSGLKV
                     ADQHAIKTYVMSEPAALKLYLNLGFKLVETVSTDYSQYGGTEPMVHYFLIREPSL"
     gene            <107921..>108569
                     /locus_tag="TRUGW13939_10381"
                     /db_xref="GeneID:55997861"
     mRNA            join(<107921..108021,108104..>108569)
                     /locus_tag="TRUGW13939_10381"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493493.1"
                     /db_xref="GeneID:55997861"
     CDS             join(107921..108021,108104..108569)
                     /locus_tag="TRUGW13939_10381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349386.1"
                     /db_xref="GeneID:55997861"
                     /translation="MAAEIRPYTKRLYSCTGYLPLTADSEQKLIKQQLIDDSSDEEHL
                     SLPVTRKRSYCRSGASVVGIVSVVLLEMVAFAVLVTDSRSGKVPDSRPPQAQGGSVVT
                     AHCGTTPEGAKARGCFWDIMSFGWMHPSCFDREESARWEAEYGPWEWYSERPGNETDL
                     VPLTAEELPYSPVVWKTQGYHVQHCLLR"
     gene            <109703..>111079
                     /locus_tag="TRUGW13939_10382"
                     /db_xref="GeneID:55997862"
     mRNA            <109703..>111079
                     /locus_tag="TRUGW13939_10382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493494.1"
                     /db_xref="GeneID:55997862"
     CDS             109703..111079
                     /locus_tag="TRUGW13939_10382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349387.1"
                     /db_xref="GeneID:55997862"
                     /translation="MLLLMITVLLSVACSNAVVIVSDPSDYVDLSLDTIDNSLLTDWN
                     ITATLYQIIAVNGPYYFSEANRKIEHRTFAATDNDTSVVVVTDNSIMNISHSLILKHG
                     YASNIYQSSFYGVNAAVNVANGSFATFNNINITTHNGSANLYAYGSGTYAIVEDSDLY
                     SSGPISHGLYAGGNGTVTGRNIRHYSGGYRSSAFSGDTPAGYVYIYSSVAHTAGIGSA
                     IFYALGEIHAENVVGHAEQAPALFMDGVQTAELQKVDLTAGLLAGLLLFSSSEREAGA
                     YINLTGSKLTVLPETAPGLWFGNIIATAELANVEIETASGILVVANYSQITQDFNYYA
                     GYPDNNDLLPAEVDIYVSESYLDGDLVAYNGSSISWTLSQYSSWTGSVKFGYGDASFG
                     VYLDKTSKWILTHDAFLTNFTNDDTGLSNIISNGHSIYYDTTSTTNTWLKNQTIQLNG
                     GGKVTPST"
     gene            <112369..>112737
                     /locus_tag="TRUGW13939_10383"
                     /db_xref="GeneID:55997863"
     mRNA            <112369..>112737
                     /locus_tag="TRUGW13939_10383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493495.1"
                     /db_xref="GeneID:55997863"
     CDS             112369..112737
                     /locus_tag="TRUGW13939_10383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349388.1"
                     /db_xref="GeneID:55997863"
                     /translation="MKTALLVLLAAAFTNAQFSGLMFFRDSGDCPQQTASESQTSWTY
                     DASEGNLCFSNPYESDDLDVAFSGELIGTNAVAPKKLGGCPTSSCDKDCTTVDVEASG
                     NGALVECAQFSGASYLYLGQ"
     gene            <116179..>117364
                     /locus_tag="TRUGW13939_10384"
                     /db_xref="GeneID:55997864"
     mRNA            join(<116179..116300,116350..116389,116444..116611,
                     116697..116967,117036..117169,117224..>117364)
                     /locus_tag="TRUGW13939_10384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493496.1"
                     /db_xref="GeneID:55997864"
     CDS             join(116179..116300,116350..116389,116444..116611,
                     116697..116967,117036..117169,117224..117364)
                     /locus_tag="TRUGW13939_10384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349389.1"
                     /db_xref="GeneID:55997864"
                     /translation="MNHLYESVTSSEPQNDKVLGEEIKRPLRKGELFCLAISMGSLQV
                     TWVTIMAEGSPFLLSLGLVPSLVSLVWLAGPVCGTLLQPFIGYKSDTCTHRWGRRKPY
                     IIYGTLVAFDNQIASNFLGLGMNISLQPVQAGLRELTVDHYPDRQQAEAGTFTSCIIL
                     IGSLIGYGAGFPKIPIPSVHGLIENIQFKGLCLIAFLSLGNDSRLASVPGSLQNSSRS
                     SSNSEDGLSCPVLLLASLVSFFVLRRDIPEQTLSVELIPDVAFSINHKSTIDKSNILL
                     IKNGASFQPVLQRTA"
     gene            <120029..>121302
                     /locus_tag="TRUGW13939_10385"
                     /db_xref="GeneID:55997865"
     mRNA            join(<120029..120436,120555..120977,121060..>121302)
                     /locus_tag="TRUGW13939_10385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493497.1"
                     /db_xref="GeneID:55997865"
     CDS             join(120029..120436,120555..120977,121060..121302)
                     /locus_tag="TRUGW13939_10385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349390.1"
                     /db_xref="GeneID:55997865"
                     /translation="MRTLTVLSFVAAVTGYRINPHLREENSSTCFPLQSATFHNSTTA
                     PDMTRSEWWCSAEQTYGFLGFSYPIEDDCDGEPYSLIESDFASMKNDFGASMARAYLP
                     GCYTDDIWERIIKAGIEYDMGVIFQVAWPLNGDPDSWWSKIQDSILDTLANSSYAEIA
                     PFVVHSIEFGTEPIGDTDGGSYDNFEGYLSKFKDLVKPYGIPVGISEDWDRPGIMSSD
                     NGNSLGPVGETIANLSDCVHAHVMPYYHDDLTEADSWNYIKNQVQWLKSNVNLPILIS
                     ETQWAWAYNDGHAGGHVTGPDSCDCGEEQYTNYWQNFDDNCQFFKQNQVGWFLHSWQQ
                     EGTFDMKKDDGSYAIPNWVPTKC"
     gene            complement(<123223..>124402)
                     /locus_tag="TRUGW13939_10386"
                     /db_xref="GeneID:55997866"
     mRNA            complement(join(<123223..123356,123419..124141,
                     124198..>124402))
                     /locus_tag="TRUGW13939_10386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493498.1"
                     /db_xref="GeneID:55997866"
     CDS             complement(join(123223..123356,123419..124141,
                     124198..124402))
                     /locus_tag="TRUGW13939_10386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349391.1"
                     /db_xref="GeneID:55997866"
                     /translation="MALRSILLVSWGAFVAANTCPLSVEISNVDDHNVNVTITNQADK
                     TVTFFKGNTVLDTRPVRKLLVQGEDDKELDFSGAYVDYKQSNPSSSMFQRLGSGQAVS
                     TIVNAAVSHKLDGVSNAKVTALQHLKYVMGETIPSNLKDMSFCPGVVSQKVAIVPNQM
                     KAASEHFSKTSPAASIQRRDLGIENCSADQQTDLQTSVNDAIAMASAAQQAEANEDDY
                     WINWFKDAGQSSTTDSIYGQVINAQSTGFTISCSDTYGACGDNGDSALAVTITPDNVI
                     IPCPNGGYWDLGEFAGDCEASDYDKAGAILHEMTHLFGTSDYAYGHDDCEALSADQAA
                     MNADTYELYAESVRLGGCQ"
     gene            complement(<126535..>128764)
                     /locus_tag="TRUGW13939_10387"
                     /db_xref="GeneID:55997867"
     mRNA            complement(join(<126535..127811,128064..128592,
                     128669..>128764))
                     /locus_tag="TRUGW13939_10387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493499.1"
                     /db_xref="GeneID:55997867"
     CDS             complement(join(126535..127811,128064..128592,
                     128669..128764))
                     /locus_tag="TRUGW13939_10387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349392.1"
                     /db_xref="GeneID:55997867"
                     /translation="MSLQEGPRKKRLKTGITRVRTGCYTCRQRKVKCDEGKPGCQTCG
                     QLGLCCEGYAPRYKFADPKTFETIQWATTVLPETGSPPQQPPSPTLLRDAGQSACSAS
                     SGSAVGSDNAIYFPVASILGTMEHNKSALIGESSSSAPQVQLDANVPAQFSPFNDVFL
                     DTFDNSGFVHHSESNFAVQRSGRSPSRMNLFPTHLATPSECADSLQIPAHRSRKSCYI
                     PQKEHQYQSLQYYNKGIQGIGKSFEVTQSNPLHVLAALLLSYYFELDSGSFTGGIGHM
                     TVIDKFLAANHEEIKTNPTGQKLLCTWMNLRSQFVNRYLGGYRSSELAHTIDTFPLNR
                     MIENGGSHHDSIMIMMCDCKLLSRKIILDWCVARGDYYGPNNKAPLDHVLTQMSLPKS
                     RQESVSQLDSIDESYRDSLAKQRTRLDKWHSDLDLSELPIDSYVSQHKDLLRQSTTEL
                     DILPLKFHSFEIAMNYAYYAHAQMLCSEDVVDRLEQTFVEPAFTRRDYPWAELILRIT
                     HGLDISDCIYKSTFNTGILTILTACMAVCPRADVASWIENWIRKVEDYGIPLESGLPF
                     GIIKRVIRFILDQRKKRRHVLLIMPLDIEDAEKSDLYQSDFKMQVIACGKNMDTGKLY
                     NEMAEIPEM"
     gene            <129236..>131572
                     /locus_tag="TRUGW13939_10388"
                     /db_xref="GeneID:55997868"
     mRNA            join(<129236..129569,129620..129659,129732..129853,
                     129918..129950,130005..130075,130129..130200,
                     130254..130605,130657..131010,131064..>131572)
                     /locus_tag="TRUGW13939_10388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493500.1"
                     /db_xref="GeneID:55997868"
     CDS             join(129236..129569,129620..129659,129732..129853,
                     129918..129950,130005..130075,130129..130200,
                     130254..130605,130657..131010,131064..131572)
                     /locus_tag="TRUGW13939_10388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349393.1"
                     /db_xref="GeneID:55997868"
                     /translation="MMVSSDVQDDPKALDMKSLSKDATDVESVAVSDSNNAVGESQLP
                     GLADLDGIQRSWSLQNLVIIWVSALLISFAINLNNQTSGSFASYATSNFASASLLGTV
                     TVVQAVASTVALQPLARLADVYGRFEMLSVSVLLLTIGEIMIASSHSVSVYAGAQVLW
                     AFGYIGISLMLQILAGDTSDLHNRALINAIPLAPSLITCWISGPVASGLINITWRWGF
                     GIFAIIIPAISIPLLASLFHNKKKGSKLRKAEGTYQPRNHVQNFIQLDPLGLLLFGAG
                     LALVLIPISLAPSNENNWKNTDTIVELVIGSLCLVAFVVWELMWARYPILSMGVLKSR
                     TVVFGLIAMVINYTGLYILQSYLLLYQMIAANLSVNAATNIYILIPFSGSLGQIGAGL
                     VVKYLKRYKWVVVSGYGIIVLGMGLTYKYINGHGQMPQLVVSQLILGIGEGIVMTTQF
                     GVQASISQSDMAAGTAFYTMSIAVGNAIGAAIAGGMWTSESLKYRLQESQIVLTELFL
                     LLALLPRKLRANLPTEDVSYVEEIEGSITAALAFPWGTSTRDAINESFTSTFRTMLLV
                     SLILVAVALLCSLLLQNHNIREVDNSREYKGIVIGKTRAVDILKEKVHVGHDGKPSVE
                     NGSY"
     gene            complement(<131788..>133178)
                     /locus_tag="TRUGW13939_10389"
                     /db_xref="GeneID:55997869"
     mRNA            complement(join(<131788..132119,132189..132564,
                     132629..132729,132790..132893,132945..133082,
                     133144..>133178))
                     /locus_tag="TRUGW13939_10389"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493501.1"
                     /db_xref="GeneID:55997869"
     CDS             complement(join(131788..132119,132189..132564,
                     132629..132729,132790..132893,132945..133082,
                     133144..133178))
                     /locus_tag="TRUGW13939_10389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349394.1"
                     /db_xref="GeneID:55997869"
                     /translation="MAPQPFNITIIGAGVAGLTTAFVLSQKPKYRVTVVAKFMPGDYD
                     AEYASPWAGANFWPMGAPGSEQAGLEEATWPELSKLANEHPESGVAFEKAYIHTRVED
                     VGKAGSLFAQSDNRMPWWSHLFHDFKCLDQPRLPAGIHSTYEFTTVCINTAVYLSWLL
                     SKCISNEVIFKRAVVEHVADAASLHASSKPADLVINCTGLMARYLGGVEDKTVVPARG
                     QVVVVRNDPGVMATISTTDTKNNGMAYMMSRPCGGGTILGGCYQIGNWNASPDPHLAE
                     SIKKGCLAMYPELTQGNAVELSVIRHGVGFRPVRPQGVRIEAERVKGVSVVHNYGHGG
                     WGYQSSYGSAAAVALLVEREAEVKSKL"
     gene            <133734..>135822
                     /locus_tag="TRUGW13939_10390"
                     /db_xref="GeneID:55997870"
     mRNA            join(<133734..133832,133892..134652,134712..>135822)
                     /locus_tag="TRUGW13939_10390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493502.1"
                     /db_xref="GeneID:55997870"
     CDS             join(133734..133832,133892..134652,134712..135822)
                     /locus_tag="TRUGW13939_10390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349395.1"
                     /db_xref="GeneID:55997870"
                     /translation="MSDTVVPYGKWISPITAEHLSSGSIHFEGIYANPSTGQIFVLES
                     RPAEGGRFAIVELADDAATSKDVLPAEYNASGTIHEYGGGSCAMHPHGRLLFTNNPDN
                     GIYLLDPGSGKVETIIAPDVCVRFGNFHVHPKTVQWILAVQESHTKDFDGTTVVKNAI
                     AAIHVATGKVSIVLEGADFYQHPQFSPDGKQVCWTEWNHPDMPWSGTSLFVAQWEDGK
                     LQDHTLVSGEAGVESICQPRWGVDGTLFFVSDKTGYWKLYQFNGTTPELIDLKGLESA
                     EFGSREPCLGNCTYVQLDKSTIVASANQNATSNLVLVDLDTSSWKDLSLPVVDIQKNA
                     MTRLSATSFLVIGSTRTVPQALYRVDLGDTVSIKLLKPTIKLDIPGTLVSKAQHITFP
                     RLHGETDDTSAKYAHAWLFEPKNGAFKAPEGTKPPLLVWMHGGPTYHVPPGLSLTTQY
                     WTSRGYAYVMVNHVGSTGYGRAYRELLDGEWGTAEIADAASCVQYLTSEGLVDATKIG
                     IVGESAGGYSVMQALYTYPDIWAAGVSIYGISSLSEFAETTHKFESRYIDSLVLGKGR
                     KTKEEVEVMYRSRSAVYHTEKIKAPLLLLQGDIDTIVPAWQATRMVQKMHDLGKTVEL
                     EIYEGEGHGFHMGKTIKASTESQARFWEDNLL"
     gene            complement(<136021..>137709)
                     /locus_tag="TRUGW13939_10391"
                     /db_xref="GeneID:55997871"
     mRNA            complement(join(<136021..136429,136505..137481,
                     137533..>137709))
                     /locus_tag="TRUGW13939_10391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493503.1"
                     /db_xref="GeneID:55997871"
     CDS             complement(join(136021..136429,136505..137481,
                     137533..137709))
                     /locus_tag="TRUGW13939_10391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349396.1"
                     /db_xref="GeneID:55997871"
                     /translation="MALLDEATPGLYISQAGQDLPKTSPLNENFKRLVSETLEKWHIQ
                     GVSVAVVDGDDTWAEGYGTASSPDVPVRPSTLFYSGSTTKAFTAAAASLLVDDEENYP
                     NIKWKTPLNQIIPGDFVLPDEYATSHVTLEDALSHRSGLAGHELSLGRLGTVRDVVLN
                     LRHFKMSQEIRSAWQYNNAMYIAVSHMIEVATGEWLGDFLQKHIWAPLNMNSTFFSLD
                     DARKYAASAGNDTTLAVPYGWDEEKFEMAEVPYCEGVLSGAGAVISNVLDYSKYIRSV
                     MRQSGPLSKEGYAAMLEPRSFCPPMLPQLKNQILYTLGWMTSTYQGEFVMFHPGGLEG
                     MTATMILFPEREWGVLVFCNADGPGRETLAWHLIDEMLKVPQEDRLDLYDLAQKRLTQ
                     KREHNCTARERLYPSIPSPARPLSLPLEGYAGTYTHPAHPDLIISVTSEAEPWLHVEV
                     TGSLRSTLALRHVSGDYFLAEVSLYMLRRDPSAIVKAEFQVNAEGKVAWFGAAIDFDY
                     MPDTLIWFARSS"
     gene            complement(<138919..>139584)
                     /locus_tag="TRUGW13939_10392"
                     /db_xref="GeneID:55997872"
     mRNA            complement(join(<138919..139195,139361..>139584))
                     /locus_tag="TRUGW13939_10392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493504.1"
                     /db_xref="GeneID:55997872"
     CDS             complement(join(138919..139195,139361..139584))
                     /locus_tag="TRUGW13939_10392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349397.1"
                     /db_xref="GeneID:55997872"
                     /translation="MSLKPLTLWGHAGTPNPWKFAMILEELNVQYERKFIDFADLKKE
                     PFESINPNGRLPAIEDPNTGISVWESGAILDAIDRYVNEIRRISGVLDRWLECKGCLV
                     GGKYSYVNAAFVPWFDVVPVLWSDKIDIEKDFPHVNAWLTRIKARPAIAKALNDKAKT
                     MTAEGI"
     gene            <140291..>141095
                     /locus_tag="TRUGW13939_10393"
                     /db_xref="GeneID:55997873"
     mRNA            join(<140291..140534,140590..140872,140927..>141095)
                     /locus_tag="TRUGW13939_10393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493505.1"
                     /db_xref="GeneID:55997873"
     CDS             join(140291..140534,140590..140872,140927..141095)
                     /locus_tag="TRUGW13939_10393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349398.1"
                     /db_xref="GeneID:55997873"
                     /translation="MARMSPVILILGSGPNVGHHVARAFVAKGYRVALASRNIKEEDD
                     NTDQLQISADLSDPHSVKGIFSKVEASIGLPSVVVYNASAGAPNNPEDPLSILLADFS
                     RDLHVNTTSAFVAAQQAALSFKKLPDHMSKTFIYTGNILNETTVASLLDGGVGKSATA
                     HIIRSAAAAYRNKGFKFYYAAERKADGSPAYSEISGEAHGKFYAELTEQKSQGPWQQT
                     FVKDIGYKHFPAS"
     gene            complement(<142169..>144907)
                     /locus_tag="TRUGW13939_10394"
                     /db_xref="GeneID:55997874"
     mRNA            complement(join(<142169..142864,142916..143314,
                     143387..143473,143544..143660,143717..144208,
                     144258..144740,144797..>144907))
                     /locus_tag="TRUGW13939_10394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493506.1"
                     /db_xref="GeneID:55997874"
     CDS             complement(join(142169..142864,142916..143314,
                     143387..143473,143544..143660,143717..144208,
                     144258..144740,144797..144907))
                     /locus_tag="TRUGW13939_10394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349399.1"
                     /db_xref="GeneID:55997874"
                     /translation="MVKFSHGCWHPAPDTLIDWAAETVIAETRDEALHFVTSSKPINN
                     RGDTLNNPTLTHSLTSPTDNVFHLSSTHWIKQKSVTQGPHFELFPDGKADRAVDIETS
                     KTAESLQLRAGDLAASVDTRPKSFDITFRAKDKLLTKLGWRSVGYIKQGTTALHPRAN
                     YINPNKGQRWVTYQLQLGVGERVFGLGERFGPFVKNGQSVEIWNEDGGTGSELTYKNI
                     PFFITSAGYGVFIPTSNFISFEIQSERTTRVNISVPGETLAMYLIYGPDPKSIIERYT
                     TITGKPALPPAWTFGLWLSTSFTTEYDEGTVNSFLDGMNERDIPVSVFHFDCFWMPAF
                     KWCDYEFDTDYFSDAKGQLARIKKRGVRICAWINPYIAQESAIFDEAAEKGYFIKKTD
                     GSVWQYDFWQAGMGFVDFTNPDACKWYQGKLQALIDIGTDFGERIPTGDVVYFDGSNP
                     EKMHNYYAFLYNKVTFEVLSKAFGEHNAALFARSATAGCQRFPVHWGGDPYSTFEAMA
                     ETLRGGMSLALSGFGYWAHDIGGFEGKPDPALFKRWIAFGLFSSHSRLHGSGSFRVPW
                     LIDQSGEADKVLKHFVQTKHSLMPYLYSSAIQTHRTGVPMLRAMFLEYPEDPTSWHLD
                     MQYFLGDNLLIAPVFNAEGRAQYYLPKGDWYGILDGKLRSGGGYVTEEHDFFSLPVLL
                     RPGSAVFRSVVQNLESVVYDWSKDVELLVNWAEGMKTTVEIADHEKLGFSKVTLNIED
                     SAEGVTINVFKGSFTGSVDVTLVNKSIMPLYEEAIASNSICLKQGSSKITFKVK"
     gene            <145541..>146096
                     /locus_tag="TRUGW13939_10395"
                     /db_xref="GeneID:55997875"
     mRNA            join(<145541..145603,145668..145758,145821..145840,
                     145908..>146096)
                     /locus_tag="TRUGW13939_10395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493507.1"
                     /db_xref="GeneID:55997875"
     CDS             join(145541..145603,145668..145758,145821..145840,
                     145908..146096)
                     /locus_tag="TRUGW13939_10395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349400.1"
                     /db_xref="GeneID:55997875"
                     /translation="MATASNSSVNGYTWACGLFAAVGSLLYGIDSGIVSTVISQPDFL
                     NYFAPFTPSIKGAVVSINTLSCELKSLLTEIQGRKKTIAIGAVIALIAGILQAASVKI
                     GMLIAGRIVGGFAVGIMS"
     gene            <146141..>147466
                     /locus_tag="TRUGW13939_10396"
                     /db_xref="GeneID:55997876"
     mRNA            join(<146141..146245,146298..146361,146418..146790,
                     146843..147049,147103..>147466)
                     /locus_tag="TRUGW13939_10396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493508.1"
                     /db_xref="GeneID:55997876"
     CDS             join(146141..146245,146298..146361,146418..146790,
                     146843..147049,147103..147466)
                     /locus_tag="TRUGW13939_10396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349401.1"
                     /db_xref="GeneID:55997876"
                     /translation="MTIPIYNSEIAPSHKRGLIAGLHAQFVGVGFAAANWVGFGCSYT
                     SGGFQWRFPFAFQCLPALIILIGIFWLPYSPRWLLEQERDEEALAVIKRLHGHQGEDD
                     TVIRGEFYQIREQLRFEKAQYVAGWSDLFTRANNRKRIILAVLVQAFTQLSGINVINY
                     YQTDLYKGLGMTGHTLTLLAGVYGLVGPLANVVCLYYVDSWGRRKTLWITGFVMALDM
                     AVVMGLSGGFAQSSNTVAKGFTIAFIFLFSMIYSLGYNSIHYIYVPEIMSMAIRARGS
                     SIAIVCNVIINIVFNQISPIAFAEVGYKYYSLFICTNLVGAVTVFFFFPETKGKSLEE
                     IGQIFGDDVIVGDLAQLREKIEAGDVEMMEQVEERK"
     gene            <150064..>151886
                     /locus_tag="TRUGW13939_10397"
                     /db_xref="GeneID:55997877"
     mRNA            join(<150064..151149,151194..>151886)
                     /locus_tag="TRUGW13939_10397"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493509.1"
                     /db_xref="GeneID:55997877"
     CDS             join(<150064..151149,151194..151886)
                     /locus_tag="TRUGW13939_10397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349402.1"
                     /db_xref="GeneID:55997877"
                     /translation="CWYAIAPQSGQIACDVPHLDSTLIYHPPIGRLLSKMALSSFASL
                     AALFCIQASLSLASSSSHNGHHHSGHHLQSRAENICAANVPNIVNDTAEYWPYQTFQS
                     FNATPPQLNITSNGKDLADGLLFFGPDLLSGDGQPKELASFIMTDSGELVWASPSAND
                     TTNLHTQVFDGKRVITYYTPDGPQSISGLHWGRVHILDNTYTEIHTVCPKLGLSKGKG
                     VTAECDADLHEHYITPENTMFVTAYNVTKIDMTSLGGTKDDWVTDALVVEVDIKSGDI
                     LMVWSALEHIPINQTHAAVPKNGVERTSAIDLYHINSIQSWGDYILVNSRHCWSTYLI
                     NRKTGDIEWTIDGETGGDFGPLPANGTFKWQHHARIKNISETEVVLTYFNNDSNKPTT
                     ETFSTGLALKLTLPPNPKTPIKLLAEVYDVNDEINAGAEGSMSTLYNGNYFMGYGFKA
                     IMKEYGSDAAHGQDVRWSAQFATLGAGHSYRAFKQEWHGLPATSPSLVVSRQAVPDEL
                     SSCIDSSSTMLGYVSWNGATDVSSYSLYGGSSKDDMKLLGSIKKMGFETVFPITERVP
                     VVMVSAGDASSDNVRNSTVVKVDWNI"
     gene            complement(<151992..>152927)
                     /locus_tag="TRUGW13939_10398"
                     /db_xref="GeneID:55997878"
     mRNA            complement(<151992..>152927)
                     /locus_tag="TRUGW13939_10398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493510.1"
                     /db_xref="GeneID:55997878"
     CDS             complement(151992..152927)
                     /locus_tag="TRUGW13939_10398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349403.1"
                     /db_xref="GeneID:55997878"
                     /translation="MIAIYSHVAIFDGQYNTYIWPCVAVWALDRVMRIGRLGVLNLSK
                     LQATIRYNKDADSIHLTVPVHGISRPRAGSYYSLYSVNGLKFWESHPFTLMSWNEVGA
                     KRTKDAALKLRFLVRPNDGFTARLRDHVSQKTYTHTEIGTSEVSIRIAVEGPYGHTFN
                     ISNYQNVLMIMGGTGVTVALSYLCMIRDIAIANEKPGISIRRVQLVWVVRDNHMFEEV
                     YESELLPLWTPDIFPGEIQFEIHVYVVENGSTTPSIKDDRGLKTKTFSSKFAKEGYAG
                     DTGKSWTRSHIGSMGASIRSEVGSALYREHSKKMI"
     gene            <155893..>157752
                     /locus_tag="TRUGW13939_10399"
                     /db_xref="GeneID:55997879"
     mRNA            join(<155893..156196,156261..156499,156561..156835,
                     156885..>157752)
                     /locus_tag="TRUGW13939_10399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493511.1"
                     /db_xref="GeneID:55997879"
     CDS             join(155893..156196,156261..156499,156561..156835,
                     156885..157752)
                     /locus_tag="TRUGW13939_10399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349404.1"
                     /db_xref="GeneID:55997879"
                     /translation="MNKTSHTDEPLEGDGYNQSPNPNSNDLTTNEDFNGLVNSRVMRE
                     SDSQALPNVASNVPGQIASDAPTENDGRGSTLGQRVRKMLATFGSFVGPGFMISVAYI
                     DPGNYSTDIAAGASYRFRLLFIVLLSNLFAIFLQSLAIKLGTVSGLNLAEACRAFLPR
                     WLNYILYVVAEAAIIATDIAEVIGFAIALNILIPQVPLVAGCAISIIDVMVILFFYRP
                     EGSMKSLRYFEMFIMFLVVAVVVCFCVQLSLIHATTPGEVFKGYLPSNSLIESEAIYQ
                     ACGILGATVMPHSLYLGSGIVQPRLREYDERNRLLPRQITSRYSVLDDGIDKGYYVPS
                     LGAIKHSLTVSVFELSISLFTFALFVNSAILIVAGASLYNNPNALDADIFGIHDLLSK
                     SISPAAGIIFALALLLSGVSAGIVCTIAGQMVSEGALNWKIKPWMRRLITRSISITPS
                     IIIAGAVGRSGLNAALNGSQVALSIILPFVTAPLIYFTCRDKYMTAHPGRARWRMVGK
                     DDESEVDQVVGDGAELECEGIKMTNSWYTAILAVLIWLFMSIMNVANLVFLGK"
     gene            complement(<158820..>160383)
                     /locus_tag="TRUGW13939_10400"
                     /db_xref="GeneID:55997880"
     mRNA            complement(join(<158820..160036,160089..160242,
                     160294..>160383))
                     /locus_tag="TRUGW13939_10400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493512.1"
                     /db_xref="GeneID:55997880"
     CDS             complement(join(158820..160036,160089..160242,
                     160294..160383))
                     /locus_tag="TRUGW13939_10400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349405.1"
                     /db_xref="GeneID:55997880"
                     /translation="MRYAAPPLGDLRFRAPQDPLKENQTQDATSHGPVCLSVPQKYSV
                     LQTTSEDCLFIDVQVPASTNSSSKLPVMIWFQGGAYILNLNADYNATGLIQASSDSVI
                     VVTFNYRVGLFGFLASQDVNDDGDLNAGLFDQRKAITWVHNHISAFGGDPERVTLFGT
                     SAGAGAVLLHTLAYGGENTSKPLFSAALSADPFVPEIFPYQQLEFQYREILNATNCSS
                     LECLRHLPTDSLLAANINRPFPGQTTSPLFYFSPCVDGIFFPDLPSKLLAEGRFQRVP
                     LLQGTVTDEGSIFAATANNTDVDQFDAFLGAQFPDLDTDGIDAQYSYMPLNTTSQAYY
                     NRASFAYGDVSYTCYGLSFAAAFAAANLPVYSWLYNVIDPVNTEVGIGVFHTWEVGAV
                     WGPGNAVNIAAPAGADSYTNINKGIVPLVQAYWTSFARAHDPNVWRLEGSPEWKTWGP
                     GQRLKIQTNSTTMEMVDGQQIENCEFWAARNSQVYH"
     gene            complement(<162264..>163288)
                     /locus_tag="TRUGW13939_10401"
                     /db_xref="GeneID:55997881"
     mRNA            complement(join(<162264..162722,162787..163200,
                     163253..>163288))
                     /locus_tag="TRUGW13939_10401"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493513.1"
                     /db_xref="GeneID:55997881"
     CDS             complement(join(162264..162722,162787..163200,
                     163253..163288))
                     /locus_tag="TRUGW13939_10401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349406.1"
                     /db_xref="GeneID:55997881"
                     /translation="MAPQLKNVAIIGASGNVGSIILDAFVGASQFNVTVLTRSSSSAT
                     FPARVTVRKSDFSEQDLVSAFNGQDVVISVVGLGGFTDQKKFIDAAISAGVKRFIPSE
                     FSANTLSPAVVQLLPVFAQKKEVLDYLKTKEASGLTWTAIWTALFFDQCLTTGFLGFD
                     LPTRTASIWDGGNSVFSLTNVDQLKRAVIATLERPAETANKNLYIASVETSQNELLAA
                     LEKATASKWTVTQTTTDEQVSEGTARLGKGDFTGAFVLVKATSLGNTPNLRANYIRDE
                     QLANDLLGLKLESVEDTVKRVVGASS"
     gene            complement(<166590..>167063)
                     /locus_tag="TRUGW13939_10402"
                     /db_xref="GeneID:55997882"
     mRNA            complement(<166590..>167063)
                     /locus_tag="TRUGW13939_10402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493514.1"
                     /db_xref="GeneID:55997882"
     CDS             complement(166590..167063)
                     /locus_tag="TRUGW13939_10402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349407.1"
                     /db_xref="GeneID:55997882"
                     /translation="MEHFHKGRPEIIQIFSPESQKCDSAHKAMDRDKLRGLLFDAARS
                     YSRAVIHAQQGKGHDRTLSALLYIVPKDEHLPEFFADPVYDFSRPSWVMTGSTNIAYQ
                     EAGFVLHQPKSVWVQYRVGDRGALFSVVANKGKGGFFVECLERAAKVVEDLLNNL"
     gene            <173300..>176390
                     /locus_tag="TRUGW13939_10403"
                     /db_xref="GeneID:55997883"
     mRNA            join(<173300..173327,173376..173899,174045..>176390)
                     /locus_tag="TRUGW13939_10403"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493515.1"
                     /db_xref="GeneID:55997883"
     CDS             join(173300..173327,173376..173899,174045..176390)
                     /locus_tag="TRUGW13939_10403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349408.1"
                     /db_xref="GeneID:55997883"
                     /translation="MQREIKALMLQIMKNQNPQPLSIFNLLDKPSSQLNILNSSQYGT
                     EILQMALGDTVRWAKTDEGLAFGSIDVTPRITLGKYSDLVSLASYFPPEDTNNNVVSS
                     LSTFDMPGIPPQLVALQHFLQHFIVLTSNHTLSQTMLFNVVDWMLKNIDASLFSYLFS
                     LKSIAVKIFMRKIFPAVVNSGNTKKALYPELSNLLIISTKDGYHGRRRLEVLQTLLSF
                     GADPEYLVKDGPRGIPLVDAAKTGNLDAVKMLITAGSGINVYVPSYFGTALQAAVHSE
                     NLELVECLLGWGADVNVPHGPQYYVQIEKFGYSQYISEFKACAFKTPIQIACERNNIP
                     LVEMLLAHGAPVDLCPLPQTIIDRSEWCVNDPPKYKETQFQTALQYSVTNRNIFLVRM
                     LLSKRVNPDSTVIPNRGDTPLQMSVRLDYPEITEILIESGADVNAAPGRINGRTAMQA
                     AAGSGNIQVAQILLSRNANINAPAGYSRGLTALQAAIRHGHPLMAGLLLMSGADINAP
                     PAPIDGLTVIEAAAESGDLNMIKDLMRQGAILDSATAESAILDAISHQNLPMLKFLVE
                     HATANKSDPEDESIPPIVAAVKLKWVDGVRHLLKMGADINASFYDEWEACENMNALNA
                     AIMNGDTEMMELLLSNDANLQWSSSENPYNDALCHAVYRNSSQLVFLLLDKYSPSGSI
                     SFDPNVLAYAVDYTHNTTTIFETILNAISKLPKGLYGAHIWNAWDKLADKLDYISKYF
                     AIKAAKLLVKAGAEINSKVGPADETLLQIAVGCGFFDMVEFLVRVGAYIQIPASRDVG
                     TPLQEAIQAPRHQCAYLLLEHGADVNALPVEIGGVTALQAAARHGHKDLAVELLERGS
                     DINAPPAKNCGVTALQAAAIKGHINIAIELLQRGAYVAAEAAPLNGRTAIDGAAEHGR
                     ENMLQLLLNHYDGDEDLKVVCERAAVWADREWHVEIARWLREYPGGSTESL"
     gene            <180278..>180751
                     /locus_tag="TRUGW13939_10404"
                     /db_xref="GeneID:55997884"
     mRNA            <180278..>180751
                     /locus_tag="TRUGW13939_10404"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493516.1"
                     /db_xref="GeneID:55997884"
     CDS             180278..180751
                     /locus_tag="TRUGW13939_10404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349409.1"
                     /db_xref="GeneID:55997884"
                     /translation="MSPIGSGLLTTFTTDANLSKLICFQALLGFGIGIGIQAPQVAAQ
                     TTLSSEDIPIGISAVMFAHGIGPAVFVSAAQSIFISRLKVYLADFSTQANATLLGDSG
                     LNNMISHVEADKLQGVLKACDKAVTEAFFLPVTLTILGMAGAASIRWHLVKQRYT"
     gene            complement(<183966..>186515)
                     /locus_tag="TRUGW13939_10405"
                     /db_xref="GeneID:55997885"
     mRNA            complement(join(<183966..184397,184457..184594,
                     184812..185232,185362..>186515))
                     /locus_tag="TRUGW13939_10405"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493517.1"
                     /db_xref="GeneID:55997885"
     CDS             complement(join(183966..184397,184457..184594,
                     184812..185232,185362..186515))
                     /locus_tag="TRUGW13939_10405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349410.1"
                     /db_xref="GeneID:55997885"
                     /translation="MENDLPPTGHAATLPSQVPPGAGKVTVSCLRCRSQKLKCNRELP
                     SCVRCRQHGAACHYPSAPDRRRIAQKTSQARARAKQRANALLRDGGDEIVGPSESSIV
                     NKSNNRRHANVFSKEDSHDASPNSDNPIDVETTDLPSTEVGLLLLEIYFKQVYNSTLL
                     FHKTVTFQLYLQNDLPDYLLRAIYAHAAIFLEQFDTPYKEYIRILPVQTLLQKSWSWA
                     RSASQQVLSYADEPTLVIIQTLQVLQFYYFSRNETQRAVIHASLAYRLNPLLGYDRLL
                     DDVSSSSSANCNIQFDHEMKRRCFWASWCTLCIGGSRLEPSSTWDNVAGLPLPAKFEK
                     RKPGLGVELMLGQKMDGAWETSSRTILIDGTQSEQFPGSLMAELVKILRVWAKVQEFL
                     AESHSHHDTQRMNQRSSFFDILELIEHHIDWPFIDLCARAESYNESIELITNIYSVYF
                     VSRLLLHASMVPILSGCSGCLRCSREPTPNNADIVLEQATAFARLLRQFIRNNLDITR
                     LWPFLGYGAFMAGSVFVVYKNNVQSARSTNQSLHTPGMDSDEMSSVRTVLEVLSLYWK
                     PLRVMAVKLNESIEMGQHAVLDSITSPMYPWYTPSHPNHTAEKRTTHYRYDSAVPKTL
                     SLRGVNESGSIHDDSYPAVLDDGHVSSLRKADTENHLLHTLHYGFQSGFHNTFLEHDD
                     AEILDLNWWGITPTANASGFPRPLGEVPQETQ"
     gene            <188151..>196119
                     /locus_tag="TRUGW13939_10406"
                     /db_xref="GeneID:55997886"
     mRNA            join(<188151..188761,188827..189337,189411..189534,
                     189601..190179,190230..193843,193905..194273,
                     194337..195155,195214..>196119)
                     /locus_tag="TRUGW13939_10406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493518.1"
                     /db_xref="GeneID:55997886"
     CDS             join(188151..188761,188827..189337,189411..189534,
                     189601..190179,190230..193843,193905..194273,
                     194337..195155,195214..196119)
                     /locus_tag="TRUGW13939_10406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349411.1"
                     /db_xref="GeneID:55997886"
                     /translation="MTVTDKLNGNSQNGTTHVSNGNTNGQQNGLANSQPIMSLDAGLE
                     PIAICGIGLRLPGAIRTGDDFWDVLYHGKDLRGPIPADRFNISAFDDLLGKKGAINTR
                     HGYFLDEDLGLIDASFFNMSKAELEKTDPQQRKLLEVARECLENAGEVNWRGKSVGVY
                     VGTFGDDWLQSTTKESQVTGSYNFSGDLMLANRVSYEFDFQGPSLVVKTGCSASLVAL
                     HEACRALQRQDCTAALVCGTSLLMGPHIFTVMTNEGVLSPEGSSKTFDAKADGFARAD
                     GINAVFLKRLPDALRDGNPIRAIVRNSGNNSDGKSQGLLSPRSSTQEALIRHVYSQAK
                     LDPSETGFIECHGTGTATGDPIETSAVGNVFGEKGIYIGSVKPNTGHSEGASGLTSLI
                     KAVLALEHKIIPPNIKFSVPNPKIAFEKNKLVVPVKPTPWPSNRTERISINSFGIGGS
                     NAHVIVDSIEQFLTDNPTLTHRWSLTFDKPTWTLPRLLLFSANNAESTKGFARQSIKY
                     ATQRPESLVDLAYSLSSRREKLPHRSYALVSANGVIAESAPVVKTTSRQRPQIWVFSG
                     QGAQWAQMGRELLANHPIFSRTIHDLDFALQSLKLRPKWTLRDELSKPKDTSQVYRAE
                     LSQPLTTAVQLGLVNVLKQLGVTADAVIGHSSGEIAAAYAADILSLSDAIIVSYLRGF
                     VTNFQTNKGGMAAVGLSANAVKEYLLEGTVIAAENSDKATTISGDETALDQVIENIKA
                     KHPDTLARRLRVDMAYHSPRMAIVGDSYLEMMRNTLGASRTWSQPSTSKTAMFSTVTS
                     QRIALTIDLKYWVTNLVSPVRFSPGFSTMLTALAGQPVIIEVGPHSQLAGPIREICTA
                     EGVQSSYIPTMIREADCVESLASAAGQLFQQGVEFDTSADSTIFPPGKVLTNLPLYQW
                     DHSAKYWYENRVSHDWRFRKYGHHALLGEIIPESSTIEPSWRCILDLEDEPWLRDHMI
                     ATDIVFPFAGYVSMAGEAIRQISGTDIAGYKVKHVVVHTALVLNESKPAEVITTLRKR
                     KLTDASDSKYYEFTISSHSGSTWTKHCEGNVVALTEKKSVADNVKTFPRKVMVSRWYD
                     IVSRVGLRYGPNFQGIKFLEASPVSMHAIAGIAETTNGPFLFHPTAMDSAFQLVIAAG
                     AKASSRNFTQLVVPTLIEEIEIYASSGLMTAEAQVSPDGKETELTCTSGQSVCLRMKG
                     ARLTALEGDQEPGFDRHKAARLEFFPNLDFVDHSTLVDAPFVRRETRVNIEETVLLSI
                     LDSAERVKDLEPSQPHYQIYREWLFREQKRASNKTYRLFTDRAHFFSTLTCEQRQDEL
                     NKRLELLSDDPVFKHLARGIHRVNQNCENLFTGKLDALNMLLEDNVLAEIYNSVSSDF
                     SRFVKLLSINKPTLRILEVGAGTGGATELILRDLVDISNNPPHSVYTFTDISGGFFAQ
                     AAERFKYTPNMEFRLFDISQSPFEQGFEANSYDLILANNVVHATENLQATLRNLRPLL
                     REGGQLLLSEVCATGANAPGFVFGQFSGWWMGEADDRKWEPYVHVSRWDRELKAAGFS
                     GADTAVFDEDEPYQYCAAIISHAVSKVTTEHSPGVGGLEAIAVVCDSPDHGPSADLIA
                     DIRSRGHDVEVVKFGTAPPPANRPVLVTLDLEGYFFQDITAPRLLAWQGLWHHHQGQK
                     LLWVMPKVQLDCDDPRPAQTLGAMRVARAELSLPFHTLEIDSSEPNFTDLVLKVFDKV
                     VGRDDVEALSPDREFVVQNGIVKVGRAQPFSLKKEIGFVATSECDTTRLEISKPGLLE
                     TLHWVSTKTTSLAADEVEIEARAVGLNFRDIMVSMGILTFGDGTPQLGIEMSGIITSV
                     GSAVQNVKPGDRVVALASQGCFSTKCIMKAPLVVQIPDNLGFEEAATMPAVFSTVIQA
                     LTRVAHLEKGKSVLIHSACGGIGHAAIQLCKNADVEIYVTVGSNTKAEYAENTLGISK
                     DHIFNSRDDSFVADIMRATNGKGVDIVLNSLSGPLLHASWDCVAEFGQLVELGKRDLV
                     EFGSLALEPFLLNRSYCCVDLAHMLERRPEKVGQLLQDSIDLFREGKIQSIASRTDFT
                     ANQITEAFRHLQKGNHIGKAVVTLPQDSSDLVSSPKRAEVSFDSSATYLLTGGLGGVG
                     RAVAAWMAERGARNLIFLSRSAGRGGDDLSFFAELEALGCTAIPVQGQVQLLEDVERA
                     IAAAPSPIHGILHLAMVLEDGAAVDLTFEQWTAAVAPKVDGAWNLHNSFIQRQQNLDF
                     FLLSSSIVTSAHHPGQSNYAAANTSLEAFAQYRRRQGLPAAVLSLCPIDDIGFVAENP
                     VIRRKLKSQGLNFLPEKEVLDYFEFAVLHQQDEVQSSSPKDQLSSWANDSHTIVGLHS
                     EMPLDDPNCHTIWRRNREMGFYHNVSTTSNNNISKSSSGLKAFIEQATSSGDPAKFLD
                     NDAAVDYLATEIGLRILQLMMRDADEVDISVSVHAVGMDSLMAIELRRWWKQNFAVDV
                     TVLEIMGAGTLRGLGHVASQGLKKKIFKEG"
     gene            complement(<196432..>198189)
                     /locus_tag="TRUGW13939_10407"
                     /db_xref="GeneID:55997887"
     mRNA            complement(<196432..>198189)
                     /locus_tag="TRUGW13939_10407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493519.1"
                     /db_xref="GeneID:55997887"
     CDS             complement(196432..198189)
                     /locus_tag="TRUGW13939_10407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349412.1"
                     /db_xref="GeneID:55997887"
                     /translation="MSTPDSTDSKAATLSGDNDLVHDRFNHANNLTTAEELNNEKDAL
                     DASLPVDLATSEAADNTTYPSGLRLLAIVGGLQLAVLCVSLDNTIIATAIPKITDQFQ
                     ALSDVGWYGSAYLLTFCGFTLFLGRLYKTFSVKWVFLLCLFFFELGSLICAVAPNSVA
                     LIVARAIAGIGGAGIFSGSLIILAFTTPLDKRPIYTGLFGAVYGIASIVGPLLGGAFT
                     DHVSWRWCFYINLPFGGITAASILLFLRLPEKEADLTQENPGLLRKIKSFDPIGTLLF
                     LPSVICILLALFWGGTTYPWSNGRIIALLTLFGVLLIAFAVVQYFVGEDATIPGRIIK
                     QRSIASSAYFSMCVGAAFFVNIYYIPIWFQVVRGTSATTAGVNTLPLLISFTLGATIA
                     GGVVTKQGYPAPFMYGLTVIGSIGAGLLTLYSVDITTGKWVGYQIVFGVGIGIGMQQT
                     IIQAQAVLPLTDVPIGTSIIIFAQMFGGSLFISVAQNVFATKLIEGLRGIHNLGVDPQ
                     TIVDAGATAAPSKLGITDPAVLEQLKHVYNEAIVGTFRVALITTCLSALGLIFMEWKS
                     VKDSQKAEDQTDAETGTTQ"
     gene            complement(<198879..>200040)
                     /locus_tag="TRUGW13939_10408"
                     /db_xref="GeneID:55997888"
     mRNA            complement(join(<198879..199592,199660..>200040))
                     /locus_tag="TRUGW13939_10408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493520.1"
                     /db_xref="GeneID:55997888"
     CDS             complement(join(198879..199592,199660..200040))
                     /locus_tag="TRUGW13939_10408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349413.1"
                     /db_xref="GeneID:55997888"
                     /translation="MATVTLEQFNPANFEPIPLPDHLPTYELPRVSISKLMGKDEAET
                     KTVVDICARTGFFLLNLMDHPLGRNLWESACKLRNLGQHIMATLPEEDKKLFLQREER
                     GVLDRGYTSSARDGQGVAKFVESINIPRDELFAKPTPGWELPSWLKPHEDLFKNIQTE
                     AHKVELVILAALEQQLELKPGTFTDTHQLEAPTHSFLRVLRYPPTGDGNGMRERPRVF
                     AHRDVVSISMLFTWVSGLQIPRDDAVYLNSDTPTEDSWLWVRPEAGHMIVNLGDTMPI
                     FTNGALKSGLHRVVTAHGDQANLDRVSVLFTGRPNWGVPMAPLVSSKIPAQSAEEAAR
                     PADSCKVWGDNVIKGYYKDNVKWNKAEVSV"
     gene            <201306..>202126
                     /locus_tag="TRUGW13939_10409"
                     /db_xref="GeneID:55997889"
     mRNA            join(<201306..201333,201405..>202126)
                     /locus_tag="TRUGW13939_10409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493521.1"
                     /db_xref="GeneID:55997889"
     CDS             join(201306..201333,201405..202126)
                     /locus_tag="TRUGW13939_10409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349414.1"
                     /db_xref="GeneID:55997889"
                     /translation="MSTLITLITGGNQGIGFETAKNLVFYSSSYHVILGSRDLHRGEA
                     AMKMLSALPDIKGTVSVVQLDVTDDASVDAAAASIKDSYGRLDVLVNSSGIFEPGKPR
                     IVARKIFETNVVGYINVTEAFLPLLHEAPSPRLVFLSSSLGSLTHASNPESRYYTPLG
                     TEYRAATAARNMIMNQYWVRLQKEGNGQFKVHGADPGLVVTNLAETPERLRARGAAEP
                     DVGGERVASIIKGERDADVGLVCGVYGVSPW"
     gene            <205674..>207082
                     /locus_tag="TRUGW13939_10410"
                     /db_xref="GeneID:55997890"
     mRNA            join(<205674..205943,206003..206362,206417..>207082)
                     /locus_tag="TRUGW13939_10410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493522.1"
                     /db_xref="GeneID:55997890"
     CDS             join(205674..205943,206003..206362,206417..207082)
                     /locus_tag="TRUGW13939_10410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349415.1"
                     /db_xref="GeneID:55997890"
                     /translation="MNGANSSGLSNCPKTPAPFPTNWIPVLEKLAFSPHKIDFVCIGA
                     GFSGLTLAYRWKHEGANEFINRRISEKNHDVGGTWLENRYPGNACDVPAHIYTFTFEP
                     NPDWTSFYASGREIWQYMKRTTEKYQLDERVRLNSRVTSAIWDDAAARWKIRVDQGGK
                     IIETEAHILINGSGILNKWHWPDIKGLSSFRGKLVLSADWDESLDWEDKRPEASKIAT
                     YIRSPTWITFNFAAQLTSDGENFEYPENDKRLWRENLGEHSKLRRHFEHEFNKFFPSY
                     LAEGAQQAEMNKLFRQTMEQRLNHNADLCAKLIPDFGIGCRRICPGDGYLEALQEKNV
                     RIEFCSVEEITPTGIRSCQGHEEFDIVVCATGFDVSFVPPWEMIGKNGVSLREQWKDA
                     PYAYFGICTPNMPNYFIYNGPNCPIAHGSLILVIEWFTD"
     gene            complement(<210220..>211188)
                     /locus_tag="TRUGW13939_10411"
                     /db_xref="GeneID:55997891"
     mRNA            complement(join(<210220..210419,210511..210534,
                     210639..>211188))
                     /locus_tag="TRUGW13939_10411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493523.1"
                     /db_xref="GeneID:55997891"
     CDS             complement(join(210220..210419,210511..210534,
                     210639..211188))
                     /locus_tag="TRUGW13939_10411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349416.1"
                     /db_xref="GeneID:55997891"
                     /translation="MSREDCYAALTWVYEHQVQFSVDIERIAIMGDSAGGCLAACASL
                     LARDRGLFHRLAKQILIYPMLDDRNTTPNLALEPLAPWKVADNITSWTTLLGNGNNHD
                     PVSQYAAPARSETVDGLQSAYIEVEVGDLDIFRNESIQYATVLAAADVGVEFHLYPGV
                     PHLFDILAPAIHVTKRALENRISELWKFLKHLYLAVGTVDYPVLLSILFRIIRAVHDP
                     RPNGDLERMLKVPGKHLFITDETWRSEPERELAERKFKG"
     gene            <211972..>212811
                     /locus_tag="TRUGW13939_10412"
                     /db_xref="GeneID:55997892"
     mRNA            <211972..>212811
                     /locus_tag="TRUGW13939_10412"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493524.1"
                     /db_xref="GeneID:55997892"
     CDS             211972..212811
                     /locus_tag="TRUGW13939_10412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349417.1"
                     /db_xref="GeneID:55997892"
                     /translation="MATTFPLFQRLPTELRLQVWSETLPKRIQNPLYFYTKRCWEPRH
                     LTEADSDYDPDAEHNINLEFCHEHLDPLEVEVPLFFVNHEAHSLALEWIRRQGLKLCF
                     NQEKQSLVFLRPFHPESDTLYVSEEKWTEFHCDPVDRLFGVDLEDISVGSPAPAFTRL
                     AVPDELLLKDPDAFSELFENYYGFDEIFIILRGQSNGYWYDIKDIQPQEWWELDTVDA
                     QRPSFRWNLGTKSFQWTGYDGDIRDCPLYDVLQHASSELTSKLLYVGKERFEIRPVFV
                     IRK"
     gene            complement(<213287..>213826)
                     /locus_tag="TRUGW13939_10413"
                     /db_xref="GeneID:55997893"
     mRNA            complement(<213287..>213826)
                     /locus_tag="TRUGW13939_10413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493525.1"
                     /db_xref="GeneID:55997893"
     CDS             complement(213287..213826)
                     /locus_tag="TRUGW13939_10413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349418.1"
                     /db_xref="GeneID:55997893"
                     /translation="MYNFKLLAFAALLCTSEVLAGKLQISTWNTKGGLKGEGGLEKLA
                     AGNIPNEYDHLVLQHIHAWSGGTHTASQGGRSGNVYVVSTKHGDHYTSYEDSKTKATE
                     ANRALKTKIHKEVKKAEEEAARHHHGHGGGGSPHGSHGSHGGHGGHGGHGHHRRRGGV
                     DEDVDEDVEDLLEEEEATE"
     gene            complement(<215668..>218586)
                     /locus_tag="TRUGW13939_10414"
                     /db_xref="GeneID:55997894"
     mRNA            complement(join(<215668..217652,217709..218419,
                     218469..>218586))
                     /locus_tag="TRUGW13939_10414"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493526.1"
                     /db_xref="GeneID:55997894"
     CDS             complement(join(215668..217652,217709..218419,
                     218469..218586))
                     /locus_tag="TRUGW13939_10414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349419.1"
                     /db_xref="GeneID:55997894"
                     /translation="MNRRSLQDIIVQYPIGTGLDGFRAKFKAQEDAYNDGDLTVQNSL
                     NKNLIGTLLLNDTPSLLRSSSGRRNLDDDLHHLLGLILNSNYDISRVRGLINAVVNEK
                     DDFEIWSAVCGFFEPRTPENQILSTDGTPNRSSHRGEVLTALYERWTTPYIGSSIHVL
                     DNMLKNHDRTMQETNPEQYYGKSVVFVQSSGMGKSRLADKFGETNLMINFVLREPDTT
                     GYPPADPEILQFMRSTMTVEDKNTINKSPTAKTLPREIEDMIWYHSLAFGLLQASFEK
                     LQDWVMEQKEMTSEGLAAERHALMAPYPPDQGNGVWEKRRTDRVKFCGAVAKEAKVHA
                     SKLIQNQQWRRAFRDTQDSQVRRNLETETLVDALETAANNLTTALAKFKCKSNNPPLV
                     VVFDEAGSLLKDPSNPSIVKPGLYHALNRVIGLLKRQHIWFFFLSTESHVRQLLPPDN
                     ENRTGSYVNDPSARLGYPPKLLSRFPPFLAFQLDIENENRMANGTMDEELKKSFSKFT
                     EMEHMAMFGRPLWHGYKLSDVHDLAQTKLTGGQTCYSSKNAYHVFSVLSVRVSLDVCL
                     QNPRGIELARVAVDSYMRVAINMNTESGIMYTDTPSEPVLANAAMSHLCQSSSSWSNS
                     IDTLTSELLNEGLIEKGLKGELYARLMLILARDSIWVQVRSKVRLETIPQSFTVRQFL
                     IALYAKEHHQMIKKWIPDALLTAKMNFNHFTVARGMIEREHDLPKIWHELLRRNAGMQ
                     FAYNQPTYDIMIPVYFGIETDDFKDSDCGAILIQVKNKNTATTPKKVFGESFQESTDT
                     AHKAKPNDKGGDKSQRGPYFIFNETKHPILALIFDLGVEKAPWNRLVRLHRSEINHPP
                     VWVIHSFGHSEQVFGCLKNMNCDDIATHGFFDALSPSKNDHDKLCERNILFSEAKLTD
                     TFLNKEKSEEENVEDGDTEMGDA"
     gene            <219417..>220334
                     /locus_tag="TRUGW13939_10415"
                     /db_xref="GeneID:55997895"
     mRNA            join(<219417..219721,219792..220233,220293..>220334)
                     /locus_tag="TRUGW13939_10415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493527.1"
                     /db_xref="GeneID:55997895"
     CDS             join(219417..219721,219792..220233,220293..220334)
                     /locus_tag="TRUGW13939_10415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349420.1"
                     /db_xref="GeneID:55997895"
                     /translation="MQFEKSTLEKYPSLGKLLDVPPENVVESHDGREITLLRYIYNHP
                     NLDSELRGSPKAILAAMDEFAAKEDFLISIGPDKAATMVGLIQKHRPKVLVELGAYVG
                     YSAILFGSAIRDINTEDAEERSIRVYSIELDPLIASIAMNFVSLAGLSDIVEVVVGPS
                     DHTLRRLHSQKRLVSGGIDMLFVDHVEDLYKRDVELCENLGLLDKEGCLVVADNVVRP
                     GAPMYREYVRSNSRFGHSWGVSGLIIPGDIEDELEISQVGHLDK"
     gene            complement(<221269..>222002)
                     /locus_tag="TRUGW13939_10416"
                     /db_xref="GeneID:55997896"
     mRNA            complement(join(<221269..221673,221739..>222002))
                     /locus_tag="TRUGW13939_10416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493528.1"
                     /db_xref="GeneID:55997896"
     CDS             complement(join(221269..221673,221739..222002))
                     /locus_tag="TRUGW13939_10416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349421.1"
                     /db_xref="GeneID:55997896"
                     /translation="MAFLLAGLSLLATVQAANVKPVLVPNGCASLPNLQQTGPASGFA
                     GPWNIVVDQCVNTTAIDNACTIEGFGDMAVPITLDDQPDVKSGFVSIVSQKLGAKSYL
                     ICTSGIGFEAMVFYDNQNDYLPINITSNPASAQLKWGQAEDESEPVDAYYHYIDGKKQ
                     DGIFLGANNVTSWGIQLQENVPGTGGIPMWQLRLLGPGSEDQKTGKALKEGEYKTFIR
                     IDGS"
     gene            <223150..>224230
                     /locus_tag="TRUGW13939_10417"
                     /db_xref="GeneID:55997897"
     mRNA            join(<223150..223479,223556..223771,223820..>224230)
                     /locus_tag="TRUGW13939_10417"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493529.1"
                     /db_xref="GeneID:55997897"
     CDS             join(223150..223479,223556..223771,223820..224230)
                     /locus_tag="TRUGW13939_10417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349422.1"
                     /db_xref="GeneID:55997897"
                     /translation="MSLFNDLDDYKLHTEFCTNPNILLHRSYRADRARGRQRIAIQEE
                     WAPQKPPLGVGQFGVVRLEQRQKVYGDTSSEHQELAVKQLRKIDLDRMRVDFRKELQA
                     LTKFSRLKFAQSQAFVKFFGWFEDDDHVYLAMEYFRNGTLDHFIAKGLLEQDAQIIGQ
                     QLLEGLKIMHQEQFTHRDLKPQNIFVVQQSPYWWVKIGDLGISKRAAKDDTVLRTSTG
                     TPLYLAPEVFHYLPFQDEETDTYTNAVDIWSFACVLYEMLALQVPFTDWPRDLVAFCH
                     GAPFPDGPLMDRVSTIAIDFVKSVLVPTPEKRPTAQEAFGAE"
     gene            complement(<227592..>229886)
                     /locus_tag="TRUGW13939_10418"
                     /db_xref="GeneID:55997898"
     mRNA            complement(join(<227592..228542,228594..>229886))
                     /locus_tag="TRUGW13939_10418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493530.1"
                     /db_xref="GeneID:55997898"
     CDS             complement(join(227592..228542,228594..229886))
                     /locus_tag="TRUGW13939_10418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349423.1"
                     /db_xref="GeneID:55997898"
                     /translation="MFHTFSAVKADASLTGSASTRRKHGSVRACDECRRRKIRCDGQR
                     PCESCQWYQRIDLCRYQDPHVQDRQTASAYERIVHKLFPNRSASDFSALADRSPLELF
                     DLARQSLSGDNTITSRAISPPPDPQTPPRSVASGDLETLQMMPEQGSNDQRDINDNNQ
                     DMTTNFSDDVNALALSSKPPSSYLGASSIAAILKVITWLQPRLCKKIDCSELCDPMQY
                     SSPVREVLIKARNDHPGVLTEQTHYIQSDEKYLIDAFFLYFHPHIPIVDETMFHETFL
                     KRQRSDSRWISLLNIVLALGSIAVTPADNKAHYVYFLKSKSHLDLTALGSPHVETVQT
                     LGLMGGQYLHYISQPNLAYSLMGAALRMATSLGLHKEFANHDNKESNSDLHLNNIRRQ
                     VWWSLICLDTWGTETLGRPSLGRWSAGITAKLPHCSVGNDQFFAILTLIENVRYCRIT
                     TQIHEAMAIVPLLAYSEIKALDRKLVEWFENLPPLLKDFESCPEPLEMTRTVLRWRYT
                     VQRMHLYRPALLSYAMRRIPYAALRTEECSAIDTCMKLAIQGIRDMGASFSVGSSQIL
                     GWPGVWMIFQAVMVPLLTLCIDDQTNPYSTTESHSSIEIAIAALVRMQAWSPTGSRTL
                     NFVCSIYDGCIHNATGKNTPRAEIPAGTQGSSIPMQNSAEPSGFTPTQSTFDLSLMRF
                     PPNFVGIEDNFGDEAMWDFITWSDDRLAQSLMQLDAQMYSDQVTLDNGISPQDHGEGD
                     ATSGQFC"
     gene            complement(<230911..>233265)
                     /locus_tag="TRUGW13939_10419"
                     /db_xref="GeneID:55997899"
     mRNA            complement(join(<230911..231852,231906..232261,
                     232529..233125,233178..>233265))
                     /locus_tag="TRUGW13939_10419"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493531.1"
                     /db_xref="GeneID:55997899"
     CDS             complement(join(230911..231852,231906..232261,
                     232529..233125,233178..233265))
                     /locus_tag="TRUGW13939_10419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349424.1"
                     /db_xref="GeneID:55997899"
                     /translation="MEVTIVASATIYLAGDSTMAPGGGGTETQGWGEYLGQDVSLTVS
                     NQAIAGRSARSYTREGRFDGIAALVQEGDYVVIEFGHNDGGSLTPTDNGRTDCSGTGS
                     ETCETTYDGVEETVLTFPAYLENASASFIAKGANVIISSQTPNNPWETGTFEYSPSRF
                     VEYAQIAAEAAGVEYVDHGAYTANIFEQLGNATVNSYYPIDHTHTSPTGADVVEQAFL
                     KGIVCGGLSLNVGITINIISYKKMGLFSTASKTAVIGLVFAIALPPFFHQAKVIGVLR
                     TPSSTLIAPENFVVISDTTYCEDIHYYSQAHVLFAACEDNNSTRYEWFPPLAIFDHPE
                     AIGQGSIHVIDPKSMISRRLEFDYFHEPFVTHGIDVIADPSAEDAVFIFAVNHLPNPE
                     YRPGESAPKARSQIEIFHHHLGSQSVRHVRSVLHKLITTPNDIHAVSPTAFYITNDHF
                     YRQGILRDMEDAIPAAGWSDTTYVQLSTLDTNTSDEGVLASIAFTGLHNNNGLGHGPR
                     ISSTDEEFLITSACSGVFHRLAAPPGEQHKLNLIESIHMPSNLDNPSYLLDPYGTTEK
                     DISGYILPGLTKGLAFQRTHKEKSVVHPGAIWYIPKSSEGNWEIRLLFEDDGSKISAI
                     TSAVAVPIEPEGETRSAWLFVTGVMADNVIAVKVEL"
     gene            <236342..>239018
                     /locus_tag="TRUGW13939_10420"
                     /db_xref="GeneID:55997900"
     mRNA            join(<236342..236672,236746..>239018)
                     /locus_tag="TRUGW13939_10420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493532.1"
                     /db_xref="GeneID:55997900"
     CDS             join(236342..236672,236746..239018)
                     /locus_tag="TRUGW13939_10420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349425.1"
                     /db_xref="GeneID:55997900"
                     /translation="MQLLLTYIPLAIGQLAIASAAQSSSISSPVTATATQSVLSEATS
                     ALAAAKSNSPTSSNGITSVFQYLFGSIDTLGAVIAKATAQAEEQFLKLVDPELFYSYG
                     GSPPVYPTPDGAGLGEWESAYKQARAVVANMTTDEKAGILYGALDAKGCSGFTGSVSR
                     LGFPGICLNDAESGVRSGELVNGYPAQLHIGASWNRSLALERAQHVGREFKSKGINVL
                     LGPVIGPVGRVAKGGRNWEGFSNDPYLAGELTGPTVAGIQESVIACAKHIIAYEQETN
                     RMPFLAGFIGLFNQSVSSNLDDRTMHELYLWPWYDAVKAGVGSVMCSYNRINNSYACQ
                     NSKVLNGYLKTELGFQGFVVSDWYGQHTGTASANSGLDMAMPSSRYWGLFQLSTAVSN
                     GSVNATRLDDMATRILSSWYRFAQFDNPGMSNYASVDARDPASESILFQGAVEGHVLV
                     KNTNNALPLNKLKSLSVFGYDADGGMNTSASDSTLYGFGLANAPEYTNGKSFSGIDML
                     FYMGALVADGNYGPDVALNGTAKTGGGSGAITPANSTSPYDALLQQAAQDNTILYHDF
                     SSFNPQVNETDACLVFINALSSESWDRSTLADNYSDTLILNVASKCNNTIVVIHNAGI
                     RLVDRWIEHENVTAVIFAHLPGQESGNSLTEVLYGRQSPSGRLPYTVAKSEEDYGTLL
                     NPTLPNSDHFFYSQSNFTEGLNIDYKYFIQADVTPRFAFGYGLTYSNFTYSDLNVAKN
                     STADTSSLPPDALAPDRVSPEGGLASLYDVIVTVEATVTNTGGVAAAEVAQLYVGIPN
                     SGLPKALRGFDKQLIQPGESTTASFQLRRRDLSTWDTVQQQWVLTRGNYTVMVGKSVL
                     DIQLNGTLVLE"
     gene            complement(<240169..>241833)
                     /locus_tag="TRUGW13939_10421"
                     /db_xref="GeneID:55997901"
     mRNA            complement(join(<240169..240736,240805..241622,
                     241681..>241833))
                     /locus_tag="TRUGW13939_10421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493533.1"
                     /db_xref="GeneID:55997901"
     CDS             complement(join(240169..240736,240805..241622,
                     241681..241833))
                     /locus_tag="TRUGW13939_10421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349426.1"
                     /db_xref="GeneID:55997901"
                     /translation="MCERQEQEDPGVEASESHRLEQLGRERPKCFATWYSELGFCFSV
                     VMSQILSEYYISGFNVLLPTLIVDLQLPETSSIWPSTALSLAVTSTLLIFGRLADMFG
                     AYTLYVTGFAWLTVTSLVLGFSQSWLMLVIFRALQGLALGAYLPSGVMLLGSIYRPGP
                     RKNIVFSVYGACAALGFYAGIFFSGLCGQFLGWQWYFYIGAILSAITFISSLVSIPSD
                     YAKTRKLGRRMDWLGAIFLVPGLVLCSFAIAYSAQAPHQWKTPYIPVCLVLGIILLGV
                     AVYIEGWIADAPLLPSKLFAIKSMKPLLLSLIFLYGCLGVFLLYAALYMENIMGANPL
                     QVVAWTTPMAAGGIIISVVGGLVLHKISGTLLMVMSCLGFMISGLLFAVIPIGGNYWA
                     FVFPAMIGATIGIDISFNVTNIFITTNISTKEQGAAGALINSTLHLGITIMLGFADII
                     QTNTLHNGLSSSYKAVFWFQLGLSGFALVIMVLFVKIDRAKSDLTLDERVAQRALEDS
                     SHNL"
     gene            <242615..>244358
                     /locus_tag="TRUGW13939_10422"
                     /db_xref="GeneID:55997902"
     mRNA            join(<242615..243026,243096..243576,243641..>244358)
                     /locus_tag="TRUGW13939_10422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493534.1"
                     /db_xref="GeneID:55997902"
     CDS             join(242615..243026,243096..243576,243641..244358)
                     /locus_tag="TRUGW13939_10422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349427.1"
                     /db_xref="GeneID:55997902"
                     /translation="MNDPCYTCRRRRIHCDQSGTPCAKCEKSGFECFQQRPLRWVKGV
                     TLRSKFHDSVLRPSAQSKHMPAKLLAEAGDVQVATEELASINQYVPGLHQESSTTDVR
                     TVDDTANSLVIASPRSLSDQAITHLDKTSRYYLDYYNDRICKLFIVQDSDSNPMRNLI
                     PLALQDSVLMNAVLTLAARHHANTGYSFHQQDTSIILPVPVNANRDALSYKYKAIQGL
                     TSSVEHATSIKHDTTLASIFLLIFLDLLESGSDRWNVHLEGAKSLITCNKSLFELPSS
                     VAYGPGQTVQEIRDFISSQIYLIGILGGTFVRPKLLTQFSGLQQPELQPKDVVERSFL
                     GCPVYLLDAIQNLSTQRDAIADSKNINDCDVRRQIQNITGVVESIESFDCYEWATALP
                     RRQVPSQQEITNLCSLASSYKLGALIYGRRVLDARTGKESSQTELVCELIMAIGSLQN
                     DDTLFKCILWPIFVAGLECQWKTQRQFLAQCLERFWRLTLCFNVINGAEILNTYWQEK
                     DQQSQSSTPSSSQWIFNMGRLGQDWLLI"
     gene            complement(<244469..>246345)
                     /locus_tag="TRUGW13939_10423"
                     /db_xref="GeneID:55997903"
     mRNA            complement(join(<244469..246206,246266..>246345))
                     /locus_tag="TRUGW13939_10423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493535.1"
                     /db_xref="GeneID:55997903"
     CDS             complement(join(244469..246206,246266..246345))
                     /locus_tag="TRUGW13939_10423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349428.1"
                     /db_xref="GeneID:55997903"
                     /translation="MPRSQKNPTGSSGRSGPKVKSGCRTCKIRKVKCDEGKPSCYRCS
                     SSSRVCDGYGVWGGDGHLPSRNATQTGVKLAISRNKTRPRNEKYANSKFGQSESQFCD
                     FPLGCTGADMKMDNASLSTTGQWEIGPVPMSLVEFPAAAHERGVFFWFQQYTVNKIPG
                     LFSFKFWSSLLPRACYSEPAILHAVLALTSAHKYEQLETTSSLSTDEKFTLEAYGKAI
                     HCLRTDFGLKSNTSLKVILIACIVFVCLEIVQQHHATAITHLANGLRLIEQLERSLAA
                     EAQPLFDHHEPEGLIFQMFLRLKLQVNMLGYCYDFSSYINNSLSAYRIPGRFLSMLEA
                     RKYMDILISRAFELEYLFQKACFRERAERGLKDNQISLRSDLDLWLQAFISSFLQDKA
                     ASNNWNKVAYNILRMYHDMAYVMAETCLSAHQEMLFDYQVERFLSILTYAINTITISA
                     GLQEPILPEATAKMQKSIVDIGWIPVLYYTATRCRVARIRLHAIRILELTSHREGMWD
                     ARVAAQVAQEVMRIEEAQDPYQSCLGDTFTLEMIPKRKELKTPTLGASQRVSNIQVIP
                     PDEPWGMIGFMCRKKHNNSNWEVIWKENDPISGMWLDVV"
     gene            <246721..>247788
                     /locus_tag="TRUGW13939_10424"
                     /db_xref="GeneID:55997904"
     mRNA            <246721..>247788
                     /locus_tag="TRUGW13939_10424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493536.1"
                     /db_xref="GeneID:55997904"
     CDS             246721..247788
                     /locus_tag="TRUGW13939_10424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349429.1"
                     /db_xref="GeneID:55997904"
                     /translation="MAPTTRTDFGQSTDASDVAAAFPASVKGRTFLITGVNKLGVGYA
                     TAVALATQSPRRLILAGRSHDKLQECADALGNTYLAVDFRPLVLDLGSQKSVRAAAAE
                     LLSWEDTPAIDVVINNAGVMNIPNRTLSEDGIELHLATNHIGHFLFTNLIMSKIIASA
                     ANSSPGAARVINVSSMATVASPLRASDLNWEKPTLELPEGEKPNLDLMKAAAVVVDET
                     MSYIPMGAYGQSKTANILYSVALNERLHRKYGVTSIALHPGEIKTELHRTTDQEWLKK
                     TEEWREKMNVSWKTLEQGASTALVAALDPELGKVNGDGQGQFLSDCQPSEIAPPYALE
                     KGKADELWAISEDLVKDSFSW"
     gene            complement(<248631..>250921)
                     /locus_tag="TRUGW13939_10425"
                     /db_xref="GeneID:55997905"
     mRNA            complement(join(<248631..248854,248945..249544,
                     249606..249819,249875..>250921))
                     /locus_tag="TRUGW13939_10425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493537.1"
                     /db_xref="GeneID:55997905"
     CDS             complement(join(248631..248854,248945..249544,
                     249606..249819,249875..250921))
                     /locus_tag="TRUGW13939_10425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349430.1"
                     /db_xref="GeneID:55997905"
                     /translation="MGAFHLASALAIAALPALSSAGTVSLPSYPLAVKSPYLSTWLPG
                     NQTTDVASGQPEFWAGQAVSWPILARVAGTTYTLFGAPQGVSGATAATTIGVSFTSTH
                     TLFTLTAGAANITLDFFSPVYPGPEHYAKQSLPYSYLTVAASVDDATDIQILSGIDYT
                     WTAQGGAAQLNYTTTDTAGFFWFYNPDQDYFTEDSDMATYGSVVYGTTSGDDVTYSCN
                     SADTIYNTFRTTGALADIGDCKGNQFAALTKDLGTVTQGNVTFAVGFQRDLAINYVGN
                     AQTGYHRSNADWNLIPGAIEAFLADYENALIASGPFDHAIRSRSENVSSDWGSQYADI
                     IEASVRQTFASFEITVPLDDPTASPQMFLKEISSDGNIQTVDVMYQTWPVFVSLNPEY
                     LKLYLEPVLAYSATGDWPHPWVIHDLGTHYPNATGHADGIAEQMPLFECSSLLILLQA
                     YQKYTNDTSFAAKYTSLLVGWADYLNENSLYPASQLISVDAIPAQANQTGLAIQSAIG
                     LQAASIILGNSTYSDTAKSIATTLYEDALGLDGDTLEESTHFTYYYGAADTWNVLFPS
                     YSDVLLELETFNSSAWSLQSEWYSQQIQTGGLPFAGPANYSAYGTDINWGLSDWNLLV
                     AATSSADVQTVIINTTHTFLTNGLNTIPFGTKYYVEGDEVGVWIGNKARPTVGTNFAL
                     LALDQGYWGSSY"
     gene            <256635..>257435
                     /locus_tag="TRUGW13939_10426"
                     /db_xref="GeneID:55997906"
     mRNA            <256635..>257435
                     /locus_tag="TRUGW13939_10426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493538.1"
                     /db_xref="GeneID:55997906"
     CDS             256635..257435
                     /locus_tag="TRUGW13939_10426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349431.1"
                     /db_xref="GeneID:55997906"
                     /translation="MKFSASASALLLSGLAVAAPLTEKRMEAKARRATSGRHSNFPYA
                     VGTNEKLVLTNTTKEEYSSNWAGAVLIGTGYTSVTAEFVVPTPSAPSGGSSSTQYCAS
                     AWVGLDGDTCGTAILQTGIDFCVQSGETSFDAWYEWYPDYAYDFSGITISVGDTIKTT
                     VTASSKSAGVATVENVSTGKTVSHSFSGESNKLCEYNAEWIVEDFESGSSMVPFADFG
                     TVEFTGAEATHSGSTVGTSGATIMDIEQSNTVLTSSSASGNTVTVKYT"
     gene            complement(<259337..>262354)
                     /locus_tag="TRUGW13939_10427"
                     /db_xref="GeneID:55997907"
     mRNA            complement(join(<259337..259483,259554..259647,
                     260081..261694,261750..262189,262259..>262354))
                     /locus_tag="TRUGW13939_10427"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493539.1"
                     /db_xref="GeneID:55997907"
     CDS             complement(join(259337..259483,259554..259647,
                     260081..261694,261750..262189,262259..262354))
                     /locus_tag="TRUGW13939_10427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349432.1"
                     /db_xref="GeneID:55997907"
                     /translation="MASERNNALVGFVNAFQKYVWIDPTVVIRPEATNIKNQKAVTGL
                     IDSHGFDWRVWLVASSGFFTDSYNLFAVNVILPSLGYVYWPDNNDNVQELRINALTLS
                     GSVVGMILFGILADTYGRRKLYGIELIIVIFGTLGTVQASSGSQDSMSVAGWLMFWRF
                     FMGIGIGAEYPLSAVITAEFAPKHARARMMAAVFLMQALGQLAAALVGLVVLLSLGSK
                     NNLENLSASDHTAQSVRCVDSIWRIVIGTGAVPALIAIIFRVTIPESPRYTLDVDRDG
                     QRALEDTKDYYGAGHADGYGAYISAVELRDYPGHSNGSHQQYGITAGLDIDGDFDERQ
                     PPSPRRQEDTGRRGFHEAEQAEEEEEEEDSDSEQEDDVEDEDEDSQSIEYRPTLFSST
                     DLYDYFKTQENWHFLAGTTTCWFFLDVAFYGLGISNPRRIAQIWLSKAPEYDFSNSTL
                     VDWQTTDPTKSIYDVLKSDGIQYIITVSIGSVVGSFVLIKLIDYVQRKALLMWSFIIL
                     AVLFAVIGGSLFAVEYTDMHAVTITLYVLSQLVFNIGPNALTFIVSVFYFFMIPQRLT
                     KNKVSAEIFQTRYRATCHGISSAGGKLGSIVVQVLMSSFMTSPESKYMSSALFAFCGC
                     MFLGAFCCWIWLPDTQEPRNSSKTALSIRENGNQDAVLGENESQAAVNEGNDGFGNRP
                     FLSSYRIPNKSLEEASEGWLETIAHGQQLGFRIKINRLIAGSVPRETASKHTPYVQPV
                     QPVQQQNHSERHDFQRHAESKNNNHAVSSRPAPELELYHKQLANYYLKIISNTASI"
     gene            <262962..>266118
                     /locus_tag="TRUGW13939_10428"
                     /db_xref="GeneID:55997908"
     mRNA            join(<262962..262986,263042..263957,264015..264139,
                     264204..264674,264733..264879,264938..>266118)
                     /locus_tag="TRUGW13939_10428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493540.1"
                     /db_xref="GeneID:55997908"
     CDS             join(262962..262986,263042..263957,264015..264139,
                     264204..264674,264733..264879,264938..266118)
                     /locus_tag="TRUGW13939_10428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349433.1"
                     /db_xref="GeneID:55997908"
                     /translation="MHEAKSNPTLAVVNLNHASQKLAELRAAFSSASGQLDDLASSMK
                     TLCKTFDGLRLSLQQTNKPFEGYDGFEKTLRNCEMFVQSFQPAKAGKPWTCSADSANK
                     LERQIMMQIALLSTTNIVLLAYVFVLVELCAFVELTKMLKQLHLYIWVYRETFFIGDS
                     DTIDEITQPAFVEVDHSTDKHDLELWEKIQRLIYRRKRRPALESKHTVSSAMDFQGLE
                     NEVQSQVRRLMLNHQPSLPGRAASRTSHHPLDLNTLSDEALLERAQQQRRFLLSASRQ
                     SIFRQPSTVRSRSNTLQDDPDGLAKQQNRNQVLGDGILSFSLASRHFRYSLAKIEAKL
                     VDRKRIIHCTSVDGDIFIVHDLPSKLKRHPTTDHPQIGSTSEVYFSEMLHVEVKTRFE
                     KMASGDAYIYYKFNEPDTICQFQEIVRDKDLLHTFCVSHINSANGKQVSYQHLKMWRD
                     RHTQACSLSFLRNAAAVDQTYVEFPLSMLIVNLAKRQKDSRTVQVDFVQESASTPWRF
                     SMDHSNSTRRLSGASSVASVRTDMTNATVKQTEKTQSLAATMAFLLIKFTNPKDIETF
                     CSTLGQLQSDPPSPFPKPTNTPPLCQKSFTPILNEDDYPRRPDFSSSPGSISGITSIP
                     RRTTYQDYTVGWIAALPIEMKAAILMLDELHDRLSQQHPQDNNAYVLGRMANHNIVLA
                     CLPAGYIGNNSAAVVATQMAFTFPNINIRLMVGIGGGVPGDNHDIRLGDVVVSKPGPH
                     DGGVVQYDFGKTTVGGFERTGSLPPPPARLLTATSLLEALHSNESDPITNRLEVFQQR
                     PEFRYPGANNDQLFLSDYDHVADQPTCASCDPGNVVQRPPRQGRTRIHYGTIASGNQV
                     MKDARTRDALRQKYGALCFEMEAAGLMHLNTFPCVVIRGICDYSDTHKNKQWQGYAAA
                     VAVAYAKELLDHVSHVHVYDNDSRFFHGDRNFYGRVDSIG"
     gene            <266917..>269209
                     /locus_tag="TRUGW13939_10429"
                     /db_xref="GeneID:55997909"
     mRNA            join(<266917..267282,267352..267725,267800..268466,
                     268535..>269209)
                     /locus_tag="TRUGW13939_10429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493541.1"
                     /db_xref="GeneID:55997909"
     CDS             join(266917..267282,267352..267725,267800..268466,
                     268535..269209)
                     /locus_tag="TRUGW13939_10429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349434.1"
                     /db_xref="GeneID:55997909"
                     /translation="MPSPPPAWVQALKPSGPQGSELLAKEREQSNVAVDALAELLHTK
                     QTLERQEELVSVLQSEKVFDKSQGQSLGRVDRLQSALRKGKRLHQLSVERKWTLEEYH
                     AAAGLLGEPTPYALHASMFLVTLREQSNPEQRKLFLERAEKYEIIGCYAQTELGHGSN
                     VRGLETTATWNPEDKTFTLHSPTLTASKWWIGSLGRTANHAVVMAQLFIGNKNLGPHP
                     FVVQIRDLDTHQPLENVYVGDIGPKFGYNTMDNGFLLFNNFKIPHISMLSRFSRIDPE
                     TNKYVRPAIPTLVYGTMVWVRANIVLDAGSVLARGVTIATRYCAVRRQFQDRDAPSNA
                     GETQVLNYKMVQVRLLPLLASMYGLHFTGRGMMKLYQENQSRMNGATQPGQDTRSPGP
                     EALRAGADLLADLHATSCGLKALASTTAGEGLEVCRRACGGHGYSSYSGIGPWYSDYL
                     PTLTWEGDNYMLTQQVARYLLKAARAVLSGKGTSNDTSQILQSYLARRDKGASFDILE
                     VDSELVAAFAWRTAHLTFEALKHRDVEKRSWNSLLVDFWRLSTAHSQYLVVKNFYEAV
                     SSPELASSVDGVTAGVLRKLFRLYALYTLEREAADFYASGAVTVRQITLTRTKAVLAL
                     LDDIRPHAVSLVDAWKIPDWVLDSSLGRSDGKVYEDLFHRASQQNPVNDLVFDPYPWN
                     EGALKKPASKL"
     gene            <269899..>270720
                     /locus_tag="TRUGW13939_10430"
                     /db_xref="GeneID:55997910"
     mRNA            <269899..>270720
                     /locus_tag="TRUGW13939_10430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493542.1"
                     /db_xref="GeneID:55997910"
     CDS             269899..270720
                     /locus_tag="TRUGW13939_10430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349435.1"
                     /db_xref="GeneID:55997910"
                     /translation="MDGPNDVPAGLIRGVQDSSLSVKVAIGVFLSIALYNATELMFLI
                     LLRFRRYHGLYFWSITISTFVGVIPFAIGSLLHFFAAGPLVLSLVLTVIGFYAMVPVQ
                     SLVLYSRLHLVFYHERILRAILYGIVTTAILFLIPTTVTMFGSAFVRSHSWNKSYQIA
                     EKLQLTGFSVQELLISSLYIFQTIKLLRINPMQGRRRKNIMYELLALNLVVMLMDVSL
                     LVMEYLNIYYMQVSFKALVYSVKLKMEFAVLGKLVSLADPSQHQDLDSGFSDYTT"
     gene            complement(<270895..>271713)
                     /locus_tag="TRUGW13939_10431"
                     /db_xref="GeneID:55997911"
     mRNA            complement(<270895..>271713)
                     /locus_tag="TRUGW13939_10431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493543.1"
                     /db_xref="GeneID:55997911"
     CDS             complement(270895..271713)
                     /locus_tag="TRUGW13939_10431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349436.1"
                     /db_xref="GeneID:55997911"
                     /translation="MSTRNILTKETRSVSFKDIKILYDSYGTGDHALVFIHGWTCNRA
                     LWATQEPLYTKYRSILIDLPGHGESEAPWGVDYNHEFFARAANVVLQQEKIEHSVLIG
                     HSLGGPLATMMLRLFPEKVSGIFYIDSFWDIPQTYLTIEERRKLGENLHDDAFFLKTI
                     DPLFVDKNDPDGSIRKAVTDVMAGTSTHVRVSAVATDSVPHQWRYDNVTTIPAFHVVT
                     PNFSNIDKNWVHHIPQLRVEVWEGHGHFMHMEAPERFNNTVDRFLVDNSLLQVA"
     gene            complement(<272668..>275055)
                     /locus_tag="TRUGW13939_10432"
                     /db_xref="GeneID:55997912"
     mRNA            complement(<272668..>275055)
                     /locus_tag="TRUGW13939_10432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493544.1"
                     /db_xref="GeneID:55997912"
     CDS             complement(272668..275055)
                     /locus_tag="TRUGW13939_10432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349437.1"
                     /db_xref="GeneID:55997912"
                     /translation="MALKSRDRFASGSSIVLIGPHGAGKSSLATIASSSLGLKPVDIE
                     EIFRRRYGVSLAVYVRQNENSECTSTDLAIIRRVFEQNAENAVIVWPSGCVGKLAYAV
                     LEEYAQKHSIVFVARSARGIQQYLKVPDLARIRQVVELENRIYRASSHYEFFNLDEND
                     LSSSSAINYDSSMARSPRPLRLKRMEESFVRFLKNILQPSPQLARKTDGLAILSSRSP
                     RTYLLNLPLSQISSPDFDIRSLDCGADACQLEVDLAEVHGLPILDITNRIGVAYAILT
                     RFFDGPVIYHLHSPSSFSQYEHLYVDLLRHGPRIGVDYMTLDLKLGPNKISSLLPCRH
                     SPRIIGTYHDYEPGSDGWSAKNRWEILEQATTIPGLDGIRLTQVANSIEDNSAVIAFK
                     VVAGRSGPHQPLIAYNTGPLGRWSRCENEILTPVATPDSKYSDSELSIQSIQNALYSS
                     FIYERRNFYLLGRDMSTCRVPHLHRAAYRFFGLPHNAHSQSIDSLRDLPNDELLGGAS
                     ILNPGYKMCTLPFISSFSEHAKNIGAVNTIIPIRGQSFKGVTTPPPDFWRQRNTPNKV
                     VGLYGENTDWLSISECIRRNLSPANAITRNTAALVIGAGGMAHAALYALLQMGIRNVV
                     IYNRTLSNAHTLANRFHKLEMSQDTSGDNLQLNIRILDSLQTDWDNDLAQPTVVVSCV
                     PATGLGCTNTSFILPLQWMKSSTGGVVLELSYRPVVTPLLNQIREHAMRGWVAVDGLE
                     NIAARTAIDFELFTGRRAPRNLARAEALRAYPDHNIQLPDVTRDAVMDEAVTPGK"
     gene            <275313..>277277
                     /locus_tag="TRUGW13939_10433"
                     /db_xref="GeneID:55997913"
     mRNA            <275313..>277277
                     /locus_tag="TRUGW13939_10433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493545.1"
                     /db_xref="GeneID:55997913"
     CDS             275313..277277
                     /locus_tag="TRUGW13939_10433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349438.1"
                     /db_xref="GeneID:55997913"
                     /translation="MASLQPPRAARRGREKNTRLLREVTKRQRASTSDATNTIPVNAK
                     LPTRRISRACDLCRLKKLRCDGIRPTCRACSLGGHDCTYGTGTKKRGLPTGYVRILEA
                     LWGLVFEVIPGSMQTALKLLQDAHVVWDEDEKVTLSSRHVSSADGLRHSWARSSVRQE
                     IDEIVMGIERGEKPSPHGGIEDNDPEPPNFGSWTGNDLLGADLVQPPQPGELVTEHPD
                     IHGHALRGAENVTDEPSMHLMVHPHGTFQPRPSIPIEAWSLLDTHSRYTNSWLPIVPK
                     TEVVRIISLYQDDSACTLPEMALMWAVLALSSSAHYNATSPGELHVSRSYYNHALSLV
                     SFDTATEYANFVPALVLLAMLDMSENKWETASMLAGNAVRAGLMTRQEDTPRRPARHC
                     LFILSAFVMDTLAAARMNFVPHLRSKDVRPLLEFNTQGPEEWEQCPGEQRPLRSLTIF
                     KEYVKLLMILNDCIYESQLSSSGFTPVSSDLETWLFGLPKHCNFNSTTGSLSTEQQIS
                     ILSPPVANLGIMFDVVLSFLQASARFNFDSSNARTNLQDNPSRLKQAYLRSFEPCPWI
                     GILDLHSHASSIRPTIGSTYSSGDQRIGATRNSTIIPTSTVGSQPIFGELDNPKTIED
                     LIDELSTTQGMAEFNSGSNQFMYDLGFYDT"
     gene            complement(<277442..>280324)
                     /locus_tag="TRUGW13939_10434"
                     /db_xref="GeneID:55997914"
     mRNA            complement(join(<277442..277608,277675..277695,
                     278114..278377,278440..278832,278889..279047,
                     279108..279645,279704..280009,280061..>280324))
                     /locus_tag="TRUGW13939_10434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493546.1"
                     /db_xref="GeneID:55997914"
     CDS             complement(join(277442..277608,277675..277695,
                     278114..278377,278440..278832,278889..279047,
                     279108..279645,279704..280009,280061..280324))
                     /locus_tag="TRUGW13939_10434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349439.1"
                     /db_xref="GeneID:55997914"
                     /translation="MTFDQLYELAQSNKSVTSELAKNPKESPGEIAHTLYSHLRHEGV
                     GDKPQLPSEQSGPIADLQRVLECGKWGDQHPSDLFLKVGNTYICCYRDALISLEHSPL
                     AGLASPSLMGSHGVVPLTIISTLQDINRHTANCIVRAQKEVFLATNFWIYSDASLIIT
                     NALHELSKRAGERGDKVVVKIIYDRGSMKQLCENHQHVPPSEWTGPKVKLPAPEEIPN
                     LDMEVMNYHRPVLGTFHAKVCVIDRKIGLLQSNNVQDNDNLEMMSHLEGPIVDALYDM
                     LLISWHKHLTPPFPCIQNPITKISSTLEKATSSSRNMESGHFSTLRPEQDILPECTSK
                     DPHYDPNIYAETRRVNSQLNARAGETRLEATARHLDKRTLSDDVIDREKFPTSDGPDI
                     TEEGDLMVPYILPPQHDPVPMALVCREPNGMPRNSDYPVPQNAAWLAAINNAESSIFI
                     QTPNMNAGPILDALLVAVRRGIVVTANLTLGYNDGGELLPGQNGTNEMVAHRLYSALE
                     TDEQKSKLKIYNYVAKDQKIPIHNKWKHRSSHVKLMIVDEAIAIHGNGNLDTQSYYHS
                     TEVNVLIDSPIICKAWRAAIEQNQNTSKYGLVSTTDGCWHHPETNSMPEGSIGPDPGH
                     FSWVKGFIGAVQRVRGVEALIESKGFTEDDVKTALEGSGYENEDLNNVLLHCMNPGQV
                     GHAKLCSSGCHEPATEGSHGC"
     gene            <281201..>282889
                     /locus_tag="TRUGW13939_10435"
                     /db_xref="GeneID:55997915"
     mRNA            join(<281201..281240,281296..281846,281900..>282889)
                     /locus_tag="TRUGW13939_10435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493547.1"
                     /db_xref="GeneID:55997915"
     CDS             join(281201..281240,281296..281846,281900..282889)
                     /locus_tag="TRUGW13939_10435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349440.1"
                     /db_xref="GeneID:55997915"
                     /translation="MVAKLRTLSGCLPCRRRRKKCGEEKPLCAACRRNGITCQWPTVE
                     RVDGRRRRHCKTITSKRPVTAESEEPSGQHCASPLLTSSVKQFHAVFEGRGSLLVDYC
                     LIHFLPSQYHQAADGKSIVDLSYLCYMCLDSPALLNAVAACATIDLSRDANGQEESAR
                     RLYMMAMSEISTGIARKSLTGTEDHLLAAVIWLCVFEKSCARGREHSAIHAAALRRIL
                     LLREPMNPEHVSTAELIWERMCVESYIYHSAVTTLFDCQPDLVNDTFAVLEKFQGGMS
                     PWPSTGNDRQESMSTVSSIQSPVLGAPYHMFLALMEGIRLVRTGSPSSQDNLMFAWSY
                     YHNVSHMQSALDTVYTYYEDPRRWIGRLYATAIRLLFLYFISCGQNNCQEKSRLLLCY
                     AEMQCTFDEARKLLIATEGEIDRTWGKFFLWPLAVIGAMVCNESDIALVRNWLDRVLK
                     RGNSSGVIIIKEVLEQRVWQHSKNEWLENASSFYAPGLSIMLDTNIMNATAANLVRNV
                     SDQPFASTYKTWPGDDVK"
     gene            complement(<283618..>285172)
                     /locus_tag="TRUGW13939_10436"
                     /db_xref="GeneID:55997916"
     mRNA            complement(join(<283618..284256,284320..284454,
                     284514..285059,285116..>285172))
                     /locus_tag="TRUGW13939_10436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493548.1"
                     /db_xref="GeneID:55997916"
     CDS             complement(join(283618..284256,284320..284454,
                     284514..285059,285116..285172))
                     /locus_tag="TRUGW13939_10436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349441.1"
                     /db_xref="GeneID:55997916"
                     /translation="MPGVPTGRACEGCRKQKKKCDEKKPACSRCLRLDILCVGSGERR
                     FKFKEERRFTKSPETDDERSIIPKQESPDYAAASAISAAGRAARTIFLPPSNELTFLT
                     SVFVQTLKPSTDLRYNLVWNYGGFLAEVPQRLGTNEALDASVYAVCAAHSSFCVYKDI
                     SVEALTKYSHALRMLRVCLDDPVKASSPETLCAVMMLLICQAFIGTGGSSFTGHCEGA
                     AKILKARQYTTPQNDFEAKLILSLRGPVLFEGLWNDRIDLTPYEWESIVGSHYDSHVP
                     EGRLMFMFSRVPCFMQRARSAIDQHEISALFEEMKPIYEASWEIVNKMQSNYDEVNAI
                     PAHNRSRFLHANHQRIYSLGLVIVTVFNCMLKALDPGNLRYKSESMDLVNKILVLCDE
                     SHDYRPLGASCNILALMVAWVANTDPITKCIIEAAIADYQSDYPVRTLEGMSESLRII
                     DRHLRLFL"
     gene            complement(<285607..>286350)
                     /locus_tag="TRUGW13939_10437"
                     /db_xref="GeneID:55997917"
     mRNA            complement(join(<285607..286248,286312..>286350))
                     /locus_tag="TRUGW13939_10437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493549.1"
                     /db_xref="GeneID:55997917"
     CDS             complement(join(285607..286248,286312..286350))
                     /locus_tag="TRUGW13939_10437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349442.1"
                     /db_xref="GeneID:55997917"
                     /translation="MSTILGKKSEKDLHRASHEENEQPPPPYSNHGDQDQEASKFPPQ
                     PYHGQAPCHTFQLQATNWLCNNFHISDINNQDTPLYTVKTKLRKPHMILRATSSPDTE
                     LATVEFHTLRPKVDVFIHGEKLTISMKKFSYTATYESAALQQTLTWKSNSHWKTFDLD
                     CVDENTMPLVKISSAYYSCKRGSQIQFFGHAVENNSAVRNELIATGLAMAQYINLMAS
                     TTVAATST"
     gene            <286986..>288110
                     /locus_tag="TRUGW13939_10438"
                     /db_xref="GeneID:55997918"
     mRNA            join(<286986..287095,287150..>288110)
                     /locus_tag="TRUGW13939_10438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493550.1"
                     /db_xref="GeneID:55997918"
     CDS             join(286986..287095,287150..288110)
                     /locus_tag="TRUGW13939_10438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349443.1"
                     /db_xref="GeneID:55997918"
                     /translation="MATDISNYYMYQPQHVVPAVFAALIGISLLLHVYQNFRYNFWRV
                     TFFMAWGGLVFLIGWIARVVSSYHTDNLNLYIVQTIFIYAGPPIYSAAAYNIVGRLMN
                     YLPMYAPLNPNRVLITFVYLGALVEALTAAGAAKMSAAGDDLSRIKSGGTLMAVALVL
                     QAVVELALVSLVGLIHFRFSRSGSEIPPNVKKLFITLYGTSTLVIVRCICRAIESFTL
                     FGEIEKGAKHYGYILAHEWYIFAFEAVPMVLFTFWLNVFHTAHFLPRQKTRYLDLDGK
                     TERLGPGWIDRRSTWETFADPFDLGGIFAGKPNHESFWLSPEKWPVAQDGSFAMGTTS
                     NVAGGQINKSPEEGQILSMTHA"
     gene            <288769..>289998
                     /locus_tag="TRUGW13939_10439"
                     /db_xref="GeneID:55997919"
     mRNA            <288769..>289998
                     /locus_tag="TRUGW13939_10439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493551.1"
                     /db_xref="GeneID:55997919"
     CDS             288769..289998
                     /locus_tag="TRUGW13939_10439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349444.1"
                     /db_xref="GeneID:55997919"
                     /translation="MQTVQNSAYEGSVFYLTYCIARILNKVYGAKCDETRPVCLNCST
                     TDRDCLYPDRFIRFGDARSGRADSDAVERSTSRSSPERNEISFPPLSPNQIGEDTINM
                     AHLELFNHLVNGDWEGFGISRATFVPIAIRNADTAPYLMYEMLALSAQHLSLVSPARE
                     EYYKNQAMRLQNRSITLFNATIAREKVTPDNCIHFFLFSSALGTHHFCNVVRNSEGDF
                     GTFITSLVDSLNLYQGLRAVVGSEWHIVSDSELKPVLQAGKEALMSFLEDGNYQPKEI
                     ESKRLMQLLEDPLDQLDSTAVEANQHAINVFDCLLHYHRRNQRNENSLRGLFGWPALV
                     KKEFKDQLIRLSPKTLIILAHYAVLLYYQRQLWLLSDGGGLLIRSIYQNIDSYWLGWL
                     QWPNREISSDIEMTNDK"
     gene            <292585..>294008
                     /locus_tag="TRUGW13939_10440"
                     /db_xref="GeneID:55997920"
     mRNA            join(<292585..292833,292973..293608,293670..>294008)
                     /locus_tag="TRUGW13939_10440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493552.1"
                     /db_xref="GeneID:55997920"
     CDS             join(292585..292833,292973..293608,293670..294008)
                     /locus_tag="TRUGW13939_10440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349445.1"
                     /db_xref="GeneID:55997920"
                     /translation="MHSKGPHSGLFQPLVIGCGKITLEHRVIHAALTRNRGVPLNAVN
                     TPDKPNRIWYPGNLMVEYYDQRTTKGGLLISEGVPPSLESNGMPGVPGLFTREQEDGW
                     RKVVDAVHRKGGYIYCQLWHAGRATVPQMTGSQPVSASATTWDSPEEHYSHIPFGEEK
                     PVRYADHPPVELSVAHIKKTISDYCEAAKSAMRIGFDGVELHAGNGYLPEQFLSSNIN
                     RRTDQYGGSPEKRCLFVLELMEDLLNAVGDENLAIRLSPFGLFNQARGEQRMETWLHL
                     CKTLKEKHPYLSYVSFIEPRYEQIFSYEEKDKFLLSWGLPDVNLDEFRRVFGNTPFFS
                     AGGWNDKNSWGVIESGKYDALVYGRYYISNPDLVDRLKKGLPLTQYDRSRFYGPFEDN
                     AIGYTDYLKTQSGLV"
     gene            complement(<294602..>295427)
                     /locus_tag="TRUGW13939_10441"
                     /db_xref="GeneID:55997921"
     mRNA            complement(join(<294602..294933,295232..>295427))
                     /locus_tag="TRUGW13939_10441"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493553.1"
                     /db_xref="GeneID:55997921"
     CDS             complement(join(294602..294933,295232..295427))
                     /locus_tag="TRUGW13939_10441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349446.1"
                     /db_xref="GeneID:55997921"
                     /translation="MAPTLQHLFHSRDFQPSEPSDSFRAEWSNPSKYAFTVLLLVGGD
                     LINRALAQMAGGWITPVAFSFEAERSPSANHQIARPSQAGLVVSVWKPSKIRKHGEPG
                     HDFLHWSGLVVTVIQMGVAAIPLGHDGDWGVLMLTAVASGLCYTTGTRGNGAQHSIAI
                     VSEGHGLDLEYHLIL"
     gene            complement(<296189..>296830)
                     /locus_tag="TRUGW13939_10442"
                     /db_xref="GeneID:55997922"
     mRNA            complement(<296189..>296830)
                     /locus_tag="TRUGW13939_10442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493554.1"
                     /db_xref="GeneID:55997922"
     CDS             complement(296189..296830)
                     /locus_tag="TRUGW13939_10442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349447.1"
                     /db_xref="GeneID:55997922"
                     /translation="MARRYLFLTTLVAAKTISATTAAAPVTTTAEGASTTQIQLYVIG
                     ETQSVPQFTGMAGSIVDANSVATTIAVECTDDAAGCGNLSGPITAIQGPSTRGGTFVV
                     KTETNGIEATMTVENSCQITGATQSASCAETIKINGEAGGQKASSTMSTTIQAKSNGI
                     TLEPLLITAGLEKLNSPQATETPGAAPAPVTGNMGLTLGGAAAGAVAAVAALL"
     gene            complement(<297587..>299288)
                     /locus_tag="TRUGW13939_10443"
                     /db_xref="GeneID:55997923"
     mRNA            complement(join(<297587..297612,297668..>299288))
                     /locus_tag="TRUGW13939_10443"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493555.1"
                     /db_xref="GeneID:55997923"
     CDS             complement(join(297587..297612,297668..299288))
                     /locus_tag="TRUGW13939_10443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349448.1"
                     /db_xref="GeneID:55997923"
                     /translation="MASKDIEAFDDLEPKTTVSVAGGADLKAYNDRRNVGTLRRKLKS
                     RHVQFLALSGAIGTGLFVSSGQTLSLAGPLSAVLAYLITGFNLYAVINSMGEMATWLP
                     LPGAVPVYAARYVDPALGFTLGWNYWYQFAIGVPIEISAAALIIDYWPNGVPTAVWIT
                     ILLVAVITINLLPVKIYGEVEFTLGAIKITTICGLILLMLITTLGGTPSHDRIGFRYW
                     KTPGPMLGYLEPGALGRFLAFFKVFISATFAYGGSEMVVVAAGETENPRRNIPKAVRR
                     VFWRIAIFYVLSIFLVGLCVSAKDKHLLNAINDGSPGVAASPFVIAMQNGGIKVLPSI
                     INAIVLSSAFSAGNSFFYASTRVLYATALDGKAPSFLKFEKFGVPYACVGITTALSLL
                     VYLNVSSNSADVFFWISNLSSVSTLVVWTSISITYIRFHKGMKYHGIPRSSLPFRAPF
                     QPYLAWFSCLFSSTVAFFNGFDCFFPGKFGAKSFIPPYIDIPIFACLFLGYKIIYRTK
                     FVKLEEMDFFSGKEEADQLEETWEEPKPRNVLERMWFWIA"
     gene            <300356..>301839
                     /locus_tag="TRUGW13939_10444"
                     /db_xref="GeneID:55997924"
     mRNA            join(<300356..300458,300515..301109,301164..>301839)
                     /locus_tag="TRUGW13939_10444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493556.1"
                     /db_xref="GeneID:55997924"
     CDS             join(300356..300458,300515..301109,301164..301839)
                     /locus_tag="TRUGW13939_10444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349449.1"
                     /db_xref="GeneID:55997924"
                     /translation="MGEYIPRTYAPTPFGKEMLREHFLIHPKYRPLNHGSFGTFPRQV
                     RDAQREFQEEAEFRPDVFFVKSHAEHVTESRRAIAEIVKAPVDECVFVKNASTGTNTV
                     LRNLDYKPGDVIVYFATVYNAVEQALASLVETTPVQLRKVDYTFPITHDEIVKRFLAV
                     VRKTKQVEGLNVRAAIFDTIVSVPGARFPFERLIKACNEESVLSIIDGAHGIGQISLN
                     LGELSPDFFVTNCYKWFYTPRGCALLYVPKRNQHLLRTSYPTSHGYTFPSERGQLHDG
                     GKSDFELLFEFVGTADDTPYMCVSAAIKFREQVCGGDNAIQHYIQDIAQRGGDVVAGI
                     LGTSIMEEPGLSSANQSDIRKCAMVNVRMPLAFKDDVLNEHVPSPNTSPYQLFSVQDA
                     AKMVAWMESRLVEEFDTFAKFYPHGGWLWLRLSGQIYLEIDDFEWIGHIVVQLCERVA
                     KGEWLQG"
     gene            complement(<301946..>305950)
                     /locus_tag="TRUGW13939_10445"
                     /db_xref="GeneID:55997925"
     mRNA            complement(join(<301946..305169,305227..>305950))
                     /locus_tag="TRUGW13939_10445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493557.1"
                     /db_xref="GeneID:55997925"
     CDS             complement(join(301946..305169,305227..305950))
                     /locus_tag="TRUGW13939_10445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349450.1"
                     /db_xref="GeneID:55997925"
                     /translation="MESAKVVDGLEDNIEPEAVAAVGAGQEELASRVFDFRAVRPVDV
                     EVKDLGVEIDTTAPLWQTPPKQIWKRLTASRSSSTHGHGTTYKTILENVNAHMPSGSL
                     TAIIGSSGSGKTSLLNVMAGRMESSRLKTAGSTKFNDDTNLEHIRSSYVMQQDVLIPT
                     LTVRETLQYAADLRLPPPITKAERRGIAEQVIMELGLKECANTQVGSSAHKGCSGGEK
                     RRTSIGVQMLANPSVLFCDEPTTGLDATSAYQIVKTLKALAQKGRTVIVSIHAPRSEI
                     WNLFDRVILLSRGAPLYSGPISAALSHFKKLGYAMPKFVNPAEFLIDLAAIDNRSTEL
                     ESASLVRVDFLRDSWKTRTKEVSEDKKATTIPSSIQAAESEQMVKKVPFSREFSVLTS
                     RTFKTTTRDPLGVAGTLFEAVGMAVITGWIFLQLDKSQAGIRSRQGSLYNACSLNGYL
                     VLMYETFRLTIDIRLFDRERNEGVVTVPGFLLSRRAARVLLEDLPAPILFTIIYYFMV
                     GYRPDAATFFIFLALAILVQYIAVSFAAVGVGISRSFSGAGLVANLSFTLQSFACGYF
                     VQSNQIPVYTRWLKWTAYTFYAFGAFCYNEFIGVNSPPYGQFYDCPSSNDPLDSACKQ
                     YTGQYIIESLGLPSNWIWRPVVILTAYVIGFYVLGAILLQYNTFAMGIAQARKSEAES
                     QTGKEGVVVRSKEEIRRVAISLDKYALEIKKRDEVWKAPRRIPILQPISTEFLAGHLN
                     VIMGPSGSGKTSLLNSVARRLHGSMMTKYQLSGTMSYNGAIPSESVIRSVTSFVTQDD
                     DALMPSLTVRESLRFAAGLRLPRWMSKAEKNQRAEDILMKMGLKDCADNLIGSELIKG
                     ISGGEKRRVTIAIQILTDPKILLLDEPTSGLDAFTATSIIEVLNNLAAEGRTLIMTIH
                     QSRSDIFHHLANLLLLARGGYPVYAGPGAEMIPYFSTLGYHCPPQTNPADFALDLITV
                     DLQQEEREAITREKVQRLIEAWKNNEKVIGRQASHIATPAELGSLKRQMHPLRTTFPL
                     VLHRSAINFFRQPELIMARTSQIVGIAIIMALFFAPMKNDYAAVQTRMGFVQEFAALY
                     FIGMLQNISVYPPERDVFYREEADNCYSAETFILSYTVLEIPFEILASIVFGVIASYA
                     VNMERSVLMLFVCSFNCFAIINAGESLGIMFCTLFNHVGFSVNVTSVILSISTIMGGI
                     MSLNLNNVLQGFNHLSPIKYAVANLAPYSMRHQTFSCTEAERLPSGQCPISTGKEALQ
                     LYNLDTNPGWNVLWLGVAAVVYRLLAYAVVKGMGTHGFWEGVGKLLTRRKEAA"
     gene            complement(<306568..>307356)
                     /locus_tag="TRUGW13939_10446"
                     /db_xref="GeneID:55997926"
     mRNA            complement(join(<306568..307051,307112..>307356))
                     /locus_tag="TRUGW13939_10446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493558.1"
                     /db_xref="GeneID:55997926"
     CDS             complement(join(306568..307051,307112..307356))
                     /locus_tag="TRUGW13939_10446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349451.1"
                     /db_xref="GeneID:55997926"
                     /translation="MVDASKSPDIESTNPKSPILNPLLLLLAARRGFNQDGRFTTTKV
                     PDDYLISYRGRSGVNMIDHTALWVRFMWAFACYPKQLKVGTVMSTAVMLQCVLNIYYE
                     DGSFQWQLLIIGILCVFQTLFLILCRVIANRHVAAATPSWCDPESYQCRLAAALGEAD
                     IQYTNIQPATLGEMETMWKSEQTLCEKFRIENLVDPGDRHQVYDIAVEFYNSGAIIMQ
                     FPSLEGSPKSRPGILISNGEGEKP"
     gene            <308322..>312809
                     /locus_tag="TRUGW13939_10447"
                     /db_xref="GeneID:55997927"
     mRNA            join(<308322..308380,308439..309640,309698..309767,
                     309833..309947,310546..311213,311272..311946,
                     312006..312478,312541..>312809)
                     /locus_tag="TRUGW13939_10447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493559.1"
                     /db_xref="GeneID:55997927"
     CDS             join(308322..308380,308439..309640,309698..309767,
                     309833..309947,310546..311213,311272..311946,
                     312006..312478,312541..312809)
                     /locus_tag="TRUGW13939_10447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349452.1"
                     /db_xref="GeneID:55997927"
                     /translation="MALFQEIQTPVVKYNQPLGLFINNEFIKGIDGKTFETINPHDQN
                     LIAAVHEATEKDVDLAVHAARAAFEGCWSTVTPSERGKMLTKLADLMMRDIQILAASI
                     SLDCGKVFSAAMLEISSSADCIRYYGGWADKIVGQTIDTDAASLTYTRHEPLGVCGQI
                     IPWNLPIYQAVCKVGPAVATGNTVVLKSSEIAPLCVLYMAQLVKDAGFPPGVINVISG
                     FGKVAGAVMAGHMDIDKISFTGSLATGRQILRDAANSNLKKVTLELGGKSPNIIFPDA
                     NLEHVMSWVNLGAFFNQGQVCCAGSRVLVHEAIYDRFLDMLKKCTEINKIGDPFDPST
                     FQGPQISQTQFNRVMDYIEAGKKAGATVIAGGNRVGSEGLYIQPTIFTDVHDDMTIVK
                     DEIFGPVCTVHKFKDESEAIRVANNTHYGLAAAVHTSNLNTAIQVSNSIKAGTIWVNS
                     FGLVSPQMPFGGYKQSGFGREMGSYALEAYTQTCWNAGKACVFEMPPTARSRFPGRSR
                     NIAGRASVDRSQTSHMSMQISYENGLHRTDSEYPGTPATEPTYQSTERSNSEKQPQVQ
                     LDHPMSTSFDDHHTHDARILSPFNGVKEAAVVQHVRSLDQLASSTAQLFGTSAESDPW
                     LLRHCKYDENGIRSFHRIDFRNVGGVPVEGLVPVHFLLTEDSLLKSAKDATASCPGKG
                     SQEKRQELDALIPPGYGWRLILLFMRFVFPSMPVISRSQLCSIWNKSLQSISPHFLAA
                     VYASALPFKVHDPELVVFGAYDESLCDRLWRMVYELILEEIHTPHLSVLQACLLYLQQ
                     LPTGSQSALADSPFHWSFLGSTVALAASLGLHLEPRPWGIPDWEKRLRRRLWWAVYLE
                     DKWRSLLVGRPPFIRREEWDVKDLDDIDFIVDHPENMGIEHPEACFQKDAEDGAIFKS
                     FAKLAQVVDNIHNTFYTLRGSQIMSEDFWASINAARPIREELQTWYMSLPESLRIRPR
                     EEATYGARERGAIGSLHFAYLTLELFVYRAILRPLARSPPPPPIIADDNSSQDIVWLL
                     EDLGYDGHGLDQLPAVDVSKFGDAAEATLNAAEKCAGIIVNFVGALAPNDFDTFWYPW
                     TRICFSTISNFIFLLLVQAPTVQHASQTKHLLDIWSQNLCFQYRNHESLLAFGLVRLR
                     TLLSGGLGRNFVLSSHVADILSMNMDREDL"
     gene            complement(<312897..>315522)
                     /locus_tag="TRUGW13939_10448"
                     /db_xref="GeneID:55997928"
     mRNA            complement(join(<312897..314122,314180..314261,
                     314310..314550,314663..314714,314796..>315522))
                     /locus_tag="TRUGW13939_10448"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493560.1"
                     /db_xref="GeneID:55997928"
     CDS             complement(join(312897..314122,314180..314261,
                     314310..314550,314663..314714,314796..315522))
                     /locus_tag="TRUGW13939_10448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349453.1"
                     /db_xref="GeneID:55997928"
                     /translation="MAERIRLGILTPSSNTSLEPLTQAIISQLPNVSVHFSRFTVVKI
                     SLDDDGLGQFQTEKIVEAATLLADANVNMIGWSGTSSGWLGFQADEMLCEAITAATGI
                     PATTSVLALNRAARGLGIKELGLVTPYTDDVQSAIIKTYAAIGVDCSKEKHLGLSKNS
                     AFAEVTESLLDEMVASVAARDVKAISTFCTNLYAAQRASYWEDKYDIVVLDTVVTVIW
                     DMLRHCGVDSTTIKGWGRLLSSASKLAAVRRPSRPRLISPCLSFHLLLIFLCDQIRKF
                     AKMTADEKPYYDCIVLNGTVVTAADIACYDLAIKDGKIMLLAPKGHLENTPATRVIDA
                     EGAYVMPGGIDAHVHLAEPPLFGKGRTADDYTTGTRSAVAGGTTTIVSFAPQDKSQAS
                     LLDALDETSGKAADQAYCDYSFHLLISNPTAQALDEFTLLRERGVSSVKIYMTYEALQ
                     LRDNQILDVLLKARATGITTMIHAENGDVLDWMTKQLEDRHLLAPKYHATSRPQILES
                     EATNRAIALGELIDAPILIVHVSSPAAAEVIRRAQTKGLPVYAETCPQYLFLTREDLD
                     KPGFEGAKCVCSPPPREGSVDHEGIWTGLQNGTFTILSSDHCPFIYDNAEMGKKAAIT
                     PEHPNGHFKYIPNGCPGVETRLALTMSANRLTPQKFVELTSSNPAKLYGLYPQKGALI
                     PGISDADLVIWYPPTAIDPFPISNSNLHHNVDYTPFEGKTVSQWPRYTLIRGQVVWDR
                     DHGGIVGQKGYGQFIKRDRSCFTAPNPVPWSVENF"
     gene            <316004..>318284
                     /locus_tag="TRUGW13939_10449"
                     /db_xref="GeneID:55997929"
     mRNA            join(<316004..316283,316338..316395,316449..316527,
                     316614..316719,316778..316947,317007..317267,
                     317321..317416,317472..317604,317666..317756,
                     317816..>318284)
                     /locus_tag="TRUGW13939_10449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493561.1"
                     /db_xref="GeneID:55997929"
     CDS             join(316004..316283,316338..316395,316449..316527,
                     316614..316719,316778..316947,317007..317267,
                     317321..317416,317472..317604,317666..317756,
                     317816..318284)
                     /locus_tag="TRUGW13939_10449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349454.1"
                     /db_xref="GeneID:55997929"
                     /translation="MKLPRSTGLLRQKQRLLDSLKVRNDPGNGQYESGQFGRWSNKDL
                     DPSPPQQRTWSAWSFFAFQFSIAFSPTTYNAGASLYAIGLNWWIIFIASIVVSILIAI
                     LLFLNARGPARYHVGYPTFVRLCAGMYGSLLFIFIRGVVAILYMAIQTYYASQFVAVM
                     LRCVFGHQWTDIPNHLPKSAAITSSNLLAFGILWIIQFPFAFVHPSKMAVVFQIKSVI
                     APIGLIATMIWALVSSHGADFEGLSSQTVSGAALGWSFMHAINAIVSNVIPPLVNISD
                     LARYVKRPRDTLPMPIGLVVSKPLVVFLGMVITAAGYKQFGQAYWNLWDFYSSVLDDY
                     WSPGARTLVFLAAGIQAFATFVTNFTSNSIPVGCDLTGLFPQYFTIVRGQVLCFILAW
                     VCVPWKLTYSASSFLTFLGSYLCFICPIVACMIVDYWVIRKGNVHVPSLYKTQPGSIY
                     YYTAGFNIRAFVAWVVAIALVIPGVSGSLHPGSIGTAAVRMYNMGFLLSTVVAGLVYY
                     LGCRIWPVPIYPSNVQPKDESWEAMRYTEGFFAEDEVIPEYLRDKVLDGQLIHVHADK
                     EEVLSAPGDGKLSI"
     gene            <320387..>321139
                     /locus_tag="TRUGW13939_10450"
                     /db_xref="GeneID:55997930"
     mRNA            <320387..>321139
                     /locus_tag="TRUGW13939_10450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493562.1"
                     /db_xref="GeneID:55997930"
     CDS             320387..321139
                     /locus_tag="TRUGW13939_10450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349455.1"
                     /db_xref="GeneID:55997930"
                     /translation="MLQSHDSPDLGLSRSPKEEHSTRNKDHKPNPKAIVMRRTAPIRL
                     RNASSISSTFPYRPSGASTSKRKRARTAASTTLSKRKSDTAAPPNAQCGVRIGDIVGL
                     AQPDGITQQFAKVSELCPFHNEQFAVVCVWLYTRDEIAQDLIRHDHSLTSTSSNETSW
                     QHLNERWSLKQERYDGDEYMLSTKRTIALWDATTIKRAPDAVATNICQNLIYNIDPSG
                     RKICDVNDPVWRWMKKILTLRPAGHTMSVLRS"
     gene            <322527..>324806
                     /locus_tag="TRUGW13939_10451"
                     /db_xref="GeneID:55997931"
     mRNA            join(<322527..322856,322947..323425,323729..>324806)
                     /locus_tag="TRUGW13939_10451"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493563.1"
                     /db_xref="GeneID:55997931"
     CDS             join(322527..322856,322947..323425,323729..324806)
                     /locus_tag="TRUGW13939_10451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349456.1"
                     /db_xref="GeneID:55997931"
                     /translation="MFSLQGPHANRHDPPHPHHPPGHRHIKQNEKGEWVDSGSNAQFV
                     EQIKSGDTIFFHTSNCTWCYNGTCSNNSPWNIPTASGGNKNDLIIVILNKGYFVISCI
                     PGSHTKEENPRPLVPHQNYAVDEFIKNYISLIWLEKAIYYSTDNFHNFTIGRGNGQSE
                     NLGQLAPGMWMKKIYGGVFHDYNDNIIPKISDEFQVFDNTDKKKNLYSNSACHAPKSY
                     EPYFLFDKNIPLDYFLMFQFQGLSNPIYARFTPQFIESGSLHNALKIIMEIFLAFTTL
                     DDPMLRDIPPNGFAFISIGDRRPYAKWKADLKIPLNGKPDTFVIMRDARDVAFVRIAK
                     NAMEDRRLTQTIFDIRNILHHRNKIASSRASAHVIFPVDEKLREKNPAVQANFRQLFD
                     QIIAVHTPGQFATWDPYCYKKHMTESELFLDITLSSKRPRKTIFHPLQKFGQLAIGEM
                     DMCIETFDKSTTVRTCFASMEWAIFTTQKDLPHFLESRQGIVINLDTYQQFDVSCPDF
                     QESFEETIVVLYDSLHCIICRYPRGFDNDIDVWNKLGRFASTLLKPIEPWRLVTINSN
                     FSAWPGANQFFNTGMRVAWFPETCLLSIIRSDHGLIEVAGARWDGELTEVPIPLRTLS
                     FDID"
     gene            complement(<326189..>328434)
                     /locus_tag="TRUGW13939_10452"
                     /db_xref="GeneID:55997932"
     mRNA            complement(join(<326189..326467,326554..>328434))
                     /locus_tag="TRUGW13939_10452"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493564.1"
                     /db_xref="GeneID:55997932"
     CDS             complement(join(326189..326467,326554..328434))
                     /locus_tag="TRUGW13939_10452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349457.1"
                     /db_xref="GeneID:55997932"
                     /translation="MSEHNPRSTKSPAHESRLRRPYRPRACDVCRCLKTRCEPHPNPA
                     IKPCQKCADLGRTCIISPSDRKRKKRTDTRVAELEAKIDTLMGALQASAGQQTQPHDD
                     NTRSNSQQRVPTDLLGHKNCCCGCLSSVPSPSIPPGIGTPSPAQKPGDPIDNQIRESQ
                     GDAISRGIVDMESARAAFERYVSELSPVMPMVVFPPRTTMENVRSEKPILFWAIVATS
                     INTIKPDVQPILMQETYRTFGEYIFARRQKSLELVQAMIICCLWYSSPERIEELNVYQ
                     LVHSAVIMAIDIGMNKQVPKKKMTFRSIQEATRRIPISFNADGIETRRTWICLYFLSA
                     LVSICYKREILLRWNNHTDECLEIMEGSTETVPSDASLLHWLKLGHIMEQVSTHFALD
                     QGSNAFKLEDPRVQYTLKAYEKLLKQWGEGIYKVTSMTIQQKLMRQAAQLVKIHMHEV
                     GIHFELDDIIFRPASGLSAAEIHSGERINSLISCVTSVHKTLDISFSIDIKDAFKIPT
                     IFIARTNYCAVILMRMSVIAFRVKAQVNPIYAPVDLKAEYYIDKLVERIRNVAKMEGG
                     RPFAHIGRLLSTLNDRFMNPEGPRIPFEEAITNLSFPRHVTSTIRELFRRAAQEPIEQ
                     DSQCTKNVWFSNSTSNSAESLQPTGSQGQGQDRNRLLPTYDSSTSHDENCFSSMPSTS
                     SNMDTTLDPNELYYLGSLLDNGLLETSSSFDELMGLF"
     gene            <329115..>329687
                     /locus_tag="TRUGW13939_10453"
                     /db_xref="GeneID:55997933"
     mRNA            join(<329115..329355,329422..>329687)
                     /locus_tag="TRUGW13939_10453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493565.1"
                     /db_xref="GeneID:55997933"
     CDS             join(329115..329355,329422..329687)
                     /locus_tag="TRUGW13939_10453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349458.1"
                     /db_xref="GeneID:55997933"
                     /translation="MSTLSLFAQVRDNKLVQRSPRAKKAVAVSYLTGASRTRLAESQS
                     PKSHANMTDKKQTKDHQGDIPDDNASQATTLVPDTNSGYYRKQVEAAAFAGLKWGITP
                     KKLHDRNAIPDPDHPVHKIPAEKQEKMRKKGINPVLYAEMNQNKLNGKGTFWWKVSQT
                     AMGGGCIK"
     gene            <330714..>331298
                     /locus_tag="TRUGW13939_10454"
                     /db_xref="GeneID:55997934"
     mRNA            join(<330714..330800,330854..330942,331001..331057,
                     331127..>331298)
                     /locus_tag="TRUGW13939_10454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493566.1"
                     /db_xref="GeneID:55997934"
     CDS             join(330714..330800,330854..330942,331001..331057,
                     331127..331298)
                     /locus_tag="TRUGW13939_10454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349459.1"
                     /db_xref="GeneID:55997934"
                     /translation="MFVKTLLVAALPLLTPAIASPLQKRDNVDLFIWGSANLQDYDTY
                     YSFAAGACQAIATPSTGHVGSATVDLNASCNVYASSDCSGSVAGTFSAPGISDTGSLK
                     NSFGSVKCSIPSSSAAASTTAGAQASDSCAAV"
     gene            complement(<331740..>334478)
                     /locus_tag="TRUGW13939_10455"
                     /db_xref="GeneID:55997935"
     mRNA            complement(join(<331740..332224,332282..332793,
                     332855..333333,333382..333856,333917..334091,
                     334155..334195,334250..334304,334367..>334478))
                     /locus_tag="TRUGW13939_10455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493567.1"
                     /db_xref="GeneID:55997935"
     CDS             complement(join(331740..332224,332282..332793,
                     332855..333333,333382..333856,333917..334091,
                     334155..334195,334250..334304,334367..334478))
                     /locus_tag="TRUGW13939_10455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349460.1"
                     /db_xref="GeneID:55997935"
                     /translation="MRLSVAGFVVAVGRASAIGWESDVWQNVSMCNWAEARANIIRDT
                     VYVDGGNLYWVPGLTNGQWGHPAKDNNIDGATYTLALGQPFNQSSNLTALFQQMPSLG
                     GRASNFAPNYVDGAMFATEDEMILYGGLLSSSITSSPPPDNVVLSYEAYPSGSESQPK
                     FLDKYLPDGMTRYITNGAAVSSLSEKLGFYFSGMRGAEWGSFVANDGLASTPANTLIT
                     VNMSTLGQETWSNSSLRSSSRSIPARANAEIQWLPVGDQGVLVAVGGVINPVSLTVVQ
                     GLNDSQLAASKATSPTFMKTVSVYDVASQKWYQQNTTGDVPPQLTLFCSVLAIAEDRS
                     SFNIHIYGGYDGLQSNSTPSDDVYILSVPQFVWTHAYTGNSSHGRTGHKCLSIYPDQM
                     MIIGGIFQNQQYTCLDKIIEIFNLNKLGFQDTYDPRIWDDYRVPDTVTANIGGNENGS
                     ATMLSPKSSWDDEELSSIFSTQYTKTIPKYYPYQLQGPNTTTTSSPTAAPSISVGSAG
                     GGGLPTWVAPVLGVVLGLIVVAAAAIIFLLWWRKKGSRNRAASDTQGSAAGLKGFVLR
                     WLYGTSGQEARSSKGPTELQVDDDATTVVSSARNERHASGVESYDVHEMADRRMLSFE
                     MATDFNNPRDWSRSSWSQPEISPPLVSPNIGELMERDPLDSSLPTPASAVGPPTMRPT
                     QSRTRRISDRSDETGISELEASDSVRPPHSRHMSDNSISDENSLAGASDGNSVQAGSA
                     GERRPQSPGTARIQTVHEVDEPNSSSMVRGQGPTELG"
     gene            <335930..>338382
                     /locus_tag="TRUGW13939_10456"
                     /db_xref="GeneID:55997936"
     mRNA            join(<335930..336139,336250..>338382)
                     /locus_tag="TRUGW13939_10456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493568.1"
                     /db_xref="GeneID:55997936"
     CDS             join(335930..336139,336250..338382)
                     /locus_tag="TRUGW13939_10456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349461.1"
                     /db_xref="GeneID:55997936"
                     /translation="MRWTLFLPHLGLAAAWVAQPQHTQAGYLARRQYSVSAPCVASTL
                     TVTETTTQSFGSPAETVTVTLVRRFTTVTVTQFYSDSVSYVDAGPATSTSSPVATLTS
                     PPITSSAPLATYAPAVVESYSEIDFTSTSTFYTTDIITETECTCTETDTTTTSISTYP
                     VSPISYTVTTTYITTYTTVLTSTVPTTISDTITTTATTDITFTATATICTTSISVSTA
                     TVTDIITDTVLNPTTVTYPVTNTVSVTLTPSVRTITDSETETASVTVTDATTATATIL
                     TTVSTTYTTTLPASTITDVSTLPGSTITVSKSIVTLPPNTVTITSSLPGTTSTVTTVV
                     TKPVTTTTSYSISVCPSRIVNPTYTAPGPLPTDYTWGCKPGFLCHPKNKPPGGGDCNF
                     ESGPPADTYYCSPDECIPSPNLIPDPDKTWGDGYKSDKVGTYPVTPGYFNLDPKNFGL
                     NYSVFTFPRGTEVTYDDLDLWLEVEIDVDTGILKKRQQGGGDTYPAACYQECDDAETV
                     GQSVGKTPALCLTSMFLGDVNSCHACIEFHASDKNKIFPLPDFQQYLDYCSTITSTTT
                     TTTTTSTSVSVTKPTVPIGVSTGSTTTTRTSISETTSVSRSSTTTTSTVTTSKTSIST
                     SVPPSTSSSTSFTTTVSTSSVSSTSGTQSISTSGGTTGPQISTTASTSTGPTSTGSSS
                     TSSGTGSISSGGISSLASTTTISTTTALPGNGGSAPNSQSPTSGSVSPSGSQIPTRSG
                     PASPSSTTPVFPGAAPLTRAVSTRWLVPFCFALGLMTTFL"
     gene            <339160..>339966
                     /locus_tag="TRUGW13939_10457"
                     /db_xref="GeneID:55997937"
     mRNA            <339160..>339966
                     /locus_tag="TRUGW13939_10457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493569.1"
                     /db_xref="GeneID:55997937"
     CDS             339160..339966
                     /locus_tag="TRUGW13939_10457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349462.1"
                     /db_xref="GeneID:55997937"
                     /translation="MADRPFGPRYPFSGARPDRWQSNYNSQNTSHSHGRPAPYLGDAS
                     NPFSPASTPQHLAYNSATTPANRQQQQQQQQQQQPVQQPYDIGRDELVARFLGWEVTQ
                     DVRANLADQEKRQKHLSNNWFSMCESLEKDYASKSEACRKNNYDKVWCPMKLKNYFDF
                     IKQETKTHYPEEFTKIAWNKKMDAHIKTIMVSQVAHKGASLLGCIAILKSSLGPPAPN
                     QKQQQQQNYPQMSTPPYASYDQQSIWGPPSATPYTRYPTNPGPPQKQWPK"
     gene            complement(<340251..>342735)
                     /locus_tag="TRUGW13939_10458"
                     /db_xref="GeneID:55997938"
     mRNA            complement(join(<340251..341011,341069..341097,
                     341678..342116,342179..342278,342349..>342735))
                     /locus_tag="TRUGW13939_10458"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493570.1"
                     /db_xref="GeneID:55997938"
     CDS             complement(join(340251..341011,341069..341097,
                     341678..342116,342179..342278,342349..342735))
                     /locus_tag="TRUGW13939_10458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349463.1"
                     /db_xref="GeneID:55997938"
                     /translation="MASTPAPPQEKTFRNLATNQAANYAATRKGYPPALINYIVNHHR
                     ATGGNTKLLLDVGCGPGNSTQALAPHFDQVFGADPGEGMIKAAKELGGVSGTGNPIKF
                     RICLAEELDKLEEPECGSVDMINVTAAIHWFDVPKFWASAAKMLKPGGTISVWNIFPT
                     NPSTPYANNEKVQEIMDHFSDVVLGPYVTPGSKLSKNGYNGLNLPWDQPETASLFDKE
                     SFLEERWYSNDLESKKMGFFGGLAQDQWTLTAVKAMLGTMSPVIRWREAHPDLAGTDQ
                     DCVDVVIRQLCDAIGAPNALKDGTTMSGGMGIVRSLNTNMELGTPDVDAATPSNIASA
                     DAEGMALENIHARSHPCVIKWFAFKKRAWMSGYETSLVKEPDYSANSGEPMKLRHPGI
                     SEKGGLASQLKRPRAPELSLANDDIIMPDSPVIETNEPGTSDGNLHSNYGETVLTSRP
                     RKRIRSAEPHAGASSANEVINWDGKNGNNDSEENDEDKENRYPTGRPFTNGALFDGRQ
                     KRNPLGSHKSKGYLDIFSKVNASTSSPKQKIDMQWKVLDDRVNRTLRQFRGCYRHQPD
                     WEYEI"
     gene            <343487..>343948
                     /locus_tag="TRUGW13939_10459"
                     /db_xref="GeneID:55997939"
     mRNA            <343487..>343948
                     /locus_tag="TRUGW13939_10459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493571.1"
                     /db_xref="GeneID:55997939"
     CDS             343487..343948
                     /locus_tag="TRUGW13939_10459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349464.1"
                     /db_xref="GeneID:55997939"
                     /translation="MESTRLKTAKKFIGHFATLDVKILETILSDDYYHEFAPSSLNPP
                     GPFGKQGFLDHHSGLDYVMTGFPVFAKEYIESESSNSVTVWATSRTIFREGAKDASIA
                     NWDYEGEYIFLFTFDPSGEKIVRTIEFLDSKATGDGLMVLMKRARENRAKS"
     gene            complement(<345640..>346828)
                     /locus_tag="TRUGW13939_10460"
                     /db_xref="GeneID:55997940"
     mRNA            complement(join(<345640..346247,346318..346516,
                     346567..346613,346675..346722,346771..>346828))
                     /locus_tag="TRUGW13939_10460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493572.1"
                     /db_xref="GeneID:55997940"
     CDS             complement(join(345640..346247,346318..346516,
                     346567..346613,346675..346722,346771..346828))
                     /locus_tag="TRUGW13939_10460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349465.1"
                     /db_xref="GeneID:55997940"
                     /translation="MSQRGSPGKKATAATTTLIAGGGAGMSEVLACHPLDTIKVRMQL
                     SRKAGLGLSSKGMVGTAGEIIKNESPLGLYRGLGAVIGGIIPKMAIRFTSYEYYKRLL
                     SDRQTMEISRKGTFIAGLAAGVTEAVTVVNPTEVVKIQLQAPHISPTGQIVPKYRSTF
                     HAISSIVRQEGVGFLYRGVTLTALRQGTNQAANFTVYSELKSILQRLQPQYSERGELP
                     SYQTTVIGLISGAMGPFSNAPIDTIKTRLQQTPPVPGQSSLSHMARIATDILQKEGFR
                     SFYKGITPRVMRVAPGQAVTFTMYEFLKGKIENSEFVSLKQTI"
     gene            complement(<349325..>350392)
                     /locus_tag="TRUGW13939_10461"
                     /db_xref="GeneID:55997941"
     mRNA            complement(<349325..>350392)
                     /locus_tag="TRUGW13939_10461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493573.1"
                     /db_xref="GeneID:55997941"
     CDS             complement(349325..350392)
                     /locus_tag="TRUGW13939_10461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349466.1"
                     /db_xref="GeneID:55997941"
                     /translation="MTQSVLITSEQAYIFALSILQNYGVPLDRAAMVAESLVLADLRG
                     VDTHGINRLSGYIDRIKCGVLDPNPELEFDMKSPVMAHLNARNTFGFVAGCMAIDKGI
                     EIASIYGLAVVAVKNSNHYGMGAGYVLRAIQQGYAAIAFTNASRAMPPWGGKEALLGT
                     SPLAVGVPGGKEGDFVLDMSPTVAARGKIRKAARRGESIPEGYALDEEGKPTTDPEAA
                     LKGVMLPIGGPKGSGIAMMMDIFGGLLTASSFAGGVNDQYKNTTEPQGVGHWFMVFKP
                     EMFLDSKENLGDRMDTLLGKVRSCEKAAGVERIRTPGENASDMERCRRVEGIPFTADE
                     VENLNQLAKNSGSDALLVNRS"
     gene            <351291..>352256
                     /locus_tag="TRUGW13939_10462"
                     /db_xref="GeneID:55997942"
     mRNA            <351291..>352256
                     /locus_tag="TRUGW13939_10462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493574.1"
                     /db_xref="GeneID:55997942"
     CDS             351291..352256
                     /locus_tag="TRUGW13939_10462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349467.1"
                     /db_xref="GeneID:55997942"
                     /translation="MGSMQEFTIYIVDPFHPDAVQLVQNIPYVRVILPDDPRKANWHA
                     DADGIMIRSDSKLTEEDFAKATRLRAVVKQGVGVDNIDLEGAKKHGIAIHNTPALNSE
                     SVAELSMALTLTLSRRVAEIDRAVRGGETVVRSKMLSTSMFRKTVGVVGMGNIGKIIA
                     QKWIGAFECNVVAYDPYAPADAWSDVAHVRVSELDELLKVSDVVTLHVPLVKSTRGLI
                     GAHALEIMKDTAILVNCARGGVVDEKALLEGLRNKQIGGAALDVMEIEPPTVDVYGEY
                     LKYENLIMTPHIGGSTKENQSRSGMAVAETLMDVLEGREAGGKLV"
     gene            <353715..>355700
                     /locus_tag="TRUGW13939_10463"
                     /db_xref="GeneID:55997943"
     mRNA            join(<353715..354160,354221..354527,354581..354716,
                     354771..355130,355191..355295,355354..>355700)
                     /locus_tag="TRUGW13939_10463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493575.1"
                     /db_xref="GeneID:55997943"
     CDS             join(353715..354160,354221..354527,354581..354716,
                     354771..355130,355191..355295,355354..355700)
                     /locus_tag="TRUGW13939_10463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349468.1"
                     /db_xref="GeneID:55997943"
                     /translation="MALSKSENDSPTPVVNHDGDTKAPATLETFKDQQANILPHKKLM
                     VVFPVIALAQMISYLDQTSVSTAVPSIGAALNMGPSISWVPTCFLVASTSIQLINGRL
                     SDIVGRKPLLLTCMGILAVADLCAGFSTSPGMLFTFRTIAGLGGGAITALVMIVASDI
                     TTLEQRGKYNGFIGAMVGLGNGIGPLIGGALTQKASWRWCFWFISPVIVAVMVLIAIV
                     IPPSNVRGKAGAKVRMIDWLGLFINIAAVVLILIPISEGGSIYPWKSPLVIATLVIGA
                     LLIPAFVFVEWKIAKLPMMPIRLFQSDMSANLVLIQGTLHGVVYWANLYYVPLYLQNV
                     RGYNPIMSGVIILPMVASHGVGSLVSGQIISRTGHYNPTIITSNLIWTIGAALQTIYT
                     RTTPVWAICVIGFLQGVGIGGAFQPGLVALLAHSRKADRAVANSLRNFLRIMGGSVGL
                     TISGAILNNVMKDKLSSFLSSETIGQITSSSYAMESMNLSTTQTEKVLDAYMSGMHDI
                     FVMYAPIIGICFICAVLIKDEGVAEKDANQQPPAPKSEQSVESSDRVVMSPEVREEKV
                     "
     gene            <357881..>359339
                     /locus_tag="TRUGW13939_10464"
                     /db_xref="GeneID:55997944"
     mRNA            join(<357881..357989,358057..>359339)
                     /locus_tag="TRUGW13939_10464"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493576.1"
                     /db_xref="GeneID:55997944"
     CDS             join(357881..357989,358057..359339)
                     /locus_tag="TRUGW13939_10464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349469.1"
                     /db_xref="GeneID:55997944"
                     /translation="MTTPIPQPPGVPLLGNIFDVSPSNTWGSLNKLAAKWGPIFKINA
                     LGTQIVFVSNAALLEEICDETRFRKCVTGPIVEIRQAVHDSLFTAYPSEDRIWGIAHR
                     ILSPWSSDESNRTTFNDMRDAIAAIVPTWATESEQKVNVADGLKRLNFQSVQWSFFHQ
                     KSDYMSGPFPAFLTAIDRSTMESVKRPTRPKFLNWLIYQRGYSKDIRTMRSFGADVIA
                     KRKSEEEHTADLLDALINGKDSETGESLNHEQAIDEIINMFIGSATSPCLLSFALYYL
                     LKNPEYITKAREEIDSILGADRELSSENLPQFQFTEAILHESMRLSAVAPGFNIEPRP
                     DVNKDPHVTLAGGTYQIPNNQAIIVILKEVNRDPAVFDDPDVFRPERMVGDAYDKLPS
                     GVKKGFGNGKRKCFGLKFAWQWSWITLITILREVDLKLADEKYTIDDDINGAYCVQPW
                     NFIAKVGKRKDRP"
     gene            <360879..>364153
                     /locus_tag="TRUGW13939_10465"
                     /db_xref="GeneID:55997945"
     mRNA            join(<360879..361837,361888..>364153)
                     /locus_tag="TRUGW13939_10465"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493577.1"
                     /db_xref="GeneID:55997945"
     CDS             join(360879..361837,361888..364153)
                     /locus_tag="TRUGW13939_10465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349470.1"
                     /db_xref="GeneID:55997945"
                     /translation="MPPKRLSHDDYKVGWICALEVEQVAAMEMLDEEHDSLPQASSDT
                     NFYNLGSINNHNVVIAGLPRAGNCPAATVVTQMKMTFPNLRYGVLVGIGGGVPVKTDH
                     GMIRLGHVVVSEPTGIHSGAVQYDYGKARSGQFERKGSLAPPPTVLLNAAREVAVRRQ
                     RMDHDPIWSNTQRIKTSRPALRRFKYPGAANDYLYQRDYVHGQEGVSCQDGSCDPKQR
                     IERPMDDDKEAFVVVHRGTIASGELVIKDAKKRDDLAKEHGVLCFEMEAAGALTDFPC
                     MVVRGISDYCDSHKNDIWHGYAAAVAAAYARQLFFHISIEEAQRNPNPKPTTFELPFS
                     LSDISEVTQFITRQAEIGRVQEVHEEIAGPQTAAIADHGLQKERHWMVPFGRNNNFVG
                     RDAILERLLTSVSPDAVPDDCQRVVLEGLGGVGKTQIALEIAFRIRDQHDDCSVFWVP
                     AIDRSNFENAYRVIGSLLGLDGMNSDDTDVKTLVQTALSQRSAGKWLLIIDNADDPLL
                     LCGNSESPVSSDAQDRPLLCYLPFSPSGSIFFTTRNHEVSVDLDTPEHNILKVEEMQR
                     EESLKLLMTTLKESQVKDMESTNKLLDLLENLPLAIRQASALIAKKQLTTAEYLDVCL
                     ASEDDLINLLSRDFEDRQRYKSTKNPVATTWLISFRHIETHNQLAADFFKFMCFLTGK
                     DIPLSLLPPARKIEVAEAIGTLKAYAFITQRGDEESFDLHRLVRLAMMSWLRGTGELE
                     AQFQQWTTKVMERLATEFPDPEHSNRSIWIRYLPHVHHFLHFREQRGYHPAEALLQSR
                     IGSCLYTMGRFPEAERAFRQAQRLLEEQVGLEHQDSLSCMHEVGLMLLEQEKLEEAEQ
                     VLQQTISLKEKALGRNHPQTLCARRDHFRTLTHLKRFEEAEGKGQPVLESFKRELGDR
                     HPDTLKCASIFAFTLSQQHRYHEAELIEKPTLALRKTVLGADHPMTLVSANNLAFALS
                     RQGKYEEAEEIERETLKLRETALGKEHPNTLASMNNLAITLAERSKHDEALILMEACF
                     ALSTRVLGVDNPETKWRGEFVRAGGHRTTTLHMTVAGTAGPEGG"
     gene            <364760..>366272
                     /locus_tag="TRUGW13939_10466"
                     /db_xref="GeneID:55997946"
     mRNA            join(<364760..365818,365892..>366272)
                     /locus_tag="TRUGW13939_10466"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493578.1"
                     /db_xref="GeneID:55997946"
     CDS             join(364760..365818,365892..366272)
                     /locus_tag="TRUGW13939_10466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349471.1"
                     /db_xref="GeneID:55997946"
                     /translation="MLLGNNRFHLSGALLLVVTILFFICHHALSTSTPDELNRSQFRA
                     LPVAQSKRVQSPLTDSDTAKHAHLAVPAIPAALRPTGVSSSLSRQKKPPYRVNTIDVG
                     DVALLLYTDASVIGQHLPIHLVTSLLPERIEPDNVLIYSNRPDTIGDWHIVDAFENST
                     TTTTITTTRRKQKHHSQASLSHHKSGHSSDNKFLPLLQHAGRNKPHAKWYIYMEDESY
                     IFLNNLLHHLSTFSWEEPWYIASSETSRRGFFALSRTAWEQVFGGEETETLQARFVSG
                     LDDRHVLDRVLKEDGVMFGSSDVAVARSEEFSQSQSHRASAINRENWCAPVYSWHGAS
                     GRDISRLHGLELNWHSISKRTLQYRDIYTHLIAHEMSHGRIDWALAAGEAHAAEYEIT
                     AATADDPAGMPQDVGSTAAWQQGWQSADACETACALWPACVQWSFVGVDDDDHQRCRV
                     DRQVVFTFVGDGLQSTSGWMASRIDEWAC"
     gene            <366913..>368337
                     /locus_tag="TRUGW13939_10467"
                     /db_xref="GeneID:55997947"
     mRNA            <366913..>368337
                     /locus_tag="TRUGW13939_10467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493579.1"
                     /db_xref="GeneID:55997947"
     CDS             366913..368337
                     /locus_tag="TRUGW13939_10467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349472.1"
                     /db_xref="GeneID:55997947"
                     /translation="MERAKWLDGLRGVAAAIVAFDHLVEGDVVHPFHSYWAYPPAKNH
                     YWLQLPPFRILFSVNAMAALFFVLSGYAIALNLLRARNNSQRRHHHQRQPSTTEEQGF
                     FARLSTAAARRVLRLFLPVLIVAVVSQFLYFVNLYRWQFDAAVTTERGIAPWTAPWRH
                     ICYLFSYLADVINPLSSLEKNLDTRGLNAQLWAIPATLRGSGLVYLLIVATAAWRPRP
                     RLVVLAALSVFFLAIGMWDIFTFIAGLGLAEFKVAEEAGGLDVDNEKSPSLLPSSSPS
                     SSPSLPSSHPTPNIPSQKYVQPLRIINLFFFVAGFYLLCLPDDHFIPGGYRFLIPLQP
                     SSWSATRESGFVAQYSWKSIGAVLTVFSISNSPALQHILSSSGVLQHLGKISFSLYLV
                     HQSVYQLLREPIKRHIWKTLADYQYPGGHLAERLPFAWAVTWIGTFLLLGPIVVYIAD
                     EFARYVETKCVTATKELERWLSRK"
     gene            complement(<368882..>372254)
                     /locus_tag="TRUGW13939_10468"
                     /db_xref="GeneID:55997948"
     mRNA            complement(join(<368882..369947,370010..370254,
                     370839..371140,371201..371268,371323..371383,
                     371446..371758,371824..371891,371948..371984,
                     372043..372189,372249..>372254))
                     /locus_tag="TRUGW13939_10468"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493580.1"
                     /db_xref="GeneID:55997948"
     CDS             complement(join(368882..369947,370010..370254,
                     370839..371140,371201..371268,371323..371383,
                     371446..371758,371824..371891,371948..371984,
                     372043..372189,372249..372254))
                     /locus_tag="TRUGW13939_10468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349473.1"
                     /db_xref="GeneID:55997948"
                     /translation="MTDKPTQVPAVLGVTCTFWSLAVIIVAVRVFVRTRLVKALGPDD
                     WWMLAAIVLSTFDQSCKIAWCFHGLGMHIEDVGAHDLDSFLMLSYIVPVQYPFALGFV
                     KMSILSFYLRVFPQKIFRHICFGVMGIVVASTVTVALGQAFACTPISDGWKAVPTGSC
                     VDREALQVAGSIINLITDVIVLVLPMKYFYSMALDKTKRYGIMALFSLGLITCVASAY
                     RLSTIPSFYASADKTWNSSSLCIWSCLEVNLSIITASIPSIKSLVSGYMRKSTASKPN
                     SYGTYGSTGRSKRTLGHEEDGWQLVNRENTANASKSDIDGKNSDIHIQSDIHVQSDER
                     VEEDFPSSTNTPVTRAFTERRHILGAVSQDKVRRDSTSSNGSILLANHRPNGDTTLDV
                     YYTLGAQVGNASANLVIDTYSADLVIDQEIYRNGTGEPYPTGFIFSVTYSNGWVFNGE
                     TMFWDTVGLYPSFNNRLSQGQNYTFYTPNQTVEVTDIKSYKQLANIPNPQGVIGLAFN
                     TSSGVIDLHNTTEKIPEPHSIIETIAPNLTDRVVGLALQRWGPPGMDIGWWDPSRMDR
                     DICWADSVYAFEAWMVHVESVLLGRNGTNFNGVAYTAVLDSKYPGLLLPLGIANAYFA
                     LVPGASQNVYPCGTTLPSLTVILKNDCVVSIPGEALKRLDLGDGKCMMAVESSGSGST
                     SLTLGIPFFNIMYTVLNYTDQTVGVGQHAGLQDTLDKVHQWETMSPLYRSPTLSPSSA
                     RPSSAASPSFKPSTTPTSQPASGTSPPIHT"
     gene            <374869..>375270
                     /locus_tag="TRUGW13939_10469"
                     /db_xref="GeneID:55997949"
     mRNA            <374869..>375270
                     /locus_tag="TRUGW13939_10469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493581.1"
                     /db_xref="GeneID:55997949"
     CDS             374869..375270
                     /locus_tag="TRUGW13939_10469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349474.1"
                     /db_xref="GeneID:55997949"
                     /translation="MAARIPRLARLLSLQNPIQHSFTRQDQTFLRKSIISSVSASPRI
                     KISPRSYSTQPPSSDKTTPKSSKNATEHNNNNDMPDVLSGLKSIKMSRATKLVVYTAL
                     TIMATVESVFWIKVLWAKFGPAQKELEDGQN"
     gene            complement(<375369..>376682)
                     /locus_tag="TRUGW13939_10470"
                     /db_xref="GeneID:55997950"
     mRNA            complement(join(<375369..376280,376336..376452,
                     376512..>376682))
                     /locus_tag="TRUGW13939_10470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493582.1"
                     /db_xref="GeneID:55997950"
     CDS             complement(join(375369..376280,376336..376452,
                     376512..376682))
                     /locus_tag="TRUGW13939_10470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349475.1"
                     /db_xref="GeneID:55997950"
                     /translation="MDISLQTHQSYIGKPVSALPTPALVLSKPVLERNVKRLHDDVEA
                     LGIGFRPHVKTLKTIEATRIMLANGKYRKIVASTLSEIRGCLPLVKEGILDECLYGLP
                     IRPSVLADLDAFTSQHNLKILLMVDHADHIRILEEFNTSTGRKAPWPVFIKVDVGTSR
                     AGIVNSSPRLDQVIRSANDSTAVSIYGFYCHAGHSYASKTTDQAVQVLQDELEGVLTA
                     AKKLVDRKTEDGELILSIGATPTAHVVANLKKSLPANANLELHAGNFPANDLQQVATG
                     LVAQDDQAVRVIAEVCSVYPERNEALINAGVIALTKETSLFAGLARWADDINWSIVRV
                     SQEHGIFSWVGEESKKEKAEDRFEVGQKVLLYTQHACITSAMYYVLYVVDEQDIIRET
                     WIPWKGW"
     gene            <377641..>381252
                     /locus_tag="TRUGW13939_10471"
                     /db_xref="GeneID:55997951"
     mRNA            join(<377641..377861,377913..378715,378760..378910,
                     378966..379530,379589..379793,380181..380739,
                     380793..>381252)
                     /locus_tag="TRUGW13939_10471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493583.1"
                     /db_xref="GeneID:55997951"
     CDS             join(377641..377861,377913..378715,378760..378910,
                     378966..379530,379589..379793,380181..380739,
                     380793..381252)
                     /locus_tag="TRUGW13939_10471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349476.1"
                     /db_xref="GeneID:55997951"
                     /translation="MDDAVNVPLPLRTASPEAQNQNQSLPYATSLHSFVNDDQSVDSE
                     NWQPEREQPPLRQQSNSYDDIYDRSNAASRASRGEIGLQEFPLPTSKPIPSHTSTVDL
                     GRTSRAESINKAATKNKTLSGEQVHPPVEQLRRQLAEYELPLLQQANPNDGTFWDPIK
                     EEDHPASFDLIAPIQESEAPLHSLEKQADLLFSTRHMLAILSNPQHLFKFREFLAAER
                     SDSLEILMYYLSACKALKAIEYSNAVSQLLTNLSEIESSDQEIPATKNNKLEQQAENA
                     LNALVKDELPAFITFNCVSLVSNVVEQRVKGTLPAKFEGTSDALAEVFCLTDPSRRDN
                     PIIFASEEFHRTTQYGMDYVLGRNCRFLQGPKTNKQSVRRIREAIEAGCQHSELFLNY
                     RRDGSPFMNLLMCAPLCDSKGRVRYFIGAQIDVSGLVMGDAGMDSMKDVAREESIKPD
                     GPEDVSANGVENSHFSGGVNGYHPYSVDGDNGHGHQFISDPLSTESVSPRKDGEARNN
                     LLEFIELLSPSELAMVREHGSSIFQPVVPRRERPYWGHVRPRIMLKQPKQAPNHAGPD
                     QMFKQPTLPGVYDNYLLVRPYPSLRILFTSPSLRIPGILQSPFFSRVGGSATVRDDLL
                     RSFMDGRSVTARIRWISKYDMHGRSQSPGNRQIPSFAMALFRPSSPEYLDDGTVVCSG
                     HLRVICDFCCTDYSPLDESPGDDSDPFAHSADEEQDEDGENSEDDDTESFDIPRPSYR
                     FRNRVRRGEGKVIAEKFIPPSDFAAAAKPQELFSPALGINSIPVVRRFINRRDATQVL
                     VFTDGACLNNGGTNPQAGCAFFFRPAQNGGEKEKGQRKKRDIPDQPPNTEGYVSFHLE
                     KKGPFGDPSLQTSNRAELRAVIAALRFRVWNGEGFRSIVIATDSEYVAEGATTWVRTW
                     LKNGWNGRAGPVKNKDLWQALLGEFERCHDNGLEVLFWRIPREQNTHADQWAKAGAGE
                     EDVKDEFTDIVGALV"
     gene            <382363..>386711
                     /locus_tag="TRUGW13939_10472"
                     /db_xref="GeneID:55997952"
     mRNA            join(<382363..384111,384180..>386711)
                     /locus_tag="TRUGW13939_10472"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493584.1"
                     /db_xref="GeneID:55997952"
     CDS             join(382363..384111,384180..386711)
                     /locus_tag="TRUGW13939_10472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349477.1"
                     /db_xref="GeneID:55997952"
                     /translation="MEPSPYNNSLATLPGGDQKSIGSSYSTTTVEQDTSKPTTRAGGP
                     KDPDSWPLKHKVEAIKERDVRSGFKPRELGVTWKDINVEVVGADSAINENAASQFNIP
                     KKVMESRRKRPLKTILNDSHGCVKPGEMLLVLGRPGSGCTTLLNILANRRKGYAGVSG
                     DVWYGSMTPEEAAHHRGQIVMNTEEELFFPTLTVGQTMDFATKLKVPHHLPNDVASKQ
                     DLRLETKDFLLESMGIQHTNDTMVGNEYVRGVSGGERKRVSIIETLATRGSVYCWDNS
                     TRGLDASTALSYTKAVRAMTDVLGLASIVTLYQAGNGIYDLFDKVLVLDAGKQVYYGP
                     MKEARPFMENLGFVCRDGSNVADYLTGVTVPTERLVREGYENRFPRNADMLLEEYKKS
                     PIYPRMTAEYDYPTSEEARERTRAFKESIAYEKHPQLPKSSPLTISFAAQVNAAVSRQ
                     YQIIWGDKATFLIKQISTLAQALIAGSLFYNAPDNSAGLFVKSGALFFSLLYNSLLAM
                     SEVTDSFTGRPVLIKHKSFAYYHPAAFCIAQITADIPILIFQISIFALVLYFMVGLTM
                     SAGAFFTYWVILFATTMCMTALFRAIGAAAATFDAASKVSGFVITASIMYVGYMIKKP
                     DMHPWFVWLYWIDPLAYGFEALLGNEYKGKILPCIANNLVPNGPGYLDPLHQSCAGVG
                     GAIQGEVTVTGEAYLRSMSYSESHIWRNFGILWAWWVLYVAITVICTTRWKASSENGP
                     SLLIPRENLHIVQEKLALDEETQSQGKTVATNSSSNSVTEKGDNDIDKNLIRNTSVFT
                     WKDLSYTVKTPTGDRVLLDNVQGWVKPGMLGALMGSSGAGKTTLLDVLAQRKTQGTIR
                     GSIMVDGRDLPVSFQRSAGYCEQLDVHEPFATVREALEFSALLRQSRDVSREEKLKYV
                     DVIINLLELHDIADTLIGKVGAGLSVEQRKRVTIGVELVAKPSILIFLDEPTSGLDGQ
                     SAYNTVRFLRKLADVGQAVLVTIHQPSAQLFAQFDTLLLLAKGGKTVYFGDIGDNGST
                     IKEYFGRYGAPCPAEANPAEHMIDVVSGELSQGRDWNKVWLESPEHEKTSKELDNIIA
                     DAAAKPPQTQDDGNEFAMTLWDQTKIVSNRMNVAMFRNTDYVNNKIMLHIFTALFNGF
                     SFWMIGDTIGDLQLRLFTVFNFIFVAPGVIAQLQPLFIERRDIYEARERKSKMYSWIA
                     FVTGLVVSELPYLCICAVLYFVCWYYTVGFPTDSNKSGAVFFVMLLYEFVYTGIGQFI
                     AAYAPNAVFATLANPVVIGTLVSFCGVLVPYTQIQAFWRYWMYYLNPFNYLMGSLLTF
                     TIWDAEVNCAEGEFAIFDPANGTCGEYLAPYQQGMGMLSHLVNPNDTSACKVCQYGSG
                     SDYLKTINLKEYYYGWRDAGIVAIFAVSSYALVYLLMKLRTKSSKKAE"
     gene            complement(<387300..>388137)
                     /locus_tag="TRUGW13939_10473"
                     /db_xref="GeneID:55997953"
     mRNA            complement(join(<387300..387818,387883..>388137))
                     /locus_tag="TRUGW13939_10473"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493585.1"
                     /db_xref="GeneID:55997953"
     CDS             complement(join(387300..387818,387883..388137))
                     /locus_tag="TRUGW13939_10473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349478.1"
                     /db_xref="GeneID:55997953"
                     /translation="MADAQRAVAAAFPPPPPFWKHFTTENIEKLDKLKTESAKSHAQD
                     SKKKWSPSELQALDAPTDLRYLIPPKAPTEGSYSVFGELQSLSSALPSLNDQGIDQLY
                     PDPPTSKDDQPAQPLNHAYYLLKISKSLLLNFLEFVGVLSVAPEQFETKLDDLRNLFI
                     NAHHLLNLYRPHQARESLILMMEEQLENTRSEIQEMDGIKNRVEKLLDQLAVEGREVE
                     ASVQPRSTKGGNNGSELDQKTIEEARQLWTLLKEEENES"
     gene            <388583..>389736
                     /locus_tag="TRUGW13939_10474"
                     /db_xref="GeneID:55997954"
     mRNA            join(<388583..388693,388759..388852,388913..389252,
                     389310..>389736)
                     /locus_tag="TRUGW13939_10474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493586.1"
                     /db_xref="GeneID:55997954"
     CDS             join(388583..388693,388759..388852,388913..389252,
                     389310..389736)
                     /locus_tag="TRUGW13939_10474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349479.1"
                     /db_xref="GeneID:55997954"
                     /translation="MSLAHQSGALGAPVRFFQRTYVAELVALGLVATAFTLIQIFVTP
                     FHRMFYIDDMSIQYPFTKFERVPLLWSIIYSAVFPVVCLIAWSIISRPSAYKFHITLL
                     ALISSLMTTPLITDIIKNTVGRPRPDLISRCRPQRGTPEHELLTISICTQTNEHLLQE
                     GWRSFPSGHSSFAFAGLGFLTLFLAGQLRVFRPRADLGRCLLAFAPTIGALMIAISRL
                     GDYRHDVWDVSAGSILGSCIAYFTYRRYYPALTDRQCDTPYDRADDASSYAAEGFSRL
                     PNDEERALGPQPPRKSMRESRDQEQRQGSWESPETIPLNEVVGSQSR"
     gene            complement(<389967..>390477)
                     /locus_tag="TRUGW13939_10475"
                     /db_xref="GeneID:55997955"
     mRNA            complement(join(<389967..390130,390201..390407,
                     390462..>390477))
                     /locus_tag="TRUGW13939_10475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493587.1"
                     /db_xref="GeneID:55997955"
     CDS             complement(join(389967..390130,390201..390407,
                     390462..390477))
                     /locus_tag="TRUGW13939_10475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349480.1"
                     /db_xref="GeneID:55997955"
                     /translation="MSVKNPDFPASAAFDAINEALADEAQRKDAIKQAAGVYAFTLTN
                     SAGKEASWHIDLKQSGKVGTGVAPAGGKADVTLVLGEDDFSSLVSGKANAQRLFMGGK
                     LKIKGNIMKATKLDPVLKKAQTKAKL"
     gene            complement(<391007..>392497)
                     /locus_tag="TRUGW13939_10476"
                     /db_xref="GeneID:55997956"
     mRNA            complement(<391007..>392497)
                     /locus_tag="TRUGW13939_10476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493588.1"
                     /db_xref="GeneID:55997956"
     CDS             complement(391007..392497)
                     /locus_tag="TRUGW13939_10476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349481.1"
                     /db_xref="GeneID:55997956"
                     /translation="MTSFASFWQTDLTRDALLDLLDKPDLANLRLVCRAFSPPAARFL
                     FRETEISFQSGTFTKPSRMAALERVGANIKTLAFRLSHNAETFLPPLVDPETGEEQVF
                     VYTPQHHQQQHHNHSHRVSSPTNEAKYGSWEMTDLLVKQYPPLFHAATNVPSFVRAFN
                     CMTGLRHLKIVCDGQPAHRYRRSVVDYALISLRIAVEQAPQLSDRLESLSLLQIHPGG
                     IMHLRPTVMGMGVSPNGRKRWARIRKLAIQMESFPYEGDEATTDQLKILHSYLQSFSN
                     VHSFAFRWTGEQKGPCPLSLVTEPAVCQPSVSQNACPKTYARNGLRALKFTHLRYLGL
                     ENVLLDAFQVSDFIAEHKDTLDEFDFEHVALRSGTWDDAFAPLQKAQGDGGMKKEGGK
                     EKHQTESMEVPFMLDPLDQTTSSSSSPPKKRQKKKKTKKRKRKANQPDINNSLFASTA
                     ALLWEDQEQSNPKLRALREGVSQLARSRARTDHMKKTLWTSMFCWR"
     gene            complement(<393749..>396250)
                     /locus_tag="TRUGW13939_10477"
                     /db_xref="GeneID:55997957"
     mRNA            complement(join(<393749..394223,394276..395455,
                     395513..395968,396040..>396250))
                     /locus_tag="TRUGW13939_10477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493589.1"
                     /db_xref="GeneID:55997957"
     CDS             complement(join(393749..394223,394276..395455,
                     395513..395968,396040..396250))
                     /locus_tag="TRUGW13939_10477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349482.1"
                     /db_xref="GeneID:55997957"
                     /translation="MRWVSILSTALLVAGASAVPHAGKHRRISSSSAASSDPSYWLAD
                     IKHQGNAPAAASGYKVFRNVLDYGATGDGTTDDTEAINKAISDGDRTGPAANQTTSTT
                     PAIVYFPAGTYSVSAPIVDFYFTQLIGNPNSPAILKATSSFTGMGLIDGDEYENGAEG
                     WISTNIFLRQVRNLVIDLTAIPGTTAATGIHWPSSQATSVENVVINVNADADSQHQGI
                     FIEDGSGGWMSDVTVNGGLYGMNIGNQQFTYRNITINNAATAISQIWDWGWTYIGLNI
                     QNCTTGISLQGGVNQTVGGLNVIDSTISNTKTFVNTSWTDTATPASAGNLILENVVLD
                     NVPTAVLGPSTTYLEGGSTTIASFGQGHKYTPTGPDTLKGTFAPVARPSGLVGGSGSN
                     YFTKGKPQYASTPVDSVVSIRDSGAKGDGTTDDTEAINTALKSAAGNGTIIFFDYGIY
                     KVTDTIYIPPGAKVVGESYPIIAASGDAFSDASNPYPVVQVGKSGDKGTIEWSDMRVG
                     TIGGTAGAVLIEWNLNGEQGSGMWDVHTQIGGWTGSELQVEQCPTSASPAAKCQAAFM
                     SLHITKDAQNFYSENDWFWTADHDVDDPTNTRVSIFTGRGVLVEGTNIAMWGTGSEHH
                     GLYQFQFDGATNVVGGYFQTESPYYQPSPDATSGPYTSDTKWNDPDFSTCLKGNCDAL
                     GLRIVDSSSLSLYGVGLYSFFNDYDTSCSDLGGSADCQSEVFRVDSGVSDLKVYGYNT
                     VGVTNMITVNGTSAAVYSDNLSVFPASIALFST"
     gene            complement(<398538..>399921)
                     /locus_tag="TRUGW13939_10478"
                     /db_xref="GeneID:55997958"
     mRNA            complement(join(<398538..398644,398699..399245,
                     399299..399612,399670..399718,399769..>399921))
                     /locus_tag="TRUGW13939_10478"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493590.1"
                     /db_xref="GeneID:55997958"
     CDS             complement(join(398538..398644,398699..399245,
                     399299..399612,399670..399718,399769..399921))
                     /locus_tag="TRUGW13939_10478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349483.1"
                     /db_xref="GeneID:55997958"
                     /translation="MADNSSERPSKRKCLGADCENDAGALACPTCLKLDIKDSYFCSQ
                     DCFKRNWNDHKAIHKTAQVNAQNGSGAYNPFPTYPFTGSVRPVYPLSPKRTIPKTIKH
                     PDWAETGIPKGEQRLSRTKIDILDAKGQEAMRKVCKLAREVLDITAAELKPGVTTDYL
                     DEVCHNACIERESYPSPLNYNRFPKSLCTSPNEVVCHGIPDQRVLLDGDIVNLDISLY
                     HGGYHADLNETYYVGDRAKADADSVTLVETTRECLNRAIDLVKPGTPIREFGKVIEKY
                     AKSKNCSVIATWGGHGINTEFHPPPWIPHYAKNRAVGVLKPGMTFTIEPILTLGKPRE
                     VYWPDNWTNVTVDGKRTAQFEHTLLVTETGVEVLTAANPDSPGGQIPMPAEANAA"
     gene            complement(<402443..>403578)
                     /locus_tag="TRUGW13939_10480"
                     /db_xref="GeneID:55997959"
     mRNA            complement(join(<402443..403375,403432..>403578))
                     /locus_tag="TRUGW13939_10480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493591.1"
                     /db_xref="GeneID:55997959"
     CDS             complement(join(402443..403375,403432..403578))
                     /locus_tag="TRUGW13939_10480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349484.1"
                     /db_xref="GeneID:55997959"
                     /translation="MPATTHPEYNDKTEAKEVAKAFSHIISGKTVVITGVNRGGIGFG
                     TAEAFASQAPAHLIVTGRTISKLQESIDALRVQFPGVDYRSLHIDLSDQHSVRTAAAE
                     LLSWTDIPTVDILVNSAGVSLFPERKLSADGIELTFATNHIGHFLFTSLIMPKIIAAA
                     EKNPKGSTRVINVSSGSPMVARMRWSDINFEQKSKDLPEAERPLPAIHKAWGLDNTED
                     VSYIPLEAYNVSKVANILFGIGINKRLYDKYGILSLGLHPGVIETELGRNASPEVTVW
                     IKGLKDKGYYTEKSLGAGASTSLVAALDPELGVGETRNGKENYGAYLADCQINEEAQP
                     LAVSSLEAEKLWELSQNLVKQKFDW"
     gene            <404670..>405860
                     /locus_tag="TRUGW13939_10481"
                     /db_xref="GeneID:55997960"
     mRNA            join(<404670..405378,405439..>405860)
                     /locus_tag="TRUGW13939_10481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493592.1"
                     /db_xref="GeneID:55997960"
     CDS             join(404670..405378,405439..405860)
                     /locus_tag="TRUGW13939_10481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349485.1"
                     /db_xref="GeneID:55997960"
                     /translation="MAGRFVLKWLSLALFHGLCVSAQDYPLPEPCTGPACIDINGLTY
                     QDFSVIRRESDGIYFRYSKSNETGQGLSVATAPALGGPWNYAFEILTELVNPMASDRA
                     ATNVWAPEVHFVDGTYYLFYSINTAPFNFDLCVATSPDMEPDNWTDHGSMNVPVSTTG
                     VDQATESYVRLDGNMLADSTDPSGVDGFHYMTFGSYQWGLYGFQVSDDLLTIKDGATV
                     DMVYLEQYNGGEYAGNKTEGPYLLTNNGYVYFFYSIGNCCAADDTSYNDSVYRVQVCR
                     KLVTDLPTGPYLDRDGADCLNGGVDRAGTTILASRDDGQVFAPGSIGILTDPDLGMVM
                     TYQYWNITQANQDADPKLDGLRFGYNLLSWDSDGWPMLVASS"
     gene            complement(<406217..>407212)
                     /locus_tag="TRUGW13939_10482"
                     /db_xref="GeneID:55997961"
     mRNA            complement(join(<406217..406410,406464..406565,
                     406631..406860,406926..>407212))
                     /locus_tag="TRUGW13939_10482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493593.1"
                     /db_xref="GeneID:55997961"
     CDS             complement(join(406217..406410,406464..406565,
                     406631..406860,406926..407212))
                     /locus_tag="TRUGW13939_10482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349486.1"
                     /db_xref="GeneID:55997961"
                     /translation="MSALRLQDKVAIVTGASSGLGRAISLRYAREGAKVVCADLSPTA
                     RSQVSEETEITTHDLITKNGGKAVFVQTDVGEAAQFEHLVQVAVDHFGRLDILVNNAG
                     LSVESRTPAVLHLTDEDTWDLTMRVNAKSVFLGCKYALAQMLKQSPHSSGDRGWIINM
                     SSIMGIVGGPENPSYCASKGAVSNLTKQVALDYAPHRIHVNAICPGYTQTAIFKETTT
                     YMTPWEVLERRHPFNGPGWPDDIARIAVVLASDDANWVTGILLPVDGGYTAR"
     gene            <407837..>409587
                     /locus_tag="TRUGW13939_10483"
                     /db_xref="GeneID:55997962"
     mRNA            join(<407837..407879,407935..408096,408157..408794,
                     408851..409114,409163..409324,409389..409475,
                     409531..>409587)
                     /locus_tag="TRUGW13939_10483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493594.1"
                     /db_xref="GeneID:55997962"
     CDS             join(407837..407879,407935..408096,408157..408794,
                     408851..409114,409163..409324,409389..409475,
                     409531..409587)
                     /locus_tag="TRUGW13939_10483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349487.1"
                     /db_xref="GeneID:55997962"
                     /translation="MGSKTYEGELHHEDANNSVPTKSNAVGGKPRGATLLEDGDGDFD
                     SGDDDDEDGDGKNPSMAGLTPAENDGLEKPKNKKKKKKRGGKKKKTGSGTSATQQSFP
                     PRVPLSQLFPDGKYPQGQIVEPKDDNLSRTTGEELRYLARGHIANDEVLNDYRKAAEI
                     HRQVRHWVHKSVKPGQSLTDIANGIEDGVRALLGHQGLEPGDSLKGGMGFPTGLALNS
                     CAAHFTPNPGQPDVILQQKDVMKVDFGVHVNGWIVDSAFTMTFDPVYDNLLAAVKDAT
                     NTGLKYSGVDARVSDISAAIQEAMESYEVEINKKVYPVKAIRNITGHNIKPYIIHGGK
                     SIPFVKTNDPTKMEEGEVFAIETFGTTGKGYLDDGAGVYGYGKNPDAPSMHLPLASAR
                     SLLKTINQNFGTIVFCRRYLDRLGLDKYLLGMNSLVSNGIVDMYHPLNDIKGSYTAQF
                     EHTILIKGSGNEIISRGDDY"
     gene            <410253..>410807
                     /locus_tag="TRUGW13939_10484"
                     /db_xref="GeneID:55997963"
     mRNA            <410253..>410807
                     /locus_tag="TRUGW13939_10484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493595.1"
                     /db_xref="GeneID:55997963"
     CDS             410253..410807
                     /locus_tag="TRUGW13939_10484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349488.1"
                     /db_xref="GeneID:55997963"
                     /translation="MTSTCQARSRDVTRFSPPFLPAKQVATGQKVNGKKKKSTFRSLR
                     STTWTKHRPVSAPGTIENRAHRFYFGRCIISVLFCRVSRFSLTPRPAAASRAVEALDR
                     AGPDSSVSSSRPRGFSKYLIWARFSIAFLLPTLFAPPHGVVTPALRERRDYPPSYRIS
                     CSLNPSQLAHSASQQRIRASKDHP"
     gene            <411436..>414900
                     /locus_tag="TRUGW13939_10485"
                     /db_xref="GeneID:55997964"
     mRNA            join(<411436..414310,414368..>414900)
                     /locus_tag="TRUGW13939_10485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493596.1"
                     /db_xref="GeneID:55997964"
     CDS             join(411436..414310,414368..414900)
                     /locus_tag="TRUGW13939_10485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349489.1"
                     /db_xref="GeneID:55997964"
                     /translation="MRRGPRLPGCRRIKELNRRRPKPAGGQSQPQVAFSFGDGTADTG
                     ISANPPAANGFSFGQSQSFPGAAPNATQNGSQPVAFGGGGSSSFNFGFGTSSAPSAGP
                     GPGPAVNNPFSNLNGGGTQSQNQTQTGGLFNFSGASTPASQPQGVFGTAPQTAPTQPF
                     GQLTNSSAPATAFQPQPATTGTSNLFGQSSTAPTSSSSSVFQSKPATTAPSLFGQSTP
                     ATTTGGPSLFGQSAAAPASTSSASQPQTTATTTSSLFGKSSSPAVDSGMFGKSFDTPN
                     QSSSTFQPKPAMGGSTLFGQSSTTAPPPSSSTFKPNESLFGRAAPPPSATAPSNSNIT
                     FNQTASGPFSAPNFFGSTTSTAAGANGANVFGQAQQSKAQSGSLFAPSTLGTTTQNAT
                     GAKSLFGFNNEPEDMSTSPDAKHKTNGQLSNASSAFNSSVKQPSATTASTFAPSSNAA
                     QPPGASNPFNLFGDAPKSTASTTPANPAPASNPFIGTGTSGFAQEKPYDSPASAAFGK
                     RGRGPLEAFKPQITAKSKTPAPALGPSPMKAAETNDRSRLSPDENRDFTKRAQIRDLN
                     RGFKELVDSFDPDTQNLDDVILFYLRVRKTMDAPLGSFTNKPGKRKLGQVADIHADNH
                     LSSKKAKESSMAHGATPDSQLSPPKNKRKVSDDEEDTSPSGKRRATGPVLDATQSIGS
                     GSTTAGIFANAFASGGSEDKEPATATPSFKPSVSAFGQPSPFGTAPSTSTASKETNLF
                     APKPKEGAQSVPKPAFEVPKFATSGESFVSQFGKKFGQPASKEAQEAIQGVKLDIPKF
                     NVSSTSNFISQFSQQAAGNDDDDDTSESEDEEPVAKKTTTTPAEPKPASSVFETKSSA
                     PSVGSNIFGHLSNSATNTEGDSSDDDLTEHLKKRASSSKQEAKAEAEEPSKGTLFDRI
                     RKIDGTPVQVSDEEKPEAPKPQLFGQPTSNPFSSLNTSSGPSLFAPKPSTPNPFGGLA
                     IPKPASHLLSATATPSVTSDSNADDTDTDTYKDTQLNLMSNAGEEGEDCIFNGRAKGL
                     KSVEAKVGEKSEKSWETQGVGALRILVNRDTKRARILLRAEPSGRAVLNTSINRAIDY
                     KIQGTSCQFLVPREDGSGMDLWTLRIKKEAAEELEAALKSAKEGLAT"
     gene            complement(<416499..>420483)
                     /locus_tag="TRUGW13939_10486"
                     /db_xref="GeneID:55997965"
     mRNA            complement(join(<416499..416705,416765..416839,
                     417192..417283,417662..418471,418673..418770,
                     418918..420302,420352..>420483))
                     /locus_tag="TRUGW13939_10486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493597.1"
                     /db_xref="GeneID:55997965"
     CDS             complement(join(416499..416705,416765..416839,
                     417192..417283,417662..418471,418673..418770,
                     418918..420302,420352..420483))
                     /locus_tag="TRUGW13939_10486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349490.1"
                     /db_xref="GeneID:55997965"
                     /translation="MSTHTRPSSPFTSEFDELVQSLLQEWHVPGLAIAVINGDSTFSK
                     GYGHAILPNTKVTPETVFFTASTTKSFTAASVSLLVDDAASHRLSRSVPPDFSLTSTV
                     SSVIPDDFALDDEYTTLNATFEDALSNRVGLPDHLYSFKPRTVPVKEVIQSLRYLPRA
                     AELRSQFFYSSYMFSAVSYAIEKMTGSGLGDFMRERLWGPLGMTRTYWTPQEAIEAAS
                     SGTVLARGYAWDSSSDKYVEEAIPDFPAVSGAGAMISNVLDYVKWLRCMMTQSPPLSH
                     ASHQMLIEPRIPFQNPGTIPFPAPHAYALGWRIDEYQGHRIIWHTGGWTGFGCTMMYL
                     PDLQWGLVMMSNMAVPSNFLQTVLYMHLLDELLNTPLGDQMDWNSEFKERRNRSRDGN
                     THALSRLYPDLPSTTSPPSLPLEAFAGQYQHAGYGEMLFELHGNELVAQRLAYEIPMV
                     VRMTHVHEDSWLAKLEIVNKDPQDQPAVRAEFQIADGVATRVGLDLEPALDGKKIWQA
                     PEKGRPRSATHDAASPTLNNFIETSNCQHSGADKAANLGHARTKVLEAAKAGASLVVL
                     PECFNSPYGTQYFPNYAETLLPSPPTKEQSPSYHALSDLAAEAKTYLVGGSIPELEPS
                     TQKYYNTSLVFSPTGALIGTHRKTHLFDIDIPGKITFKESEVLSAGNKVTIIDLPEYG
                     KIGLAICYDVRFPELAMVAARKGAFLLVYPGAFNMTTGPLHWSLLGRARAIDNQTYVA
                     MCSPARDLTATYHAWGHSFVANPNADIVGELEEKEDIVYADLDNETLASARKGIPVTT
                     QRRFDVYPDVTMSSTTKGKKSGRSAIADVVSREYTIHLHKRVHGVSFKKRAPRAIKEI
                     RAFTEQAMGTKDVRLDPQLNKKVWEAGIKGVPFRLRVRISRKRNDEEGAQEKLYSYVQ
                     AVNVKEAKGLNTTVVEDA"
     gene            complement(<420960..>422318)
                     /locus_tag="TRUGW13939_10487"
                     /db_xref="GeneID:55997966"
     mRNA            complement(<420960..>422318)
                     /locus_tag="TRUGW13939_10487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493598.1"
                     /db_xref="GeneID:55997966"
     CDS             complement(420960..422318)
                     /locus_tag="TRUGW13939_10487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349491.1"
                     /db_xref="GeneID:55997966"
                     /translation="MYPWHERLNAWANGTGIHIDALGLVTLLGAEDMDRIVGRLIPSP
                     YLDYLPLLGAFTVSASHFTRKQSGFILYSISDGMMTTELAGWFSRWLQTQEFDRVRSI
                     VTWQAGRQPPQLQRFFLGFLLIALPIHGMLIALTVLAADWWGLANVVSMIASVVVRCV
                     LVSEIQAGIDRSIRKSEEAAQKYNYPLKRAKYDEAKTKLENIRQMGQPTEGMKEPIAP
                     KDQYEIVKIIVVTDESKAVTIQAPRYLTKSVFAVSPEAPNPNTYRVFQAIGWVAFAVH
                     VISIGMAQLYTQIASVVLILGATILTAYKIGCEDSRPWQFIRRAIHEEDQGYSCRLTS
                     NLKATVSTYPADYCEWQETAEACDSFTAQEMDKNNAGLSRDSKRVTVNDVEKSQSPTR
                     PTTPGRQDLYAWLDLTEAEDKCLNIWGLIPHDPEWVDRYLEKKMFHRRRMERKNILET
                     ES"
     gene            <423564..>426284
                     /locus_tag="TRUGW13939_10488"
                     /db_xref="GeneID:55997967"
     mRNA            <423564..>426284
                     /locus_tag="TRUGW13939_10488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493599.1"
                     /db_xref="GeneID:55997967"
     CDS             423564..426284
                     /locus_tag="TRUGW13939_10488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349492.1"
                     /db_xref="GeneID:55997967"
                     /translation="MTLFHPSLEEKKEKALRKAKKNLKKQYDGGKHKVPFGRKFERPR
                     MDDRQREIRMIELEDGKGNYRKRVYRNPLGEKTSKHPDLDTYYSTTREIPRRLVVQAT
                     EAAMNEARNDPHPRYWRQTKINGRAPFLIRLAEFCWNPLGLLEADEIEESDDDDDDDD
                     NIYGKKKSEEKKPVAIRHLCMRILNWITSAFCILSFAWIIQFVLAAQIAATPWSDDDS
                     ADPYKEYDNVHWSWPQHAINRLDQAPDNPEHQSEIGRLSIPRLLRVKTSGKWKTKETR
                     YLHDKATRMLPEYVLLSFSRANFPGRSVAFFEEYFDRVADTILAQENKKREIEGKHRI
                     EAYWVDTHCVSKETEQKTTEDINTICDAVRCAKKVYIVLPAINTYELETWGQRIWTMP
                     EVLLAVGKIAYCTCSPDVEETGELNSEIHDVDLNEFYDSFWHDTRPTEKDDEDVVGLL
                     VKHYSGSLKLTDLQLFTCAVQALARRFTSERGKENPKTIEGYTTTDVAYAAMGLMAYR
                     ITPNKADDNFQAIARLSLVNDSNLLLERLVSLWPHQTGETTEQKNLVIDKNAAGSVDI
                     MRNIANRDQYSTYLWDIHPLCNVVGIADEKYTPAVILDQCRAIPIRWKGFPKMKYVQD
                     FNKLGATLSQTIVFWGSSLVALGFALFTSALSLEFSLLPYKNYNNNNSNNAQIPSVKM
                     YLVGSAVFFGCAWVISWLSPRAVRQLCHSGSAGISCHLVGFEGIQSLHDIETSIFGNC
                     DGRFSYAPSSNLFSEPLRAKHIRMGKEPKEGVDELKRIAKSLCKSPRDRLFTIVDTGD
                     LTVTVIAAERPPVVALICGREGGMLRALLCSWRFDNNCLYRESVVRMRSSLEDQTTPM
                     DWLKVSLASQGDVSREIVKHRIDEKRKQYSGPSPQIPLSTVKPHVSINGL"
     gene            complement(<426743..>428065)
                     /locus_tag="TRUGW13939_10489"
                     /db_xref="GeneID:55997968"
     mRNA            complement(<426743..>428065)
                     /locus_tag="TRUGW13939_10489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493600.1"
                     /db_xref="GeneID:55997968"
     CDS             complement(426743..428065)
                     /locus_tag="TRUGW13939_10489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349493.1"
                     /db_xref="GeneID:55997968"
                     /translation="MDSLRTACTDPESLFSLPVEGLLHLVHNAFPEDIDRLQRAYSIR
                     GSCWNPPATPSPSYILYGENYDEVNRTLIGFLALCWIHKGEYESFIGSHPSEARLTRA
                     SFEWIRSFYTQTVVTPNDLFTLIVSIIVNDLGKDPQLASDYHELTGEDISDLNHDAIL
                     LKACSAGLVKSLASLSIQDKNDVVRSLHLGASFNFGQLAQAENAPACLSGLLQMKGRP
                     RSFQLRFLEQLLDIAGAAGHMDWTCAKKLNQPIFDAYRNVYDACQGVITGSLDLRAAY
                     DLVLFRRVGLLESRGYRKLQVEENEDDRALTRLLCMGGVGDLETARLYENAWRHLEKP
                     IRDNLVHSLNVDGSKVEPAIQPTYMPALISRAKDEKSLTCVMVYLARVMSATNIAYSS
                     SAVVIERSVLGIMKKNVENGEFEQDPAVLEGVDVPPAAVALSEQDSWR"
     gene            <428970..>429701
                     /locus_tag="TRUGW13939_10490"
                     /db_xref="GeneID:55997969"
     mRNA            <428970..>429701
                     /locus_tag="TRUGW13939_10490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493601.1"
                     /db_xref="GeneID:55997969"
     CDS             428970..429701
                     /locus_tag="TRUGW13939_10490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349494.1"
                     /db_xref="GeneID:55997969"
                     /translation="MASLSSASASLKPPSATAPRQRVVSPSGAASGPPPPPRAPVSVH
                     PTTTVSETATFHGKYPVIIGSGTVIHPRARFYSFEGPIQIGDGCVIGEKCIIGDNEPT
                     ARGPASSEDQGITTRLSSSVTIGPQTTIRTGAYIRSAAAVDALAVVNRHATVGSHSKV
                     CSSCEIPEKTVLEDWTVFWATGQGIGHRKRRRLVGPAAIVTESGQQQRPNAKRVEDAR
                     LILLHKEREGLAKMISLSVSAGKRR"
     gene            complement(<430108..>436213)
                     /locus_tag="TRUGW13939_10491"
                     /db_xref="GeneID:55997970"
     mRNA            complement(join(<430108..435863,435922..>436213))
                     /locus_tag="TRUGW13939_10491"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493602.1"
                     /db_xref="GeneID:55997970"
     CDS             complement(join(430108..435863,435922..436213))
                     /locus_tag="TRUGW13939_10491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349495.1"
                     /db_xref="GeneID:55997970"
                     /translation="MAAATIEIPFLASHYGLSEASLTTLTQAPTVDLVNQLLESISTK
                     AREFDDLKSDKLRLEVELENSVRSSESKTKVLKTSVEKGLTEIHDLRTRLQESENNRS
                     NLESEISTIKSSTSSNESEANGLKSRITSLETSNRDTLSLLESKTSAYDKLSDELSAT
                     HQKTVDLRRQLSTVEQNLQAANSASASARFREQSLQQELDLTKKNNEYFETELQAKNA
                     EYLKFRKEKGARISELQREIEEASTTIDQLRRNENTLKSRLDDVEQKYEESIASMQSL
                     REEFTSTSESLRIELDSANRLAELQGNAATTAKQRVQECQLALEKARDDAAEEISRLR
                     VEGETEHSDKEAAERKIVELETRIGQLESQGPLSPAHLNGGPSTPLRPSTPAGTFSPR
                     TSKSRGGLTMTQLYSEYDRVRSQLIAEQRNNAELKATLDEMVQDLESSKPEIDDLRAD
                     HARLENAVMEMSNILETSGKERDEATREARKWRGQVEGLTKETEILRQQLRDLSAQIK
                     VLVLEVALSKEGQEYNREELEKIARNEVEESMSTLNSTGRFITQNLTTFKDLNELQEQ
                     NVTLRRMLRDLGDRMESQEAREREASYQQDQEELKELRIRVQTYRDEITNLTAQTKSY
                     VKERDTFRSMLMRRGQASADNSIFSQSVPLGSAPPTIPQQSADVTDYADLLRNVQAHF
                     DTFRQESATDHTALKQQVNDLSRKNSELMSDASRLNSQLGAAAQRAELLQNNFNMIRT
                     ENSELQKRYSTLMENVNRQEIKTQQAAEDLVAAKGLVDSLQRENANLKAEKDLWKNIE
                     KRLVDDNESLRNERGRLDSLNANLQNILNEREHTDAESRRRLQHNVESLESELQSTKR
                     KLNDEVEDTKRTTLRREYEHEQSQKRIDDLVTSLASVREELIGVKTTRDHLQSRVDEL
                     SVELKSAEERIEVLHSRSSATSAPATSTEAAPGGGEANGSGGLSREQELAIEVSELKR
                     DLELARTDLQHAKEQVEDYKAISQNTEERLQSVSETQDQYREETDQLVQEKDSKIQDL
                     EKRIEEISSELSTTNSELSRLRDEQSEVTRRFEEQKAGFESDIVRLKEEAERQLENAK
                     TYEQSVQAQAEIAQQAQQNYENELLKHAEAAKQLQTVRSEANELRLEIVGVRTQAENS
                     KKDLTQKEESWKEQKDRYEGEILELQKRRDEILHQNSLLHNQLENITKQISTLQKDRA
                     NMAAGEDESEGASSSLESLQEVIKYLRREKEIVEVQYHLSTQESKRLRQQLDYTQSQL
                     DDTRLKLEQQRRAAADSDHQSLSHNKLVETLNELNVFRESSVTLRNQARQAETALAEK
                     TARVDELAQQIEPLQNKVRELENLVETKEEEMKLVQDDRDRWQQRTETILQKYNRVDP
                     TEMEALKEKLDTLEKERDEATEVRNTLQTQVDGFSEQLVKAGEDAKAELRNKLTEQFK
                     ARSKDLSGRVKTKDIELKAVQQEKEVIQQELDSAREEINQLKSQSAEPSATPMQVEGE
                     TATPSVTQQLAPTPSAGDEEKVKALEEKVARLESALAEKEAQFDAKLKERSDKMKETF
                     NSKVAEIRNSHKQQIDTLKAQQSNEPAQPSEAPAPGTPAPGTPVPGTPAKTESGGPLP
                     ELTESQVKDLVANNEVIKGIIKRNIQTQVNKVKAQMQQQEAQIQAATGPSPEAVAELE
                     QKFAEERERLKRASDQATDEKVKSAVELNDKKSAVKISMLEQRAKVAMAKIVVVQKAA
                     SETPEKPVREVWEIAKDVKPPPATPAKPPVATPQKSTPATQGQAVQPVAPAAAAPPPA
                     TPAAPQTPTPNAAAPSPFAAIQQNQPVQQQPAPPNPFAAIQQNQTQPQTTPNPFAQSQ
                     QTTASSFAAIQQPQQQQQTAQTPQAQPNQPVPQNQPVALPGKPQPANNVGTGPAALKA
                     LQSGLPIPRGRGGPGADGQQQGQQQHGQNQSQRGSGLPRGGRGGRGRGNQRGGGQAAS
                     PQAHDGAGSNRGAMNANARQFIPQGNKRPREDAGEGGGDGDNNLGKRIRGGGHNRGG"
     gene            <436749..>437630
                     /locus_tag="TRUGW13939_10492"
                     /db_xref="GeneID:55997971"
     mRNA            <436749..>437630
                     /locus_tag="TRUGW13939_10492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493603.1"
                     /db_xref="GeneID:55997971"
     CDS             436749..437630
                     /locus_tag="TRUGW13939_10492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349496.1"
                     /db_xref="GeneID:55997971"
                     /translation="MSYLQQQINNFNASVVSSAGRLPQQKRVAATSLPGSSTPSHVAS
                     TPSTPGTASDHRRRHDANIVYSQPADTGTGKDIMTNVLYAIQKLKEKNAPLSFEDIVG
                     YLSLQERRHDQGYVRALRSILQVHEKINYDPNGDNGNGSFSFRPPHDIRTGEQLLQKL
                     QAQTTMSGISVKDLKEGWPDVEQAIDALEKDGKLLVTRNRKDNHPRMVWANDPSLVHH
                     FDDEFRHIWEKTKIPEQQRVVEELEKAGMIPANKNKVVKPRVKIEQKKTKKPRRTGKT
                     TNTHMMGILRDYSHMKR"
     gene            <438763..>439644
                     /locus_tag="TRUGW13939_10493"
                     /db_xref="GeneID:55997972"
     mRNA            <438763..>439644
                     /locus_tag="TRUGW13939_10493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493604.1"
                     /db_xref="GeneID:55997972"
     CDS             438763..439644
                     /locus_tag="TRUGW13939_10493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349497.1"
                     /db_xref="GeneID:55997972"
                     /translation="MLKVGQVNETDTALAYFITAVIAISLYNSIETVVIVLFVFKRYG
                     GTYFWSLLAACLGLFMMTFGYSTYFYDIVPNLFGQSAPTIVGWCIFMVAQSVVLWSRL
                     HLVLQNRKILRAVIVMICSTAIFLLIPTAVLAFGNDIRPPRQVFIRGYQIMENIQLTV
                     FTLQEAIISALYIWGTISILRYATEKSKRNLILQLLAINVVLILMDVTILVIQYCGYR
                     TLQINIKSLIYSLKLKLELAVLTRLVDYVKKDHSETSDFVNSVHSVHGALNVSHSKSA
                     TEEVEVPEEVVPRMVPE"
     gene            <439932..>440620
                     /locus_tag="TRUGW13939_10494"
                     /db_xref="GeneID:55997973"
     mRNA            join(<439932..440460,440511..>440620)
                     /locus_tag="TRUGW13939_10494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493605.1"
                     /db_xref="GeneID:55997973"
     CDS             join(439932..440460,440511..440620)
                     /locus_tag="TRUGW13939_10494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349498.1"
                     /db_xref="GeneID:55997973"
                     /translation="MMRIALFHLALDLLSPVASSILRPRDTAFTHRDESTAVYATGDT
                     YENFQPGYLGGTWELFKRGEYVDLSGTGYMRVRWEVEYWQGVGPLYEPTFDQVAGTLL
                     FVAGGGGFQWGDAYDGACSHGTGCVNRTGASEYGYSYFPDGSDPWINMCYYLDGSVTI
                     TNHESGGDYNVGVEPIAYADILVDINTTPADKNTKYGYSYDPSEASCPCSET"
     gene            complement(<441161..>441649)
                     /locus_tag="TRUGW13939_10495"
                     /db_xref="GeneID:55997974"
     mRNA            complement(join(<441161..441415,441464..>441649))
                     /locus_tag="TRUGW13939_10495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493606.1"
                     /db_xref="GeneID:55997974"
     CDS             complement(join(441161..441415,441464..441649))
                     /locus_tag="TRUGW13939_10495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349499.1"
                     /db_xref="GeneID:55997974"
                     /translation="MDSAAIRNLDITSNESRNSLKLLQDALQSAEIKHTEDNGNVHYL
                     DKSLDNKVLSLLKCLELTGLGYTAWKVVTRLPIRNKIGPEYIIPILSIPGTEPKLVPR
                     DRLHPETHIYHDKAVDIHLGSYLYHDGPVDLLPGLTCLFVGIPS"
     gene            <442222..>442725
                     /locus_tag="TRUGW13939_10496"
                     /db_xref="GeneID:55997975"
     mRNA            <442222..>442725
                     /locus_tag="TRUGW13939_10496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493607.1"
                     /db_xref="GeneID:55997975"
     CDS             442222..442725
                     /locus_tag="TRUGW13939_10496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349500.1"
                     /db_xref="GeneID:55997975"
                     /translation="MEDSKQQIREHIMDQIPDTIKNFLQTVDPAAIRILGDTPNSVLD
                     SRDYLGSIRPFVSAVERSLRQHRLDNQTSFLAVSIYPGRHSYFVLDLNNSDYVYETAH
                     NDMNPISVYVLRLSRNPKIFRKEALDKTLAETLAEMHNGHGYEPLPLFDDHNQIVQYH
                     NPRSLQS"
     gene            complement(<443430..>444243)
                     /locus_tag="TRUGW13939_10497"
                     /db_xref="GeneID:55997976"
     mRNA            complement(join(<443430..443862,444239..>444243))
                     /locus_tag="TRUGW13939_10497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493608.1"
                     /db_xref="GeneID:55997976"
     CDS             complement(join(443430..443862,444239..444243))
                     /locus_tag="TRUGW13939_10497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349501.1"
                     /db_xref="GeneID:55997976"
                     /translation="MGVGQEEACSPSREHWTISTTLSPALSSQLTAFSPRFDFRETKD
                     GYQLNGDLPGVEKKDIEIESSDQNTLNVKGHTEQSTSSEGDEGTEGSWWCAERSTGDF
                     RRSFSFPGPVDRDHVDATLKNGVLSINIPKAEKASTGKRTDVK"
     gene            complement(<445038..>445727)
                     /locus_tag="TRUGW13939_10498"
                     /db_xref="GeneID:55997977"
     mRNA            complement(<445038..>445727)
                     /locus_tag="TRUGW13939_10498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493609.1"
                     /db_xref="GeneID:55997977"
     CDS             complement(445038..445727)
                     /locus_tag="TRUGW13939_10498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349502.1"
                     /db_xref="GeneID:55997977"
                     /translation="MAQNAHIPEDLYHILLTTSHISKNPNNVVEKVRVLGSYTSLIAA
                     KAAAHSCLYDAGYEEEFFKTYEINPGRAEKEQNERDSGVIIHASAADGTIFRVRIKNS
                     PNEALALTSDLPDGRVSVPLYYVIQASVEYGGDDGSLVRDIDVEGAFASYAEARKFAS
                     TVLLSPEDGITKDSFAEYSEAGPDETDCGYGENVIVHAASEYGTNYLVNVVKTLELKA
                     VGVAEAAMRIR"
     gene            <446620..>449169
                     /locus_tag="TRUGW13939_10499"
                     /db_xref="GeneID:55997978"
     mRNA            join(<446620..446637,447029..447438,447488..447757,
                     447806..448285,448344..448453,448517..>449169)
                     /locus_tag="TRUGW13939_10499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493610.1"
                     /db_xref="GeneID:55997978"
     CDS             join(446620..446637,447029..447438,447488..447757,
                     447806..448285,448344..448453,448517..449169)
                     /locus_tag="TRUGW13939_10499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349503.1"
                     /db_xref="GeneID:55997978"
                     /translation="MPPAVEVVYAGVSELVVTDSIARFAIVVRNVSDLVSFFECQLAL
                     APSHDKSTAVPDLVLQKLIEYRNSYNKKFAAVALPRSLADQCPSLCLRLWKELDSVPY
                     VIAKEPHQRTRADQGELATFAGWEEKQIDEQADSLARKCIRSFGIGHVMPAAQLDLHG
                     MVTNFRVSFVDETDYQRTVGNRTWSLVQNYADDLRKRKVKVAFFSSTTHGRPDVSTRH
                     ALIRLAQCLGVDFQWYVPRPRPQLLDIIRRVQRILHCVEAPSQPLSADEELGILEWVY
                     KTAKRYWLTKGGPLLPASDGGADVVVISDAILSSLALIAKQSDPWRPVVFENRLHVHH
                     WAEDRDNDDNRRRWENQTLEFLRARLKHVDLLVSQEPKAFAPSLLPMKQVGYIPVAID
                     QIDGVNKPLQDWDISFYGRELNAICRSAGKPVLDYPYRRYFIHLVQLLPDEGTTRLLD
                     SYKAFYHQYRAENPNASVPYFLICHYSSTNTPDTDQVHANLLTHIQSHMPDLEGLISI
                     IRLRPPEQLWNSLVSQALAVVQLRDYEGIPEMLLGAVQKRTPVIVSREFAYYPFLQES
                     NGALVFEYNEGNSLSQYLLDVVKGETQTEKHAAAKTRLEDRATTVGNALCWFFLTSEL
                     SRGEKVEPAGEDIYVMAERKDL"
     gene            <449845..>451247
                     /locus_tag="TRUGW13939_10500"
                     /db_xref="GeneID:55997979"
     mRNA            join(<449845..451057,451117..>451247)
                     /locus_tag="TRUGW13939_10500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493611.1"
                     /db_xref="GeneID:55997979"
     CDS             join(449845..451057,451117..451247)
                     /locus_tag="TRUGW13939_10500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349504.1"
                     /db_xref="GeneID:55997979"
                     /translation="MVRVASIHQAATVVRFASHHEIPFTTRGGGYSTSGASITYGGIV
                     LDLSKLRAVHVFPDSQTVTVEGGAVWADVDVAAAQHQLIVVGSTLNQIGVAGATLGGG
                     YGWLTGQYGLVIDNLLWAKMILADGSIVTASETAHRDLFWGVRGAGQCFGVAVELGFR
                     AHRQENHVFAGTLCFSPDKLPQIVAFANHFETVTDGKQGFWFGFTMQDSMAQCSILVV
                     LFYNGSESEARQFFSPVLSLEPAMDRTQMLPYDGLNEILNTTDVTTRRDRLSKIDITY
                     PDKSVGFRKSLRGSNITLPLDVDFVRLIYDEFNAVLTDHPQARDSRILFELLPNRQIT
                     KVANSATAFASRGPYYNVSSLFEWTEAHLDNEIRSLQQSLMDRIGRCAGITRQPGYNP
                     STHGTGLYANYAGRDVPVGEIFGDNLSRLRRLKEKYDAHNIFRKWHNLNKHDPPA"
     gene            <452244..>453047
                     /locus_tag="TRUGW13939_10501"
                     /db_xref="GeneID:55997980"
     mRNA            <452244..>453047
                     /locus_tag="TRUGW13939_10501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493612.1"
                     /db_xref="GeneID:55997980"
     CDS             452244..453047
                     /locus_tag="TRUGW13939_10501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349505.1"
                     /db_xref="GeneID:55997980"
                     /translation="MDVIQFSEYFGDENDDVAFQYTQVIFQHDNQIYHGLSKKRYGSK
                     LDINDHDLYDTTRIPVEELKPKFENTFTKACDYSEPVQWYIKRQCLSHYDPQHPDRLK
                     YQTLQEVKMCEILRANPHPNIAVYHGCEVMDGQIRGLCFTKYSQTLMEKVNGAKYNKQ
                     SFALKTVGNIPAEANQWLDDIGCGIRHLHSLGLIHNDINPSNIMFDGDHPVIIDFGSC
                     TPDGHNLNEIGRTYEWHDGKIMEAKRSNDLDALEEIRLWLKGDVDSFKH"
     gene            complement(<453377..>454278)
                     /locus_tag="TRUGW13939_10502"
                     /db_xref="GeneID:55997981"
     mRNA            complement(join(<453377..453902,453976..454117,
                     454215..>454278))
                     /locus_tag="TRUGW13939_10502"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493613.1"
                     /db_xref="GeneID:55997981"
     CDS             complement(join(453377..453902,453976..454117,
                     454215..454278))
                     /locus_tag="TRUGW13939_10502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349506.1"
                     /db_xref="GeneID:55997981"
                     /translation="MPSTTDGNLQFDSVEDVVAAFKSLTVSVTENGQFVIILDSQDRE
                     NEGDLIIAADAVTDAQMAFLVRYSSGYVCAPILPSHADKLQLPQMVINNADPLITAYT
                     ISIDSNDASVTTGISAHDRALTCRRLADPAIKPDNFRRPGHILPLRARAGGVRERRGH
                     TEAAIDLCRLAGRAPAGVIGELVEEGDVVDGVAEVTGNNDMMRRDSCLRFGHRFGIKV
                     TTIEDMVAYLTKVDPSGDLASANGH"
     gene            complement(<455068..>457141)
                     /locus_tag="TRUGW13939_10503"
                     /db_xref="GeneID:55997982"
     mRNA            complement(join(<455068..457034,457099..>457141))
                     /locus_tag="TRUGW13939_10503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493614.1"
                     /db_xref="GeneID:55997982"
     CDS             complement(join(455068..457034,457099..457141))
                     /locus_tag="TRUGW13939_10503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349507.1"
                     /db_xref="GeneID:55997982"
                     /translation="MDSLPVEILTKIIDYLTPREQVQLQLVSRRFFELSRDNYLWRLH
                     CYEGSWNGRQDAFRARNQTAGLSQASTTTLSSLGPDSLRTLIYPLTSSNDAAEDEFTE
                     PSMGQRSRAAAEWDPSYESEDVDWYSEYIARSAPLSFSWLQRPATHPEKDTTRDVKGM
                     GLLRDWSFAREDKVVAPLEDGTVCVWDLNHSHSAFSRVTKGRISGTSQPGILFADLSK
                     RGENSQPRGPPLEFLGVGECMSVDSVRKRAYVCVGNILNEVDLETLRVVHQERYAWSI
                     FALSQETDYSVPITLATTLSLQIYDARLSTPDEEAEISFRCEKHPAEDFLPNSNLYSH
                     PDSQILRLLPNGQPPQRIRSPEPNDRGANYAPLFQPGPLSILHPPTPHVNTILLAGRF
                     PSILCYDRRTFPKLQQPIHSGGRLCGLTSIPPPSFPVCSDSSWPNKHTIVACGDYNGR
                     GSLELHDLDFKGTDPQDRDAESTMHTARYRNRQSAASSKLLSVASHGARIVFSDANGN
                     IKWVERDGRTEVRRWNINTDRQQSPVAASSDDNSVDGIISPSGMFLTSEASTRNAVAR
                     KILPTDANLDGDELLLWTGDRIGRLRFSPDPDGATDDEDEDGNDDAEDDIPADDSDLD
                     PAQRQARRNSRQALRRREKEYARMMRLALERQADEVRWMGRLGMA"
     gene            complement(<457562..>459220)
                     /locus_tag="TRUGW13939_10504"
                     /db_xref="GeneID:55997983"
     mRNA            complement(join(<457562..459077,459135..>459220))
                     /locus_tag="TRUGW13939_10504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493615.1"
                     /db_xref="GeneID:55997983"
     CDS             complement(join(457562..459077,459135..459220))
                     /locus_tag="TRUGW13939_10504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349508.1"
                     /db_xref="GeneID:55997983"
                     /translation="MQHSQLAPLPTELPFRIVSKTIGQGAYACIKKASPLQDENPVFA
                     VKFIHKEYAQRHGKIGARQLQMEVTVHKHIGDHNNIISFFHTGEDATWRWIAMELAEG
                     GDLFDKIEADEGVGEHIAHLYFTQLISAVSYMHSRGVGHRDIKPENILLSDDGNLKIA
                     DFGLATVFEYNGKMKMCTTLCGSPPYIAPEVIGCSTRGQTKGPGYRADSADIWSCGVV
                     LFVLLAGNTPWDSPTENSYEYSEYVEKNARTTDELWQRLPPTVLSLLRGMMKVDVNSR
                     FTMEDVRRHPWFTQPNKYLSTEGKLRDQVNLATSMFESLRIDFSQDPIAQSQRSRQRA
                     SSSAMEIDSSDGLEARLSSTQPEMPTDNLTVDWDAPLGNAFSATQPIDYGISTTQDFL
                     MADRLEDEPAMSQFSQNPSVPISRTQNAQKFRDIIPSRSLNRFYSTWALKLLVPFLSE
                     ALHRLGVPVPAHLPGSDSVGPIAIRVATKDQRLCLLQGTIIVECVSDGLFEAEFTKVK
                     GDPLEWRRFFKKVAVLCKDAVYKPD"
     gene            <459736..>460395
                     /locus_tag="TRUGW13939_10505"
                     /db_xref="GeneID:55997984"
     mRNA            join(<459736..459842,459907..460239,460290..>460395)
                     /locus_tag="TRUGW13939_10505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493616.1"
                     /db_xref="GeneID:55997984"
     CDS             join(459736..459842,459907..460239,460290..460395)
                     /locus_tag="TRUGW13939_10505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349509.1"
                     /db_xref="GeneID:55997984"
                     /translation="MDYSMEDTQNAAPQAREASKLGAPAPRNDTQSVTKRLQSELVQL
                     MLSPSPGISAFPNADGNMLSWIATIDGPTETPYENLTFKLSFAFPNNYPYAPPTVLFK
                     TPIYHPNVDFSGRICLDILKDKWSAVYNVQSVLLSLQSLLGEPNNASPLNGEAAELWD
                     KNFEEFKRKVLARHRDIDDDE"
     gene            <461193..>462271
                     /locus_tag="TRUGW13939_10506"
                     /db_xref="GeneID:55997985"
     mRNA            join(<461193..461591,461651..461750,461805..>462271)
                     /locus_tag="TRUGW13939_10506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493617.1"
                     /db_xref="GeneID:55997985"
     CDS             join(461193..461591,461651..461750,461805..462271)
                     /locus_tag="TRUGW13939_10506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349510.1"
                     /db_xref="GeneID:55997985"
                     /translation="MSSLDPTFSSYTKPQAQKYAQARLSYPSQLYETIITHHTQTGGR
                     LDTLVDVGCGPGNATRDLALSFEYAFGLDPGTEMIISARQRGGRTRSGNEARFAVAPA
                     EECVGVVAEMTRAGGVEGGDGKVDLLTAAMAAHWFDMPKFWTNAAEMVKPGGTVALWT
                     CASLYCHPSTPNAAAVQAALFRLEREILAPYELPSNRLSRDLYDKLVLPWDVPRNNEA
                     VFPASEFVRMEWDRDGVLSDGKEFFGGESKRITLADLAKSLDTASMVTRWREAHPELV
                     GTDKDCVRETIDEVRRSLGESGEIGNEDVSIKVGSGTVLLLFKRR"
     gene            complement(<462328..>464629)
                     /locus_tag="TRUGW13939_10507"
                     /db_xref="GeneID:55997986"
     mRNA            complement(join(<462328..462542,462596..463043,
                     463097..463589,463656..463864,464012..>464629))
                     /locus_tag="TRUGW13939_10507"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493618.1"
                     /db_xref="GeneID:55997986"
     CDS             complement(join(462328..462542,462596..463043,
                     463097..463589,463656..463864,464012..464629))
                     /locus_tag="TRUGW13939_10507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349511.1"
                     /db_xref="GeneID:55997986"
                     /translation="MSGSQSKSWILTASVIFHFQILTISLQCDGQQPECGRCKGYGFT
                     CTWLSSRKRNHNTSTGGRAQRAETDVEHDGHRACSYIVKSYEALIRSFQSKLDQGDQV
                     ALDLTLTSIRQRLPDELGDQAQRVESSEQPESPSEERSPTYVGRASDLYFFKTIESCM
                     GGDDLSKQYYDQTDIPENTTILGRPLLCTSQEEGSRYLDIYFSTIQMLTALDFIFAIG
                     SYYLSFPHDDHPSSQSHFQYFEQAVYFSNELMAQCSLVNVWASLLRCFFLLAICQTDR
                     CWNTLGFAVRMGQSIGLHVETSPPRRGLSVSIDTECELRRRTWYSMYVLDRLLALQLG
                     RPMAIRQADFHVALPSRENMDADSDDNMVGNLIMDYFLHVIQFSSIVEDVIQELYQPI
                     QPEISADQLLLNASAIDSSLLRWRSSLPHHLRFDLGHTFERSVVFQRQRNMLAVKFHH
                     LRALIHRPFLALPRLPHHSDAFMASLRSYRTEIQEAEKKCISAAQQTARLLHNVADER
                     SLVQDFPWWQMISCLICAGSILFVADVFCDANERSNEFSGYLNEDANTCLKVFQALSV
                     QSPAAKQAVGMLQNLAHLRSVSGVTPRAPDSSIPLGTHTEALSAMSMGSLALDFPPDS
                     LADLDFEWPSEISNSMEWSIQVLDKANNVVNPRADK"
     gene            <465134..>466097
                     /locus_tag="TRUGW13939_10508"
                     /db_xref="GeneID:55997987"
     mRNA            join(<465134..465325,465392..465433,465567..465910,
                     465971..>466097)
                     /locus_tag="TRUGW13939_10508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493619.1"
                     /db_xref="GeneID:55997987"
     CDS             join(465134..465325,465392..465433,465567..465910,
                     465971..466097)
                     /locus_tag="TRUGW13939_10508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349512.1"
                     /db_xref="GeneID:55997987"
                     /translation="MSPSPKYQTQVSGSVENGDFQLSFAADNGSPISPWHDIPLMADS
                     TERIFHMVVEIPRGSRPKMEIAKEVPGNPIKQDMTWEDPSTIDSETNANGDDDPLDVC
                     EIGSRVSTVGEVKRVKVLGAFVIIDQGETDWKVVAVDVEDPLATKLNDISDVEANTPG
                     FMASLKNWFCMYKVPEGKKANTLPLGQTDKTQSYALDLIDRCHNEWHSCRRRLLERSH
                     KSESKPDVDISEESSA"
     gene            <467656..>468528
                     /locus_tag="TRUGW13939_10509"
                     /db_xref="GeneID:55997988"
     mRNA            join(<467656..467831,467901..468137,468199..468420,
                     468468..>468528)
                     /locus_tag="TRUGW13939_10509"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493620.1"
                     /db_xref="GeneID:55997988"
     CDS             join(467656..467831,467901..468137,468199..468420,
                     468468..468528)
                     /locus_tag="TRUGW13939_10509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349513.1"
                     /db_xref="GeneID:55997988"
                     /translation="MSVRVFLIRHGETEWSAAQKHTGSTDLPLTEKGENEIKKARASF
                     VGTVKLIDPASIRRVYCSPRTRALQTAEILFPNITSKSQQSNGPKLEVAPCLQEWDYG
                     DYEGLTRDQVFQARSDQGVENYRDWNIWRDGCAGGESPVDVSLRLGNFISRLKNEIEK
                     EIKENPNQNRPGDIVCVAHGHILSSLAMVWAKIPLGNGVRLLLETAGVATLGFEHDDV
                     NEPAIFIGVRPRS"
     gene            <469002..>470525
                     /locus_tag="TRUGW13939_10510"
                     /db_xref="GeneID:55997989"
     mRNA            join(<469002..469101,469153..469445,469502..469736,
                     469801..470251,470300..>470525)
                     /locus_tag="TRUGW13939_10510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493621.1"
                     /db_xref="GeneID:55997989"
     CDS             join(469002..469101,469153..469445,469502..469736,
                     469801..470251,470300..470525)
                     /locus_tag="TRUGW13939_10510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349514.1"
                     /db_xref="GeneID:55997989"
                     /translation="MQNDSGIVRSVAASQRLDSRGKPTVKVTITTEKGNFTALVPSGA
                     SVGAYEAHELRDEDARQYGGNSVLKAVHNVENIIGPELVKQRFNTRDLREIDKFMIHL
                     DGSHDKKRLGANAILGVSMACARAGAAETGVPLYEFLRQTAEITGPYILPTPFFNVLN
                     GGRHFGNEIVFQEFMIAPTAAQSITEAIQWGSEVYQSLKGVITEKFGSSAIGIGDEGG
                     FVPPITQPTEALDLLMTAIKKAGHEGKIKFAIDPAASEFFKSGKYDLGMKAHKPNALS
                     ADELQELYKSLLDQYPIILLEDPFAEDDWEAWKSFHQNYSVELVGDDLLATNIERIDL
                     AHAQKACNSLLLKINQVGTITEALDAARKAQSYGWSVFVSHRSGETTDDFIADLTVAI
                     SVGHLKSGSPCRGERVAKYNRLMDIEEELKGSRCEFQYAGLP"
     gene            complement(<470730..>471095)
                     /locus_tag="TRUGW13939_10511"
                     /db_xref="GeneID:55997990"
     mRNA            complement(<470730..>471095)
                     /locus_tag="TRUGW13939_10511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493622.1"
                     /db_xref="GeneID:55997990"
     CDS             complement(470730..471095)
                     /locus_tag="TRUGW13939_10511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349515.1"
                     /db_xref="GeneID:55997990"
                     /translation="MKKHENKNKTSTFCAVRYLDKKYSRNLNLPSSVLVADPPFIVHP
                     EGDDDPFKVTWVFAQDTAAQPVEPGRILATSHDLEKPHEIGPCAFILVKLIYHDRLVW
                     SGFDKTRGLGSPRGVQYTS"
     gene            complement(<472071..>474081)
                     /locus_tag="TRUGW13939_10512"
                     /db_xref="GeneID:55997991"
     mRNA            complement(join(<472071..472331,472392..473652,
                     473744..>474081))
                     /locus_tag="TRUGW13939_10512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493623.1"
                     /db_xref="GeneID:55997991"
     CDS             complement(join(472071..472331,472392..473652,
                     473744..474081))
                     /locus_tag="TRUGW13939_10512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349516.1"
                     /db_xref="GeneID:55997991"
                     /translation="MSVAENTAADDGLEHQPQPPRDPALDPANEHHHAHHHHTAFAEK
                     GLEDQVVYSVDVKGPDPNSLDHSFPDKNSKDISDVEDLGEGHAKRPWQRRMLKQWRHA
                     AHIFVWLLFTGWWIAGLILHRHDLGWLIPFLLYLAITLRIIFFYVPITIVTVPMRWVW
                     DHTALVVVPLIPQKLRFPAAGLLVVSVIIIGSFASPESPQNTRVDRVVSLVGLGVLIA
                     VLWATSRNRKMINWQAVIVGMLVQFLVALFVLRTGAGYDIFNFISGLATDLLGFATQG
                     VEFLTENPVPASISSWFLVTVIPAIIFFVSFVQLLYHFGILQWFIGKFASFFFFTMKV
                     SGAEAVVAAASPFIGQGESAMLIRPFIAHLTLAEIHQAMCSGFATIAGSVLIAYISLG
                     VNPQALVSSCVMSIPASLAVSKLRWPETEETLTSGRVVIPEDDEGHHSANALEAFTNG
                     AWLGLKIAGMIGATLLCIISLIGLINGLLTWWGHYLNINKDDGLTLQMILGYVCYPIA
                     FLLGVSREGNDIYHVAQLIGLKIIANEFVAYKALVTDPAYADLSSRSRLIVTYALCGF
                     ANIGSLGNQIGVLAQIAPGRSSDIARVAVSALITGALSTFTSASMAGLVIIDE"
     gene            <477039..>478070
                     /locus_tag="TRUGW13939_10513"
                     /db_xref="GeneID:55997992"
     mRNA            <477039..>478070
                     /locus_tag="TRUGW13939_10513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493624.1"
                     /db_xref="GeneID:55997992"
     CDS             477039..478070
                     /locus_tag="TRUGW13939_10513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349517.1"
                     /db_xref="GeneID:55997992"
                     /translation="MFENFSFPSPSNGMDGDDRLMLECDSTMISPLSSRSPSPSCISR
                     RPHPLSRPRSPYIRSRPQAPTSMPTNYEAFPRRISVGTLTAKLNAHTLDQTATVTRPA
                     AVYEQPPSSPLSPTSTSFSTGSESISTRGSSAYTLLTSPGDYEDDEFDEPMSLHWERA
                     SHSSGRFPSPTSVPSQNPDFLLPEGNRQPCMRSQRQRLYRAQYSIDAVRLALMAEASS
                     RRTSDSSEALPGDDCHPSSLPPDVSPARRVSSHRHHHRSTRGVSPSLLGGSGSGLRSR
                     ERTPPEQGMRRRSTSATTFASATRIAKPRARDLHTKKSEQTLRRKSLVSAALSSMMYN
                     TPSPEPSSP"
     gene            complement(<478733..>481754)
                     /locus_tag="TRUGW13939_10514"
                     /db_xref="GeneID:55997993"
     mRNA            complement(join(<478733..478863,478909..479383,
                     479693..481090,481365..>481754))
                     /locus_tag="TRUGW13939_10514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493625.1"
                     /db_xref="GeneID:55997993"
     CDS             complement(join(<478733..478863,478909..479383,
                     479693..481090,481365..481754))
                     /locus_tag="TRUGW13939_10514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349518.1"
                     /db_xref="GeneID:55997993"
                     /translation="MAQPLMYGLAIEANLPNGQLSLHNYRKFLSQSNDIITIPAEASR
                     RTLKRKPATINLHQAKIHKQPQHDFLLYSPVSSAPSSPPPLSFCQSVVTLHGDLPTPV
                     SPSPLPSSTIRSLSRPSSVARSSASQRIESFSSRIKQSKNESTISYAHHRASSDSMLG
                     MENSHPTINHNGASFQILNPHKSLEGSRIVPPSVRSSTQSGLAEMLQIDQEKPYLARE
                     QSLLDGFVRPLSASESDILSRAPMKPAPPIPAEETNSDSSFVALPSIKDEPMSSRPET
                     PQLPERAPTRTLRQKVSHFFGSAEKRGDVDSQNSGKRSSNVSTLYAGSHQPSIAARKS
                     IDSSSDDDEECTIDEAPITPLSLEVPRYLFGEDDFLSFSEENGVGEKHGAVESEPSIP
                     GDLRRVSSLDSETPGSKLAAAQWHDQAVEQDEQQEDTLPAACNDDGQTKNTVCTRPWR
                     RPVYGSHSSNRHQTLHDALSQLNTNRQSGVTYEDITEFLRSQAGEVDCESQTHDGVEK
                     PWQPETWHELETFSRPLCSRASDGELSTTAPSTRPSIRPYARQAAAFIAGDGLDNASV
                     TSFGTAIDDVEDNETEKRAEFAMEEAIEEAAAKLPSSRKSTMRRAISHRARPLSSNPP
                     ELDIPIFLAESRSSSSLSPSCQNVQSPKADDTAAGGNNGSSANSPSAETVASATRVPA
                     PAPTVSLSPGPQIAAGTGLNCHLGVPEDLVHGAADPGSKATLLRGSAPLTGVRGSGGK
                     MKKATKKHQQKDKRVYTRHNFSRPVLTETIVDTSFWMLLLLSGEVKEKVLRTRRGEKS
                     "
     gene            complement(<484272..>490862)
                     /locus_tag="TRUGW13939_10515"
                     /db_xref="GeneID:55997994"
     mRNA            complement(join(<484272..484289,484340..485284,
                     485352..490640,490701..>490862))
                     /locus_tag="TRUGW13939_10515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493626.1"
                     /db_xref="GeneID:55997994"
     CDS             complement(join(484272..484289,484340..485284,
                     485352..490640,490701..490862))
                     /locus_tag="TRUGW13939_10515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349519.1"
                     /db_xref="GeneID:55997994"
                     /translation="MAFFLPWFVQKRLLRYALTRIDLLDLDSADLDGLGFRWGQKSSM
                     QLQDIDLKVEKIASLLRLPQTCQLLKARVSLLRLNIPADLYNDGVVVEIEGIDIHLRL
                     LSDDSLEASRNFNHPTEKPPSEDNILPTTDDLAESFLKSEPKEEREELEAAISSQSQY
                     LQQSTTSLSDDGDVGIGNEGLSLPSFISSFIQGITDRLQVKVNGINIRIAMDLPQDGP
                     VKRAPENKPDQVTALLVIREISATGLLSNSDDEDSATNQRGRTITVDNLHAMLVSDPV
                     VFSNYSRFGAAPSSPSTTHSKTDQESIRTELPSPSQTSSTSDSTLDLSRSVVWNRSQV
                     TERSTFLENRNMESSTHTLEGRFSDAGSEAEYDPRSYLVDQSTSGSRYDDVNEEIYDN
                     PAYLDEVFHSQYLDGVEDSGILPPRSMEEGAGTPRPHSPQLDSPVSAETWHDFDQPQL
                     PVEHEDHNLASSYLHDDTSEDTSRTIFHELPPSQAADTSYYAASFEGLGAVHSDNNND
                     ENVISSRTSSSSGSQTGDLSESKLFTHEEASSMYMSAISHGSEDYSPAMPGAWDSSSF
                     REESTSLPTRSRVISGSEIDDDSDTKTSTPKLTVHTGDSTLDQDKDGPGDYSTSTHAS
                     IHRDRSQTPSDATSENIEVARKVLEVDRITIWIPVGNINGEPERHQEPEEDHQGSTNT
                     KFSTNPSHSTMGDSLGASKLAFSTRSRWDSLMSPVSHEEAEQAAADKPQGTDQTRPKN
                     SAPDISVDINNAVILFDIATGWLLIKAGQKMASVSEGIMAEFNSTNTPKSSAPSSQSL
                     NFSLQTCSIKFLQHLTGIPYHGRHGTDFSHPGLSPVQDVILQVSIAGAKSTLGLRTDT
                     AEFQLKIAKFVLGYASEDLISFNEGLKMRESVRDILAPVHNDLSLSITKTTGSARIDL
                     STLPIHLNFNIQRLEELLGWFGGLSTILELGGSIASVSTVREEKPQKPVKSSPGVRFA
                     GIPPTEPASVSTSSTSTPWKVNARLGGVLVDLIGETCALELRTTAVKVVSRFEGIGIQ
                     IDKGELSGPYLIDDSNDAPAKVTLGNIRVEYLFSPREVDLDRLLSLLTPSQDKYEEDD
                     DIMLDTLLRQRRQGGVLRVTITTLNLLISDLHGLHPLSSLPNEVSKLSNVAKYLPEDD
                     RPGIMTLALIREFESQIRVGGKIGDLNVISQDMEAAHIGLPSLVAGQVKRLSVNRNGT
                     EELIGEALEKPPVAGPARPSVPMIMTRFLADEMEPTVKVKLCNLRVEYMVSAVMAFMG
                     LGDETTSEDLAVNLANSVANLTELQTSLHQAMSPSASVVYKPETKPYKLAVSLRDCVI
                     GLNPRDMPAKGLVVFAFAKLRGSLEKETTSEANFEIKKATVMIIDDTQNIDSVDTSNQ
                     RSISAGQSEQIKGFTDKGFVPVSFISSAMISAKINQPDNDGTKSVDIDVRDDLLILET
                     CADSTQTFISLINGLSPPTPPSTALKYRTEVMPIQDMLASFTGDAFATDEITDAEDIS
                     GHDFDEQLGGAIEDELEYVSEFYPQKPDQEEAMSASMMSSTSDASRPPHLLDSFQSDN
                     NVTISMSGLDFRDDHFAKQSTVGGTAHRWDSSHNTYGLANEVKIHGSPLRVRVRDVHF
                     IWNLFDGYDWQRTRDTISKAVKDVEIKATERRAKKGGLAPVEEDEEESVIGDFLFNSI
                     YIGIPANKDPRELSRAINHDIDDLASETGSYITSTTVTGMTSRQNRAPSVRTKRLRLS
                     RSRHHKMTFELKGISADFVVFPPNAGETQSSIDVRVHDLEIFDHIPTSTWKKFATYMY
                     DAGERESGTSMVHLEILNVKPVAELAASEIVLKATLLPLRLHVDQDALDFLSRFFEFK
                     DESAPAPSSPSDQPFLQRVEINAVPVKLDFKPKRVDYAGLRSGRTTEFMNFFVLDEAD
                     MVMRHVIIYGVSGFDKLGQTLNDIWMPDIKRNQLPGVLAGLAPIRSLVNVGSGFKDLV
                     VVPMREYQKDGRIVRSIQKGAFSFAKTTSNELVKLGAKLAIGTQTVLQSAEDFLGAPK
                     AAQGAHHHLEGDGDSADEEEKKQISHYADQPVGVVQGLRGAFSSLERDLLTARDAIVA
                     VPGEVMESGSAAGAAKAVWRRAPTVILRPAIGASKAVGQTLLGAGNTLDPTNRRRIED
                     KYKRH"
     gene            complement(<491561..>493342)
                     /locus_tag="TRUGW13939_10516"
                     /db_xref="GeneID:55997995"
     mRNA            complement(join(<491561..493140,493201..>493342))
                     /locus_tag="TRUGW13939_10516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493627.1"
                     /db_xref="GeneID:55997995"
     CDS             complement(join(491561..493140,493201..493342))
                     /locus_tag="TRUGW13939_10516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349520.1"
                     /db_xref="GeneID:55997995"
                     /translation="MLASNIPSQDDSEWEQEEGIPQFEDAFIQKYLNGRDALIEQEHK
                     QRHDFKFYNSMSAVAKEACRIVATIRDKELREIWTKDHQQDDELLYPGVMFTVARERM
                     EKTKLWKIVEQMPKGSLLHAHLDAMFDVDFLIDQAFDTPGIHISAPAPLLTEQDLEVA
                     PLTFQYSSTPLAASENKEPVWSKEYSPSSLIHIRKAATTFPNGGEEGFRKWLRGRMVI
                     SAEHSYQHHHGVNAIWDIFQRTFPFIGSILFYEPIFRACLRRMLTELSKDGIRYVDFR
                     TAFVFEYRREGADAAEEDYVEFIRVFKDEIEKFKVTEDGARFYGARMIWTTLRFFDNR
                     GVVESMKQCIIAKHEYPEMICGFDVVGQEDNGRPLADLIPVLFWFRKLCAEEGVEIPF
                     FFHAGECLGDGDETDENLYDAILLGTRRIGHGYSLYKHPLLIDLVKEKKILIECCPIS
                     NEILRLASTIKHHSLPALLSRGVSVSLNNDDPAILGHGKNGLTHDFWQVLQGLANMGL
                     SGLATMAENSVRWSCFEDQSSQEWQAGIRGGIMGSGTKAKRLQEWYEDFEKFCQWVVL
                     EFADEVD"
     gene            complement(<493853..>494597)
                     /locus_tag="TRUGW13939_10517"
                     /db_xref="GeneID:55997996"
     mRNA            complement(join(<493853..494339,494401..>494597))
                     /locus_tag="TRUGW13939_10517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493628.1"
                     /db_xref="GeneID:55997996"
     CDS             complement(join(493853..494339,494401..494597))
                     /locus_tag="TRUGW13939_10517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349521.1"
                     /db_xref="GeneID:55997996"
                     /translation="MVKKPKPGLSLALEDASVAPSTFNDGLPLPKLIVFDLDYTLWPF
                     WVDTHVSAPVKPKDNNSRCVDKWGESFAFYPAVSSILYSARSLNIPLGIASRTHAPEL
                     ARDMLKALHVIPTFSDNPAARDARRSIRALDYFDFTQIFPGSKTQHFTRIHQASNIAY
                     EDMLFFDDEARNRNVQNELGVTFYLIRDGMTRDEIDRGVWDWRKKLGIKPGDQPVAPE
                     DREVSRFDE"
     gene            <496511..>499851
                     /locus_tag="TRUGW13939_10518"
                     /db_xref="GeneID:55997997"
     mRNA            join(<496511..496909,496960..499677,499726..>499851)
                     /locus_tag="TRUGW13939_10518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493629.1"
                     /db_xref="GeneID:55997997"
     CDS             join(496511..496909,496960..499677,499726..499851)
                     /locus_tag="TRUGW13939_10518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349522.1"
                     /db_xref="GeneID:55997997"
                     /translation="MDTLNSPSHIRDASPTPDPVSHASRQSSSKNSRKRDIEEMQEVT
                     AGLVPSSSLGQFSFAPATRTTVVTTTTTTTTNFPPLVFNPPRSARHLDPKLYPLAANP
                     TPSELRRFQFELGGQSVIFNEPDDTTAALDELNEQRDALKASKGVLTSVAVYDGPDQN
                     ATPSQPPTHQVSKATGSRRRPGSPLGKRESSRKNRSLGTAPEPRGPNMPRRSRLGRVA
                     SATSSSAPGLATPETESNQFRLDHHAVLRKRIHGGRAGHKVNSGSSNDDQDSLQSSNP
                     RPPLFTRAPSETHDKSEEATSAVENSQDSQHALSAPGGLDSGEAMIEDNETSQYPESS
                     ATQPYRTVPGLANLPAIDSALSQDMCLPSPSLSPVTAMNTHNPDSFFEFTEDQGTETD
                     SSLDNQVSKLTRLTSRNGATSVSAPADVYNGTIQPRPPSLMEIPATLDFFESIPDEMK
                     TYMMYQLLRRCPKSTLQFVADVVNPALKCDFLALLPAELTLNIVRYLDLKSMCRAAQV
                     SKKWRHIINSDERSWKQLFDSHGFKLPPGELQRAIREGWGWQFPNGSDDWEKDLSSSV
                     MKLDSDNLPVDQSSAFADTASVGSSSSRRPKRKAAANRTSSRKLARRKLTSSHEAAPA
                     SYDWAGEATSLEGPYAAANAAAIAVPYPEVGIPSLRSVHLYKSLYQRHSTIRKSWMRS
                     DLNPKHLAFRAHDRHVVTCLQFDTEKILTGSDDTKIHVYDTKSGALKSILSGHEGGVW
                     ALEYYGNTLVSGSTDRSVRVWDIEKAKCTQVFHGHTSTVRCLQILLPTEVSKNADGSA
                     EMMPKEPLIITGSRDSNLRVWKLPKPTDPTYLDASPHANDTDCPYFLRTLSGHQHSVR
                     AIAAHGDTLVSGSYDCTVRVWKISTGESVFKLQGHTLKVYSVVLDVERNRCISGSMDN
                     MVKIWSLENGTLLHTLEGHSSLVGLLDLKSDRLVSAAADSTLRIWDPEDGQCKSTLTA
                     HTGAITCFQHDGEKVISGSDRTLKMWNVRTGECIKDLLKDLSGVWQVRFDDRRCVAAV
                     QRDGLTYIEVLDFGAYRDGFPDYRLGKRIVVDRQGIEVADDDEDDYDATE"
     gene            <501169..>504888
                     /locus_tag="TRUGW13939_10519"
                     /db_xref="GeneID:55997998"
     mRNA            join(<501169..501294,501359..501403,501459..502050,
                     502118..503282,503689..503738,504047..504581,
                     504662..504761,504814..>504888)
                     /locus_tag="TRUGW13939_10519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493630.1"
                     /db_xref="GeneID:55997998"
     CDS             join(<501169..501294,501359..501403,501459..502050,
                     502118..503282,503689..503738,504047..504581,
                     504662..504761,504814..504888)
                     /locus_tag="TRUGW13939_10519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349523.1"
                     /db_xref="GeneID:55997998"
                     /translation="SFLADIKKLPAEAHSKRQPYTQKIFCSLFSSSDKMVKVNVAKMI
                     TGPKAGLAMKTNLNTRHPMSDTFRSTKLRDTLLEIDMADKCLTDEGLCMFTADLKRLL
                     EFKNDKYPDGIAKLTGLNLQGNKLTVSCLRELGELIRLSAQDLRELNLSNNQITIKDY
                     NSRVEAQEWELFLTSFSQCCVLKKVDFSDNSIGDTGMDIFARVYIQSELDFVNTYTSS
                     SEDEGRDETPMSSASVSGPSDSRQSSSHRRKSSLAKDPKSYPPDDINHWSCTRGLQSV
                     PYIILANVDMNDASVVHLSEIIKIRRTPEQLLEYLPEGKSPSLPEIPQHAKKGIYWEQ
                     NSELSKLSHRLMKAVAAVYPKNTLYDDFDGLNLEEYDDDEEPSNDQVERRQERKKLED
                     ELRRLESQQRSQALLSGGISDCALWKYSLGLLMLSRAILLDDKRRPPSAEKELSTAKK
                     NIRPVLAGNEIAPSPPPPPTTTTKFGYEPTVQNRVTPPGVLISSMRFDPESSTFDYMF
                     PSMHAPSPNPVQIPTMPDIGAVPSTYNHNGNNSAAKPSSRQSKGKGTTNQATALHPDR
                     KALTDKQYRSEYRFGLPLHLWRRIITMSSSRWDRFVPAAHQLRILNYAADWDAFAAEL
                     SVDGAPDNQQISRILHNMNESVTGADKQLSCYRQSVEKGLGLGLANVYLQQPNTKVIL
                     TTRTSPSELCSALPSSFAGTLQGIYKLDSSSTADAIALREALLAEKLAKIDIVIANAG
                     YGDPFTTVLDAPIDALDTLYQVNALGPVRLYQQLWPDFLSKSDQSPKFLLISSALASI
                     QLLDHTPCAGYAAAKAAGNLFIKKMHLENERLVTVALHPGWVQTANGQAYADAIGMAG
                     PPLTTDESVNAIVKTVAEAEKTTTSGKFIDVMRGAELPW"
     gene            <507751..>510177
                     /locus_tag="TRUGW13939_10520"
                     /db_xref="GeneID:55997999"
     mRNA            <507751..>510177
                     /locus_tag="TRUGW13939_10520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493631.1"
                     /db_xref="GeneID:55997999"
     CDS             507751..510177
                     /locus_tag="TRUGW13939_10520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349524.1"
                     /db_xref="GeneID:55997999"
                     /translation="MGRQSLRNPFTISARSSSIQAETNYGERSISRMRSQESMMADRS
                     RKAHRLLGDYNPNSRYLDREGSVNGTVDSSVDDHYSMASSTVDRESITSSVPQHELRV
                     RASSPLLGRNYHSKNPTPEVPRIPQSGSWADIMMSKPDPYAFETQSQHSLAYGVVEDM
                     KGIRFPNLASDHYQQQQQQQQQQQQQQQQLLLQQQQQQLLQAQERQKQTKKKRPSRID
                     LSLLFPRPKPAAEPLLSPQRLTNSPSPVLSEASIARKVAPVKLTKSRSRSNSRKNGLD
                     NVIPEESPAMPSQSRKTVDWFDIPVEKTIRVDHMASDYTDDEEISPKMAFRPTPEARQ
                     PQPQRPPSQKDTNFSQPMSIRSSRRSSLTSGTSRTSRGTSRSVESQVSPQPTTQSSDR
                     TRPSLQPWQPQGDLRSKRSQGKLSKKSSSSTLRAFDLSKTSVLSLSSSEDEDESEDAR
                     EDDAKYGESLVKGAAPPRMIRASISTYDGFEPEICTAEAVIPTRGQPLTQFNRTAPLP
                     LYRSHSKMSTDSSDSRRTVRQRSNGRSRDPSLSSVTRSASNRRLESRASTRVPLIEEQ
                     EELADVHEENEENIPNLLPVPSSNSTQSAEKRRSRIIAVTRQEESLLEAMRQRNGRFT
                     PSIFHEVTSTSADSDTDSNSRVSPKPRAQEASQPSYDTSFLRLSTAMFPSPGSQSGGE
                     GAVSKEKEAFMSLSSTSDSEQRTESNSTASPRLSLAFSETQSSSSTTGHTSPMTPTLP
                     IHRFSPRAPPPSHAPPPIPDAARRHSRRRTDSSEAIVVEDSANGKDETEYPLWAIKWA
                     PDSVDLAVAH"
     gene            <513202..>514752
                     /locus_tag="TRUGW13939_10521"
                     /db_xref="GeneID:55998000"
     mRNA            join(<513202..513267,513336..513365,513428..514399,
                     514459..>514752)
                     /locus_tag="TRUGW13939_10521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493632.1"
                     /db_xref="GeneID:55998000"
     CDS             join(513202..513267,513336..513365,513428..514399,
                     514459..514752)
                     /locus_tag="TRUGW13939_10521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349525.1"
                     /db_xref="GeneID:55998000"
                     /translation="MGERSQRLRKSKFPFHAISIFLLTVQYASSVVLLHYSRIMPAVG
                     GKRYVTSTAVFLTEAIKLAISLTVALYEVSKKVPPSMPATSLFFSLINSIFSGDSWKL
                     ALPAVLFTLANSLQYIALSNTDPATFQITYQIKMLVAAVFAILLLRRSIPVRNWGLFL
                     FLIIGVALLQLPGQESDELVAHDDYLHFPRSLEEWKQRARAPAANLQKRSASYEGIEE
                     DMLLEHPPLNRRIGLLTTLFASVASALATTYLERAFKDSASPKSVWMRNVQLALYSVF
                     PALFVGVVFLDGETIATQGFFGGYNWVVWAVIATQTIGGIGAGFTIAYTDKTAKTWAT
                     GFSIVLSMITSLSVFDLQLSANFSIGAAIVLVATFLYGSQPSSIPVKMRPPPIRIESY
                     EKGEDGSGVVSPPNDFSIKLPTTPLLSVAGLSSSRPTSPSHSRVKSNQNVPGGGYFPK
                     LEE"
     gene            <515350..>520104
                     /locus_tag="TRUGW13939_10522"
                     /db_xref="GeneID:55998001"
     mRNA            join(<515350..515434,515501..515650,515706..516717,
                     516778..516899,517010..517701,517750..518325,
                     518380..518534,518581..518678,518731..518943,
                     518995..519178,519229..519355,519403..>520104)
                     /locus_tag="TRUGW13939_10522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493633.1"
                     /db_xref="GeneID:55998001"
     CDS             join(515350..515434,515501..515650,515706..516717,
                     516778..516899,517010..517701,517750..518325,
                     518380..518534,518581..518678,518731..518943,
                     518995..519178,519229..519355,519403..520104)
                     /locus_tag="TRUGW13939_10522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349526.1"
                     /db_xref="GeneID:55998001"
                     /translation="MSAEYFLSGPVRRQPLLPIDDDIPFDTFDRELLAELTEQQGFQD
                     HGPSSSFARFPSSTQTRHAFRTPAGDHTSQFVGGLSAPITTPVVGQEPSSEDTGGLQS
                     SPLLRYFKPNKPGTSAASRSLDSRHILTGIDDDLDLQNSPSTGKGRAYPTHVDLPHQI
                     SLSHAPPIVQGINLISTQQLPDRFRSLFPFPLLNAVQSKCFPHVYQDDCNIVVSAPTG
                     SGKTVIMELAICRLVNNLKDGLFKVIYQAPTRSLCSERFRDWSTRFTSLGLQCAELTG
                     DTEYSQLRAIQTASIIVTTPEKWDSMTRKWRDHSRLMQLVKLFLIDEVHVLNESRGAA
                     LEAVVSRMKSVGSNVRFLALSATIPNSEDIATWLGKSDTFQHLPAHREHFGEEFRPTK
                     LQKFVYGYQCNGNDFAFDRFCGSKLPEIISKHSKRKPVMIFCCTRNSAIAAAKDLAKL
                     WTNTIPPVIGAGVAFHHAGLESDDRHAVENSFLKGQISIICCTSTLAVGVNLPCYLVI
                     IKNTVCWQDGGCKEYSDLEMMQMLGRAGRPQFDDSAVAVILTKKDRLSYYEKLVSGTE
                     QLESCLHLNLIDHLNAEIGLGTIGDLESATKWLAGTFLFVRLRRNPTHYKLKENADRR
                     DEDEMLRQVCEKDVKLLQECGLVTTEGSLKSTPYGDAMAKYYVKFETMKILLALPPRA
                     KVSEILSAISQADEFREIRLKAPERPLYREINRGNGIRFPIRVDLSQHAHKVSLLIQS
                     ELGASEFPSAEQYQKHKFQLQQDKTMVFTHVNRLLRCVVDCQIHNEDGIAVRNALELS
                     RSFAGRAWENSPLQMKQIDQIGIVAVRRLASAGITSIQELEETEAHRIDTLLSKNPPF
                     GTKLLSRLADFPKLRVTIKMIGKASRCRRSVSVNLKVDIGFLNEKLPAFFQKRPVYVC
                     SLVEISGGRLVDFRRMSAQKLQNGHEILFNAELTSSLQHITCYVMCDDIGGTSQYAKL
                     NPDIPVGMFPKDSFDEGSKISDKFSMNTSRRRSNDASKSTRPSNRGDVFEDDDFADDD
                     FLAAVEDFDRSERPSKLTFSKSLKPDLNPSSRMRQNDPFNDNDQQQSAVLVNGKYKCN
                     HKCKDKSACKHFCCREGLDKPPKVYKKGPSAEMTPARNSQLSLIDSVRKKNSIDLIDL
                     SQPSQPKTNILKDMIGTKSLGCEVAPSKATRMANLDLAVSQSAARKLTFEAGGSVNKK
                     RKRKLSRNRRGSSSEYGDSDLEKFFAPSAILPQPDNQTSAERYDPAIEDTGTDSTIEG
                     IDTDFEFVDDTKRSATYPSTPHRTLDSVPGFLIDSKDGQSPSISRTAAIHNPEFPTPT
                     NGGGTQQTFHSNDIMEREDAVKRCKVSEAIEENLDQSWLEEFGDIVNFTGI"
     gene            complement(<520326..>521431)
                     /locus_tag="TRUGW13939_10523"
                     /db_xref="GeneID:55998002"
     mRNA            complement(join(<520326..520809,520869..>521431))
                     /locus_tag="TRUGW13939_10523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493634.1"
                     /db_xref="GeneID:55998002"
     CDS             complement(join(520326..520809,520869..521431))
                     /locus_tag="TRUGW13939_10523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349527.1"
                     /db_xref="GeneID:55998002"
                     /translation="MVGRTLICTACRASLRGVVRLQPKRSHATKTFEPPVMKRLTDVN
                     SVYAPKKFDDLESTDLAAYWDTIPPSNEDLEYADKIFKRSRHSPVKLFSAAKFRTIPF
                     DSNEPEVAFIGRSNVGKSSIINALTESEICYTSKQPGKTTEMNAFGIGGTKGGESKIV
                     LLDMPGYGKSSRREWGVEIMKYLQQRKQLRRTYLLIDSLHGLKDTDKEILSLFRQYGI
                     SHQIILSKLDRILVSKLNKGIKEFTHGKREIRRSKLKNLKKVMEELRPIIQPIGAAAG
                     PGSLGEMLGCTTLAKLSPPSRNCLGISAIRWSILQATGLAGGFKPEIVQSPSSPQEPA
                     NNTITPTFTFDDKM"
     gene            <521667..>524101
                     /locus_tag="TRUGW13939_10524"
                     /db_xref="GeneID:55998003"
     mRNA            join(<521667..521774,521863..522306,523204..523275,
                     523332..523841,523901..>524101)
                     /locus_tag="TRUGW13939_10524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493635.1"
                     /db_xref="GeneID:55998003"
     CDS             join(<521667..521774,521863..522306,523204..523275,
                     523332..523841,523901..524101)
                     /locus_tag="TRUGW13939_10524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349528.1"
                     /db_xref="GeneID:55998003"
                     /translation="RTAARARALSSGGMINAVLVFNNNGEPRLTKFYTQLDTQIQQKL
                     IRQIYDLVAQRPPSACNFLPLPPLLVQGASSKASSGPSDAPTQITYRTYATLSFIMIS
                     TSTESPLALIDLIQVFVEALDKLFENVCELDLIFGYESMHATLSEMIVGGVVIETNLE
                     KIVAGVRAQEGTRGKRKAVDAASTPPKGKKVAAAPFPQGKAGASKKTKNPLIEKRSRN
                     FGIGQDIQPKRNLSRFVKWPEYVRLQRQKKVLNIRLKVPPAIAQFSNTLDRNTAAQTF
                     KFLNKYRPESKVEKKERLLKEATAVSEGKKKEDVSKKPYAVKYGLNHVVGLVENKKAS
                     LVLIAHDVDPIELVVFLPALCRKMGVPYAIVKGKARLGTVVHKKTSAVLALTEVRSED
                     KSEFSKLITAVKEGYSDKYEENRRHWGGGIMGSKAVARQEKKRKAAEAAVKI"
     gene            complement(<524944..>527794)
                     /locus_tag="TRUGW13939_10525"
                     /db_xref="GeneID:55998004"
     mRNA            complement(join(<524944..527404,527463..527671,
                     527735..>527794))
                     /locus_tag="TRUGW13939_10525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493636.1"
                     /db_xref="GeneID:55998004"
     CDS             complement(join(<524944..527404,527463..527671,
                     527735..527794))
                     /locus_tag="TRUGW13939_10525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349529.1"
                     /db_xref="GeneID:55998004"
                     /translation="MAEGEPDFSSLPLPERFTHKIWKVRKEGYEDAAKEFEKTPDESA
                     PVFRPFLLDSGLWKGAVADSNVAAQQEGLAAYCAFLKYGGAQACIRSRATTIAPIAEK
                     GLSSARPAAKANALEALLLCIELDKADPVIEDLLPSLSAKQPKVIAAVLAAFTAIYHN
                     YGCKIVDPKPVLKALPKVFGHADKNVRAESQNLTVELYRWLKEAIKPVFWGDLKPVQQ
                     QDLEKLFDKVKEEPSPKQERLTRAQQDAIATAPVGGGDDGDQDAGQDYDDDGAEDAEP
                     IDLAEPVDVMPRIPADLHEKLGSSKWKDRKEALDALYNAINVPRIQDGHFDEIARAFA
                     KCMKDANVAVVTIAANCIDLLAKGLRSSFGKYRSVVMSPMLERLKEKKQSVSDALGQA
                     LDSVFASTSLSDCLEETLEFLKHKNPQVKQETLKFLIRCLRTTRSVPEKPEVKSIAEA
                     GTRLLTESSEVTRSGGAEILGTLMKILGERAMNPYLDGLDDIRKTKIKEYFDTAQVKA
                     KDRPKPIVGPPKAAPTPAKKAAPGTKRPAVKKAAPAAAPPPPAPEEASPPPKPKAVSR
                     PGLARPGGIPKSGLATPGSGLKMQRRIPGVGGAAAPQASPQRRAASPPLDEPAPALAQ
                     PKFGLGRGLTSRPIGKPAAVVDAAPPAAAPAVSGLAAVERAELEELRLERDHLTTVNE
                     ELKSEKTKLTSQINEFQNQNAQLIEDHTRDVLSIKAKETQLVRARSDAETAEQTVQKQ
                     QREIERLKRELARAVRAAAISPPPVLADGGGAVESVPLSPDPAAYHSNSSRSGLQMGA
                     RFDGARPRSYVSSPSDDKENNGLVSPSHDSNFEPNFGRRKFSPPASSGISSRGSPSRP
                     TARYASTGSNNGEEHPAAPARSTEPAENWKRAAEVTSQLKARIEQMKASRLFQQ"
     gene            <528781..>530318
                     /locus_tag="TRUGW13939_10526"
                     /db_xref="GeneID:55998005"
     mRNA            join(<528781..529374,529428..>530318)
                     /locus_tag="TRUGW13939_10526"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493637.1"
                     /db_xref="GeneID:55998005"
     CDS             join(528781..529374,529428..530318)
                     /locus_tag="TRUGW13939_10526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349530.1"
                     /db_xref="GeneID:55998005"
                     /translation="MAKSHPEDISRLCTALATKASQDPGLPVPNPTTAYWQSEVHELA
                     NHQSATLPATADIVIIGSGITGVSTAYHLLQQQPTFAISILEARSLTSGATGRNGGHC
                     KEVPYVDYPELKELHGREGAGKIVKFRLAQLDALLELSASLGSEASSAVVRRVDGLDV
                     YYDQEVFDKMKEKLADYLADFPDQKDTWLVFEGDDINEKFGTVNAVGCMTGPAGALWP
                     YKVVGAVTSYLFNSRKYPNLTIETHTPVESISTTTSSASATHPVVVKTSRGEIHANYV
                     IHCTNGHAGHLLPGLRGKLFPIRGQMTRQAAPAEFPRVGDRRSWILHYAPGYDYITQS
                     PFSASGDIYIGGGLLKALLSGNVTVEDADIGNVRDDLQSEEALKALETAIEERFRGGK
                     GTRILDKWTGVMGFTVDEAPIVGRVPDDISGRRASREWVAAGFCGHGMAYCWLTGKAV
                     AEMLLKGEDSVNEWFPTEEYACSNQRLQRTTLHDSLLSFIETVA"
     gene            complement(<530415..>532157)
                     /locus_tag="TRUGW13939_10527"
                     /db_xref="GeneID:55998006"
     mRNA            complement(join(<530415..531742,531808..531881,
                     531930..532078,532146..>532157))
                     /locus_tag="TRUGW13939_10527"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493638.1"
                     /db_xref="GeneID:55998006"
     CDS             complement(join(530415..531742,531808..531881,
                     531930..532078,532146..532157))
                     /locus_tag="TRUGW13939_10527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349531.1"
                     /db_xref="GeneID:55998006"
                     /translation="MTAPATVVPSLDVAQEVVAKSLNSQYPPNVLPLTASIPADLLTP
                     TVAYLKIAAKSKLSFLYESAATTETIGRYSFVGADPRKVIKTGLGHGPECDPLPLLEK
                     ELSEVRSATIPGLKLPPLTGGAIGYVGYDCVRYFEPTTARPLKDVLGVPESLFMLFDT
                     IVAFDHFFQVVKIITYIPITAGGAQLEEAYRKGQQVIQEKINILLHPDIPLPPQGPIL
                     PNQEYKSNIGQAGYESHVTKLKEHIKVGDIFQTVPSQRLARPTTLHPFNLFRHLRSVN
                     PSPYLFFIDCGDFQLVGASPELLVKEENGRIITHPIAGTVKRGKTSEEDDALAAELRG
                     SLKDRAEHVMLVDLARNDVNRVCDPITTQVDRLMVVERFSHVQHLVSQVSGVLRPDKT
                     RFDAFRSIFPAGTVSGAPKVRAMQLIAELEGEKRGVYAGAVGYFGYDKSSADGSSEIA
                     GDMDTCIALRTMLLKDGVAYLQAGGGIVFDSDEYDEYVETLNKLGANIACIKGAEEKY
                     LQLEKEVAAAGQ"
     gene            <533031..>534039
                     /locus_tag="TRUGW13939_10528"
                     /db_xref="GeneID:55998007"
     mRNA            join(<533031..533647,533703..>534039)
                     /locus_tag="TRUGW13939_10528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493639.1"
                     /db_xref="GeneID:55998007"
     CDS             join(533031..533647,533703..534039)
                     /locus_tag="TRUGW13939_10528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349532.1"
                     /db_xref="GeneID:55998007"
                     /translation="MATSPPLSQRHHHHRLSPSFTDSAIDVELSEPGRTEQSEQSEQS
                     HVDDDDDELETRLARIAQLAAAQDSFRGLDGDGRAAVERYLDGLEGQLLDPRPQITRE
                     IAKNRPVSRSASNNSPTTTEAGTGTVTPTAIIPHTTTTRRRKDENRAMEQTSLDLTAL
                     LEELSTVNAELQQRRVEACHIHDLFTSKCEGMAQRIIELDHEIHELRSDIVEDTIELE
                     GLRGTVRGLESWIGRWQRQRDITINSSSSPSPSQSRSRWKRKKQHAPQEAEDENENDF
                     DTLLDGISAWMRGWNDVEEGFRVRARRRKLRRERQFNPIQR"
     gene            complement(<534771..>536932)
                     /locus_tag="TRUGW13939_10529"
                     /db_xref="GeneID:55998008"
     mRNA            complement(join(<534771..534818,534877..536526,
                     536584..536732,536813..536829,536892..>536932))
                     /locus_tag="TRUGW13939_10529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493640.1"
                     /db_xref="GeneID:55998008"
     CDS             complement(join(534771..534818,534877..536526,
                     536584..536732,536813..536829,536892..536932))
                     /locus_tag="TRUGW13939_10529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349533.1"
                     /db_xref="GeneID:55998008"
                     /translation="MDLTSHHVNYLIWRYLQESGHGEAAVMLQRAWLANPQTLPFASH
                     IKTHALVSLVQKGLQYHEIEQSLDQDGNPVPFTPSKYFFGPTPLDTESLKSRDNYNQA
                     HPAPSADTAAIPSPAGRPVRDTPTVNGHLSTEHTLPALNVKKSRKPERPEAVVNGDDG
                     AMEIDSNGTTHERIVSGTPAVRSPSPGDTIDANGDVDMDIDPAAETEVETHEGPTHTL
                     TTGRSVGVQIATAKAADLTSNTSIIDLDVPRDDHVMRCAWRPHDPSMFAASGDSFCHL
                     WKIPSQTALEGASPTCEKIYDSKGDGSWVTALSWEPSGRKLAVATYNERRSSIQMYDN
                     SGNVVDLLPTAPGMINGLHWAPSSPYMVVVASNDQNSELSLWDDSVKPEEYPPYQAIE
                     GHVHDMTWAGNNQVFVSGEGLVWQCEIDSSIHIVNKFQSRNSTTEWSFVRGAKRGDFT
                     VAVAAASSAATIWIPTHDILVEDAHRAAITAIEPQPESHEQQNGQASTSFVFASASVD
                     DTVKIWDVNLETKNITCLHTLFLSPGVPALALAFSPDGYAVSAASTDRLFIWNTERGN
                     EPLATWVAPATPEVKEESSEKTINGSNGSHATAYRSLAWDTNGKKLIMGYEKKMAIIS
                     PQGRVTNATE"
     gene            <538106..>539284
                     /locus_tag="TRUGW13939_10530"
                     /db_xref="GeneID:55998009"
     mRNA            <538106..>539284
                     /locus_tag="TRUGW13939_10530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493641.1"
                     /db_xref="GeneID:55998009"
     CDS             538106..539284
                     /locus_tag="TRUGW13939_10530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349534.1"
                     /db_xref="GeneID:55998009"
                     /translation="MAIRINIPPATRILLISQLALSFLYNVARWRQLDVSPSATGSQK
                     TPIVPYLTLVPSMFYYYPWSLLTATFVEQNIFTVLLNGATLFYAGKYLERAWSSREFG
                     KFILATALIPNILVIPIYLIWAALTGSSLRGYAFWISPDDCDTACAMPADDPVLRSLT
                     QICGGVALQGSFLVAFKQLVPEHTVTILKGIIKIRVKHFPAIFLVANTISGVLFGTDT
                     AAVLSWLGLLTSWTYLRFYKHQPDLTGTSTDGLGFKGDASETFTFASFFPDAVQPPIA
                     FVADQVYALLVAIKVVTPFSAEDIASSNEHAIARGQAGLPSLLNNTGGARGMAKREEA
                     ERRRALALRALDQRLQAATGKGPTVPSHPPSASSQTTAPTVTAGQNMLGETNYTPDHS
                     "
     gene            complement(<539668..>540336)
                     /locus_tag="TRUGW13939_10531"
                     /db_xref="GeneID:55998010"
     mRNA            complement(join(<539668..540243,540298..>540336))
                     /locus_tag="TRUGW13939_10531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493642.1"
                     /db_xref="GeneID:55998010"
     CDS             complement(join(539668..540243,540298..540336))
                     /locus_tag="TRUGW13939_10531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349535.1"
                     /db_xref="GeneID:55998010"
                     /translation="MVNLLKRMRKLNTRLLNIRIGTGAAILPSISTSLKDQPAVTRIH
                     LTYAQYIKGGHMGARQFWRRCLPRLKYHNPAIQMSVKQTDEQDGPAALTIFFSGAPKS
                     NKHHDSSIQDKYAPTPAEGEKAIVIDTKNYDYKQIWQKVQEATGAQEIPPTAEEVQQL
                     AEFKEMAIKSEHDRVRIAAMRQAKKDQERMLQEARGEVEKLRQL"
     gene            <540667..>542267
                     /locus_tag="TRUGW13939_10532"
                     /db_xref="GeneID:55998011"
     mRNA            join(<540667..541122,541173..>542267)
                     /locus_tag="TRUGW13939_10532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493643.1"
                     /db_xref="GeneID:55998011"
     CDS             join(540667..541122,541173..542267)
                     /locus_tag="TRUGW13939_10532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349536.1"
                     /db_xref="GeneID:55998011"
                     /translation="MVSTDARLELLSKSIDLSYALENDDNILEQLTYPSRRVDFFVHL
                     YEHQQNIEATTAYHLGISSKYCKISEVKEWRHGSFNVCIPVDISNGHYAGKRVLIRFP
                     LPYKVGESRYPGNADEKLHCEVAAYMWINQNCPSVPIPKLLGFSFYNNRTFLLPQSTT
                     FFNRFIWHARRFLSSLFGTPLPCDYVISGSPHALGYGYILLEYIGPSTGKMLSSSWDV
                     HRHDRNRRMNLFKDLSNIMLTLAGSIFPKIGSLTVDDHGMVQLENRPLTLRIQHMENE
                     GIPTDIDRRQTYCTSEAYVLDLIRCHDNKIRFQPNSICDEYDGRAQLATLGIMRTIYS
                     HYLQHARRNGPFLFSLTDLHQSNIFVDDDLHIRCIIDLEWACLLPVEMIQPPWWLTSR
                     GIDELPEGEYLKEYDDRRREFIKCFETEEKSLYPKRQPYIADTMNTGWGSGAFWFFQV
                     LSNPRAVSGLFLDHIQPIYDRTQDLNFDSIVSRYWAPNTEEFIAKKIQDKMDYDCELK
                     RRFQPPLT"
     gene            <542737..>546456
                     /locus_tag="TRUGW13939_10533"
                     /db_xref="GeneID:55998012"
     mRNA            join(<542737..542811,542921..543109,543182..543490,
                     543544..545543,545599..545797,545854..>546456)
                     /locus_tag="TRUGW13939_10533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493644.1"
                     /db_xref="GeneID:55998012"
     CDS             join(542737..542811,542921..543109,543182..543490,
                     543544..545543,545599..545797,545854..546456)
                     /locus_tag="TRUGW13939_10533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349537.1"
                     /db_xref="GeneID:55998012"
                     /translation="MAAAAAAAAALDPSNSSKNTLKIENFDKRNTLQAIEKKYQQQWK
                     DNKVFEVDAPSLSEIPAGSMSAEEIHTKHPKFFGTMAYPYMNGTLHAGHSFTASKVEF
                     MTSVARMQGKRALFPLGFHCTGMPILACADKLKDEIKKFGTKFEGYKEEEAVPDQPPA
                     PTQDTAVDPTKFSGQKSKAAAKTIKAKYQFQIMLSIGIPLEEIHKFSDAHYWLQYFPP
                     LAIRDLDSLGAKVDWRRQMVTTDANPYYDAFVRWQMNRLHEKGKILYGNRYTIYSPKD
                     GQPCMDHDRTEGEGIGPQEYTALKVKVTEWSPAAAELVKGKIEDDANVYFVPATLRPE
                     TMYGQTAIFLGPKITYGIFKVGEKEYYIVTKRAAWNMAFQGIFFDSDHFPKTQDQLPL
                     VAEGPGSTFIGTGLSAPLSVHETIRILPMETVSATKGTGVVTSVPSDSPDDYATIADL
                     AKKADYYGIKKEWAELEIPPIIETPTYGNLTAPALVKQMKINSPKDATQLALAKDLAY
                     SEGFYKGTMLVGEFKGEAVQTAKDKVRQSLVKDGAAFAFADPSGKVVSRSGDDCVVAY
                     LGQWFLNYGENDAEWQKTTLNHVVNGMNTYSVETRNGFEKNLDWLNRWACARTYGLGS
                     RLPWDPQFLVESLSDSTIYMAYYTISHLLHGDRFGKTPGLLPDVKPENMIDDVWDYIF
                     TRRELDDDLIQKSGISKENFLRLRREFEYFYPLDVRVSGKDLIQNHLTFLLYIHVALF
                     PEELWPRSIRINGHLLLNGEKMSKSTGNFLTLKDSVDKYGADATRIAFADAGDAIEDA
                     NFDETVANSNILRLFTLKEWIEEVSKDDTLRTGPTDVLWDKLFTNELNALVREAKTHY
                     DDTNFKLALRSALYDFVGARDTYREATTAAGIGMHRDVVTRYIELQALMLAPIAPHWS
                     EYVWLEVLKKGDTIHHQVFPEVPEADVGLSAAAAYIRSTSSSITSSESNYTKKLSKGR
                     NVSFDPRKPKKITIYAAKNFPAWQEKYIDLVRESFDSLKLTVDDKGLNAKVGKLGEMK
                     KAMPFVQGLKRRLINSREAPDTVFSRKLPYDEIAILQELVTGIKRTTGAKEIEIISVD
                     EGGKSGTVVGTGEKRENLQGENAVPGQPSFTFVNIE"
     gene            <547235..>549160
                     /locus_tag="TRUGW13939_10534"
                     /db_xref="GeneID:55998013"
     mRNA            join(<547235..547307,547445..547514,547574..547794,
                     547854..>549160)
                     /locus_tag="TRUGW13939_10534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493645.1"
                     /db_xref="GeneID:55998013"
     CDS             join(547235..547307,547445..547514,547574..547794,
                     547854..549160)
                     /locus_tag="TRUGW13939_10534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349538.1"
                     /db_xref="GeneID:55998013"
                     /translation="MSKVVRSVKNVTKGYSSVQVKVRNATSNDPWGPTGTEMSEIAAM
                     TFSSPTDFYEIVEMLDKRLNDKGKNWRHVLKSLKVLDYCLHEGSEMVVTWARKNVYII
                     KTLREFQYIDDEGRDVGQNVRVSAKELTALILDEDRLRSERSDRKLWKSRVSGIDEGG
                     IQGGGFGGSDSGRRPDRERRDRRRNDEDDAEYRLAIEASKHEAEEDRKRRERSGRAAA
                     TADDDDDLAKAIKLSREEEELRKRELEESNAQSLFDDTPVQPTQAQPTGFNQGYQQQP
                     AVDWFGNPIDTQQPLTTGYLNNQYAQQPTGFQPQQTGFPGGYQVQPNGFDPSQQFGQP
                     QNNFFQSQNLQPQQTSFNNNNPYGNTGGFGQPQQQQPQQQDNFLQPGTHNPWATNNQQ
                     TPDTLKPLPTGSNNPFASSINRPASQPARTGPPTLSTLAEQQATTAFSNYPSGPNPIA
                     NFQAPNPAQPRRDDNNPQHARLNALLASGEGQDTFGNVGDLRLPSHHTAATFINSAGQ
                     GVQSAPTGNNPFFNQQFTGVPQQTGFVQQNNPYSGQQRQQQGGSLIDL"
     gene            complement(<549686..>552138)
                     /locus_tag="TRUGW13939_10535"
                     /db_xref="GeneID:55998014"
     mRNA            complement(join(<549686..551844,552132..>552138))
                     /locus_tag="TRUGW13939_10535"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493646.1"
                     /db_xref="GeneID:55998014"
     CDS             complement(join(549686..551844,552132..552138))
                     /locus_tag="TRUGW13939_10535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349539.1"
                     /db_xref="GeneID:55998014"
                     /translation="MNSSSQLRYQASRSVCTSTTRWPRRSNNQFHPKQSAFGASRRIY
                     IDTDPQNPSQSSVSPPDPAEPAVANTSVDPPREESSSSPPAPPESIALFPSSPPTPLE
                     SIALRSDVLPVCCPGCGAYSQTIEPADPGYYDVSRRRVKKIWGKAQHAKRAQASAAQN
                     DNKADKEMENEVNTETDAAIEPQDEQPAEIDTVAATEFIQASTLPSQICDRCHDLLYH
                     NKGISAPSPSINSIAAYLDESPHKSNRVYHIVDAADFPMSLISGIYDALELQGPKSKN
                     RRARTEKYKYSKKMTTLSFVITRSDLLAATKEQADSLMQRVRSIIMKVMRFKQEDIRL
                     GSVHMISAHRGWWTTQVKEEIRKHGGGIWVVGKANVGKSNFIESCFPKDSKNIAKITE
                     LFERRKEEGKALSGANPVASDAFSDALPDQHILGGDNLLPPAPREELFPTLPVISSLP
                     GTTVSPIRIPFGRGHGEMIDLPGLDRSTLPDFVLDQHKPDLVMTKRINPADPLTILDR
                     QSLLIGGGLIRITPVAPEGITILAACFVPLETHITRTDKAIEIQSGVRKYNTGGGDRG
                     TTIIKPEFLENNNDTIRSAGTFTLSTDVTTSNLPSIIKKKWDDHGIKPDLNALPYRVF
                     STDILIEGCGWIELTGQIRTKKQTTSANESLDITDLPKVEVFSPLGKHVSARPTLEIW
                     KFIRDKRKADKRKGQYTSGSHRPRRQSISHTKRTLRGGA"
     gene            complement(<552166..>553104)
                     /locus_tag="TRUGW13939_10536"
                     /db_xref="GeneID:55998015"
     mRNA            complement(<552166..>553104)
                     /locus_tag="TRUGW13939_10536"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493647.1"
                     /db_xref="GeneID:55998015"
     CDS             complement(552166..553104)
                     /locus_tag="TRUGW13939_10536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349540.1"
                     /db_xref="GeneID:55998015"
                     /translation="MAFENINVLLSSFPGLSLPPTLSFSIPSTSTVIDLTEKIDSYLP
                     ESLKRAAPGLALTTTSNKQLLPFSNTLVSSYLPTTQHASSLESTFLPLRLSVPLRGGK
                     GGFGSQLRAAGGRMSSKRKRNQGDNNGSNRNLDGRRLRTVNEAKALAEYLAVKPEMDQ
                     KEKEERRRRWEAIVEMAEKRTDEIKNGGGKSKLDGQWVDDKEEVSEKAREAVLAAMKD
                     GMWKDNLRDILMGGSSTSASEGSSGEESESESVEDEEEEKEAADGPSNSQPKPAAPSR
                     RFIGFDEDDEFMSSDEEEEEEEEEEEDVKGKGKARA"
     gene            <553136..>554103
                     /locus_tag="TRUGW13939_10537"
                     /db_xref="GeneID:55998016"
     mRNA            join(<553136..553152,553399..553452,553499..553548,
                     553605..553675,553735..>554103)
                     /locus_tag="TRUGW13939_10537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493648.1"
                     /db_xref="GeneID:55998016"
     CDS             join(553136..553152,553399..553452,553499..553548,
                     553605..553675,553735..554103)
                     /locus_tag="TRUGW13939_10537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349541.1"
                     /db_xref="GeneID:55998016"
                     /translation="MRVRTLLRASSKRFHEELQELATMLIPKADRKAIHEYLFREGVL
                     VAKKDFNLPKHGDIDTKNLYVIKACQSLTSRGYVKTRFSWQYYYYTLTPEGLDYLREW
                     LHVPAEIVPATHIKQQRSHAPPRGMLGAEERERRPGGRGGPRGDRDGGYRRRDQEGGK
                     EGGAPGEFAPTFRGGFGRGRGAAPPS"
     gene            complement(<554330..>555939)
                     /locus_tag="TRUGW13939_10538"
                     /db_xref="GeneID:55998017"
     mRNA            complement(join(<554330..555275,555327..555641,
                     555698..>555939))
                     /locus_tag="TRUGW13939_10538"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493649.1"
                     /db_xref="GeneID:55998017"
     CDS             complement(join(554330..555275,555327..555641,
                     555698..555939))
                     /locus_tag="TRUGW13939_10538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349542.1"
                     /db_xref="GeneID:55998017"
                     /translation="MASKVFSFSRRCLSRSPINQKTPCVQHIPSVRQEYSISHKLNRS
                     TTELSEEQVSTLKIDRDRLATDLHHSCQWGPGIRWGQNPTDTGMQRLTLSEEDKHVRD
                     WFVQTMSGLGCNITIDQLGNIFAVRPGRRANVPATFIGSHLDTQPTGGRYDGILGVLA
                     GVEAVKTMVDLGLETEGGIGVVNWTNEEGARFPISMMSSGVWAGKISLEHAYNLKEVP
                     TVASLPTAASAPETVKTALDKIGYCGPTPCSHEATLMAAHFELHIEQGPHLVSAGQRI
                     GVVTAVQAYRWYKLQVTGRDCHTGTTAFQHRADAMYASARMMVKAREVASAHGCLASV
                     GIVDARPGSVNTVPGLVSFSLDIRGPETADVEVVVRQLQQDFDAIAADEGKEIGKPCR
                     VEWQLDFDSPAVNFHEDCISCVQQSAEAVCAQDVGVTDSKSLVRTIMSGAGHDSVFTS
                     KVVPTSMIFVPCKDGVSHHPEEFTSADDCATGASVLLQAVVRYDRQRFQS"
     gene            <557487..>557867
                     /locus_tag="TRUGW13939_10539"
                     /db_xref="GeneID:55998018"
     mRNA            join(<557487..557509,557573..>557867)
                     /locus_tag="TRUGW13939_10539"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493650.1"
                     /db_xref="GeneID:55998018"
     CDS             join(557487..557509,557573..557867)
                     /locus_tag="TRUGW13939_10539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349543.1"
                     /db_xref="GeneID:55998018"
                     /translation="MGVTVLSGKAQFDELINSGKIIIIDFWAPWCGPCRIISPVFEKL
                     SGEISGPEFYKVDVDEEPDIAQEVGVRAMPTFVAFKDGGKVGELVGADPSRLTELVKQ
                     FAA"
     gene            <558528..>559281
                     /locus_tag="TRUGW13939_10540"
                     /db_xref="GeneID:55998019"
     mRNA            join(<558528..558564,558624..558706,558773..558841,
                     558965..559057,559109..559123,559174..>559281)
                     /locus_tag="TRUGW13939_10540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493651.1"
                     /db_xref="GeneID:55998019"
     CDS             join(558528..558564,558624..558706,558773..558841,
                     558965..559057,559109..559123,559174..559281)
                     /locus_tag="TRUGW13939_10540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349544.1"
                     /db_xref="GeneID:55998019"
                     /translation="MSAACIFCKIIKGDIPSFKLFENDKVFAFLDIQPLSRGHALIIP
                     KYHGAKLVDIPDDSLTEVLPLAKRIAKATGAADYNILQNNGRAAHQVVDHVHFHVIPK
                     PNETEGLGIAWPAQTTDMEKLKALFEELKSNM"
     gene            complement(<559542..>561536)
                     /locus_tag="TRUGW13939_10541"
                     /db_xref="GeneID:55998020"
     mRNA            complement(join(<559542..560128,560179..560278,
                     560334..>561536))
                     /locus_tag="TRUGW13939_10541"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493652.1"
                     /db_xref="GeneID:55998020"
     CDS             complement(join(559542..560128,560179..560278,
                     560334..561536))
                     /locus_tag="TRUGW13939_10541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349545.1"
                     /db_xref="GeneID:55998020"
                     /translation="MHGMHSYRSAICGSLRLRLQPRLLVQQPLAQALDRLASSAPPQS
                     PSSATSKRFLHNQFRAVPTAAFRSLAQPRQASYLWTVALAAFVLGSATAAQLILANNP
                     DDLSTVPLSDSNQTPDHNYLGPINTLKMSSSQVETGHVGNLTAEQEAKLREMWTVLFR
                     LTGVKFEAGEVQRAASVASTTTPEGSADTKKKGRRSLFGWGAAKKEEPPAVESTTASL
                     GNVTLSDADDKYGQNKEFKQALADLPPEQLRDAFWNMLKSDHPDALLLRFLRARKWDV
                     NKAIVMLVSTLRWRLTEMHVDDDIMLRGEAGAIAQAEGSNAAEKRVGEDFMAQMRMGK
                     SFIHGVDKQGRPMCLIRVRMHKIGAHVGESVERLTVHMIETARLMLPRPVETAVIIFD
                     MTGFTLSNMDYTPVKFIIKCFEANYPESLGAVLIHQAPWVFFGIWKVIKGWLDPVVAA
                     KVHFTNTVEDLEVFIDRKRIIKELGGDEDFDYEYIEQQTGENDAIKDTAKRDELLARN
                     KTIAEELQEATKSWIEAANKGDKAGAESWKPKREEIVERLNKGYWDLDPYVRARSFYD
                     RSSVIQGGGIVDFYPEQSGQKQVNGTSTEDKEKAPVVNGNGTAEVEKTDSAAVPAETP
                     AVAVN"
     gene            <561985..>562738
                     /locus_tag="TRUGW13939_10542"
                     /db_xref="GeneID:55998021"
     mRNA            join(<561985..562302,562354..562402,562459..562504,
                     562555..>562738)
                     /locus_tag="TRUGW13939_10542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493653.1"
                     /db_xref="GeneID:55998021"
     CDS             join(561985..562302,562354..562402,562459..562504,
                     562555..562738)
                     /locus_tag="TRUGW13939_10542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349546.1"
                     /db_xref="GeneID:55998021"
                     /translation="MDSSAPRSSSRPRPTSRPTTPLRPSSRSSIRDSHGFGASVDGGA
                     HADPAVNALEPQFAELADSMADLEANFMHLQLMHESLARFSESFASFLYGLNMNAFCV
                     DFPEAPISESFKRAQTKAKQEAEASKIGHDADATFMTTDTSFIDNPPTTVSSKATPST
                     RGRGTASRRGTTGNRYSTRGTGTARSRPSALPRGRGYR"
     gene            <563692..>565637
                     /locus_tag="TRUGW13939_10543"
                     /db_xref="GeneID:55998022"
     mRNA            join(<563692..563767,563821..564060,564115..564806,
                     564858..565268,565320..>565637)
                     /locus_tag="TRUGW13939_10543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493654.1"
                     /db_xref="GeneID:55998022"
     CDS             join(563692..563767,563821..564060,564115..564806,
                     564858..565268,565320..565637)
                     /locus_tag="TRUGW13939_10543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349547.1"
                     /db_xref="GeneID:55998022"
                     /translation="MAAVSTSSLATVTQVSVLTEAEYGCEHLAAVLKDGGDRGAKFTI
                     GFMKQIAARSPIVSAPETNGAKSSAPFTRPSTKPEYICVNCTETFRNGDRHTHSEKTK
                     HFFYIDSRTGALFCQECRDFVYDHELDKIRGMASGLPSRARISADKVDSVRMTKMIEH
                     AVLDAYAQAKRDRESPMKNSKELSKTTAYVLKSLIEKTSPLAKKRKASEISTDETNGD
                     HAGQNGVNGSVSDEAVELEADESYVRANATKRICQSEGLRGLFNLGQTCYMNVVLQTL
                     LHEPLLNAYFLGNGHRYYECAVDGCVLCAVSKAFADFNGCDKKDGITAEQLLYSTWKN
                     HPALAGNHQQDAHEFYQFLVGGLHAATSMEDDQMKCHCFFCKAFFGKFQSTLTCHMCQ
                     HTSRTEQTLLELSLDVQLHSKKRPMNGMSTPTLAKCLQSWVSPEELIMEGYQCQGCHG
                     YPDKLTKQLRIKRLPAMLCMQMKRFEQTQSETRKMQGKIDFPLEINMQPYTVASKAHN
                     KGQSEGFMYDLVSTVVHDGVGLNEGHYIAYVRQGERWCLFNDDKVTLVTEREVLNADA
                     YLLFYTLRSLAW"
     gene            <567524..>569454
                     /locus_tag="TRUGW13939_10544"
                     /db_xref="GeneID:55998023"
     mRNA            join(<567524..567770,567835..568445,568500..568796,
                     568850..569218,569275..>569454)
                     /locus_tag="TRUGW13939_10544"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493655.1"
                     /db_xref="GeneID:55998023"
     CDS             join(567524..567770,567835..568445,568500..568796,
                     568850..569218,569275..569454)
                     /locus_tag="TRUGW13939_10544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349548.1"
                     /db_xref="GeneID:55998023"
                     /translation="MRQSHPFNLLGAAFLLVALATALPDGDHDMNMDGDMDMGHKDTM
                     SKPAEDWAQSYFALGQHSGSILAHIILEVISWCFILPVAVMLSIAHSRYTIPLQFVFL
                     AVNAVALLFGTIYNTSTPDLYENNAHHKIGWIATWVAGAQVIIGLIYAYSGRGRSKSG
                     PDYERATFMPVSTQNMMGHQQLYSPVGEYRWSGDSGQGTSCPATPDEERFSKPEDDEE
                     DVEVPTPLARGWLRSAALDRFFTSRVPSLVSNRALRVLRVVYNVIDRIILPFGFIAVA
                     SGGVTYGGIFRGQGIFSGLAHFIKGGIFFWYGLVVLGRFMGCWANFGWAWNLKPAESR
                     AVTGEFVESALIFTYGSTNVFLEHLGGWGQAWTPQDLEHVSISVMFFGAGLCGLLLES
                     KRVRSWLKQSIMGKTAAPVSQQAEEEETSGVSFNPMPLLIIFLLGTMMGGHHQQQMVS
                     TMVHKQWGNLLSGAAMARAVTYMITYVKPPTSYLPARPPSELVGAFCLISGGLIFMLS
                     ASDIMDVMVFYDLDAMFTFNVAVGVSCFIMAYEILVIAVKAWAVKKETVQYHARSWSS
                     A"
     gene            complement(<569833..>571240)
                     /locus_tag="TRUGW13939_10545"
                     /db_xref="GeneID:55998024"
     mRNA            complement(join(<569833..569936,570460..571016,
                     571215..>571240))
                     /locus_tag="TRUGW13939_10545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493656.1"
                     /db_xref="GeneID:55998024"
     CDS             complement(join(569833..569936,570460..571016,
                     571215..571240))
                     /locus_tag="TRUGW13939_10545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349549.1"
                     /db_xref="GeneID:55998024"
                     /translation="MSLSSGVNIANEGEGFFTTPGRTASGKLQRTISPSFSDLWSQPR
                     LFFNSLVPTEQQFLINAIRFETANVKSTVVRNNIVIQLNRISNDVAKRVARALNVEEP
                     QPDPTYYHDNKTTDVGVFGTKLKRLDGLKIGVLASVAERSSIDEANALRSSFASDDVD
                     VIVVAERFEAGVDQTYSASDAINFDAIIVADGADDRDGWWEKREDGRMGSGNWKVPQE
                     SGGPRPTVST"
     gene            <571417..>572325
                     /locus_tag="TRUGW13939_10546"
                     /db_xref="GeneID:55998025"
     mRNA            join(<571417..571423,571560..571885,571952..572069,
                     572123..>572325)
                     /locus_tag="TRUGW13939_10546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493657.1"
                     /db_xref="GeneID:55998025"
     CDS             join(571417..571423,571560..571885,571952..572069,
                     572123..572325)
                     /locus_tag="TRUGW13939_10546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349550.1"
                     /db_xref="GeneID:55998025"
                     /translation="MADPAYFAYPKTANPKKAIILITDVFGIVSNSQLLADDFARNGY
                     LAVIPDILNNDSINFGDWGTSRVNFPAWIAKHGPETVEPAIEATIKHLREELGVEKIG
                     TAGYCYGGRFVVSFLKNGKTDAGYTAHPTAIQTGQLAAIEKPLSIAAAEIDTVWPTEH
                     RHEAEGILSKTGQPYQINVYGGVQHGFAARGDMSNAHLKTSKELAFLQALNWFQYYL"
     gene            <572934..>573966
                     /locus_tag="TRUGW13939_10547"
                     /db_xref="GeneID:55998026"
     mRNA            join(<572934..573129,573191..573328,573383..573464,
                     573520..573707,573758..>573966)
                     /locus_tag="TRUGW13939_10547"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493658.1"
                     /db_xref="GeneID:55998026"
     CDS             join(572934..573129,573191..573328,573383..573464,
                     573520..573707,573758..573966)
                     /locus_tag="TRUGW13939_10547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349551.1"
                     /db_xref="GeneID:55998026"
                     /translation="MAFSPSALLALPFSPARLRSYLLRLPLFTRAVLLIIVALWAMEL
                     QTVWNIVKWGALIPDEMNLGTMYRLNTYPVIHSGFFHVLLNILALTPLLERFETEHGT
                     LTAVALFVGPLSTFPGGIYTLIEKFILHMNTAVVGASVWVFLLLASEAIRTFRANPYL
                     QLGPIKIPTWTSPLIASFVVAVLVSHTSFLGHICAIFIGYLLGLGYLKVFVPPEKVIR
                     WIEGKLNLLGRLPHYVSVDQKKHGRYGLLPTTSTEPAVAMSNYIGSSQRLGP"
     gene            <574950..>577028
                     /locus_tag="TRUGW13939_10548"
                     /db_xref="GeneID:55998027"
     mRNA            join(<574950..575296,575362..575600,575655..576472,
                     576531..>577028)
                     /locus_tag="TRUGW13939_10548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493659.1"
                     /db_xref="GeneID:55998027"
     CDS             join(574950..575296,575362..575600,575655..576472,
                     576531..577028)
                     /locus_tag="TRUGW13939_10548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349552.1"
                     /db_xref="GeneID:55998027"
                     /translation="MPFPLKVLFPNVIVASGLVRKLRDDPYLLFARLPSYISLLCVIV
                     GVASLLILPLDEYSRGTYISENALLPGQVHTYFAGSEQNIFRGYKKELEGLLSVNSGD
                     GASETYEHGENRTEVSEKVQSIFRAAGLKVATQNYEYESAGALHKGQNIYSIIHAPRG
                     DATEAIVLVAAWRTIDGELNLNGVTLALTLARYFKRWSLWSKDIIFVITPDSKSGTQA
                     WIDAYHDMHPASVQSLPLKSGALQGALVIEYPFEHRFESLHIVYDGVNGQLPNLDLIN
                     TAASIATGQMGIGTSLQEMWEHDNSYEKRLETMLRGMAKQGLGLAAGAHSSFIPYHID
                     AITLQTKGNGWEDEMALGRTIESLFRSLNNLLEHLHQSFFFYLIMHTHRFVSIGTYMP
                     SAILIATNFTIMAVALWLMSGYKVISPSTEKKATSASKAEVDATSERKLSVPLTLVIA
                     LHFLGVIPLYILNNISSQYFLFATYLILAFTILLPVLFSVVLCKLLAPPPQTFLLIKS
                     FSLLLLGLFLSALATLNFSLSFLIGLVCAPLSFTGPITATSIKSKPLRLALAALALAA
                     LNALSPPAVLLSACWFMQLSVRQVLTQAAFGWNVWGMWTQVVVWCVWWPAWMAGTLLL
                     GSSFFVDLV"
     gene            complement(<577184..>578440)
                     /locus_tag="TRUGW13939_10549"
                     /db_xref="GeneID:55998028"
     mRNA            complement(join(<577184..577825,577884..578119,
                     578173..>578440))
                     /locus_tag="TRUGW13939_10549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493660.1"
                     /db_xref="GeneID:55998028"
     CDS             complement(join(577184..577825,577884..578119,
                     578173..578440))
                     /locus_tag="TRUGW13939_10549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349553.1"
                     /db_xref="GeneID:55998028"
                     /translation="MEADKISDFLADQRDQASGEAQALFLNFEDFWERKLWHQLTDAL
                     VEFFRLPESAPQRLPIFKSFILSFADRINQLKFVSLGLMASTQCSVDQERLAFLTSLA
                     ERVDKPESQEAHVYAVADVAGVKLRLQDFEGARKDLDKSQKILDGFDSVETIVHASFY
                     KVNAEYYQAKQEFASYYKNALLYLACIPLEDLSQEERATRAYDLSVAALVSDSIYNFG
                     ELLLHPILDSLTETPHAWLRDLLFAFNRGDLTAYDVLAGNVSKNKLLDSHRQFLYIKI
                     SLAALTEAVFRRPPHDRTMTFSTISTETKVKPDEIEHLIMKALSLGLIKGSIDQVAQI
                     ARINWVQPKVLDMKQIEGMRNRLKEWDSGVNQLGHWIEGVGRDVWAQ"
     gene            <579224..>580064
                     /locus_tag="TRUGW13939_10550"
                     /db_xref="GeneID:55998029"
     mRNA            join(<579224..579261,579324..579495,579549..>580064)
                     /locus_tag="TRUGW13939_10550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493661.1"
                     /db_xref="GeneID:55998029"
     CDS             join(579224..579261,579324..579495,579549..580064)
                     /locus_tag="TRUGW13939_10550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349554.1"
                     /db_xref="GeneID:55998029"
                     /translation="MTDILEANIRVFNKDAHKYETDFQEAIRMLCEETESRRLWISSK
                     WSDTPEGNGKDVKLLDYACGPGYISRVLAPYVTKIVGIDASEGMVGEYNKKAQEAGIP
                     PEKMSARAGNILGDSFSEDFKGPEYHDFDVAFVGLALHHFSDPLLSMKRLVDRLRVGG
                     VLWIIDALDQPHAHHEHEKLSPETKAAIHTHGFTVDQVKDLFAQAGAGADVRVEVIDK
                     PFEIKTPNHTFKRTAFFARGQKL"
     gene            <580405..>581867
                     /locus_tag="TRUGW13939_10551"
                     /db_xref="GeneID:55998030"
     mRNA            join(<580405..580559,580616..580629,580679..580741,
                     580791..580885,580941..581333,581385..581720,
                     581769..>581867)
                     /locus_tag="TRUGW13939_10551"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493662.1"
                     /db_xref="GeneID:55998030"
     CDS             join(580405..580559,580616..580629,580679..580741,
                     580791..580885,580941..581333,581385..581720,
                     581769..581867)
                     /locus_tag="TRUGW13939_10551"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349555.1"
                     /db_xref="GeneID:55998030"
                     /translation="MQKCRAFNGALGRKAVPAPASVRVQFQAQRRNLQDVHITRTGKP
                     ILKIQGGRSSLGGHTATVFGATGFLGRYIVNRLARAGCTVVVPFREEMTKRHLKVSGD
                     LGRVVFTEYDLRNTQSIEESVRHSDVVYNLVGRDYPTKNFTYEDVHVDGAERIAEAVA
                     KYDVDRFIHVSSFNASEDSPSEFFRTKGWGERLVREIYPETTIVRPAPLFGYEDNLLH
                     KLAGVTNLLTSNHMQERYWPVHAIDVGSALERMLYDDLTAGQTYELYGPKQYSTAEIA
                     EIVDREIVKHRRHVNLPKAVLKPLAFYLNKYLWWPTMSADQVEREFIDQVIDPSAKTF
                     KDLGIEPADLTNLTFNYLMGYRSSQYYDLPPATEREKREEKKYLHVLDDQ"
     gene            <582471..>583216
                     /locus_tag="TRUGW13939_10552"
                     /db_xref="GeneID:55998031"
     mRNA            join(<582471..582550,582604..>583216)
                     /locus_tag="TRUGW13939_10552"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493663.1"
                     /db_xref="GeneID:55998031"
     CDS             join(582471..582550,582604..583216)
                     /locus_tag="TRUGW13939_10552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349556.1"
                     /db_xref="GeneID:55998031"
                     /translation="MTTQFQERPLFGGAITGTIPQGWLDASDLRQVPNHQEIFLSSTT
                     LSNLIVEINEYVSAQEAPPPAAGSAAGTEEEKIGVAAALYHMQDLCDEDDTMEVINAP
                     HRVQLSRLAASSSAAGVTISAFAAVVKYTTPKKQRGPHQHQISTNSSGDATAGSSAAA
                     TPQKSVHGSHFLLVRLPEKETDLLVFVNVPHDEFDAQGDSGALAREEALASELVGRYI
                     ETIDVVDWNLFG"
     gene            complement(<583466..>585766)
                     /locus_tag="TRUGW13939_10553"
                     /db_xref="GeneID:55998032"
     mRNA            complement(join(<583466..584983,585034..585443,
                     585502..>585766))
                     /locus_tag="TRUGW13939_10553"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493664.1"
                     /db_xref="GeneID:55998032"
     CDS             complement(join(583466..584983,585034..585443,
                     585502..585766))
                     /locus_tag="TRUGW13939_10553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349557.1"
                     /db_xref="GeneID:55998032"
                     /translation="MSVRVVARVRPLWKSERELDIIVRPGSASTEPARTKKDSPDGKA
                     AAALKDRDTLIRIPNPKNEGEQYTFQFNAVYGGDSTQQDLFDAEVAPTVKHLFNGFDV
                     TIFAYGVTGTGKTHTMRGGKSLQDRGVIPRLLSAIYRRSRKIEKDSQGASNVEVLMSY
                     YEIYNDKVYDLFEPLEKRTPAGLPLRDNGGKTVVVGLTERPCANLKDFESLYDQANAN
                     RSTSATKLNAHSSRSHAILCVKIVTTTGEKTRVTMASAIDLAGSEDNRRTENGKERMV
                     ESASINKSLFVLAQCVEAISKKQSRIPYRESKMTRILSLGQNNGLTLMILNLASVRSY
                     HLDTISSLNFANRTKKIEIREIENEPMFKGPARPLTRASTTGGALRQPLRPLTSSVNV
                     KVNVENPSTSDEKKPAKAFFVYSDKQSLKSHTPFDRPRRSSPLKRNSDVSTRLPSKIP
                     RESDRSASKAHGDIPADRIEEMVERKVEQILAARAMDDSSKQQAQMEHMNEEVQRRLE
                     LLERKIEGTEDARAEGLSYLLMAKQHHGRGEYSSALRMYRLALPFFPRNEKLAAKIAA
                     LEEKLNPQPQVTAEVQVAGRGSILSIKKPVKMARTHAAIDENYKIFEHEDEDDYGDSY
                     IGLKRKRATATPKMAVLKDDNTFAGENAIPDRIQSPRTSHLLSVINSRDVGQIKLLKG
                     VGAKKAEAIVDCLCEMGEVDQVRSLSELGRLKGVGLKTVQNMRSGVFV"
     gene            <586980..>592578
                     /locus_tag="TRUGW13939_10554"
                     /db_xref="GeneID:55998033"
     mRNA            join(<586980..587507,587561..589207,589277..589846,
                     591298..591416,591474..591669,591721..592102,
                     592154..592501,592550..>592578)
                     /locus_tag="TRUGW13939_10554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493665.1"
                     /db_xref="GeneID:55998033"
     CDS             join(586980..587507,587561..589207,589277..589846,
                     591298..591416,591474..591669,591721..592102,
                     592154..592501,592550..592578)
                     /locus_tag="TRUGW13939_10554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349558.1"
                     /db_xref="GeneID:55998033"
                     /translation="MASPQGDYPPQEGYDQQPPAPGAGPAAQAGAKKKRAYAGQAFDF
                     GSGANAALGGQQQGGGNYGAYAAQAAAAGYPPAGYGADPAAGYVAPAVPAPGGYQPPV
                     AGYPGPADAGVAQVTQQFGHMGVGDPNQPQQPMQPQQVPRAVPLNQLYPTDLLTQPFN
                     VAEIDYPPPPIILPPNTSIYPSPYANCPPKYVRSTLNAVPTTHSLLKKSKLPFALVIQ
                     PYAALHDAEDDVPVIPDQVISRCRRCRSYINPFVSFLDQGHRWRCNMCNLTNDVPQAF
                     DWDTTLQKPADRSQRPELNYSVVEFVAPQEYMVRPPQPLVYLFLIDVSYASVTNGLLA
                     TAARCIKESLDRIPNADRRTRLGFLAVDSSLHYFTIPRDGSENSDPRMLVVSDLEEPF
                     LPIPGDLLVTLSECRENIETFLDKLQDMFQNTQNGGCALGSGLRAGYKLIAHVGGKIT
                     VLSSSLPNLGHGALTVREDKKVLGTSKEGSLLQTGNSFYKSFAVECSKAQVSIDMFLF
                     SSQYQDVASLSNLPRYTGGQTYFYPGWNAARTEDAIKFAREFSDYLSSEIGLEAVLRV
                     RATTGLRMNTFYGNFFNRSSDLCAFPGFPRDQAYVVEVAIDETVTKPVVCLQTAVLHT
                     TCNGERRIRVLTLALPTTQTLADLYASANQQAITTYFSHKAVERVLGSGLEQAREAVQ
                     SKLVELLSTYRKELAGGSVGGGGLQFPANMRGLPVLFLALMKNLGLRKSAQIPTDMRS
                     AALCLLSTLPMNLMIQYIYPKLYSLHDMPDDAGLPDDKTGEIVLPPPINLSSERLVPY
                     GLYLIDDGQTQFLWVGRDAVPQLVLDVFGVSDKNQLRVGKQFLIELDNDFNERVRAVL
                     QKSRDHKAKGVGSIISPQLYVVKEDGEPGLRLWAQTMLVEDRTDQSPSLQQFMASLRD
                     KRAAMAQSQNPQGGSRKISFNVSDQYDIQDVIGEGAYGVVCSALHKPSGQKVAIKKIT
                     PFDHSMFCLRTLREMKLLRYFNHENIISILDIQRPRNYDSFTEVYLIQELMETDMHRV
                     IRTQELSDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARS
                     AASTDDNSGFMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGK
                     DYHHQLTLILDVLGTPTMEDYYGIKSRRAREYIRSLPFKKKIPFKALFPKTNDLALDL
                     LEKLLAFNPAKRITVEEALRHPYLEPYHDPEDEPTADPIPEEFFDFDKNKDALSKEQL
                     KLLIYEEIMR"
     gene            complement(<592792..>593848)
                     /locus_tag="TRUGW13939_10555"
                     /db_xref="GeneID:55998034"
     mRNA            complement(join(<592792..593414,593491..>593848))
                     /locus_tag="TRUGW13939_10555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493666.1"
                     /db_xref="GeneID:55998034"
     CDS             complement(join(592792..593414,593491..593848))
                     /locus_tag="TRUGW13939_10555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349559.1"
                     /db_xref="GeneID:55998034"
                     /translation="MPPSQNQSPPIFLLKTAATPRDLYEEYFRKEFCVNTQSHGYNPV
                     FVPVLSHRMHTENLARVESFFTSHQTHQNDGGDEEKEKGEVESFIGENPTYGGMIFTS
                     QRAVEGFRDVLKQGNIPAPVSQNLVLYTVGPATTRLLTPLRDQYLPHARIVGEEAGTG
                     EKLALIILNDYNNTWHHTNKPKPGLLFLVGEQRRDIIPRTLMNDSLEEHRRIRVDELV
                     VYETTEMPGFEASFRDAVTSGEKVLNDNDSNMWVTIFSPTGCDAVLRVLGELSSSGNE
                     QKKKCLIVTIGPTTRDHLRIKHGVEPDAVAETPNPEGVGEAIRKFYNNTQ"
     gene            <594860..>596935
                     /locus_tag="TRUGW13939_10556"
                     /db_xref="GeneID:55998035"
     mRNA            join(<594860..595667,595738..595873,595932..596038,
                     596096..596490,596549..>596935)
                     /locus_tag="TRUGW13939_10556"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493667.1"
                     /db_xref="GeneID:55998035"
     CDS             join(594860..595667,595738..595873,595932..596038,
                     596096..596490,596549..596935)
                     /locus_tag="TRUGW13939_10556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349560.1"
                     /db_xref="GeneID:55998035"
                     /translation="MTATRDPCSLSNYGAWRTKHTSVDFKIDFDVKQIHGSVVLQLES
                     QTDKESEEVILDSNSVKISDVRVNDVEAKWEIKDHSDPFGAPLHVAVPGGVSKEEVIH
                     IKIHVQTTDKCPALQWLSPAQTSNGKHPYIFSQAYPINARSIFPCQDSPDVKSTFSFR
                     LTSKLPVVASGLYVGDRDHTATLGTEKVYEFEQKIPIPSYLFAVASGDIATARIGPRS
                     IVATGPNELAACKWELENDIEKFLQAAEKLVFPYRWGEYNVLILPPSFPFGGMEIPIY
                     TFATPAIISGDRQNVDLFAHELSHGWSGNLVTNCSWEHFWLNEGWTIYLQRRIVGAVN
                     GDAEFHFSAILGWKRLEDDVEQFGKDHEYTKLVVNHDNVDPDEVFSTVAYEKGFHLLY
                     YLEKVVGRENFDKFIPHYFDKWAGKSLDSFEFRDTFMDFFNETGDAEIKKNIATIDWN
                     DKLYTPGLPPKPEFDTTLADQCFELANKWKDPSFEPSEKDVEEFTANQKLTFLETVQQ
                     AEKPLSPERAQLLGKVYNVATSTSVELKTSYLLVALKANDTSCFSDVAEWLGHVGRVK
                     YVRPLLRALNKVDRQLALDAFQRHKDFYHPFCRGLAEKDLGITA"
     gene            <597925..>599098
                     /locus_tag="TRUGW13939_10557"
                     /db_xref="GeneID:55998036"
     mRNA            join(<597925..598916,598978..>599098)
                     /locus_tag="TRUGW13939_10557"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493668.1"
                     /db_xref="GeneID:55998036"
     CDS             join(597925..598916,598978..599098)
                     /locus_tag="TRUGW13939_10557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349561.1"
                     /db_xref="GeneID:55998036"
                     /translation="MPSQRRKGQSKASESSSVASKYMLPLTENFGPVFFKNQFRTKIN
                     LPTKEKYPTIAEKGSCAIITGSNIGLGLESSKQLLSLGLSHLVMAVRSIEKGNTAAKQ
                     LRAAAVANANPSAKIDVWQLDMESYESIQAFAQKCQEDLTRIDFVILNAGLSPMTFST
                     NPSTGHEKTIQVNHISTVLLSILLLPVLKNKSMRRDQPARLTIVNSVTAHLCKIPNKD
                     KRPFLSSFDNTAITPWDAEERYGVSKLICQLLIVRLAERVDPDQVIINMVDPGLTKGT
                     GLARDATGATGVAAKMFFSIAGRPVDRGAATYVDAIMGHGKESHGCFLMNCQIAPLSR
                     WFYTDGKVLTDPIWTETLQELRFANVEQIIASMRRD"
     gene            complement(<599423..>600637)
                     /locus_tag="TRUGW13939_10558"
                     /db_xref="GeneID:55998037"
     mRNA            complement(join(<599423..600104,600168..>600637))
                     /locus_tag="TRUGW13939_10558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493669.1"
                     /db_xref="GeneID:55998037"
     CDS             complement(join(599423..600104,600168..600637))
                     /locus_tag="TRUGW13939_10558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349562.1"
                     /db_xref="GeneID:55998037"
                     /translation="MSLQSLRYLVSNLVSAVSKQKLFPLESCILFDKQEGQQWLELMT
                     FDPVFLHTIVFTTLTYHDSLLGRQECAPTNTQISLHFTKTLRLFRERLILEDDGAKFS
                     DITIFIVLGLAIYAYLTGERKAAEYHLSALRTIIDFRGGLSVFWHNEKLLFELFRCDI
                     GRALNNGSTPFFFYNPLVEPFPPYPEEELLLGFLGSDTQATQGNKHKFLDEVDKDLAK
                     AWSIVEQFSARINLVDETKNKLPKKLLLDTMASVMYRVMHMSYEYGSLDECIRLGLLA
                     YSSSIFLQWSNRRTSYHRFSTAYRDLLTTSHFLDLFPIHFRLWFLVTGAVSIFKEHDD
                     QWLKSQLLYIIDSCKLERWDQVKNILHSIMWIDLLHDHLGKGFFDNIVT"
     gene            <602584..>604117
                     /locus_tag="TRUGW13939_10559"
                     /db_xref="GeneID:55998038"
     mRNA            join(<602584..602628,602692..602832,602888..>604117)
                     /locus_tag="TRUGW13939_10559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493670.1"
                     /db_xref="GeneID:55998038"
     CDS             join(602584..602628,602692..602832,602888..604117)
                     /locus_tag="TRUGW13939_10559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349563.1"
                     /db_xref="GeneID:55998038"
                     /translation="MRICVVVPGTASESETPVRPQLSDYIDTKLYPIETRQITKENAI
                     AEIDDLEIGRADVFINYLFHQDPYDQKWAEALKYLNTKTSLTGIGTVSDSLLKSLHVA
                     ESLDKANGVGPTTSQLALPNATLKNQGGDFSVLVVLIGQNAFALTPLEYKDQETTWKL
                     AGDSELTERLRDNAKSTFEHIRGTTEEYLGYLRVNLHVDRASIEISTINADPAPRLFY
                     PQGTSPWDDEVIAKTFPGGHAAFFEVILSTRLARIPQYVMRNEGCARQQGRLARLYYT
                     VLATNVTQTRLSPFVGKYDYNGTVLDCCSGSGEFARFAIDAGVQAKYTALDYSVEMTA
                     LPISKKCYEQPFIIGPVQEILSKAPMHDHVVCFGSFHLLQPFDFFSTVSQMFLRARKS
                     VTFDVDDLSQTYIQNFPEASSEKCWEKLEYNHNNVAQAFRFGVPVGWRAVLNGERRFA
                     YRSLVMGEDVYTHSFRFERVK"
     gene            complement(<604316..>605668)
                     /locus_tag="TRUGW13939_10560"
                     /db_xref="GeneID:55998039"
     mRNA            complement(<604316..>605668)
                     /locus_tag="TRUGW13939_10560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493671.1"
                     /db_xref="GeneID:55998039"
     CDS             complement(604316..605668)
                     /locus_tag="TRUGW13939_10560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349564.1"
                     /db_xref="GeneID:55998039"
                     /translation="MQSADATSNWDFTEVIGLLRTPTKPPTSSKDDSLKNDRRNGYEA
                     NVDRSSDHTRLGDFSALWDALRQPAVIRKPSEVDKTTRRSLEEASAATYEEPPSNSPS
                     KPISILKRRPEVKSLRQQTRLNNDTSLGVLSDSTAEAISDGDVSVFDSPVQRKSTLAF
                     VPSQIHTIEEITPVLTPPSSCEESTTPLKTYEKVTEKTPRYKSAADRKAGLVLKLGKK
                     FPEFIGLTPPSRLSPQTHDLHVFVDASNISIGLHDSYKIQHGIPVTTHIRRLPLSFHN
                     FSLILERGRPVAKRVLAGSDRFAAINEAEKIGYEVNILSRVHKAKEYTPRQLKFRNTP
                     NHGGGVGSETGSSSPPERWVEQCVDEILHLKMLESLIDTDKPATIVLATGDAAEAEFS
                     GGFLRMVERALQKGWNVEVVSFAMNTSFAYKRKEFRAKWKSQFRMINLEDYVEEMLDM
                     "
     gene            <606396..>606779
                     /locus_tag="TRUGW13939_10561"
                     /db_xref="GeneID:55998040"
     mRNA            join(<606396..606429,606485..606677,606740..>606779)
                     /locus_tag="TRUGW13939_10561"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493672.1"
                     /db_xref="GeneID:55998040"
     CDS             join(606396..606429,606485..606677,606740..606779)
                     /locus_tag="TRUGW13939_10561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349565.1"
                     /db_xref="GeneID:55998040"
                     /translation="MSDFGRKDFTSKAKEELTPDASKSTQQKLSENVSDTADRVVRGG
                     QPDDSKSNVQSAFDKTQRTSDNEAHGGATNSIGDKIKDTLGLNK"
     gene            complement(<606988..>607851)
                     /locus_tag="TRUGW13939_10562"
                     /db_xref="GeneID:55998041"
     mRNA            complement(<606988..>607851)
                     /locus_tag="TRUGW13939_10562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493673.1"
                     /db_xref="GeneID:55998041"
     CDS             complement(606988..607851)
                     /locus_tag="TRUGW13939_10562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349566.1"
                     /db_xref="GeneID:55998041"
                     /translation="MDSPLISPAKARQAAIQAKDWAYINSWLSRKYSPNRVPPFERNE
                     DTLKALLAIAAANDAADEEAALVHRAREEVIQALKERDEAEHPRKKEILENIEAHLDA
                     TGEKSVNDLAETTTVLGSSSTDTIELAHAIMELTRDEFDAANQVQKVESLQNYLNKEM
                     DSLQKEVTVLLTDPAYTAPAELSSQTMEWVRSAKMLGAKVSEYRDRIASLQRSVNTDG
                     STIPDLVAEEEKVIEIQESVDHLEKSIKTFYDLPPDLEDAKKEYKRLEKELASLTQER
                     DKLFEKAVSRG"
     gene            <608058..>610329
                     /locus_tag="TRUGW13939_10563"
                     /db_xref="GeneID:55998042"
     mRNA            join(<608058..608351,608407..>610329)
                     /locus_tag="TRUGW13939_10563"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493674.1"
                     /db_xref="GeneID:55998042"
     CDS             join(608058..608351,608407..610329)
                     /locus_tag="TRUGW13939_10563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349567.1"
                     /db_xref="GeneID:55998042"
                     /translation="MESYAANATESAADDSSVTSPPLSGANVAPRSNALSNRLTSVLS
                     ASYADSDIRDALETLDIRETHNTPETRRQLRLDVQKEVISCNGEIVADFGKVAEQLKQ
                     LGSVIVDLQQICTEMRKHITLSKQETAAVLDEAASLTEQRRETETKQRLLDAFNKHFV
                     VPEDDLNLLTSTGEPVNEQFFVVLARVKQIHNDCQVLLGGEDQRLGLEIMEQSSKQLN
                     SAYQKLYRWIQKEFNSLNLEDPQINSSIRQALRVLAERPSLFHSCLDFFAEAREYILS
                     DAFHHALTDSVSGAAADQNVKPIEFSAHDPLRYVGDMLAWVHSAAVSEREALEALFVY
                     EGDELARGLQAGLSSEVWSRVDEEETPVFDGKKALNDLVNRDLGGVSRSLRQRVQLVI
                     EGHDNAVTTYKVVNLLAFYKTTFSKLVGPESHLTEVVTGLVESTFKHFETLMRDQAHL
                     HSTDPHSSTPPDDLSVPQFLADELEALASLMKEYNASVGAAVDVQDQEENEFTPVLRV
                     ALDPFLDIAKASANELDDDKASTIYKTNILLAVRATVSSYPFASATHLSPISNVLSNL
                     RVELLDIQRQFLLETSGLQDLLTALEPFSQKAPKTQTQNLAEIGDLTAFQPATLSAIS
                     QQLDDFLPSALMDATDNLKRVRNLSLVKSVTEEAVEEFCRDFEFVEGMIIGADEARGT
                     KVDMSRIEMESDIVSVSVRGTQIGGNNDEADTSAEGKHSLRALFPRTVGEIRVLLS"
     gene            complement(<610452..>611613)
                     /locus_tag="TRUGW13939_10564"
                     /db_xref="GeneID:55998043"
     mRNA            complement(join(<610452..611227,611274..611399,
                     611449..611492,611555..>611613))
                     /locus_tag="TRUGW13939_10564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493675.1"
                     /db_xref="GeneID:55998043"
     CDS             complement(join(610452..611227,611274..611399,
                     611449..611492,611555..611613))
                     /locus_tag="TRUGW13939_10564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349568.1"
                     /db_xref="GeneID:55998043"
                     /translation="MAQPAMSPFSQAVVAAMRKIYPESLADKSFDNTGLLLESPFDPK
                     QQLKNSVLLTTDLTKAVADEAIARRDSIIVAYHPIIFRGLKSITLQDPQQKSLLRLAQ
                     EGISVYSPHTAVDAVPGGMADWLCDIVSGSVSGPSASLQNDLQNQTQQSDPTSSYSDV
                     IYPQAGHNEIQTTNIIPHTRSAIHPSPDPVPSGFEGAGAGRILTFTDPQPLATLLDRI
                     GRATGNPGSLSVAIPQDASISSLNITTVGVCPGSGSGVLTKGSVLPDLLFTGELSHHE
                     ALAAIERGSVVVTLFHSNTERGYLHDVMRSNLADALKQDGQVAVSKADRDPYGIVVRK
                     "
     gene            <612177..>612648
                     /locus_tag="TRUGW13939_10565"
                     /db_xref="GeneID:55998044"
     mRNA            join(<612177..612399,612467..>612648)
                     /locus_tag="TRUGW13939_10565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493676.1"
                     /db_xref="GeneID:55998044"
     CDS             join(612177..612399,612467..612648)
                     /locus_tag="TRUGW13939_10565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349569.1"
                     /db_xref="GeneID:55998044"
                     /translation="MFARRAGLLSRGYRYLVAPNQHPQTFSSLSSRAFAAVNAAMADT
                     ANTSGVTADGLKQKLAAGLGAPHVEVEDISGGCGQSFQAIIVSPQFDKKTMLARHRLV
                     NSVLKEEIAAIHAWTPKCYTPEQWQKAQEERA"
     gene            complement(<612796..>613522)
                     /locus_tag="TRUGW13939_10566"
                     /db_xref="GeneID:55998045"
     mRNA            complement(join(<612796..612824,612880..613045,
                     613099..613259,613315..>613522))
                     /locus_tag="TRUGW13939_10566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493677.1"
                     /db_xref="GeneID:55998045"
     CDS             complement(join(612796..612824,612880..613045,
                     613099..613259,613315..613522))
                     /locus_tag="TRUGW13939_10566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349570.1"
                     /db_xref="GeneID:55998045"
                     /translation="MFAARRFTAAAPRALGAQSALFHATRPALVNVGDAVPNVDLVEN
                     SPGNKVNLAQELSGKGVIVGVPAAFTFLSPGPACSSSHIPGYINHPKLKDAGNVFVVS
                     VNDSFVMKAWAASLDPTGKSGIRFLADPAGAFTKALDLDFDSTTIFGNNRSKRYALVI
                     EDGKVKEAHVEPDNTGLNVSAADKVLA"
     gene            <615196..>617454
                     /locus_tag="TRUGW13939_10567"
                     /db_xref="GeneID:55998046"
     mRNA            join(<615196..615246,615301..615317,615415..615487,
                     615565..615708,615764..616654,616715..616904,
                     616958..>617454)
                     /locus_tag="TRUGW13939_10567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493678.1"
                     /db_xref="GeneID:55998046"
     CDS             join(615196..615246,615301..615317,615415..615487,
                     615565..615708,615764..616654,616715..616904,
                     616958..617454)
                     /locus_tag="TRUGW13939_10567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349571.1"
                     /db_xref="GeneID:55998046"
                     /translation="MDGQSSNTSSAGNSSDFVRKLYKMLEDPSYSEIVRWGDENDSFV
                     VLECEKFTKSILPKHFKHSNFASFVRQLNKYDFHKVRQNNEETGQSPYGPNAWEFKHP
                     EFKANNKDSLDNIRRKAPAARKPTQISEEAVPTAQIDLMNSQLIAQQQQIQQLTDRNA
                     QLTVDSQVLLQEVMRMQKNVMQHECVIHQFMNYLITVDARHRRESRASGPFAAQDGVT
                     PNPVDDLPASPLQQASKILSDMNNSQMPANVPPQMDPLNDPSKAQVLATPPLGPTARN
                     GVARAPNSAGSAASMGYPKVNGELENVVYPVGTTNGIDPMYSEHVGQIPYSIPPTKEL
                     AIDTSDARRQYPENRKKTALVNPGWIKQPQILLVEDDVTCRHIGGKFLGSFKCNIEYA
                     YDGLEAVNKVQSGKRYDLILMDIIMPNLDGVSACHLIRQSDRTPIIAMTSNIRSDDIQ
                     LYFQHGMDDVLPKPFTRKSLLDMLEKHLVHLKTVPPTMDGVSATPMTTQNSAAQSIKE
                     DSSPGQSPAASMNNWQSPSQLQGMSPVPLNVQQVPQPYMQQMAPNAAPFAIDPNGVQY
                     AAPQATINQSAVRPPHRRQISEISGVQDPAAYAKRQRMYQNPQMMSQVAGQQGG"
     gene            <618747..>621117
                     /locus_tag="TRUGW13939_10568"
                     /db_xref="GeneID:55998047"
     mRNA            join(<618747..618839,618907..618963,619011..619135,
                     619189..620354,620408..>621117)
                     /locus_tag="TRUGW13939_10568"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493679.1"
                     /db_xref="GeneID:55998047"
     CDS             join(618747..618839,618907..618963,619011..619135,
                     619189..620354,620408..621117)
                     /locus_tag="TRUGW13939_10568"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349572.1"
                     /db_xref="GeneID:55998047"
                     /translation="MAPKQKGGSSGGGGKQKGNTADEVEETLQAVVLADTFETRFEPF
                     TLEQPRCLLPLANTPLIEYTLEFLANAGVQEVFLYGGAHSSILEKYINASRWKAPSSP
                     FKKFTFLKSTSTSVGDVMRDLDGKHLITGDFIAVSGDVISNLPIEEVLAKHRARRQTD
                     KNAIMTMVLREAGTQHRTKASSISPVFVIDPTKDRCLHYEEIDRHDSSAGARLNIDVE
                     LVTSHAELDIRQDLIDCNIDICTPDVLGLWSDSFDYQDPRKHYLFGVLKDYELNGKTI
                     HTHILKDHYAARVRNLKAYDAISKDIISRWTYPLCPDTNLLPSHTYELRRGNLYQERG
                     VILARSCVVGRRTVIGQGTSIGDKTTVANSVLGRNCKIGKNVVLDGAYIWDGAVIGDN
                     TEVRRAIVGEQVTVGANCKIEPDVLLSSGVKISNGVTVRRGLRITTAPREDGSPANDA
                     NVVGENGQGYEYVPEEDEDDDDDRSDSSGLVYNMPDLALSTASISTLSSEISADDDYF
                     RGQRSDSFGTSASEDEGHESFQHDATLGLYEGLRDGTAADMVQLELVSLRMSQNASDQ
                     QVRRALASSFMKVISQMTESGKSAGDAVKEMFTRYKEVFDRSLFDKDTEAKPDQVDLL
                     LQIQQDLAHRNKGDTILLFAAKELYDLDIIEEEAYEAWWADERSSSTEEMRKVRSQAQ
                     QFVDWLANASEEEDDDDEDDEDEESDDEEEDSDE"
     gene            <625374..>626705
                     /locus_tag="TRUGW13939_10569"
                     /db_xref="GeneID:55998048"
     mRNA            join(<625374..625405,625467..625536,625605..625640,
                     625707..625839,625904..625996,626048..626104,
                     626158..626602,626657..>626705)
                     /locus_tag="TRUGW13939_10569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493680.1"
                     /db_xref="GeneID:55998048"
     CDS             join(625374..625405,625467..625536,625605..625640,
                     625707..625839,625904..625996,626048..626104,
                     626158..626602,626657..626705)
                     /locus_tag="TRUGW13939_10569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349573.1"
                     /db_xref="GeneID:55998048"
                     /translation="MAEQIPGQEYEYEALPSNYGLSHNMMAGAFAGIAEHSVMYPVDL
                     LKTRMQILHPTTGGLYTGITNAVSTIYRIEGWRTLWKGVSSVIVGAGPAHAVYFGTYE
                     AVKELAGGNVDDGHHPVAAALSGACATIASDALMNPFDVIKQRMQVHGSVHKSLAQCA
                     KTLYRTEGLQAFYVSYPTTLCMTVPFTATQFVAYESISKFMNPKKDYDPFTHCIAGGL
                     AGAVAAAITTPLDVIKTLLQTRGLATDQEVRSARGLFNAAAIIKRQFGWKGFLRGLRP
                     RIVSTMPSTAICWTSYEMAKAYFKNQMG"
     gene            <627760..>630497
                     /locus_tag="TRUGW13939_10570"
                     /db_xref="GeneID:55998049"
     mRNA            join(<627760..627846,627973..630211,630277..>630497)
                     /locus_tag="TRUGW13939_10570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493681.1"
                     /db_xref="GeneID:55998049"
     CDS             join(627760..627846,627973..630211,630277..630497)
                     /locus_tag="TRUGW13939_10570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349574.1"
                     /db_xref="GeneID:55998049"
                     /translation="MRPKPSSSMQKTYDECYLMCSTAVYFEGQNNEAEALRSWRSALE
                     TIYYHNAYRVPVNYNPKSETEKALQGSIRQLELQCKERVGLLEALQESRKESEENADD
                     NSNSGNSNKDSKQQQQQPPQQQAATSSRSKKSLFLESFKRPSNGVNNSNSSNSNSNST
                     STPGWLGDGTIPPVDYMDLSKPKPPPLPARSSTASSKTPMPPPPPPPHLERKNSGDAS
                     SALPKPSASPVPASSPLAKESSRGSSPERRKIMLTTLRQKKDSKKPAKPKSSASRTRP
                     AAASKAAGLAWGSTSPAVSTDGPSANPRHSTSSDSELRRDSETKGLSKHKTRKPLPRD
                     YIPSAHWREPQNPDPSYWSIPPPNNVQPAPSDTTVPAVPPKTTPVDQTASKPPVSRQN
                     KPLLPPEYPKYRNEYLSHPRPAARPASNTPMNRSFSATDTQALGAAENGSRTPKKSIP
                     KSHSTPRKLNIAANNRTSTSSGSGDEPARTTRRTGGASTARRPAAGRKPKAAAPRVTP
                     PSSDQEDSAGENSPEKGEDQYSRDIIKKLPKGIDVNAARQILNDIVVRGDEVHWDDIA
                     GLETAKKALKEAVVYPFLRPDLFMGLREPARGMLLFGPPGTGKTMLARAVATESKSTF
                     FSVSASSLTSKWHGESEKLVRALFGLAKTLAPSIIFVDEIDSLLSTRSSGSEHEASRR
                     SKTEFLIQWSDLQRAAAGREVDKKEGDASRVLVLAATNLPWDIDEAARRRFVRRQYIP
                     LPENHVRGQQLRRLLGHQIHEMSDEDIEVLVRVTEGFSGSDITALAKDAAMGPLRNLG
                     EALLHTPMDQIRAIRFEDFEASLFTIRPSVGQDGLKKYEDWAKEYGERGG"
     gene            complement(<630766..>631578)
                     /locus_tag="TRUGW13939_10571"
                     /db_xref="GeneID:55998050"
     mRNA            complement(<630766..>631578)
                     /locus_tag="TRUGW13939_10571"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493682.1"
                     /db_xref="GeneID:55998050"
     CDS             complement(630766..631578)
                     /locus_tag="TRUGW13939_10571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349575.1"
                     /db_xref="GeneID:55998050"
                     /translation="MPPTNVLRSLWLSRSSVFSSTVPTATTRRTTRYVSGGSRFTLPH
                     RTLTTTRPSLAEVKSTTTQGTPKETETSSEKKQQQQQEEANKRKYAFPSGITMPKPRQ
                     YPYDVKTGTVTSVGLMDKTVRVQYRHRKWEPHIQKYYPHVTTYLVSDPQGSLREGDVI
                     EFSSGARRSPRVRHVVDRIVAPFGVGIDERPAVLTREQREQQQTEKRQAKVARKLARV
                     VDEAVERNGGQPVDEADLETLKRHFLLRQFQDGKIKRLVRKRLQVEAAEESK"
     gene            <632234..>634171
                     /locus_tag="TRUGW13939_10572"
                     /db_xref="GeneID:55998051"
     mRNA            join(<632234..632708,632756..633173,633319..633393,
                     633469..>634171)
                     /locus_tag="TRUGW13939_10572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493683.1"
                     /db_xref="GeneID:55998051"
     CDS             join(632234..632708,632756..633173,633319..633393,
                     633469..634171)
                     /locus_tag="TRUGW13939_10572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349576.1"
                     /db_xref="GeneID:55998051"
                     /translation="MSQTPRKSESQRSEDSSLSLSLSLSDYPLQFKCDGNKPSCTRCL
                     HRQLSCSYTTEGDNRGTAPKSYVRLLQARIELLERILRLHNIDIYDSMAELLLLDNRD
                     ISLLSATEQSTSSVDQLCTAFEGILSLDEALNFESESEPRFFGLTSGRLSFMAISNDK
                     DNPHLSRSIQSPNIHNQALARENWGIPEELESHLLDLYFTWEQPWFQVVDEALFYKSK
                     NNYGRFYSPLLLNCILAIASRYSDRIEVRSDPTDANTAGCIFLETAEVLLHVDLKSPT
                     ITTLQSLAILGVTYWAGLAQCFRSLLVSFQHALSGLSQILEQILCTLYSPKPAHGNRK
                     RSFFDSCLLTLNTWHYDLSPELKPLRGAISTRFPQAYTLCMTYHTSVLLLAKPYLRDS
                     QDLSQHQIDADSITTKAEDLYKETAKQICSLSEQYRKTWGSFRQSPITATHCTLSAAL
                     GLFRTLSQEKEKESVVDAVLKNFETCLKTLQELSVAWTPPRKYYHNLRRMMHDQSTAD
                     DQVEINNSDSITELGDDSGQNTDQEANIERERTFSTNEIGFNSLWPTW"
     gene            complement(<634223..>634714)
                     /locus_tag="TRUGW13939_10573"
                     /db_xref="GeneID:55998052"
     mRNA            complement(join(<634223..634536,634603..>634714))
                     /locus_tag="TRUGW13939_10573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493684.1"
                     /db_xref="GeneID:55998052"
     CDS             complement(join(634223..634536,634603..634714))
                     /locus_tag="TRUGW13939_10573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349577.1"
                     /db_xref="GeneID:55998052"
                     /translation="MSGLQYYAYPGVGVRNKKTFKYSQAVRVGDNIECAGQGGWNPET
                     GEFYKEIDAQIDQAFKNVELTLKDAGGKGWEQVYRVNSYHVSINDEALDAMVRNFRKW
                     VPDHEPIWTCVGVTRLGEDDMRVEIEVVAHDPEGRAAGR"
     gene            complement(<635538..>636296)
                     /locus_tag="TRUGW13939_10574"
                     /db_xref="GeneID:55998053"
     mRNA            complement(join(<635538..635619,635691..635957,
                     636010..>636296))
                     /locus_tag="TRUGW13939_10574"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493685.1"
                     /db_xref="GeneID:55998053"
     CDS             complement(join(635538..635619,635691..635957,
                     636010..636296))
                     /locus_tag="TRUGW13939_10574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349578.1"
                     /db_xref="GeneID:55998053"
                     /translation="MSPDPESHITWFDEDDWIGTEIVFETPHASRWRVDQKLAESEDC
                     VTEFDVQQCNMQSSARGVFVCSSIDDPGKEAAVKIRMQYKPPSLFTQILPHQAEQAKP
                     EVRRQTENEVCALKRLTAAGCSSTPAFFAWKHEIQGDDGWVPGGYIDYILMERVPGSR
                     PKIWSPDMDREERDELRRAFKPAWIETIACGLVHDDSAIRNVVWHRDSQKW"
     gene            <637087..>638423
                     /locus_tag="TRUGW13939_10575"
                     /db_xref="GeneID:55998054"
     mRNA            join(<637087..637347,637449..637605,637672..637784,
                     637845..>638423)
                     /locus_tag="TRUGW13939_10575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493686.1"
                     /db_xref="GeneID:55998054"
     CDS             join(637087..637347,637449..637605,637672..637784,
                     637845..638423)
                     /locus_tag="TRUGW13939_10575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349579.1"
                     /db_xref="GeneID:55998054"
                     /translation="MAPSNLTGKKLIQQGLPDLLLSDSSTTSNSTHRIDFMATLGFWS
                     RFERDARRNFLQARWNNTVLDYDPDDRDNGPNHVNHEQLLCGDSVANGVDFNKVPDIA
                     VMDQKARLLLVGEAKTPWVHEIEKTLNHSQSRFRRYLGQIARYMHLAQCKYGFLTTYD
                     ETIFLKQEALPGRRGKWNARGHQQDISNPALYRRKVSLRECFLYLITLACEERTAKNA
                     MGLHSWITGDTLNVDKLEYLSEGSSGPSEGEGKEEEEKSRTPRSARQGDSRAARAAAR
                     ERSRNPMTLGGLEDRTSRLTLTTRNQSRREIPWKEGYVDVYFSETRREWYYPGSQEER
                     VYVELFEEEDPRGGTISYFIKGNYRYQVGERNGRR"
     gene            complement(<641095..>642450)
                     /locus_tag="TRUGW13939_10576"
                     /db_xref="GeneID:55998055"
     mRNA            complement(join(<641095..641243,641302..641581,
                     641634..641702,641758..641783,641849..642184,
                     642258..>642450))
                     /locus_tag="TRUGW13939_10576"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493687.1"
                     /db_xref="GeneID:55998055"
     CDS             complement(join(641095..641243,641302..641581,
                     641634..641702,641758..641783,641849..642184,
                     642258..642450))
                     /locus_tag="TRUGW13939_10576"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349580.1"
                     /db_xref="GeneID:55998055"
                     /translation="MAQPRENPGPFPRFKGPLELSGALDKYESIEVTPVLGREFPTAK
                     LLEWMDAPNSDELLRDLAITVSQRGVVVFRAQDGVDTEVIKKLAIRLGELTGRPSENG
                     LHIHPLFNSERDHGGADNQINCVSSEDRKRVYAAEQHQKKKVQSHNNWHSDLGFEAVP
                     GDYSVFVLTEVPETGGDTLFASGCDLYDRISTPMQKFLETLTAINASPKLEQIARDNE
                     FSMYTNQRGCPQNVGTVFRHEHPVVRTNPVTGWKSIYALGQNTESIKDLAPEESTLLL
                     DWIINILYKNHDTQARIRWKQNNDVAIWDNRSVFHCVTWDYDHLGPRMGKRALCVGER
                     PYFDPNSKSRQESVGY"
     gene            <643162..>645220
                     /locus_tag="TRUGW13939_10577"
                     /db_xref="GeneID:55998056"
     mRNA            join(<643162..643794,643847..>645220)
                     /locus_tag="TRUGW13939_10577"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493688.1"
                     /db_xref="GeneID:55998056"
     CDS             join(643162..643794,643847..645220)
                     /locus_tag="TRUGW13939_10577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349581.1"
                     /db_xref="GeneID:55998056"
                     /translation="MKYVLVTGGVISGIGKGIIASSTGLLLKTEGLKVSAIKIDPYMN
                     VDAGTMAPTEHGEVFVLDDGGEVDLDLGNYERYLNVKLTRDNNITTGKIYQHVIEKER
                     RGDYLGKTVQIVPHLTDATQDWIERVARVPVDETGAEPDACVIELGGTVNDIESAPFL
                     ESLRQLRRRAGKDNFVHIHVSLVPQIHGEPKTKPTQQAIKDIRGVGLVPDLIACRCAT
                     RLERPVIEKIAAYCQVDDEQVIVVHDIESTYRVPMLLKQQKVTSLLTKMFNLEKLVIS
                     EAQRKQGGETWKAWESLTGVSKQHLKTVSIALVGKYTNLHDSYMSVVKSLEHASMACN
                     RKLNVIWVDAEHLEPQTQNTDPAKFHKAWHELCTAQGVLVPGGFGKRGTEGMIAAASW
                     ARENKTPYLGVCLGMQIAVIEYARNVCGIADAGSEELDGAFADSKIIVNIPEIDQVSL
                     GGTMRLGLRPTYFQGGSEWSRIRKLYRRTQKPLVNGHAVNGHAVNGHAVNGHAVNGHA
                     VNGHAVNGHAVNGHAVNGHTVNDHAVNGHAANGHAANGNGVNGHAVNGHTINGEADTN
                     MPAILERHRHRFEVSPEYVKQLSKAGCSFVGKDERGERMEIMELKEHPYFVGVQFHPE
                     YLSRVLEPSRPYLGLVAASIGELQGVIDHGLRNEVASTNGKVNG"
     gene            complement(<645495..>646754)
                     /locus_tag="TRUGW13939_10578"
                     /db_xref="GeneID:55998057"
     mRNA            complement(<645495..>646754)
                     /locus_tag="TRUGW13939_10578"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493689.1"
                     /db_xref="GeneID:55998057"
     CDS             complement(645495..646754)
                     /locus_tag="TRUGW13939_10578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349582.1"
                     /db_xref="GeneID:55998057"
                     /translation="MPESIKTESASNGVHDNKHNNASGSLDASRLEYTFTNSLRAIPA
                     PNSPELWAQGEATDHMILARYDVAKGGWQAPELVPYGPLTLMPTASTLHYATECFEGM
                     KLYRGNDGRARLFRPERNAKRMVTSAARVSLPEFPPDELVKLIHVLAAIDAPRWLPAD
                     KAGGYLYVRPTFIATQPSLAVKKASEALLYVILVCFPAFDDPAGSLGPGGNSQEKRAG
                     LRLLASEEDMVRAWPGGFGNSKVGASYGPSIVASAAAAAKGFDQILWLFGKEGWVTEA
                     GACNFFAIMKERGGDKAQLITAPLEDQVILPGVTRASVLETAQEILAGELDVVERKFS
                     IHELIEAVNEDRLVECFACGTAFFIAPIGEIHYKGQSIEVPLGEDGLAGEYAKKLRAR
                     LGGIMHGDVQHPWGYKIEETGPTKIKS"
     gene            <647996..>649852
                     /locus_tag="TRUGW13939_10579"
                     /db_xref="GeneID:55998058"
     mRNA            join(<647996..648053,648113..649558,649611..>649852)
                     /locus_tag="TRUGW13939_10579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493690.1"
                     /db_xref="GeneID:55998058"
     CDS             join(647996..648053,648113..649558,649611..649852)
                     /locus_tag="TRUGW13939_10579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349583.1"
                     /db_xref="GeneID:55998058"
                     /translation="MSPATMEISSKQPVRFLLVGVGPHAKRTFIKHLRDLKAEHRGEI
                     VAAVDISAQQTQIEEYAVENMPGIELVFVPFFRETMPEDVQDQLTQVVERLQVDCVII
                     STEPECHKPYGLWAIGLGLHVIMDKPITTRRNACNSIKQAAGIADDYNELLDAYDELQ
                     TRKDTFFLINSHRRYHPGYYGTADFISDIRKKTGCPVTSLISTHCDGQWRLPSEVVEQ
                     HYHPFKYGYGKVSHSGYHFLDTAYRFFKAGWNPEKRPDEIEIVSTFVRPNDFMGAFTN
                     EEHSRILGNQGYDESCKYSADELRWLMEDMGEMDAMIQLTFKQRGQTMAVAQLNLFHT
                     GFARRSWVDQGATPDLYKGCGRVKHEAHEVRSGPFQTIVIDSRQANDKHDRSKPSTAE
                     LGSDNHFEIQTWRNCNVLGEKEPLKVYTVSDLDRRYNSKLPGIYAENTKRGILWEALD
                     FLDGTKGFDDLASNLPDHSIPASLMSAAYISHVRRTAGQNPITHIDIAYSNQSENGVA
                     RATVRAGDLIQQSSSPSERSMPITPAVSSNNIETIQIPSGLGEFNKAFDGSGVVDYTV
                     PIINAEDDIQLQAIH"
     gene            <651778..>653387
                     /locus_tag="TRUGW13939_10580"
                     /db_xref="GeneID:55998059"
     mRNA            join(<651778..651889,651947..653142,653253..>653387)
                     /locus_tag="TRUGW13939_10580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493691.1"
                     /db_xref="GeneID:55998059"
     CDS             join(651778..651889,651947..653142,653253..653387)
                     /locus_tag="TRUGW13939_10580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349584.1"
                     /db_xref="GeneID:55998059"
                     /translation="MSSETGGQKDNDDDDWSQISSQVMRKRVQNRLAQRKHRKGVKAK
                     LKELERLATHESSSASTTQAAAAAAAPTRGSSLSANDHAPGLSPDMPDLSSLDVPMPG
                     GFPLHGSSAANYIYNHPPSSYPAVSGGGSLSLPPTVPVPFANTFPVPEWAGDGRLSPT
                     SNLLPQGYEDEMDSLGRYLEQHRHTIENRDLHSHTRSSTTSSSWVSSHRPGQSTDSSS
                     IPDRIIMPSDSVSARENEISAGALSTRTSLSKHGSRMSSGSPRLLDVYSDLELNQSNS
                     SSQLATTKASIPGRRHHDTSSTTPAIDGLSITRDEVPTTLSSRIASAMKAIRALGFSG
                     IEELTAQFYTADLQDRPALADAQRISRRRGLTRILANLREHAQDNWTEWEAQGYREEI
                     LRAAEDILGDECRRFSVGEDARGSSSKRGRNNNITDLKQDFQDELPNLYGLLGVLSLS
                     SQQWGDEDHTPVIVNAISLLLRGGSADRPR"
     gene            <656980..>660875
                     /locus_tag="TRUGW13939_10581"
                     /db_xref="GeneID:55998060"
     mRNA            join(<656980..657207,657270..>660875)
                     /locus_tag="TRUGW13939_10581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493692.1"
                     /db_xref="GeneID:55998060"
     CDS             join(656980..657207,657270..660875)
                     /locus_tag="TRUGW13939_10581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349585.1"
                     /db_xref="GeneID:55998060"
                     /translation="MASVSEAQAPNEEKGDRVLETEEQRAILDRQLHGLQDETAKRNL
                     GPWTYANQWDYIVLTLSSIAGIAAGAANPLLVVIFGQLAGTFTGFENGSIPGSTLRSK
                     TNQFALYYVYLAVAEFVLIYTSTVGFYWSGDRIVRRMRRAYLKAIIRQNMSFFDTLGI
                     GKVTSHITSDMTTIQEALTSKLSIALYAASNFLSAFIIAFIIYPRLAGILCSVLVAMI
                     LVTTSTTRFAIKNDKISKKFYSTAASIAQEAITSIRHVTAYGSQKQLADRYERLLRGS
                     ETSGVKSRVYVALLIGWSSAMPCFTYALGWYAGGHYLSQGHTTVSAVVSATVAIVNGS
                     FAMVRVIPTMENFVSSITSATATFEIIERQSPQDPFSTAGETPASVEGNIELKGVEVV
                     YPSRKDTKVLKGVDISIPALKTTALVGLSGCGKSTVLGLLERFYEPTAGSVRLDGHEL
                     QDLNLQWLRSQMAYVGQEPTLFSTTIYENIRHGLINSGVSETPEQTKERVIAAAKLAS
                     AHDFISTLPNGYDTEVGEKGISLSGGQRQRIAIARAVVSGPKILLLDEATSALDTRSE
                     KAVQQALDNASKGRTTVVIAHRLSTIRNADNIIVMQAGEVMEQGTHSVLLAKNGIYAD
                     LVQKQQIVDSVGDNGDAGSESESDEKVQIERAESRANPNAGEKGAGNSVTIIEGEGDL
                     ATQKELKPSLWLATKVILKLNYPERWLLIGGMVMAFFAGFTLLLQAIWFAEVLSAFSL
                     NDTDRMVSQVNLWSLLFTMTGIYAFIVAGSNGIFFAISTERLARRVRDVTLRSILRQN
                     IAFFDDKAHGTGVMASRLSSSSSDLSGLGGAVMGCIMTFTATIAISLILCLAVGWKLS
                     LVCAAVIPLLTALGWVRMEFISVFDGKIRLAGERAATYASEAVGAIRTVASGGLEGYV
                     LESYREIQAEQAAKSLPAILRASVFYAVSQGINFLAAALVFWYGSGLLASGEYTLKQY
                     YICFIGLIWGSGIAGSLFNFSPDMSKAAHAACDLQTLFDRTPEIDSWDESGEHMAKET
                     CQGHLKFEGVSFAYPSRSDITVLRDLDLDIPAGKFVALVGASGSGKTTVLGLLERFYD
                     ATRGRITLDGQDISGLNINEYRHMFSLVSQEPAIYSGTIRENLTTGLDPKKPVTEDDI
                     IAACKDANIYSFITSLPEGFETDVGSSGSMLSGGQKQRLTIARALLRAAPILILDEAT
                     AALDSDSEKLVQEALNATSRGRTTVAIAHRLSSIQHADIIYMLDRGQVVEKGSHAELV
                     KKRGAYFKLVQIQGL"
     gene            complement(<661506..>663245)
                     /locus_tag="TRUGW13939_10582"
                     /db_xref="GeneID:55998061"
     mRNA            complement(join(<661506..662023,662078..662448,
                     662502..662874,662942..>663245))
                     /locus_tag="TRUGW13939_10582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493693.1"
                     /db_xref="GeneID:55998061"
     CDS             complement(join(661506..662023,662078..662448,
                     662502..662874,662942..663245))
                     /locus_tag="TRUGW13939_10582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349586.1"
                     /db_xref="GeneID:55998061"
                     /translation="MPEADGSEGDDSRLLLVSNRLPITIKRSDDGKYDFSMSSGGLVS
                     GLSGLTKSTTFRWYGWPGLEVPEEEIPVVQKRLNDEYGAIPVFIDDELADRHYNGFSN
                     SILWPLFHYHPGEITFDESAWEAYKEANRLFAQAVARDVQDGDLIWIHDYHLMLLPEM
                     LREEIGNSRHNVKIGFFLHTPFPSSEIYRILPVRNELLLGVLHCDLIGFHTYDYTRHF
                     LSSCSRLLGLMTTPNGIEFQGKIVAAGAFPIGIDPDKFKEGLQKEKVQKRIAMLEQKF
                     NGVKLMVGVDRLDYIKGVPQKLHALEVFLSDHPEWVGKVVLVQVAVPSRQDVEEYQNL
                     RAVVNELVGRINGKFGTVEFMPIHFLHKSVNFDELIALYAVSDACIVSSTRDGMNLVA
                     YEYIATQHNRHGVLVLSEFAGAAQSLNGSIIVNPWNTEELASAYQEAVTMSEEQKALN
                     FSKLDKYVSKYTSAFWGQSFVSELKRISAHSKQKVSLRKASVLIPGTSAPMANGDDQT
                     APDDAVVHSGEEE"
     gene            complement(<664240..>665309)
                     /locus_tag="TRUGW13939_10583"
                     /db_xref="GeneID:55998062"
     mRNA            complement(join(<664240..664679,664737..665121,
                     665226..>665309))
                     /locus_tag="TRUGW13939_10583"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493694.1"
                     /db_xref="GeneID:55998062"
     CDS             complement(join(664240..664679,664737..665121,
                     665226..665309))
                     /locus_tag="TRUGW13939_10583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349587.1"
                     /db_xref="GeneID:55998062"
                     /translation="MATQLVSLPEVERLSASVVRILAGNPSKITESNIFPGTNTYLIG
                     RGPRRLLIDTGEGVPRWSSLLQTVLKDEKATVHEALITHWHHDHVNGIPDLLRICPQA
                     TVYKHQPDDGQREIEDGQVFQVEGATLKAFHTPGHTVDHMSFIFEEEDAIFTGDNVLG
                     HGTAVFEDLHAYIDSLHKMKSAVSGRAYPGHGPVLDNATAKITDYIKHRQQREDEVVR
                     VLTYGTVDAAEAQKKSGEQQQQQGSSSWTPIELVKVIYRDVPESLHLPASHGIVLILN
                     KLENEGKVKHEGSSGKWSLNVHRPAL"
     gene            complement(<666004..>668761)
                     /locus_tag="TRUGW13939_10584"
                     /db_xref="GeneID:55998063"
     mRNA            complement(join(<666004..666264,666330..668274,
                     668346..668365,668421..668498,668592..668609,
                     668726..>668761))
                     /locus_tag="TRUGW13939_10584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493695.1"
                     /db_xref="GeneID:55998063"
     CDS             complement(join(666004..666264,666330..668274,
                     668346..668365,668421..668498,668592..668609,
                     668726..668761))
                     /locus_tag="TRUGW13939_10584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349588.1"
                     /db_xref="GeneID:55998063"
                     /translation="MISTRLTRLGALGTKSRVLLGSRSLATVADSPLDKKVEMTNWEK
                     GNYINYKKMSENLDIVRSRLNRPLAYAEKILYSHLDDPHGQEIERGSSYLKLRPDRVA
                     CQDATAQMAILQFMSAGMPSVQTPSTVHCDHLIEAQLGGDKDLARANDINKEVYDFLS
                     SACAKYNIGFWKPGSGIIHQIVLENYAFPGGLMIGTDSHTPNAGGLGIAAIGVGGADA
                     VDVMAGLPWELKAPKVIGVKLTGQLSGWTSPKDIILKVAGLLTVKGGTGAIIEYHGPG
                     TESLSCTGMGTICNMGAEIGATTSLFPFNDRMYDYLKATKRQQIGDFSREYAKELRED
                     PGAEYDQLIEINLSELEPHINGPFTPDLATPISQFKKAVETNKWPEELKVGLIGSCTN
                     SSYEDMSRAASIARDALNHGIKAKSLFTVTPGSEQIRATIERDGQLQTLEEFGGVVLA
                     NACGPCIGQWDRKDVKKGEANSIVSSYNRNFTGRNDANPATHAFVTSPDLVVALTIAG
                     TLNFNPLTDKLKDKDGNEFLLAAPTGDGLPANGYDPGRDTYQAPPADRSSVQVAVAPT
                     SDRLQVLSPFEAWDGKDIEGIPILIKTQGKTTTDHISMAGPWLKYRGHLDNISNNMLI
                     GATNAENGEANKVKNAVTGEYGPVPATARDYKARGIKWVVIGDWNYGEGSSREHAALE
                     PRHLGGLAIITRSFARIHETNLKKQGMLPLTFSDPADYDRIPTDAKVDLLCTQLAVGK
                     PITLRVHPKDGKTFDVELSHTFNESQLQWFKDGSALNTMAKSSKA"
     gene            <670004..>670478
                     /locus_tag="TRUGW13939_10585"
                     /db_xref="GeneID:55998064"
     mRNA            join(<670004..670044,670114..670293,670355..>670478)
                     /locus_tag="TRUGW13939_10585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493696.1"
                     /db_xref="GeneID:55998064"
     CDS             join(670004..670044,670114..670293,670355..670478)
                     /locus_tag="TRUGW13939_10585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349589.1"
                     /db_xref="GeneID:55998064"
                     /translation="MGATRRPKTKRRTRDYDQILADLASTKHLQQYKDTKEVGDLPAL
                     GKHYCVECAKWFEDEHNLVAHRRGKNHKRRVRILRDEPHTQKTAEAVVGLGVDNGKRE
                     QTMMDMDDEAKE"
     gene            complement(<670963..>672036)
                     /locus_tag="TRUGW13939_10586"
                     /db_xref="GeneID:55998065"
     mRNA            complement(join(<670963..671007,671061..671403,
                     671468..671807,671862..>672036))
                     /locus_tag="TRUGW13939_10586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493697.1"
                     /db_xref="GeneID:55998065"
     CDS             complement(join(670963..671007,671061..671403,
                     671468..671807,671862..672036))
                     /locus_tag="TRUGW13939_10586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349590.1"
                     /db_xref="GeneID:55998065"
                     /translation="MSSDFWAGYISGAGGILIGNPLDLIKVRLQAGQARDPLLASPQA
                     RGGSYLEAATSFARGAAAPILGYGALNAILFVAYNRTLKALDPSISDPTSIDEVSLTK
                     IWLAGATGGMASWIVSSPTELIKCRAQLSRDRHTSSWSIARDMFRANGIRGFYFGGLI
                     TSIRDSVGYGFYFWSYELCKRSMSSPDDTAHQETLKVLACGGIAGIATWTSIFPLDVV
                     KTRLQTQPLDTIPRGQASQTQPLVRSSDTRVLGSWEIARQAYRTEGLRVFVRGLGTCN
                     IRAFIVNAVQWAAYEWLMKEFNKH"
     gene            <672508..>675100
                     /locus_tag="TRUGW13939_10587"
                     /db_xref="GeneID:55998066"
     mRNA            join(<672508..673194,673247..673330,673382..673505,
                     673554..>675100)
                     /locus_tag="TRUGW13939_10587"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493698.1"
                     /db_xref="GeneID:55998066"
     CDS             join(<672508..673194,673247..673330,673382..673505,
                     673554..675100)
                     /locus_tag="TRUGW13939_10587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349591.1"
                     /db_xref="GeneID:55998066"
                     /translation="WLINHRQRPRPTTLQGGQITQKAARFHGPSQQSADRLSKPFKCP
                     GTATATITSDRPSRKRRKVDYTGADGAAEDDVNKPWTNEDRLALANRDVNKFGVFKVK
                     DKDSTFKQRFSVPLINKAAGGYDAARPAPTLGMRRGATFVVKPLHDPSGEFAIVLYDP
                     TVDDKPAKKKEEAENPEEVPPKLDEPLVHKSLADILGLKKVVEDRPKVPVVIDPKLAK
                     ILRPHQIEGVKFLYRCATGMIDENANGSIMADEMGLGKTLQCIALMWTLLKQSPEAGK
                     TTVQKCIIACPSTLVRNWANELVKWLGPDAITPFVIDGKASKAELSSQLKQWAIASGR
                     AVVRPVLIVSYETLRLNVEDLKDTPIGLLLCDEGHRLKNKESLTWKELNNLNVTRRVI
                     LSGTPIQNDLSEYFALVHFANPNLLGTQNEFRKKFEIPILRGRDAAATDEARKKGDER
                     LAELSAIVNKFIIRRTNDILSKYLPMKYEHVVFCNLSEFQLSLYNHFLQSPDIRSLLR
                     GKGSQPLKAIGLLKKLCNHPDLLNLSQDLPGSEQFLPEDYVPPEARGRDRDIKTWYSG
                     KMMVLDRMLARIRQDTNDKIVLISNYTQTLDLFDKLCRARGYGSLRLDGTMNVNKRQK
                     LVDRFNDPNGEEFVFLLSSKAGGCGINLIGANRLVLFDPDWNPAADQQALARVWRDGQ
                     KKDCFVYRFIATGSIEEKIFQRQSHKQSLSSCVVDSAEDVERHFSLDSLRELFQFKPD
                     TRSDTHDTFKCKRCKPDGTQHIKAPAILYGDTSTWNHFVNDGEKGHLNKIQDLLLRQE
                     TTEKDVSAVFQFISS"
     gene            <676258..>677127
                     /locus_tag="TRUGW13939_10588"
                     /db_xref="GeneID:55998067"
     mRNA            <676258..>677127
                     /locus_tag="TRUGW13939_10588"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493699.1"
                     /db_xref="GeneID:55998067"
     CDS             676258..677127
                     /locus_tag="TRUGW13939_10588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349592.1"
                     /db_xref="GeneID:55998067"
                     /translation="MAAQSGNEATKNFDEKKDKVNPEAQSLLESYSNIKPDEVLQHVV
                     TLRDEAFSVYHYSCIGQMRFLSFNLSKMPFYSRILNLLKSSPDAGFLDAGCCFGQEIR
                     YLANQGIPHSQLYGCDLEQVFIDLGYRLFLDGEGKLGAKFFVGDLAQPEETTYEKGAL
                     AQGLKNKLQAIFASSLFHMWDYEEQVLVAKRMVAMCEDKAGVMITGRQLGSHLGGRYP
                     MTGMRKDGEKYRNYRHNEQTIRGFWLDVGEATGTQWTVDAGTYWGEEMEQTRNAPWAE
                     PEMCMIWWSATRK"
     gene            complement(<677292..>678640)
                     /locus_tag="TRUGW13939_10589"
                     /db_xref="GeneID:55998068"
     mRNA            complement(join(<677292..677727,677805..678199,
                     678257..678391,678461..>678640))
                     /locus_tag="TRUGW13939_10589"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493700.1"
                     /db_xref="GeneID:55998068"
     CDS             complement(join(677292..677727,677805..678199,
                     678257..678391,678461..678640))
                     /locus_tag="TRUGW13939_10589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349593.1"
                     /db_xref="GeneID:55998068"
                     /translation="MPTLTPAQLAAWDETLQPAIYGVCITFFVLGNISVPMRIWSQLR
                     THRKAMGEDYCLIAALISADVVTLSTLLAARNGFGQHIWRVEATAIAAGDKTLSNLQS
                     IFTGIWLTSVFNGPCLISIKLGLLFYYRRLFYTSQKWLAICWWANLIYAVAWALGSTL
                     FFILQCSPVPYYWERLNPTLHITGKCSSATHTVAIPLILSTVSDVAILILPIFVVAGL
                     RLTAQTKLGLVALFGFGFIAVGCGIARLIVLEVDTETTTDPTYGTVAFEILNVVELHL
                     AIICACIVPIFSIIRRLINGDSPKTTMSPGTQRLTKQGYGFYRTGEPARSQGSEYLHL
                     SEFPETQSGTVTSATKNFSRSFSSAGNGDVPLNGVIQVKTELHFSSE"
     gene            <679977..>682865
                     /locus_tag="TRUGW13939_10590"
                     /db_xref="GeneID:55998069"
     mRNA            <679977..>682865
                     /locus_tag="TRUGW13939_10590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493701.1"
                     /db_xref="GeneID:55998069"
     CDS             679977..682865
                     /locus_tag="TRUGW13939_10590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349594.1"
                     /db_xref="GeneID:55998069"
                     /translation="MAPAAVELHVKNTQGNGLLDPQDLIGILENAALFKDGVGKEPGL
                     WLYKPETDGTLPVRWTYKELLLEAKRKASILLHYLKAQFPADLLAVKRKVVLLHFDNH
                     IDSIAWFWAVVSAGLLPAISPPLSANAAQQEQHIQHLTTLLETPVVLSTDRLIKRYPE
                     LGSQPFTVTIEQLLSQSSNVFNDELDNGKYGSQPPRGEEPAVLMLTSGSTGNAKAVEL
                     TVPQLVASLRGKSKALNVSENASFLNWIGLDHVANLVEIHLLAMYNKVDQVQLRAHDV
                     ISEPVLFLKVIHNHRITNTFAPNFFLALLTKRLAILESEASSITGLDLSCLKTVVSGG
                     EANLVETGKALCATLEKLGVTKFALYVAYGLTESSAGLSYGLFDAKYEDGEDHEFASI
                     GKPTIAAKVRVFGDGKETGPYVLGELQLSGDAIFKNYYRDLEATKKSFTPDGWFMTGD
                     RGYIDRTGALNIAGRSKEILIINGVNRAPQDIEAALETANLAGVVSSYFAAFSHRPKG
                     SDTEGYCVVYSPQVTFEVPKRRDEIAESIARAAAVIPGMRPEWLIPLPLSRLEKSSLG
                     KLSRTRLKKQFDQGVFDDVRIRSRIPIQTYVHASYVAPSNDTEKKVVEALGDMLEMPA
                     NLISVDRTIFELGVTSLTLFRFEHLLRKHISLDVGVSIITFLNSPVIRNIATAIDNAN
                     SHEYNPVAQLQARGSKLPLWLVHPASGNVLAFLPLARTIVDRPLYALTARGLGNNEKL
                     FDSIPEMADTYFQHVKRTQPKGPYALTGYSLGTTVAFELAKRLEANGDEVAFCAALDS
                     PPHIIPLVGPLDWTAAAIRVTYFLELIAQDDIPKYEVEFKGLSQVEVINRLLEVSFPE
                     QLAKLKLTTAQLMAIVHVTDNFGKMGKVYQPEGTVRKMDAFYCIPLKSVCLNKDKWVS
                     EHLGAWQDFSREPIEVIECEGDHADMLNAQYVEGFEQRLSKVLAARGI"
     gene            <683748..>684420
                     /locus_tag="TRUGW13939_10591"
                     /db_xref="GeneID:55998070"
     mRNA            join(<683748..683940,683993..>684420)
                     /locus_tag="TRUGW13939_10591"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493702.1"
                     /db_xref="GeneID:55998070"
     CDS             join(683748..683940,683993..684420)
                     /locus_tag="TRUGW13939_10591"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349595.1"
                     /db_xref="GeneID:55998070"
                     /translation="MRGVVALLSFMEVGLGWAGHAGGNTLPPELQVLGAPRQTLHVKF
                     PTSSPPYVVNVRPGGFLETADTADAPEADVKPLSHGQGHGQGHDQDLFVFMMVDPDIN
                     TTSPTYVGLHTMVANLAAHNTDALTTTVATFIAPEPPVGETHNYTLLAFHQPPHFSIP
                     PKYAPYVATTPTSPLNRINFPLQQFIADTNLGPVVAANWFKTGDLD"
     gene            <685529..>691331
                     /locus_tag="TRUGW13939_10592"
                     /db_xref="GeneID:55998071"
     mRNA            join(<685529..685596,685668..685830,685887..686057,
                     686112..686799,686848..687587,687638..687742,
                     687793..687911,687964..688043,688097..688253,
                     688315..688706,689813..690365,690425..690548,
                     690604..690644,690704..>691331)
                     /locus_tag="TRUGW13939_10592"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493703.1"
                     /db_xref="GeneID:55998071"
     CDS             join(685529..685596,685668..685830,685887..686057,
                     686112..686799,686848..687587,687638..687742,
                     687793..687911,687964..688043,688097..688253,
                     688315..688706,689813..690365,690425..690548,
                     690604..690644,690704..691331)
                     /locus_tag="TRUGW13939_10592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349596.1"
                     /db_xref="GeneID:55998071"
                     /translation="MDQSVQRLLNDKLYDKRKQGALELEKIVRDATIRGEHDRIQKIV
                     DQLCHDYAYAVHQPHARNGGLIGLAAASIALGSEGVAPYLQEIVPPVLACFTDQDARV
                     RYYACESMYNIAKVAKGEILPFFNDIFDALCKLASDSELSVKNGAELLDRLVKDIVAE
                     SASSYVSVLQLEEKDLLDSGKTPEDEISIELPTAFSLQKFIPLLQERIHVLNPFTRTF
                     LVSWLTLLDTIPDLELVCHLPAFLGGLIKFLGDPNKDVNVATQGLLERFLSEIKRIAR
                     IKKGIAESRKSKDENTAVAASENASIATGNSEEVKGSDNAVADSVSGDSEDDENSIAL
                     DGDWVPGQDAYVDYPKILGILVGFVDTTYEEEMQLIALRWIDNFFEISPGDILQFVPA
                     LLIQVLPAIASGSDQVRQAATRVNTSLMEYIVSLSEDIPETSQPVASKSGPSAAKEEE
                     DRRASTQSIRPPLEHSFSSGPSSNPPSDLDYAAAVSSLTLQFLNENEGTRVAALSWLI
                     MLHRKAPRKVLAFNDGTFPALLKTLSDPAEVVVTKDLQLLSQISRNSEDGYFTSFMVN
                     LLQLFSTDRKLLEVRGNLIIRQLCMNLSPERIYRTLADCLEKEEDIEFASIMVQNLNN
                     NLITAPELADLRKRLRSLDSREGQVLFVALFRSWCHNAVSTFSLCLLAQAYEQAYNLL
                     QIFAELEMTVNMLIQIDKLVQLLESPVFTYLRLQLLEPERYPFLYKCLYGVLMLLPQS
                     SAFAALKNRLNSVSNIGLLHSPRPSASTSGNSYDRPGGSRLKSREESIRWVELLDKFK
                     NVQEKSKRSQRNLQRQFERDLGGNGLKQPLMAGAVNAASAIDQQGGRDKTLPDVPRGG
                     FGNTGLGISGRGSDGGASRDGRSTPTSGNKGKSGLGNLVSNSHRSRDDLLSNPEHILV
                     DYLINPKSHYERKPRLGAGVAIIVVFYMLLFPVIATYLRLYYVVIFTPDFLPRGASWN
                     GSASEYGPRPSRRRRKGSRSRGGGHGNREKRIPSTTEAVDIENQAGGVAFPLTDFAQE
                     SFWTKDAFICQDDGRPAYCSKCCQFKTDRSHHNRDVDRCVRKLDHFCPWVGGVVSESS
                     YKFFLQFIFYTALFTCFTLIVSAIFVSEIHSDTGSVNPHWAVALGLSALFFLFSGGMS
                     GTSLQLASINVTTIENINRYTKIWNLAIYIPPHQLQRIFGPDNTDKSQWAQTFRTVTY
                     PLQPIDPSSAQANNPPTKPSINEAAKNSRTFAILTTQPGENPFDLGDPTNNLQQAMGY
                     TLLDWLLPLKVSPCVDHSSQESAYPMGPVVERLKRDAGLSITMEDGERTHRKRRHRKW
                     KKERTDKESENSSSVAEGNEER"
     gene            <691810..>692800
                     /locus_tag="TRUGW13939_10593"
                     /db_xref="GeneID:55998072"
     mRNA            join(<691810..691861,691923..692283,692369..692504,
                     692570..>692800)
                     /locus_tag="TRUGW13939_10593"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493704.1"
                     /db_xref="GeneID:55998072"
     CDS             join(691810..691861,691923..692283,692369..692504,
                     692570..692800)
                     /locus_tag="TRUGW13939_10593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349597.1"
                     /db_xref="GeneID:55998072"
                     /translation="MSSFTLQGSAYITGAGSGIGRAVAHAFVKNGVSQIALGDINEQT
                     AQETADQLKSINKDVNAIAIQVDVANEDSVKASIETATAAFGRIDFAVNNAGINGPLG
                     LASDVSFEDWKKTIDINLSGVWLCQRAEITQMLLQEPVSTRQYRGAIVNVSSMLGING
                     IWSETPPTAYSACKHGIVGLTKTDANTVASKGIRINAICPGFVSTPILKLALDMGYMD
                     EQIAATPMKRVATPEEVADGIVFLVSPASSFMTGSALVMDG"
     gene            complement(<693654..>694807)
                     /locus_tag="TRUGW13939_10594"
                     /db_xref="GeneID:55998073"
     mRNA            complement(join(<693654..693948,694011..694288,
                     694377..694407,694465..694678,694741..>694807))
                     /locus_tag="TRUGW13939_10594"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493705.1"
                     /db_xref="GeneID:55998073"
     CDS             complement(join(693654..693948,694011..694288,
                     694377..694407,694465..694678,694741..694807))
                     /locus_tag="TRUGW13939_10594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349598.1"
                     /db_xref="GeneID:55998073"
                     /translation="MTGKVGEFSLTNKVAVVTGGGSGINLEYARRIHAQGCHVIIGDV
                     RLVEESKSWLQSVKDEPTKALYQKTDVINWDDLKALINRAHQEFGKSPDLYVAGAGVF
                     EPSFSNFWEDPESDFYRELAINTAHPIKLTRMAIQELLPNRKKGVVVIVGSVAGQVYD
                     LSGPIYVASKHAVSGFTRSLTLLDEKYGIKVVSLAPGPVKSRLFTDRPEFMKMHGITD
                     EISMTPGEMADEMVNLTTSAQYGGGTVLEVMKGMPPRNVPGFNADPPAGMHTEHVVTN
                     AVKKVFDLLDKERDGGSE"
     gene            complement(<695592..>698388)
                     /locus_tag="TRUGW13939_10595"
                     /db_xref="GeneID:55998074"
     mRNA            complement(join(<695592..695736,695829..696134,
                     696306..696456,697095..697277,697353..697475,
                     697533..697835,697888..697951,698008..>698388))
                     /locus_tag="TRUGW13939_10595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493706.1"
                     /db_xref="GeneID:55998074"
     CDS             complement(join(<695592..695736,695829..696134,
                     696306..696456,697095..697277,697353..697475,
                     697533..697835,697888..697951,698008..698388))
                     /locus_tag="TRUGW13939_10595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349599.1"
                     /db_xref="GeneID:55998074"
                     /translation="MAVQFEHFNVPGAQVVHSNSFPYGLQVKIEEGKPHTPSLEASVK
                     AVKALSESGRFSELLQKHGAVVLKGIGHPSADSYAKVINALETARGSRPFIQIGLAGK
                     RNIVAENIWTANEGPQDRRFYQHNEYSRYTRFPANIHFYCEKKALEGGETPIAHSALV
                     YEKLENSIPELVQEIQKRGLAMKMLFRAPGKEGTGNEFNWAGEFSFGQEFLPTDDQAT
                     KKAKVEKQVRKLTDDFHWTEDDSIEITQHIPGIRRAPASGHPVWFNGLVGRFGITRDI
                     GALDPPYIGRDGMTYLPCEYGDGTPIPHEHLEKLEEIIDKLEINLSLDEGDILLVDNF
                     QVSHGRKPWKGERRILVNLTTTAKEGQIGAPSNTADKQVFHTDAGDIISLICLQPAAE
                     GGESKIASSWFNDPQKPYTKRPILYHQPATDSAPERVLIQYARRYFTGFLAQPRSKNI
                     PPITEAQAEALDALHFLAEKHSATLNFQKGDVQYINNLSILHARNGFRDEKGKERHLL
                     RLWLRDPEYAWETPEPLRPRWNNVYENVNVEEQVFPVEPRIRKT"
     gene            <698866..>700874
                     /locus_tag="TRUGW13939_10596"
                     /db_xref="GeneID:55998075"
     mRNA            join(<698866..698896,698959..699103,699167..699390,
                     699442..699806,699870..699971,700033..700192,
                     700250..700560,700650..>700874)
                     /locus_tag="TRUGW13939_10596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493707.1"
                     /db_xref="GeneID:55998075"
     CDS             join(698866..698896,698959..699103,699167..699390,
                     699442..699806,699870..699971,700033..700192,
                     700250..700560,700650..700874)
                     /locus_tag="TRUGW13939_10596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349600.1"
                     /db_xref="GeneID:55998075"
                     /translation="MAEIDNKNSFAEEAKPVPQYDVSNDQDFLHIVEKDVLQEREIGV
                     FGAVSLIVNKIIGAGIFSTPSTIFKLSGSVGMSLILWLIAGFISTCGAMVMLEFGSAI
                     PRSGGIKVYLERSFSPKLLQTCVYLFYCVFLQVSASNAYTFSSYLLLAAGVDQTTWKT
                     RGVACAAAVFAVGIHTVAPRIGRGLQDILSLVKLFTLLFIVCTGFAALAGHLKIDNPQ
                     NFAISTSFKGTSNNGYNIGTALLNAIFAFQGYDNVNAVLSEVRNPKKTLKIALPSAMA
                     AITVLYLLANIAYFAAVPKEEFISSKITIAASLFENVFGHSAATKALPALVAISALGH
                     LLGIAFTVPRLIQELAKDGVTPFPDIIMQNRPFRTPIFGLAIHLGVTILFICAPPAGD
                     AFNFIVSLSSYPTTFLLTVITFGLVKLRLSSTERWISAFSTPWIVIGLYLAGNIFLLV
                     MPYVRPPDGKGNTNLPYWLTSVVALAILSLGIIYYILRFVLAPRIFGYVLQPVAVELS
                     DGSQVTRYKVSK"
     gene            complement(<701178..>704016)
                     /locus_tag="TRUGW13939_10597"
                     /db_xref="GeneID:55998076"
     mRNA            complement(join(<701178..702542,702597..703082,
                     703160..703743,703812..>704016))
                     /locus_tag="TRUGW13939_10597"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493708.1"
                     /db_xref="GeneID:55998076"
     CDS             complement(join(701178..702542,702597..703082,
                     703160..703743,703812..704016))
                     /locus_tag="TRUGW13939_10597"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349601.1"
                     /db_xref="GeneID:55998076"
                     /translation="MWRNFIYLIPLLGTAVVADVTDSCPGYKVSHVQQTKGTITADLT
                     LAGSPCNVYGTDIENLKLIVEYQTDSRLHVKIYDEDEKVYQIPASVLETPSGQPQSSS
                     NQSDLIFSYSEAPFSFAVQRRSDSETLFNSSGSNLIFESQYVRLRTSLPLNPYLYGLG
                     EDSDSFRLEVNNYKRTLWNTGQAYLPTNGPLYGSHPFYIEMRNGRAHGVFLSNSNGMD
                     ININQTSGTSQYLEYNTIGGVLDFYFLAGPAPADVARQYASVIGTPAQQSYWTYGFHQ
                     CKYGYQDIMMAAEVVYNYSQAGIPLETMWNDIDYMDLRRTWTVDPDRFPLEKVQEFVT
                     YLHENQQHYIVMVDPPVSINDSTSYNNGVDAGVFIQYDNGTEFLAVMWPGAVSFVDYF
                     HPNSQNYWSGQIGSFFSDSNGIGVDGIWIDMNEPANFCGYPCIDAVDLAIQMSNPPQP
                     PAVRTSWDPLPGFPVDFQPPGASKFRRDSTAGNMTGFPDRDLLNPPYTIGHVQPLLST
                     GTIWGDLSLYGGYTAYDTHNLYASQMIAHTRQGLLDRRSNERPFIISRSTFAGDGRNG
                     GHWTGDNASWWSHYLLSIFQHMEFASIFQMPMVGSDVCGFNDDTTETLCARWAMLGAW
                     YPFYRNHADIGANFQEFYRWPLVTDVAKKAIATRFQLMDYFYTSFYQQTLDGSPTTIT
                     PLFFQYPEDPNTLEINYQFFYGPSILVSPVTVENATNATFYLPEDTFYDFWTAEKMPE
                     TGMDVYYDNVTYMDIPVHIRGGSILPLRTNADQVNTTTQLREQDFELIIALDDNGKAK
                     GNLYLDDGISINSTSSFMEFTYNNGQLVVNGTFGYQTNVTLQSATIYGTNDTTSPIHS
                     LNKALNSAWKAELSSSNSTVRSG"
     gene            <706463..>707474
                     /locus_tag="TRUGW13939_10598"
                     /db_xref="GeneID:55998077"
     mRNA            join(<706463..706757,706828..>707474)
                     /locus_tag="TRUGW13939_10598"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493709.1"
                     /db_xref="GeneID:55998077"
     CDS             join(<706463..706757,706828..707474)
                     /locus_tag="TRUGW13939_10598"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349602.1"
                     /db_xref="GeneID:55998077"
                     /translation="EDFSWSSPDHPSSFQDQIYSFYRPLVHNITDPTFVNDDNQVFTV
                     QGEPRIKSPLGKKAIILTVDSRPRNGVGELLAGDPLKFATASPSAFGALNHYLYALIH
                     VYDYRYVRAPEFADRYGTWVKVPIVEEALLTHDVAVFMDGDVGVHYPHVPLEWLMNHW
                     NITDETLVAAPVDVHQYDNFNDRGEVSLNTGFLLGQASQRIHELFQEWVDCPLELTDF
                     YAGCSTWAYNWAHEQAALRDYIRHKYDRPEDVVEIPCAEANGSPDHPDGSQQGGEGGW
                     PRWLMWPTGVIKYIIDYRPPREVGRTSARPCGPVTRI"
     gene            complement(<711788..>712804)
                     /locus_tag="TRUGW13939_10599"
                     /db_xref="GeneID:55998078"
     mRNA            complement(<711788..>712804)
                     /locus_tag="TRUGW13939_10599"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493710.1"
                     /db_xref="GeneID:55998078"
     CDS             complement(711788..712804)
                     /locus_tag="TRUGW13939_10599"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349603.1"
                     /db_xref="GeneID:55998078"
                     /translation="MQRMELLLTNMSARLSHVEGQVNNTTEPPMPEVPTDATPSVTPM
                     YSANKPRHSLDHPDKYDDSDRSRYMQFVAILYAKLTVDAPAIGGPYEQLWYAYGRLAG
                     KAQTKVYPWMRLHGNVNTVTPATLEAFFAHLNVLFEDHQLVEKANLELNRIRQGRTPF
                     QDFISEFERILLLAGGQSWTDDVKISRLKTAINQEMRRATVGSDMPKQYEAFCERLHR
                     VANDLEELKRIDNIQSRYKRNTSRPLTKGTSPDRGQPQVMDWTPAGLPINTVRTDNCF
                     RCGKPGHIAQYCPEPAPLRRAPSPRNRGKKKHDTFTRISNTGVKENETESDTGSDSTS
                     ESKE"
     gene            complement(<713995..>715346)
                     /locus_tag="TRUGW13939_10600"
                     /db_xref="GeneID:55998079"
     mRNA            complement(join(<713995..714077,714130..714303,
                     714359..>715346))
                     /locus_tag="TRUGW13939_10600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493711.1"
                     /db_xref="GeneID:55998079"
     CDS             complement(join(713995..714077,714130..714303,
                     714359..715346))
                     /locus_tag="TRUGW13939_10600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349604.1"
                     /db_xref="GeneID:55998079"
                     /translation="MLEERLHVGSDQTQRFTSISLALHGLVSVFGGPLIGHFADKASN
                     RKLPFLIALVGCIIGTFMVACATSVGVFFGGRVLQGISGSGAWIVGLATAANAVGPEQ
                     IGTTIGILMAFVNAGMITGPMVSGFILEAGGYWLTWSVPVVLLLIDVAARLLIIENSE
                     RPSTKAPAEAEEIDSLLHSQDGGQEGPSAPSSNFWRTMLSNSRVMTALLIGTWGPALS
                     TCFNATLPLHVLNIFGWSSSRVGLMFFLLAVPGLFFSPLAGYLRDRIGTRKPATMALG
                     LQAVFLVLLGFAGNSHFDWACSGGRGPALYILSIVAMGILRPFISGIGPVELTSVVKA
                     EEAKNPAIFGPRGGHSRVFSLVEVAATAGMTIGPIISGILVEQFDYYRMSWILSVISI
                     IMATLAYTFLGDKDKAREANAE"
     gene            <717099..>717524
                     /locus_tag="TRUGW13939_10601"
                     /db_xref="GeneID:55998080"
     mRNA            join(<717099..717173,717225..>717524)
                     /locus_tag="TRUGW13939_10601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493712.1"
                     /db_xref="GeneID:55998080"
     CDS             join(717099..717173,717225..717524)
                     /locus_tag="TRUGW13939_10601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349605.1"
                     /db_xref="GeneID:55998080"
                     /translation="MVTTRGMTSLTPDEPGTVPVPNPGFDATSEELPPQAVPQVNMIM
                     EMLQALIQGLRTTGPSHATTSERRDTKVPDPKCFASKSIKEFEEWIEDVENNILSCPR
                     SYPDEASKVQYAAAWLDGDHRI"
     gene            complement(<732369..>733794)
                     /locus_tag="TRUGW13939_10602"
                     /db_xref="GeneID:55998081"
     mRNA            complement(join(<732369..732785,732854..733060,
                     733120..>733794))
                     /locus_tag="TRUGW13939_10602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493713.1"
                     /db_xref="GeneID:55998081"
     CDS             complement(join(732369..732785,732854..733060,
                     733120..733794))
                     /locus_tag="TRUGW13939_10602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349606.1"
                     /db_xref="GeneID:55998081"
                     /translation="MSKSFEIAIVGGGIAGLTLAIALHRRNIAVQVYEQTAQFKEIGA
                     GVSFSSNAVAAMETCDGELAGSFGPGVKSAFDKVTTANGWPSKQTVWFDYYDGMSPKQ
                     RDEILFSITSGCGQQGVHRARFLDELVKAFPAEKTHLGKRLQNIVEREDGKIILNFTD
                     GTSAEADAVIGCDGIHSRVRSFIVGENHPSAHPSYSHKYAYRGIVPMEAAIEAIGEEK
                     ARNSCMFLGKSGHVLTFPMDDGKFLNMVAFYEDQNEWADDRRLTKMSTREDALNDFKD
                     FGPDVTKIMSLVQPRLPIWAIFDTCENPLPIFFKGRIAVIGDAAHATSPHHGNGAGFA
                     IEDSALIAELLADELVHTPRDIEAALATYDKVRRGRDQWLVQSSRFVGNVDAGLIPEI
                     GTDYKKVHQEIKERYSKIIGFSPKEEAIHAKKVMHEKLAL"
     gene            <735313..>737372
                     /locus_tag="TRUGW13939_10603"
                     /db_xref="GeneID:55998082"
     mRNA            join(<735313..737080,737146..>737372)
                     /locus_tag="TRUGW13939_10603"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493714.1"
                     /db_xref="GeneID:55998082"
     CDS             join(735313..737080,737146..737372)
                     /locus_tag="TRUGW13939_10603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349607.1"
                     /db_xref="GeneID:55998082"
                     /translation="MSHSSRYRSDSPGSKRLYDPLRASTGTVPTDLYASPTSYYGHEG
                     MLSAKTAERRGGFFSADARDHVDVKPISKTAYRDGGHSTKTRTEYAVRPRSQTIADSR
                     REPLSLVIPQTPTRSSQVPASAYERTISPLPPRAPYSREDPERYTAPPSRSHRRPYGS
                     DYPSDTGYLEPHDRSRKHRDRGYRVYRPGGVSHYPAYGDPRKWDDSRYYDAYSYTNAR
                     ETFEKESAARSSQRTSRRTGRPLSMTATEMAPGQSSYARDSRGPPPSQRGFDRLPGGD
                     RLRITSGREYSDSDANRDPRRHPYQRGSVLHQDREDGYYSVTDDPKESRNHRHRSRHR
                     GSLKQAGELLAPVLSGLATLGLASGYSDDGRSDKYRSRDSEHGRSDRNKDYDRDHRDG
                     EREKVLSDDRRLRERSQRRDDSSASETESRTRRRDKSSARRHHSSSDSDSGRGSHQRS
                     RANSSRHRSKPKDESSEISTKRALVENGSEDRPRKPVTVEPPMAKEPEAPPKSILKAP
                     REKFPEDDNPIREGVAPLKDAHKQGIPPGARWTKIDRRLVNPAALNLGHERFEERSDY
                     VIVLRVLTKEEIQAYAVKTQEIRDERYKEAKEERRRVREERRRNGENNDSSSSDDEDE
                     DDEERAPLAIEAPPEKDDFPVSRDKGRVANDMVNEAMKVR"
     gene            <741429..>745510
                     /locus_tag="TRUGW13939_10604"
                     /db_xref="GeneID:55998083"
     mRNA            join(<741429..741500,742493..742769,743012..744109,
                     744540..745268,745323..>745510)
                     /locus_tag="TRUGW13939_10604"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493715.1"
                     /db_xref="GeneID:55998083"
     CDS             join(741429..741500,742493..742769,743012..744109,
                     744540..745268,745323..745510)
                     /locus_tag="TRUGW13939_10604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349608.1"
                     /db_xref="GeneID:55998083"
                     /translation="MTAVVQPDLGPPAHKYKDNPADDPLRHIGANAHHSHGLQQQHRP
                     TTLVQQQTHKSSDSPHQKSANIPPGAYSTPGGLSGVHLQHPPYPGPAPDPGYYASHPN
                     HYPATTTPAQYPSSGPPDMMATATHMQRPYPPIYHAHTPQSNSPASVSSTQAHDQHGR
                     AIYGQSPQMAPQIYGYQQYSPMNPVHPAYAPHPPTPQHPLTTQPLMIPPQSAPLPHSN
                     PPPPHPAPLNNAAIGNHSPRTNLDSHQQHPPVQAQRPQMPTPNLTSPTGAVPPLSANN
                     AHAQPNHPPSTNSTTNAAPGPIPATTPWVVRQDGNGVQWIAFEYSRDRVKMEYTIRCD
                     VESVNVETLPQEFKTENCVYPRACCSKDEYRGNRLVYETECNAVGWALAQLNTPLRGK
                     RGLIQRAVDSWRNSNQDPRLRSRRVRRMAKMTRRQASQPGHVGAPSPVQHLVSGSNAN
                     LAPSTRPSEPMALATPMHHVHSDNSAGNGQVSGGTDLTNGAHHSSIPPGPTPTRNPHE
                     RSDLRPGHVFHGLPAYPTAAHASGASGAPAMVPPLRESSGFDAMGRPSVATAASKRRN
                     PTKSEKITDDPDSEDIFGGLPEGKRRKFILVDDTQRSCRVRVKVMLDQVDVSEIPDSY
                     RLTNAVYPRAYSPVQMKAPPGRVVPGNRYRDDSDIDDPDGPVTTGRTLVPAGLGDGDL
                     EVTVPQLNRSRHRKDKVLNDLGYRMSWSQSRVFADRPLFLQRSLDAYRNKMHATITNT
                     GHAPSSKASHFETRCGKNRWRKRDRQDEDNPQLTDSAYRIEAEEVQD"
     gene            complement(<746473..>748440)
                     /locus_tag="TRUGW13939_10605"
                     /db_xref="GeneID:55998084"
     mRNA            complement(join(<746473..746592,746689..748212,
                     748275..748324,748380..>748440))
                     /locus_tag="TRUGW13939_10605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493716.1"
                     /db_xref="GeneID:55998084"
     CDS             complement(join(746473..746592,746689..748212,
                     748275..748324,748380..748440))
                     /locus_tag="TRUGW13939_10605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349609.1"
                     /db_xref="GeneID:55998084"
                     /translation="MVRLLKFVVLTTVTASSAIKAVSALLSPNLPKFLTDGPLEDGLP
                     WGKANPAGDPPNTGVTRHYHFTIRREFKSLDGFNKSVILINDQFPGPAIEANWGDMIE
                     VTVVNNIDSQDEGVTLHWHGTTLRKTPWYDGVPGVSQCPIAPLGGRFTYTFQADQYGT
                     GWYHSHYSAQYDDGLYGPMVIYGPVQPEISYDFDLGPVMISDYFHMSYYEALEISFAK
                     PPQPLHVDNNLINGKTAFYNCNSTETHCLPAPGPAKFQFHSGKLHRLRLINTGSLANQ
                     KFSIDNHDMTVIANDYVPVKPYKTKVVTLGAGQRTDVIVNATGSPTDAVWMRSDIDMV
                     CLQTNATIQTALAAIYYESANISSVPRTKRTAWESNNCRNDPLNQTVPYYQLTPPEPE
                     TVQTVTVTVGYNETGFVVMFMDNSSFRADYNDPVLLDVSNPRGNFSFPRERNAYNFGS
                     NSSVRLILNNTYATVHPMHLHGHNFWVLAEGLGSWDGKITNPSNPLRRDTHNLQPGTS
                     NQSSYVVLQWTQDNPGIWPFHCHMSVHSSAGMFMLSIEHPELIKTDLQIPMIMAQTCR
                     DWDFFSSTSFVDQIDSGA"
     gene            complement(<749027..>750850)
                     /locus_tag="TRUGW13939_10606"
                     /db_xref="GeneID:55998085"
     mRNA            complement(join(<749027..749952,750006..750140,
                     750204..750489,750549..750784,750847..>750850))
                     /locus_tag="TRUGW13939_10606"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493717.1"
                     /db_xref="GeneID:55998085"
     CDS             complement(join(749027..749952,750006..750140,
                     750204..750489,750549..750784,750847..750850))
                     /locus_tag="TRUGW13939_10606"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349610.1"
                     /db_xref="GeneID:55998085"
                     /translation="MVFVRTYQAYPLSENVSSSTIVPIVSFIVIIIYLLSLLWSEVFG
                     YKVPVFGIKSLWEPIVVSNFRFFRHAEDVLVEGYRASKGEIFQFRRADTNMLVLPPKH
                     VDDIRKLPNDVASPTVAHVHNLMGSSTNMHIILRSNLHFRTLQLKLTPNLNWLTRPMQ
                     EEVNFAIEKDLTKSEDEWVTIKPYHTLLDFVARVSARIFLGKPLCRNPEWLEISTQFT
                     ENVFVSLVILRLLPMWTHGIVSWFMPSSYKGTAYIRRAKKLLVPEILRRREKESGGIG
                     AEEQDKNKQNLLSWMMEIATPEESDPASLAHLEVVMSLASIHTSQMNAVHVLYDLLAH
                     PEYLDPIREEIRDVIKETGPWMTWSKSVFSKLRKLDSFMRESQRFNPPTLLSMHRVLL
                     QKAQLSNGTILPKGAHISMAVNAIQNDPEVTSDPEIFDGFRFYKLRQREGEAHLHQFS
                     TTESNVLNFGHGPNSCPGRFFASLEIKIILIRLLMDFEFKFKHENKRPENLRAHEFIF
                     PNPDAEILMRRRPASERLEI"
     gene            <751273..>754002
                     /locus_tag="TRUGW13939_10607"
                     /db_xref="GeneID:55998086"
     mRNA            <751273..>754002
                     /locus_tag="TRUGW13939_10607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493718.1"
                     /db_xref="GeneID:55998086"
     CDS             751273..754002
                     /locus_tag="TRUGW13939_10607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349611.1"
                     /db_xref="GeneID:55998086"
                     /translation="MASEKQRKLDADLIKRSQQLVYKISHGCQSERGFGGFSLSLYDT
                     SWVSMVRKTDSAGVRQWAFPEAFAYVLRQQHESPGTNSSPVDVILNTMASLLSLLEHR
                     ATDAAEGSVNIQPMDYEWRVSHAIATLSKALSSWNVGSSLHVGFEILIPSLLDQLAQR
                     GVNLDFSGKRELEELQQHKLSKFRPEMVTSKQQSTLLHSLEGLIGRVDFGKLKHHCTV
                     YGGMMGSPASTAAYLIHSPVWDEAAEHYLRNVVQSSGGAPSAFPTSIFETSWSISTLL
                     ANGYTIDNFSSDNMKHITTYLQQLFVRQHGLLGFAPTFVPDADDTARSLLALSHLGIK
                     IDPSFMVEYFEAPNHFQTYKLERDPSFSANANILLCLLGAPNPMDFFPQIEKTTRFLI
                     TIWGNGGLQDKWNLASEYSQMLLANALLDLIAAWSEGRLTMLSTEVLVRVDISIVLSQ
                     LFSKTLLRQCEDGSWGNSVERTAYSVLLLAYILRLPWPLPLRELACASLLRGRNYLTL
                     HANEWSKGDYIWIEKVNYRLPILSEIYCLAAMKVSVEERVWASEVTDIFTMPEKQLGT
                     MPNFLGRLPIFRHTSPDTMLLATAEAWFYLHKLKTIRVDIFPRDNIGMSKDKYLDFIP
                     ICWTSVNITTGFPLSGDVIWNMMVISMLNYQADEYMESVVGSLPESSLSELKYEIGVA
                     CSESCYEQTHSPHLSEVSEVILKYIRHIRDHQYVAACPEYAQREVAEELEKFLNAHMA
                     HNADNKNNGTTNFDKGKSYFDWVRTTGANDTSCPYSFSFFTCLISRGMSSAKQRYFAR
                     ALGLHLATMCRQYNDLGSYSRDKQENNLNSLDFTDFHDGNTCETCECSGPPRKQDLID
                     IAEFERTCMQACFAHLSSEISVTTSAQIKAFINVTDLFGQIYVAKDIASRLKK"
     gene            complement(<754746..>757372)
                     /locus_tag="TRUGW13939_10608"
                     /db_xref="GeneID:55998087"
     mRNA            complement(join(<754746..755079,755160..755287,
                     755358..755413,755475..755609,756054..756532,
                     756601..756818,757103..>757372))
                     /locus_tag="TRUGW13939_10608"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493719.1"
                     /db_xref="GeneID:55998087"
     CDS             complement(join(754746..755079,755160..755287,
                     755358..755413,755475..755609,756054..756532,
                     756601..756818,757103..757372))
                     /locus_tag="TRUGW13939_10608"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349612.1"
                     /db_xref="GeneID:55998087"
                     /translation="MSSQAQNPSLVTTALLTVAIVFPILATLAVALRVWSTLSKNKRL
                     FLDDYILILALIFAWGVPIDIYVAAGRGGVNYSTRSQLEASSIFLQAQLLAGDPISAA
                     YDPLSVNPLRYNYTAFGIAFSGMSMCFDVIVLCFPLPIIYRLMMSTRRKLQVAGIFWL
                     GIFCCIASVLRFYYVYKEAYESTSSTGANRYVAVTPSVTWATIEPSTSVIAACLPTYG
                     HLIGASRGFSTSFRSFWSRLSLKSIGGGDEDRSSIVHTSNQRSSGNRRQWERLGKIDN
                     NNEDIEMAGTTFEDDHIPLAKDAQSMNIHTRQSFMQLESYGESSADDHVPNPPKVLII
                     FEELDLPYESAYVELDEFKKPPLTDANPNGRIPVIIDPNTNITLWESGAIIQYLIDTY
                     DKDQKLTYTTFPEKYHLIQWSFFQASGQGPYFGQAAWFNIFHEKTYGESPESAKVRYG
                     SEVKRVAGVLNTALSDKEWLVGDKCTYADLAFVTWNLQIPFFMGSRTGEHAWRPEEFP
                     HFDRWQNAMLARPSVAKVVSLMNEKEVKKSA"
     gene            <757745..>759640
                     /locus_tag="TRUGW13939_10609"
                     /db_xref="GeneID:55998088"
     mRNA            join(<757745..758516,758570..758713,758778..>759640)
                     /locus_tag="TRUGW13939_10609"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493720.1"
                     /db_xref="GeneID:55998088"
     CDS             join(757745..758516,758570..758713,758778..759640)
                     /locus_tag="TRUGW13939_10609"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349613.1"
                     /db_xref="GeneID:55998088"
                     /translation="MASLSANALVFFAVAWAAWCLASLRANLSRARATGLPYVILPCS
                     VLGAPWLLTQPVLLPLLAALPESWTAKWLPLLLFNDGWHNGYEPFQRAGGDTFLAVSP
                     GGVILYTCHAEVSSQLFRDTRLGKPAHLMSLLNIFGPTITSTDGAESRLYRRITAPFF
                     SEATMRDVFVGTVQGGGQLAQVLRQPAAHHHLRDLAAKLSLHILNRFCNQAETLEDLA
                     MTLRGDDKPQGTHRMTYAEAVFTLLENYMTIFLIPSKLLRSSPSHTHRQAATAYAELG
                     RYLQEMKGQKEAELQQKVPALSNKPESIPELLVQSGLPAKDGSPAVLRPDQVIGNIWV
                     FVLAGHETNANTLTFIILLLACYPVTQRAMQADLDRILGDTPPDQWTYDTHYNPLMNS
                     FVGAVINEALRLFTVLPVIPKYVPPTGPPISITIDGHVHPLPPDTVAFVNTSATHRHP
                     QYWPRRESSEDTTPRAKRPFAVSDFNPERWIQKTGVAKHGLLSPPPGTFIPFSEGSRG
                     CLGERFALVELCASVAVLFKSSSVRLLTRGEEGGEYPEGELADTWEAARDRAELALSE
                     GVKFDMSLRVVRNVPVRFEARDSVSR"
     gene            <760278..>761225
                     /locus_tag="TRUGW13939_10610"
                     /db_xref="GeneID:55998089"
     mRNA            <760278..>761225
                     /locus_tag="TRUGW13939_10610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493721.1"
                     /db_xref="GeneID:55998089"
     CDS             760278..761225
                     /locus_tag="TRUGW13939_10610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349614.1"
                     /db_xref="GeneID:55998089"
                     /translation="MSFDPSALPSLTSKVYLVTGGNAGIGYHTARQLALHGARVYIGS
                     RSLSKASDAIAKIKAEAPNADVHFLHMDLMDLSSVVKAADEFKQKEDRLNGLVNNAGI
                     MATPFAKSEKDGFEAQWETNYLSHWVLTWHLLDTLAKTAKEEGSPAGNARVVNLTSNG
                     HKAAPKRGIDFDDLDQKNGGIWSRYGMSKLANILHVKKLNKLYGPQGSEGEKTGIWTA
                     AVHPGFVDTDLNKQTDGPSFIQPALKCLGVYKKPEEGAYTTLFAVAASEFKQSNSGEY
                     FEPVAKKGKPSKHASNMELADQLWEWTVVEMRKRKLLEQ"
     gene            complement(<761526..>762861)
                     /locus_tag="TRUGW13939_10611"
                     /db_xref="GeneID:55998090"
     mRNA            complement(join(<761526..761581,761652..762216,
                     762272..762416,762482..>762861))
                     /locus_tag="TRUGW13939_10611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493722.1"
                     /db_xref="GeneID:55998090"
     CDS             complement(join(761526..761581,761652..762216,
                     762272..762416,762482..762861))
                     /locus_tag="TRUGW13939_10611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349615.1"
                     /db_xref="GeneID:55998090"
                     /translation="MQLHTLPVDNTESPYRELYRTAKDCLSYVEGSNIFSIRLLQAAL
                     LIALYEVSNAMYPAAYLSVGHCARLGHAMGIHDRRRAPQMLSSPSKFSPAGEAIGLGP
                     DQDSETATELEERRRVWWAVIILDRYVNLGSKNRPFACEDARPDEYLPADDKHWDQGV
                     SFSARALSRKNAHLEAPPFARTCQAAHLLSRVLRNLNDSDTDAEFRFQEAIQLHRTTQ
                     ALYSTALHESEELVERMSDLTAHLPFSAAMGLCLSALLTLYDKYSCTENSEVDQMGSP
                     NLLEMQKIAISGLKELSSAVFQLSRRIRAAAELGGMLKTSPLICDCLYQAAANYLWYI
                     LETGNEECRSMVVGIKDVLQMLGTRWKSPIEYIRILDSYEMSQGLAM"
     gene            <764515..>766799
                     /locus_tag="TRUGW13939_10612"
                     /db_xref="GeneID:55998091"
     mRNA            join(<764515..766598,766652..>766799)
                     /locus_tag="TRUGW13939_10612"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493723.1"
                     /db_xref="GeneID:55998091"
     CDS             join(764515..766598,766652..766799)
                     /locus_tag="TRUGW13939_10612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349616.1"
                     /db_xref="GeneID:55998091"
                     /translation="MSRRPRSSSSGRDVSPVDVHNARRTSSQVSPVSEQSMHFEQSVS
                     RAFYPGSHPDSAYARLSSQRFGNIDSANQNQIHPPSPPRHVHQHMPPRITHSNSLRTN
                     ATATPGVDNLGAAAVGGGISGIAFGVANRNERQSGVEAMRPVDERGQQEQQHYYDGPS
                     ERHYTDTPYVPPVPYSDQPAADPRLARDSYHGNSNSYSASHLPLGGGAALAAAGTPAH
                     GSPSMSTSNPSQLSVGEPYPRYPSGGLYDGPYHSYHNNPASINPDEIADDGDDGFINV
                     PQRRSGLFGKKSSQEAVAGGAAAGAATGGVLGAMNNLRGGGSTVYGPVPHSEGGHAEK
                     NPALTQHAADAAAAKRRKRWMLTLLVGIGIIAVIVGAIVGGILGSRKHGSSSSNSDGD
                     SSGDGSDDPGTNTQTAEGDIKTNGLLDKNSPEIQKLMNNDNLHRVFHGMDYTSWGVQY
                     PLCEKYPPSPNNVTRDMAVLSQLTDTVRVYGTDCNQTQMVLAAIDRLELTDMKLWLGV
                     WVDSNETTVNRQMDILYDVIDDMNDTSILQGVIVGNEVLYNGGFEVKATAQEKLTTYL
                     NNVRSNLTSKGLKIPVATSDLGDNWTADLLEASDLVMANVHPFFGGVQVDKAAAWTTT
                     FFDTHDVSLTSGTKKEAIISEVGWPSDGGNDCGTNNCTDTTSGSVAGIDEMNQFMADW
                     VCQALNNGTKYFWFEAFDEPWKVKYNTPGKSWEEKWGLLDAGRNIKSGLKIPDCDGKT
                     VSS"
     gene            complement(<767104..>768063)
                     /locus_tag="TRUGW13939_10613"
                     /db_xref="GeneID:55998092"
     mRNA            complement(<767104..>768063)
                     /locus_tag="TRUGW13939_10613"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493724.1"
                     /db_xref="GeneID:55998092"
     CDS             complement(767104..768063)
                     /locus_tag="TRUGW13939_10613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349617.1"
                     /db_xref="GeneID:55998092"
                     /translation="MPHTSRRHRNHVSNNPLRAAHGKRLQITDDDGWVHVVNTSISDS
                     SPRTKPKTYTSATTDGSADDPDCSPSSKQEEKEKEEEEEGKLPLILPAEAPPRLTLSS
                     LRQKFDADLAAWQTSATWTTLRDSLLRILARLPAGSEFDRLVCIGLGSPSGLRDGWVD
                     RRDVASYQLAAFVSLVQSVQQEQEQETSQTGEAAATTRKMEIIAQDPIFNALDKQLLS
                     SLGITVVAHPQAFSSVTAQTLLFAPGAEKRHLELVLPARPLVLFGGPLEEDTGRLYQN
                     QQKQKDSVIEQFLTTTQSMKLVEFGPRPEAFWRMRIYWRDLVD"
     gene            <769223..>770049
                     /locus_tag="TRUGW13939_10614"
                     /db_xref="GeneID:55998093"
     mRNA            join(<769223..769430,769492..769805,769855..>770049)
                     /locus_tag="TRUGW13939_10614"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493725.1"
                     /db_xref="GeneID:55998093"
     CDS             join(769223..769430,769492..769805,769855..770049)
                     /locus_tag="TRUGW13939_10614"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349618.1"
                     /db_xref="GeneID:55998093"
                     /translation="MQTRSIWTALAVLSLFLVDIVTAHTIIVYPGYRGNNLHTNGTVL
                     EASGLGQTVVNDTTIFPYGMMWMYPCGGMPTSTNRTKWPTQGGAISVQPGWFQGHQTA
                     FFYFNLGLGATPPNMSHPMLPPFQIIGPSADPYPGTFCLPQVPLPANITVKVGDLATI
                     QVVETAKHGAALYNCVDIEFAEPEDCVEVTTDNCFNSSDIQFANVYTAALTTSDASSM
                     TASSLFALVPLVVLGLWSLI"
     gene            complement(<770329..>771549)
                     /locus_tag="TRUGW13939_10615"
                     /db_xref="GeneID:55998094"
     mRNA            complement(<770329..>771549)
                     /locus_tag="TRUGW13939_10615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493726.1"
                     /db_xref="GeneID:55998094"
     CDS             complement(770329..771549)
                     /locus_tag="TRUGW13939_10615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349619.1"
                     /db_xref="GeneID:55998094"
                     /translation="MAHLTTARDPLPLPLPAGITSRRLDLSPQGHLNYHILEACSSPS
                     PSSQHNQLIILLHSFPEVAYSWRKTMLPLARAGPYHIVAPDQRGFGRTTGWDSRPYGD
                     VDLHTCSRTSLVRDVLVLARALGYATVKCVVGHGDVGGMVAADCALIRPDIFQSVLLI
                     GYPFAGVPDLPRSSSSDSSNEKKKAMHDRLAALGRKHYQQYYSSARANADMTGPITAR
                     GLRGFFRGYFYLKSGAWPGNDSARALETCSADEFAEKLPYYCIMPVQASMPEAVQMLM
                     KSEESDSSKQWLSDEELEVYVSEYARTAFQGGLNWYRVVTASGCDSGSMELVHELDIF
                     SGLKIKVPCAFLGGKKDWGLYQEPGAMQKMRDGTACEELVFLRMIDGAGHWIQQEKPD
                     EVTQGILELLKSVK"
     gene            <772698..>773389
                     /locus_tag="TRUGW13939_10616"
                     /db_xref="GeneID:55998095"
     mRNA            join(<772698..772907,773045..>773389)
                     /locus_tag="TRUGW13939_10616"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493727.1"
                     /db_xref="GeneID:55998095"
     CDS             join(772698..772907,773045..773389)
                     /locus_tag="TRUGW13939_10616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349620.1"
                     /db_xref="GeneID:55998095"
                     /translation="MDLDGNSGSELSEVLDDQELRRMQVELENNDEAEKNTNQETKKT
                     RQSKHTAQVSGLTDRKKKAQEIEEPQLQTLRKLYFGPSIPDQSTSNNPNPRPSTTGSK
                     KRKHDDEDGKNDDRKYHEERPSGKGKQRAEGSFSTKYNLRDRSRQVPGEVWCPDFKYW
                     VNPCWEFGPELTTQDVIRRLGRRL"
     gene            <775818..>785145
                     /locus_tag="TRUGW13939_10617"
                     /db_xref="GeneID:55998096"
     mRNA            join(<775818..776062,776118..776388,776455..776625,
                     777271..777570,777616..777667,777719..777765,
                     777834..781908,782785..783080,783551..783912,
                     784239..>785145)
                     /locus_tag="TRUGW13939_10617"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493728.1"
                     /db_xref="GeneID:55998096"
     CDS             join(775818..776062,776118..776388,776455..776625,
                     777271..777570,777616..777667,777719..777765,
                     777834..781908,782785..783080,783551..783912,
                     784239..785145)
                     /locus_tag="TRUGW13939_10617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349621.1"
                     /db_xref="GeneID:55998096"
                     /translation="MNGIFPADLAVYLALFPITCYIFMAHRWTGFLPWYYLCIFCLAR
                     IVGGALGAQDNSSLPANIIQSVGIAPLILAVDGLVHEARAYRYPSKSRLLDWSVVVFT
                     SSLMAAALGLSITGALHIYQRNATPDSLSFWKAGSAMIVVVWLMQVFWSIFSLVTSDG
                     KTYGPAHQGSTALLQGACAALIPIGIRVIYTLVAVCTQRTDLSPVYGTTAVRVVLMFL
                     PEVLAIVVMVVRNNNLGFVSLSCFAFCFFVPPPLSALAALELAACLPRPASVTLLALF
                     PAVARPVLTSHFPIISSILSLLFAHLARAALWDPTSTSPVPIVHGPWLCEERLAFRPS
                     RDVSSQKFVPSSEAIAGAHPMVDVRVVPPLNTTPSASAQTAASRAFTANRDAGAALSS
                     AAAAAALRSHTTTPTSVENVQSKRMLQRRLSNSSRGSAATTPVRGGSLHRTPSSSSMS
                     SRTFREPSPHRPQTSSGETTKRHPPIPPLPQGLTNLSKLGGGRRSSSVQVPPSRVTSP
                     STVLPNGRVTSLDRSSGQTASPTSPSPRTVRSQHSAQSSLDLDRPGSRTSINFSYPMN
                     ARPNSPPHSPIQTEFPRDSSEQSPSRPLSPIEAANIQQSVNKASSLKVKKKPRTAAPG
                     STEGSHLAQKSMGSRPTGSAVQDTPKSVDSRAPQSPKSPITDNTTKRPSPVVDDSSQS
                     PIAIINNSTPTEDVNNVRAKPKKRPSAVMEDHNAEEQAEAAETSQQKIPEPPVAPQSP
                     VNNKSVNGRPNQRPPAHLSIETPQTKDQMISNSPMRLSPSTSSTPSSPASDRLSADQT
                     FDKQKPDRPASISPNRSARFSSHLTVSSESPIHEPPPRSMSPVKPALKMSSSPDRRLY
                     TGLRTGQTPSEISDATSVASDDGSRTGSRKKAVKVSFDDGPDIVGVAASPPTSPEPVD
                     TPSPIEKTKSRSWFSIAKKKLNLKDANDDDFESVLKPRPALPSFGSIRGTRELDEPTT
                     SVVDDDNESTSSSDDELDHFSASNDHAIGGILANAYSQKEESIAQDRETTAQNTGSEA
                     RDTVLEDIDEIPSVSMQQQLPTVVEESDSNPSPLATPVQTPTVALDGPLLGTNVDGSL
                     EAVPTIAIQPATPGEDNRRSLEIQNMPGGFPMSSERNTTTKVESTPASAAAAQTEPST
                     PANDAPTTADDDDGESDESVYSDAAEEPDGFDGDRFGSINAIVDSPMPSKTKPQQQAP
                     ESPSPSRVSPVTALAVSPPQSPSAPQAMTPEPSTKSSVVESQSPSIPKATSPTESAEP
                     VKQRKNTTSVNAPRTAGKQKGIDSFDPSWPLRSKDDPSPSVSTQTKAKRPVSGNPHQG
                     SHLRNALGKNERQRANPQNKHSTPVMPHVPISQRMSSPPLPNSATLKNQSSTKPTQKP
                     MSLAGSLISAKGDDSDSDSSFKRTRRSSRAEGQYSMKRTMRATRPVSMAATETMVGRS
                     TSPRASSMRMTMRGPPPERSSSGFASLRNKTASPRMRTSTTAPSIRSRIIDSDDEGDG
                     GRNIFHSRFADSSDEDEPLSSNLTPVRGIPRRRGELDRESTDLEDSSDDEGKRAARNG
                     IIRPGSQITPADIDAILSQPRKRGGLLSRFTSKGKDGKVRKSDLESAARRDTPLERTP
                     TELAQVREEVEILGAGRSTTPKLHKKNTTAQGSTWPTASPAPSREIPNRPSTSDGLVN
                     GVDRTAIERPTYSRKNTLDSLESEPVGAVSDVVVGRTGRKKRFPLLRKAFGLPVNNCT
                     FDHIILSSIIVMTMSQLGADRRSTDPIGARREAVAIETPRRVCSTRRSRLVILPAPFC
                     DGTGLYACELPRPRLPAIAAATVQKEKPLQWLVNDVQRHSRKDAQRTVNLDFEARVPI
                     PFSVFPSSYRSDAVSEATQTRVEGEVDINSTSRVRREDTVGVAAAQQLPDPRAYGKEE
                     VDVRISEDRRRYEPAPTRVYQEQRDRYYESQPQVELSRDRYQEPIGRYEEPRTTQDKA
                     LETQLDITERDYRRRIHPTYDVDVYDRRYQPSTEAYRPDNTYELTSQGRAPYPPVDVS
                     VTKETIRETAPKSKMGYYDDEGHYHSFRRGVERAADRILHPFHHDHKEEVVAEGPSRY
                     REGVREEVRVVEPRGGSSNRESVPIPVHFVRVGDLLILQGRPCQVIRISVSPQTGQHR
                     YLGVDLFTRQLHEESSFVSNPSPSVVVQTMLGPVYKTYRVLDIHDDGRLTAMTETGDV
                     KQSLPVVTQGSLFQRIRDAYSDGRGSVRALVINDGGRELVVDYKVIHGSRL"
     gene            complement(<786545..>788754)
                     /locus_tag="TRUGW13939_10618"
                     /db_xref="GeneID:55998097"
     mRNA            complement(join(<786545..787272,787327..787586,
                     787644..787919,788147..>788754))
                     /locus_tag="TRUGW13939_10618"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493729.1"
                     /db_xref="GeneID:55998097"
     CDS             complement(join(786545..787272,787327..787586,
                     787644..787919,788147..788754))
                     /locus_tag="TRUGW13939_10618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349622.1"
                     /db_xref="GeneID:55998097"
                     /translation="MSPRRSSRARTTQPSPALLQHTNSNSSGNSLGRGDRNTRANNHK
                     ISSPQRSSTQRSQSLDDSDGKLDQPQTRQRQRVRDEDNGAPPGPNGDIGDEDDDENEE
                     EEVTRCLCGQQEYPGLPPSRQDATARNDPPQVGAKDSTNIATIESDPLSEEPGSMFIQ
                     CDSCKVWQHGGCVGIMDEAMSPDEYYCEQCRKDLHNVINESNGQLSSQYLPVAPVSSP
                     RSPSRESSRDRSHSSRDTKSRHNDNPKRRSTMNSRDAAYDEEELLRRAIEESKEETRM
                     SNDETSSRRTKRSRSDSEANRQAAVKRPRTSSPSPSALSKQSIPGSQPVSEDETKTKM
                     NGANRPKRAPPPRSQREKETKEPEEQEAERVDPAARRKSRSEKKRGDESDREAEASPT
                     KPPPTSAPVVAEQPEPSEATPETPVQPAEPTPAPRQSTRKSGRPPARRGGRVGRNQYT
                     RERDVNGDSNNSPNSPHGGPFRDNGRDSPNLSGPNGVQANGTDSGKTGKARHLNPNRT
                     SMSEMKRRVSAILDFISRMQVEMAASGETITPPDSNGNGSSSRTSLVKGVQEQLGNLL
                     AMNGEGASTDSSTASVTSGEATGKEPDFKELSSVEMMDVLTRHLLKWQQEYGKYGEK"
     gene            <790670..>792466
                     /locus_tag="TRUGW13939_10619"
                     /db_xref="GeneID:55998098"
     mRNA            join(<790670..790673,790753..791532,791592..>792466)
                     /locus_tag="TRUGW13939_10619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493730.1"
                     /db_xref="GeneID:55998098"
     CDS             join(790670..790673,790753..791532,791592..792466)
                     /locus_tag="TRUGW13939_10619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349623.1"
                     /db_xref="GeneID:55998098"
                     /translation="MSGPYSAMPDTPSPVYPDRLIRPLPKRPLRSRLSPEAAGTIMFP
                     PAPPVSQLFYGSYSEHGDTRDSKVYMQQNSVESYSHEHSPDRDQRHPYENGVSEVESG
                     DEGSPVVVRRSAGFRGSSLSPSTPVPNGQAVQSSPGGPDGYDAFENTNNKKKRKIPTS
                     GALNSHHSSLTSDLASMGISSSIAGSPVGLGDSAAGTYYGSGSPATSSVGSVSGPGRG
                     RYGRHAPRAVGGRNSLSVHQQNTWLSGRAGSSRRDLTSPHSGTGETGTKSDQGIISTA
                     IANAAALSPSPKGGNNVSLLEQQANKTTPTKTQFTFTCESDSSKSIAMHPPNPYPLSH
                     PRMPNPSMNARDFATQTTPNMGGQHGPPLPGGGTPTNNPGQRPRRSRESMYALAARRR
                     KIQQHYANIHNPPSPEDIWICEFCEYETIFGEPPKALIRQYEIKDRKERRRLAEKRRL
                     LEKAKMKGRKNKKATKNAAKHPNAQQPAHHGSDHHHSMDAPPHPDDYLGEYDDEIPPM
                     AAPAPAPPHAHHHRAPAVPSAGRPPPLAGPIPEGTVGSGLDRPA"
     gene            <793803..>794444
                     /locus_tag="TRUGW13939_10620"
                     /db_xref="GeneID:55998099"
     mRNA            <793803..>794444
                     /locus_tag="TRUGW13939_10620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493731.1"
                     /db_xref="GeneID:55998099"
     CDS             793803..794444
                     /locus_tag="TRUGW13939_10620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349624.1"
                     /db_xref="GeneID:55998099"
                     /translation="MFFLVFRLLRIGVNQAKKRKNGGGDQQQHDGWYDNGNREMQGGI
                     TGPGDRSATKSTLDSILRFFQFVMGLTVVGLYGVDIHHAHKKNVSADAKWVYAEVTAG
                     MAVVTATIILLTPFFMKKRSITSVHALQLPAFVWESVLCVLWLTLFGIFGKMYIGEDA
                     EGDSGITRMKHAVWVDLVNLLMWTGTATWCGLRWWKGKASAPEPFESDKVYEQ"
     gene            complement(<794777..>796316)
                     /locus_tag="TRUGW13939_10621"
                     /db_xref="GeneID:55998100"
     mRNA            complement(join(<794777..795384,795463..795922,
                     795981..796156,796208..>796316))
                     /locus_tag="TRUGW13939_10621"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493732.1"
                     /db_xref="GeneID:55998100"
     CDS             complement(join(794777..795384,795463..795922,
                     795981..796156,796208..796316))
                     /locus_tag="TRUGW13939_10621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349625.1"
                     /db_xref="GeneID:55998100"
                     /translation="MNQRIPSGVVTTTDGLTTELQRSEAVNPDDIAQLWKVYTTQSSK
                     IQDAVACRLENLFWRLWADPKLQKGLSGVTLANLFMAIHESRTIHAIPPSKTDFSRPN
                     DTSQVTILTITHERDGGSGKGSKSPLPPILKNSAGAKGQPPSESSSYKTARIVIPDQP
                     SQRPTKNAGTANNNKATGGLGSKQTRKRPSFAVNTSASSRRRGVFMRRKSPITTPTVE
                     MEEPFPPAVIEQIAEREETEQTEQTEPVSKEDAELPWRSLSYLKPSDDDITSIQASLA
                     ASPSSPPPATFSVSSVARHRSPEDLEHGQTTAAAEVVKSDTTLVDRDFRTHFVERKRH
                     ESVGSKGGASSSLTSNLSSSQFKDLINSNANPIIIPSVSRSLSPAKRHILSSNNPSAL
                     SPSSPRKRDRGPAPMAIISTSQTQFAPSSTQKTTSGVFSVSRQSQDIGEQLTSLMRSK
                     "
     gene            complement(<797533..>798759)
                     /locus_tag="TRUGW13939_10622"
                     /db_xref="GeneID:55998101"
     mRNA            complement(join(<797533..798139,798200..798269,
                     798327..>798759))
                     /locus_tag="TRUGW13939_10622"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493733.1"
                     /db_xref="GeneID:55998101"
     CDS             complement(join(797533..798139,798200..798269,
                     798327..798759))
                     /locus_tag="TRUGW13939_10622"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349626.1"
                     /db_xref="GeneID:55998101"
                     /translation="MASIFKPTAARQALRAVARPAVRAAVRPALAVNSRSLSTTPARL
                     KDDDPKKRLTTEAPQGASGTHEGAFARTDDNLVIEHPTDEEMPRSPVVQGRGGMHFKR
                     TLASFSLENKVSVVTGGARGLGLVMGQALIASGSDLAIVDLNKDEAEDQAKKLVAQFQ
                     KENPGLEELPRVTAHYADVSDPDSVTTVLASIIEQHGKIDNLVTSAGFTENFDAISYP
                     YDRIKKLWGVNVDGTYLFATGVAKHLMDRQAPGSIVMIGSMSGAIVNVPQPQAPYNAA
                     KAAVRHLAASLAVEWAGHDIRVNCISPGYMLTALTKKILDENPELNKKWTSLIPQGKM
                     GVPEDLMGAVTFLLSDASRYVTGAELRVDGGYTVT"
     gene            complement(<799913..>802312)
                     /locus_tag="TRUGW13939_10623"
                     /db_xref="GeneID:55998102"
     mRNA            complement(join(<799913..799966,800101..801715,
                     801762..801859,801908..802106,802167..>802312))
                     /locus_tag="TRUGW13939_10623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493734.1"
                     /db_xref="GeneID:55998102"
     CDS             complement(join(799913..799966,800101..801715,
                     801762..801859,801908..802106,802167..802312))
                     /locus_tag="TRUGW13939_10623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349627.1"
                     /db_xref="GeneID:55998102"
                     /translation="MMLRTSRTLGPIALLRGIQPARAASTSAANKQGTVLDSILIANR
                     GEIALRVGRTAAQHGIKVTTLYTNPDSKAQHALSSPYAFNLGDTSAYLDGDRIIEIAK
                     REGCQGVHPGYGFLSENSEFAQKCTNAGLVFIGPPSKAIEDMGDKSRSKEIMTAAGVP
                     CVPGYHGRNQDAQFLEAEADKMQYPVLIKAVKGGGGKGMRIVRSKAEFQDQLRSAKLE
                     AQNSFGNDNMLVEKYITTPRHIEVQVFADKHGNCVALGERDCSIQRRHQKILEESPAP
                     HLPDEIRKDIWEKARSAALAVGYEGAGTVEFIFDNDSGDFYFMEMNTRLQVEHPVTEM
                     VTGQDLVHWQILVAEGAPLPLSQEEIEAKMAVSGHAIEARIYAENPDQGFIPDSGRLL
                     HVRTPKETENVRIDAGFIAGDEVSAHYDPMISKLIVRGANREEALRNLSVALEEYEVA
                     GPITNIEFLKTICKSPDFVSGAVETGYIEKHREELFAKRTVEDELLAQVALASLLNTS
                     QQNIESSPLGFSPSYQQRRFTFTEQVSLAPDATNPTHEVEVRQVGPDEFDVTVNGRKF
                     EQVRSHRAAGSRHGITSFFRHTRLDTTVVQDEELIVAFQRGRQYRLTVPRSKWMEKAL
                     GLRDVANSVLAPMPCKILSVEVTEGQTVEKDQALVVIESMKMETVIRSPHDGTIARVV
                     HKKGDQCKSGTPLVEFAGGEE"
     gene            <802601..>804183
                     /locus_tag="TRUGW13939_10624"
                     /db_xref="GeneID:55998103"
     mRNA            join(<802601..802796,802859..802946,802995..803089,
                     803145..803386,803437..803714,803772..>804183)
                     /locus_tag="TRUGW13939_10624"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493735.1"
                     /db_xref="GeneID:55998103"
     CDS             join(802601..802796,802859..802946,802995..803089,
                     803145..803386,803437..803714,803772..804183)
                     /locus_tag="TRUGW13939_10624"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349628.1"
                     /db_xref="GeneID:55998103"
                     /translation="MFAAAVPRSTIRHLALRGPCGVRAALSSSPAAVRSRLHSTKHPR
                     GFAPPTDDDLTELRERVQEFTRREISEEVAAQTDRQNEFPADMWKKLGEAGFLGITAD
                     EEYGGLAMGYQAHCTVLEEISRASAPGSIGLSYAAHSQLCVNQLSLNASPEQKAKYLP
                     GLISGEKIGALAMSEHSAGSDVVSMKTSAVAVDGGWLLNGTKMWITNGPDADYIVVYA
                     KTEPDQGSKGISAFIVEKSFKGFSCARKLDKLGMRGSNTGELVFEDVFIPKENLLGEI
                     NRGVKVLMEGLDLERLVLSAGPLGIMQSALDLVLPYTHTRKQFNTPIAHNQLVQGKLA
                     DMYTKLAASRAYTYATARQIDESAVTSAVNIRTQDCAGAILYAAERATECSLDAIQLM
                     GGNGYINEIAAGRLLRDAKLYEIGAGTSEIRRMVIGRAFNKEYA"
     gene            complement(<804329..>805619)
                     /locus_tag="TRUGW13939_10625"
                     /db_xref="GeneID:55998104"
     mRNA            complement(join(<804329..805474,805548..>805619))
                     /locus_tag="TRUGW13939_10625"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493736.1"
                     /db_xref="GeneID:55998104"
     CDS             complement(join(804329..805474,805548..805619))
                     /locus_tag="TRUGW13939_10625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349629.1"
                     /db_xref="GeneID:55998104"
                     /translation="MSDDEYYEDDDDWYWYEDEYTGIGDDLAATAVHSPIMVEDPSLE
                     IVETFSDWEYYSDDYYDDDPSIIKKQGTESGSAEGHTDGPPRKKKRKLSALQDVPTTL
                     SLGPAIVDGSSSPTDANSFQGVLWRRPPAAALGKEEITLYEPGKGEKVALLSDWREVF
                     KSSLARTDWFQNGVNPQEDDDMEKQQQHLEPIVREEVTPEIQENGVRENRYATYSPPP
                     LEIDDMNKSINRQREKNIQPDLGKPQSNLREMMVVGDSEEGEPEEIEESAAAPLEEPA
                     DAEVEDENMEQQQEETEKEPTTRKKMLRVEVPAPSSNVTNSSPPRKRGRKPKDATSTK
                     QQQKPQKSPVITSDNNKVSNPKKRGASSLQVDENDEPDSKRRSRRIASVSETQPEQKR
                     VPAKSNRGRKRNV"
     gene            complement(<815418..>819284)
                     /locus_tag="TRUGW13939_10626"
                     /db_xref="GeneID:55998105"
     mRNA            complement(<815418..>819284)
                     /locus_tag="TRUGW13939_10626"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493737.1"
                     /db_xref="GeneID:55998105"
     CDS             complement(815418..819284)
                     /locus_tag="TRUGW13939_10626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349630.1"
                     /db_xref="GeneID:55998105"
                     /translation="MAIRKDLIGAVRVENRTDLVDHPYLQALDIWEAPIISGHAPRRT
                     RIVNCYDVWIGASYRWQGAFPRRRRAIEDADWDLLIVGRCLLVGDFNAHSPSWNPLAK
                     GRVNAEPLEQLIERHSLYVNNPLGEATRYKKTEGVSIIDLALSSPTLGPLQAWEVDKD
                     KPTTSDHELIVLAWEALEPPPGGISGEITGWQIEALQVNEEALKLATAAWASEAVGHP
                     PLSDQCTEEDLAREANWVQDTLTSVLDRHAKAVRLCARSKRWWKPELRQARSLWAAAR
                     KRWQAHACTDTEFKAARTAYYHEIKAAKRTCWEVFLAEGGPGGKEEWKKGSNPTGNPF
                     PKGPRDGLEKPSPGDPNRCWIALQYTKPRTNPTTPALQGPDLGAPPATTMADKEALIR
                     EMAFPNAPRSSPPGELPGGQAHMLITPERVHQALFSQSIKKAPGADRLNFKACRLLWA
                     LDSPRIIGMARQCFRLGVHPGAWKTAKGILLRKPGKPDYTQVKAWRVISLLSCLGKVV
                     EKLAAGLIADWCEAQGALHPGQMGCRRGRGAIDAVACLVQTVHEGWTQKLLTGTIFID
                     VMGAFDHVDPYKLSEAMEAAGLDNDLIRWTLSFLTNRRVSLVIDGYKAPEQPIDSGLP
                     QGSPVSPILFLIYIRGVFQAMEQQVPGIKALSYADDIGLVAQGSSVSEICRQLEAAAK
                     AATEWGLANSVKFDPKKTEAILFSRATSREHKNQVQEARVQVGDALVAFSPTAIRWLG
                     VLLDPKLTLKAHYKYRLQKGQNTERRVRALCKAQGLPPGLAWRIQKATAQSVALYGAE
                     LWWHGQKNCLEGLQGLINNQARAVTGMLKSTPLGPLIREAALEPAEALLDSKQRRYAL
                     RLLGLPQGHPAAEILPITLREGDAHAQPGEQPLEDRAWATPTRRGPWKLGMGLARRLR
                     EALTADPSQGFERTIEPGNRSIPLDFRIDSPETAMQLASDPLSGIGNTDLYSDGSRLD
                     DQRVGAAVAYKPLIGPWRSRLAPLGAGFEVFDAELIGVVEALEWALAENLRGPIRVFL
                     DAQAAIGRLQHTQPGPGQALALRAHDLAKELQATGRRVTICWVPGHKGVPGNEEADKA
                     AKKAAGKPRTGKYSGISLAHAQRACTEAYRAARANWLAAKLAKRAQRASQAYYPPRGW
                     KLDPMLANTPKHLARRYYQFKTGHAPIGAYLHRIKARDFPNCLGCSRGTETVRHLLTN
                     CRQWCHQREKLYAGLAEAGVKALQDSEQCPEARLFQDPKATTALLAFIGAIREREDNQ
                     QAWEQAYKTDNWGIEALDEGEREGEG"
     gene            complement(<819450..>821351)
                     /locus_tag="TRUGW13939_10627"
                     /db_xref="GeneID:55998106"
     mRNA            complement(<819450..>821351)
                     /locus_tag="TRUGW13939_10627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493738.1"
                     /db_xref="GeneID:55998106"
     CDS             complement(819450..821351)
                     /locus_tag="TRUGW13939_10627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349631.1"
                     /db_xref="GeneID:55998106"
                     /translation="MAPGLPNIDNHPLDPGGQALGLVNPVGAYIGTPAGTAPPAPPEA
                     SATVPQSEGFLPSLEINPRELFPPLSSVPGSQEAPKTLGKRLQEHSPDGAERAPMKAL
                     IGPAYKDMEQALLGHFASSNSALHAEMAAMKAYMTSLVEAMEQRLTGQLGALERRFST
                     LEAQQASPNAPNHPLKPLSSGGDRQGPRQPLPSQGTTFAEVAHGPQANPNRAAKPIEP
                     RRASPPISKPPPGVKPAAGPQWADIAASNAQEWQIVTKKRAYSPNQPPKVQMDPGSLK
                     PIRGSNKGDRRLIFRRENGRTAPRKSKADVILQLNRCLAQAGFPNFARVIDANYTESG
                     AISALLDQGSTVGSLLPAYKDLLVAACHRVDPAVISVEADQQWHKIKVHAVPVARYSA
                     SGLGLAREEIELGGTCTLMRNPTWIKPIAAIQTNKQRFSTIVITVGGLDDARRLLARG
                     VRFGGNRHPTSPYHEVGKDTVCTRCCGIGHRTYRGCGTRPPLCTVCAGAHEAQEHTCN
                     VLDCRAQTGHPCLHAPTKCGNCGGKHQADSPGCPKLREARRRLHKRFPGVEVVMPPPP
                     PEWTEWEGVAEEASPPTTTQDAPQAPKLREVDDAMEDAPGTSPLPYSSPCPTPTPGAA
                     APINVDYST"
     gene            complement(<822781..>823665)
                     /locus_tag="TRUGW13939_10628"
                     /db_xref="GeneID:55998107"
     mRNA            complement(<822781..>823665)
                     /locus_tag="TRUGW13939_10628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493739.1"
                     /db_xref="GeneID:55998107"
     CDS             complement(822781..823665)
                     /locus_tag="TRUGW13939_10628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349632.1"
                     /db_xref="GeneID:55998107"
                     /translation="MSPMNERGSDAEDEFLSHLPPDTPVFYYKSQFRLESLQPPESPY
                     DSFVVIKAFPPELLDHLDEKLPGRLDYSLSLKVLILKMPSRPHEAAAEEFGAMLTTLA
                     NHMKVRRQISYLGSSRVDGEDRKKQADRSWAPVRTQGKFPSVVLEVGYTETAAKLERD
                     IAWWVRQSEGRVKMGITIDIKRGSHNIEIKSWIPARPFTKHVRLTASNRQVVNRDTSL
                     QPPLRIAQKIVIKKGGNGKEPTIEGGSLIIPFKSLLLCEPGEGEDNFVFTEDMLIHDI
                     ADFIWVAIEKEEAEKRAK"
     gene            <825165..>827017
                     /locus_tag="TRUGW13939_10629"
                     /db_xref="GeneID:55998108"
     mRNA            join(<825165..826657,826726..>827017)
                     /locus_tag="TRUGW13939_10629"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493740.1"
                     /db_xref="GeneID:55998108"
     CDS             join(825165..826657,826726..827017)
                     /locus_tag="TRUGW13939_10629"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349633.1"
                     /db_xref="GeneID:55998108"
                     /translation="MAKSGLLRTSFLRTEAVSSVSAVRCLSSLSIQQPTLRHRTFQHA
                     RRKPAAQFSRSVANHTFQHHANAISVLQSSVDTESADFKENARQMSELVENMTDLHTK
                     IAQGGSQKARDKHIARGKMLPRDRVTSLIDPGTSFLELSSLAGHEVYPGEDVPGGGII
                     TGIGTVEGVTCMIVANDSTVKGGTYYPITVKKHLRAQAIAQENKLPCIYLVDSGGANL
                     PHQADVFPDRDHFGRIFFNQARMSSLGIPQISVVMGPCTAGGAYVPAMSDETIIVENQ
                     GTIFLAGPPLVKAATGEVVSAEDLGGGHLHSTISGVTDYLAVDDSHALVLARRSISNL
                     NYPTTTAPVSGLSPDTDFKEPLYDPEELGGIVGTNLRRQIPVHEVIARIVDGSEFSEF
                     KRDYGSTLVTGFGRIYGTQVGIVANNGILFSESSLKGAHFIELCAQRKIPLVFLQNIS
                     GFMVGADAEKGGIAKNGAKLVTAVACADVPKFTVVFGSSAGAGNYGMCGRAYSPRLLF
                     MWPNAKIGVMGSEQLSAVMETVGRSADPELKARIDRESQATFSSARLWDDGVIPPAHT
                     RRVLGLGLAAAVGGRVDEKETKFGVFRM"
     gene            complement(<827618..>828634)
                     /locus_tag="TRUGW13939_10630"
                     /db_xref="GeneID:55998109"
     mRNA            complement(join(<827618..828038,828089..828098,
                     828154..828182,828232..828254,828318..828397,
                     828449..828475,828542..828573,828624..>828634))
                     /locus_tag="TRUGW13939_10630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493741.1"
                     /db_xref="GeneID:55998109"
     CDS             complement(join(827618..828038,828089..828098,
                     828154..828182,828232..828254,828318..828397,
                     828449..828475,828542..828573,828624..828634))
                     /locus_tag="TRUGW13939_10630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349634.1"
                     /db_xref="GeneID:55998109"
                     /translation="MQPRREYHIVVLGAGGVGKSCLTAQFVQNVWIESYDPTIEDSYR
                     KHIEVDGRQCILEILDTAGTEQFTAMRELYMKQGQGFLLVFSITSMSSLNELSEIREQ
                     IVRIKDDEKVPIVIVGNKSDLEEDRAVSRSRAFSLSQTWGNAPYYETSARRRANVNEV
                     FVDLCRQIIRKDLQQSQSSIMDLQTRKREAPVNNSRKQNRRRRRGQCVVI"
     gene            complement(<829910..>831634)
                     /locus_tag="TRUGW13939_10631"
                     /db_xref="GeneID:55998110"
     mRNA            complement(join(<829910..830127,830270..830965,
                     831109..831435,831494..831564,831627..>831634))
                     /locus_tag="TRUGW13939_10631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493742.1"
                     /db_xref="GeneID:55998110"
     CDS             complement(join(829910..830127,830270..830965,
                     831109..831435,831494..831564,831627..831634))
                     /locus_tag="TRUGW13939_10631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349635.1"
                     /db_xref="GeneID:55998110"
                     /translation="MCLFRTTCEDLELAVTLDSLELFGVEDAQNLVLDLISALRALAD
                     IRRLPSANGRKNLLSDLNVMIRSNDLELDRFKPLLQAVLDEESDRIIWDKIYGAVRES
                     TPPPKAFPVLDQTPYLHTTSGLVNSSGHRSDIDGQGDEANIPLVIKDSWQYPEREEEG
                     VLLREAAAKGVTNVARYYYHETIKFNGIIDDIRDNIRRGLDVSKAANYRPTRFEGSPT
                     ISTADSRSTSTGGRKRSSSRTGVAPPASKRTCSSSPSKSAKSPDLSNRIHRRVIVRDY
                     GTAIYKAKSSVSMLSALESCIEGYKSLHMKAGLLQGDISTGNLIFNEEEENPSWSAFL
                     IDLDLAIKEQREGPSGARAKTGTRAFMAIGLLLAGMKLGVVAKESIFLKTATDNFTSH
                     YRALIPWVNRLRKEVFLMDKPWEKEDHRLYERFSTVLSQARKDPSVQ"
     gene            complement(<832855..>833746)
                     /locus_tag="TRUGW13939_10632"
                     /db_xref="GeneID:55998111"
     mRNA            complement(join(<832855..832963,833019..833350,
                     833405..>833746))
                     /locus_tag="TRUGW13939_10632"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493743.1"
                     /db_xref="GeneID:55998111"
     CDS             complement(join(832855..832963,833019..833350,
                     833405..833746))
                     /locus_tag="TRUGW13939_10632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349636.1"
                     /db_xref="GeneID:55998111"
                     /translation="MSQPTLVVYRGFPERGAYVWSPFVIKLETRLRFARVSYQIETGS
                     TQKAPRGKIPYISVSRADTEPVVLADSQLISDALTDEGVLPKLNEKLSPFENTLDAGL
                     KALVEDKLCFYNTHERWNENYYTMRDKVLAAIPYPLRVAVGILAWRKINASLYGQGTG
                     RFSPEEIRAFKTKIWHQIEDLLADAKRKAAAKSSEKVFWIFGGTEPTEADTAVFAFII
                     SGLICEAAPETGKLLRSLPSVVEYARRIHNEYFPDYTSPVWE"
     gene            complement(<834691..>835918)
                     /locus_tag="TRUGW13939_10633"
                     /db_xref="GeneID:55998112"
     mRNA            complement(join(<834691..835472,835534..>835918))
                     /locus_tag="TRUGW13939_10633"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493744.1"
                     /db_xref="GeneID:55998112"
     CDS             complement(join(834691..835472,835534..835918))
                     /locus_tag="TRUGW13939_10633"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349637.1"
                     /db_xref="GeneID:55998112"
                     /translation="MTLSNVTATNATMRAVVWQGHPYSVDVVDLPKPTIINDTDAIVQ
                     MSRAAICGSDLHIYRGTNQGSPAPFGLGHEGVGYVAEVGSGVDYLKVGDPVIVPFTVY
                     EGHLHTNLTTQMYAGYGNGANMGGTQAEYLRVPFADNGLIPAPTLEYTDPANNESVSL
                     LNDYVMISDIFATGWTSLDFAGFEAGDTVAVFGAGPVGLMAAYSAILRGASKVYSVDY
                     VPERLRLAETIGAIPINFLDADPVEQIRALEPNGVARSVDAVGYEQVNRNLTVQSDVI
                     IGNMLAVTSTGGGMGTVGVYNPESNNTATAPRAASVHTHFDFPLSDFFFGEFKWGAGP
                     SKPIDLAPQLVQLVASGKARPGFIVSDVVNIEDAPDAYARFEKHEITKVVIAFD"
     gene            complement(<836459..>837620)
                     /locus_tag="TRUGW13939_10634"
                     /db_xref="GeneID:55998113"
     mRNA            complement(join(<836459..836735,836801..837241,
                     837308..837373,837421..837469,837530..>837620))
                     /locus_tag="TRUGW13939_10634"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493745.1"
                     /db_xref="GeneID:55998113"
     CDS             complement(join(836459..836735,836801..837241,
                     837308..837373,837421..837469,837530..837620))
                     /locus_tag="TRUGW13939_10634"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349638.1"
                     /db_xref="GeneID:55998113"
                     /translation="MEGYTHTGPIDCDKPINSDTVRGKTAIITGGAKGLGEAYVRTLS
                     AAGVYVCIADPDIENGQRLEAQLPRTKYVPCDVTNWDDQLRLFREAASFSPSGRISFV
                     VANAGIHRPDEVYKYAGDEQEPKEPNLDIIDVNLKGVLFTAKLAAHYFIKQNGQQPSP
                     QQEDTCLVLIGSGAAFLDCPRGLQYAATKWAMRGIMHSLRRTVFYYGSRVNVISPWYV
                     KTNILSDEAFKHVQEVGVEFAEAEDAGQCLLRILSDQTINGHSLFVCARKWAPNGYMD
                     LDLDDYPGSTLLQEIQDDQIKPAPVSLGLFA"
     gene            complement(<838172..>838462)
                     /locus_tag="TRUGW13939_10635"
                     /db_xref="GeneID:55998114"
     mRNA            complement(<838172..>838462)
                     /locus_tag="TRUGW13939_10635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493746.1"
                     /db_xref="GeneID:55998114"
     CDS             complement(838172..838462)
                     /locus_tag="TRUGW13939_10635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349639.1"
                     /db_xref="GeneID:55998114"
                     /translation="MDLQPADISDQNTRPLASYNPAGHPSRDLESRRISSEGPLSAKR
                     ECRDQVPRKTIAIYIAVVLVGSFGVGIATCLVGFQLGFRLGEQLAILRDMGQ"
     gene            complement(<839347..>840963)
                     /locus_tag="TRUGW13939_10636"
                     /db_xref="GeneID:55998115"
     mRNA            complement(join(<839347..839710,839769..840049,
                     840100..840545,840606..>840963))
                     /locus_tag="TRUGW13939_10636"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493747.1"
                     /db_xref="GeneID:55998115"
     CDS             complement(join(839347..839710,839769..840049,
                     840100..840545,840606..840963))
                     /locus_tag="TRUGW13939_10636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349640.1"
                     /db_xref="GeneID:55998115"
                     /translation="MRPMTTHSQLGTGTLALGRVFVVHEAGSWKTPGHASGCEKDGAA
                     VSSTVAAAWRWRREIKCLACLCICLVLWIYALTEALGRCARSMQRQMAPTPDRMLRFT
                     KNGTFQISVFEDLHFAENSDKDVLSQRVMKSVLSTESPQLVVINGDLVSGEQTSSSNS
                     YTYLHQVVSPLVDRGLLWASTYGNHDSNPNLDPWQDIFVQEKQYTNSLTQSMVSHPDA
                     GVTNYYLPVYSSETEVPALILWFFDSKGGRVPSNRISKRDTNRPDWVDQSVVDWFNET
                     NSDLRDKYGRVVPSLAFYHIPADAMRAYQDDGVNPHTAPGINGETVVQQGSGDTSYTG
                     QDTEFMRALLNTAGLMATFSGHDHDNDWCFKWDGNTTAQNLSGNGLNMCYGRHTGYGG
                     YGDASRGGRQIVLNEKTVQDEVETWILLEDGTISAHVTLNATYGQDRYSPGIKRAAGV
                     LDSAAPHLNSPEPLLFMTYLWFPIFMLFYLKH"
     gene            <842294..>843020
                     /locus_tag="TRUGW13939_10637"
                     /db_xref="GeneID:55998116"
     mRNA            join(<842294..842570,842668..>843020)
                     /locus_tag="TRUGW13939_10637"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493748.1"
                     /db_xref="GeneID:55998116"
     CDS             join(842294..842570,842668..843020)
                     /locus_tag="TRUGW13939_10637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349641.1"
                     /db_xref="GeneID:55998116"
                     /translation="MNGNGQITQLHSFQGTTLHTAQWDDSINWDGKRVAVIGNGSSAI
                     QLLSQMQKSASQITTYLRSPTWISSNHTAHFAKDGRNFPYTEEEKREFPTLRDMFEAD
                     MKKRLKNDPHLCAKLVPDWDVGCRRLTPGDGYLESLLEKNVGVEFGDIERITPKGIQN
                     ANCEKQFDIIVCATGGYGEFRRGQRVHRLQSGILNQKGVDKRLSLVVQE"
     gene            complement(<844850..>846141)
                     /locus_tag="TRUGW13939_10638"
                     /db_xref="GeneID:55998117"
     mRNA            complement(join(<844850..845100,845208..845557,
                     845622..845718,845775..>846141))
                     /locus_tag="TRUGW13939_10638"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493749.1"
                     /db_xref="GeneID:55998117"
     CDS             complement(join(844850..845100,845208..845557,
                     845622..845718,845775..846141))
                     /locus_tag="TRUGW13939_10638"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349642.1"
                     /db_xref="GeneID:55998117"
                     /translation="MLFYQKTALYSLLPDLEYPEELGQSPSGSRSRRFRILLPILILI
                     FVAAFALSLVLLIPHPIPESCTHPSFRREWRTLNMEEKLSYISAAQCSAKTPSVSLRN
                     DNASIHDEFALLHGRFGNYHSRNAAPFLPWHRYFIHVYKQALRENCDYQGSLPYWDWT
                     LNHQDLSRAPVWNIIDGFGPSRNENGSEGVAGGNCVVSGPFAGLVPTFYEGFRDPHCL
                     SRGMLDEETVRGVGDLTVKPSELTRLANTNESYFDFLIELEYTPHLVIPYILQDQLFY
                     LHHARIDRLWWIWQHLSEANRSEHNGPSTNESSVEGVLRDFLDSGIFRPMRPRVEKDV
                     MNTERGLLCYQYDTTAWEES"
     gene            <846830..>847615
                     /locus_tag="TRUGW13939_10639"
                     /db_xref="GeneID:55998118"
     mRNA            join(<846830..846863,846918..>847615)
                     /locus_tag="TRUGW13939_10639"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493750.1"
                     /db_xref="GeneID:55998118"
     CDS             join(846830..846863,846918..847615)
                     /locus_tag="TRUGW13939_10639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349643.1"
                     /db_xref="GeneID:55998118"
                     /translation="MEQHIDRQNRLSICPYFNTISVTIWEPVAVPFQNSQPLPTLPTI
                     DEIRACTNVLWETRASKIVAVNDDIVVKYGGCIDVWEGQSLVYLERYVPEVPAPRLYA
                     MYYDSEQLFLVMQRAPGVQLNSIWPSLAQSEKDDIIAQLQVIFNAMRKAECPWPDFFG
                     GLDGGGVYHYLFYSQHGDEKFLGPFSSEPAFVAGLVGNYRALVERNNLPGYKARFYEK
                     YLSRVLQGHRPTLTHGDIQQKNIVA"
     gene            complement(<848526..>849972)
                     /locus_tag="TRUGW13939_10640"
                     /db_xref="GeneID:55998119"
     mRNA            complement(join(<848526..848803,848847..848912,
                     848981..849039,849101..849168,849230..849429,
                     849488..849544,849627..849695,849745..849781,
                     849829..>849972))
                     /locus_tag="TRUGW13939_10640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493751.1"
                     /db_xref="GeneID:55998119"
     CDS             complement(join(848526..848803,848847..848912,
                     848981..849039,849101..849168,849230..849429,
                     849488..849544,849627..849695,849745..849781,
                     849829..849972))
                     /locus_tag="TRUGW13939_10640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349644.1"
                     /db_xref="GeneID:55998119"
                     /translation="MTYVNEASVLGVSMFFLILGTLTASARVFVQLKTSRLTAADWLS
                     FLAWSLVMGECGIMIAGATTHTVGAHSTPNLGPEVLDYNARIPIRSDTDLRARDAQTV
                     FLIGIVVVWAITFLICLLAQCGSNIATNFGTLGDLKAKCTDTFAILIGLAASDVAVDL
                     VILSIPLPLVISLRLPLKKRIGIVAVLAIGMSATACGIARMSLFVEILGPSLISKPTV
                     GGVSSDDDIGNDNLPCIVSILMFWGMLEMGIAVVAICLPVLYRLRRHQPLRDLMGRLR
                     LYGLSNSSHYSGTEIFDLDDPRHTAWLQTQPGECVAQVSHVPKTSGDAE"
     gene            <850459..>851946
                     /locus_tag="TRUGW13939_10641"
                     /db_xref="GeneID:55998120"
     mRNA            join(<850459..850689,850746..851006,851084..851131,
                     851187..851716,851772..>851946)
                     /locus_tag="TRUGW13939_10641"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493752.1"
                     /db_xref="GeneID:55998120"
     CDS             join(850459..850689,850746..851006,851084..851131,
                     851187..851716,851772..851946)
                     /locus_tag="TRUGW13939_10641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349645.1"
                     /db_xref="GeneID:55998120"
                     /translation="MASTRIAELAARIQLRTSDIDSYLQHNQLPSPAFDEDGPVDLNL
                     PNGDLSAAREQVLDATLELHDLLLGPSLCLRPVYNGLSLQVIYKYDIASKVPLYGEAS
                     FADLAEKCSLSEVNIRRMLRYAMVFHHVFREPRKGFVAHTAASRRLAEDPYAGAGLGY
                     MFDETLPALEQFHSDEPNKCGWSHYHNTDKAAWEYYALHPDKARRFTHAMSAFADGHG
                     NSPAFLVQNYPWNTIGTGTVVDVGGSKGDIGVLLAKQFPDLGFIIQDLPEMITGASDT
                     IPAEFKSRIQLQAHDFFTEQPVYGADVYFFRNIFHNWSDSRAILILKALVPALRQGSR
                     LVINDYVLPEVGTMSLTKERAVRDMDLIMLTLFNAREREEADWIELFRKADPRFSVVR
                     IWTPEGATMAIIEVLWTCADAA"
     gene            complement(<854332..>854904)
                     /locus_tag="TRUGW13939_10642"
                     /db_xref="GeneID:55998121"
     mRNA            complement(<854332..>854904)
                     /locus_tag="TRUGW13939_10642"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493753.1"
                     /db_xref="GeneID:55998121"
     CDS             complement(854332..854904)
                     /locus_tag="TRUGW13939_10642"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349646.1"
                     /db_xref="GeneID:55998121"
                     /translation="MTSSSPNATDLSARSAASSAHYHPTSDTTDLTGIDATTIGASGT
                     TGGYGKTVIADTGFGTATYGNTDISGYRSSNTDTYGGKRRTAGYDTESDTSNTFGGGN
                     TFDISGLTTGTRGYTGSAYDAGRTSSSNSSSNNNVSSLRASKGGGGIGDGGSDTGFGY
                     GNGWRNTFDVGNAGNTESTGYGSRADYRGR"
     gene            complement(<855556..>856932)
                     /locus_tag="TRUGW13939_10643"
                     /db_xref="GeneID:55998122"
     mRNA            complement(join(<855556..855573,855629..856186,
                     856242..856340,856480..856754,856809..>856932))
                     /locus_tag="TRUGW13939_10643"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493754.1"
                     /db_xref="GeneID:55998122"
     CDS             complement(join(855556..855573,855629..856186,
                     856242..856340,856480..856754,856809..856932))
                     /locus_tag="TRUGW13939_10643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349647.1"
                     /db_xref="GeneID:55998122"
                     /translation="MKFSPITTRLAAVTCLLASSPAVALTISYCSKENTAASDTLVSS
                     IYQSNGRCESQCNADYAFAVVQYKSCWCSNYVPGDQASVSDCDSPCPGYPDDLCGNSD
                     KGLYGYIAMSNVQPSGTSGAAGSTSSTGTSSGSMTTTQSTPQTETITVTASNSVPSTL
                     TTSLSPVSSASSTSSGDSTTTTAPNISVHTVAGQPVTVTVGNPDPAQTSDASATTGQK
                     SSSLSGGAIAGIVIGCLLGVGALAAAGLWFFFFGRRRNEPTEKSPTPESRYDPSTPGT
                     TSDTHRQSRGSQMTFMRNFMGSSEPKSATSPNDFLNPNQAFTDNRMKKGAPLYQSGGR
                     HSAVSLRDEEDYSRPVLRLTNPD"
     gene            complement(<859970..>861144)
                     /locus_tag="TRUGW13939_10644"
                     /db_xref="GeneID:55998123"
     mRNA            complement(join(<859970..860311,860362..860710,
                     860780..>861144))
                     /locus_tag="TRUGW13939_10644"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493755.1"
                     /db_xref="GeneID:55998123"
     CDS             complement(join(859970..860311,860362..860710,
                     860780..861144))
                     /locus_tag="TRUGW13939_10644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349648.1"
                     /db_xref="GeneID:55998123"
                     /translation="MQSSLTPQPLAYLMRYHRELFVDPLFWTSRHLGLVGCRFKLLES
                     TEYTQDNTDVHQAQNNNNNNNNNNDTHEFSDTSHELVRVPLLPLSDPERFAKNRAPLM
                     KLSTLYRILEYEGGPFEEHRKKGPKFFFSGQEIHRPKSVVFGRRKQASQPPLDDDSQI
                     LVGYFDYTWAICGRKDKFQARSHPGNGNNAPVGRLYQKRLAQITPTNWQEDPYFVCIL
                     LSIAQLQERSLTTKDRKTHTSRLLVAKWQDCEFIHLYEAQFTSELLEAIKNPKNATTY
                     TNWPTITQKKIPFKPFDTFRQRLVAELLLPANQDGPIASDIKGGDVDVTFPAKRPHEQ
                     GEEMRIVRRKVDMGCGD"
     gene            complement(<862244..>864652)
                     /locus_tag="TRUGW13939_10645"
                     /db_xref="GeneID:55998124"
     mRNA            complement(join(<862244..862441,862506..862857,
                     862908..862995,863059..>864652))
                     /locus_tag="TRUGW13939_10645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493756.1"
                     /db_xref="GeneID:55998124"
     CDS             complement(join(862244..862441,862506..862857,
                     862908..862995,863059..864652))
                     /locus_tag="TRUGW13939_10645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349649.1"
                     /db_xref="GeneID:55998124"
                     /translation="MSRRGRRPVDYYEEDEEEEEREEIIDEPSRRRRDLDEQYVEPEL
                     ESSRHRRRPAPLRREPTPPHLRREVEELIRTREKAREEPERLIRRSRGDDNDDDDVRR
                     YEKDYLEEDVDDKRDRLPEREETEEMYIRRGSLPPRDRSRRRRVSLDDERLERRRSRD
                     EEDVMLETQELSPPVYKDKFDQLLREDEKRTRRRRAKSREVEEREFEEREETEIPIRR
                     RNRSPPLRDEIIADKLRRRSLLSQDERDEEEERFLRHRDRSSRRHLVRDDREEILLRH
                     RDASLPPRDEPERIRRRRSLPGRDEEDDIFLRRRDHSVPTRDDREDEILIRHKERPPH
                     ADRDEIRIRHRERSGSERDDDRDEVRIRRKERLHSHRDAEDDFLEEVRVRRRHSLPPE
                     DEEDEVIRPRRLVEDDEREEILVHRGRRDHNKKPLASGGDRDEIYFRDEPGREKVEFR
                     HTHGPPSVKSSQSRQGSVEREDIIRRSEHKGRAGRSRLERELSRQSEAASSSSESSPE
                     EPPSVIRKPPIVQEVITHHRHIESYEKASPSLRLSVDDTKSRAGIDEVELRERGDRNG
                     DIHEKITIEHRHQDRSPSPSLRRQPPVEEEEEIIERSRSDDGHHSRSKEIMILEREAE
                     RDYLAEDLDRVKEKRKKRYTEVTKDLVVREAIERAGYDYDETDRDFYIYKYLRYDDVS
                     RLVEMTEDIRQSRRERMRRERDILPPPPHLPPAPRPPMRDAYRERDVFVEGTRPRRRY
                     REV"
     gene            complement(<865157..>867160)
                     /locus_tag="TRUGW13939_10646"
                     /db_xref="GeneID:55998125"
     mRNA            complement(<865157..>867160)
                     /locus_tag="TRUGW13939_10646"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493757.1"
                     /db_xref="GeneID:55998125"
     CDS             complement(865157..867160)
                     /locus_tag="TRUGW13939_10646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349650.1"
                     /db_xref="GeneID:55998125"
                     /translation="MSSPPAFIPSSPGASSKPSAYTYRHLQQLRQNSATSPLRVVAHI
                     DLDAFYAQCEMVRLGTPRDTPLAVQQWGSLIAINYAARPFEITRMLPAVEAKKKCPDL
                     VLQHVATFREGEGGKWAYREDAASSIQTDKVSLDPYRAESRKILSTIKEELSRWRDEL
                     VRSQADGAFTDLLAARMEKASVDEVFIDLSSLVYATLWQRYPELQKPPATDNRITPLP
                     APPTTALAWSPDDGLVDLDENDAEEDDPDWDDIGMQIGAEIVRSVRAAVWEKLTYTCS
                     AGIARNKMMAKLGSACNKPDKQTIVRNRAIQKFLGGFKFTKIRMLGGKLGDQISAEFG
                     TEQVNDLLKVTADQFKAKLDDDTAVWLYNIIRGVDASEVNTRVQIKSMLSAKSFRPYI
                     NTMDQAEKWLRIFAADLYNRLIEDGLLEKRRRPKTITLHHRTGAQVHSKQLPIPGGKM
                     IEEDILFDLSRDLLRQVNAEGRAWPVSNLSLSVGGFEDGPTNNKAIDSFFAPGRISSP
                     VVDTPAAKVGNSIESVDGGNPAKKRKTATSGIGRFFKQMDSEVESDDATPPATHLEEH
                     LETCQATEMPFITTEVGQESAEPFGVYVCPRCNQRVDEYQRDEHEDWHFAKDLEAQEV
                     QADRTSQDIVQQLSRRPAAAPDRKKARPRETKAEKGQKRLFFG"
     gene            <870513..>871526
                     /locus_tag="TRUGW13939_10647"
                     /db_xref="GeneID:55998126"
     mRNA            join(<870513..870653,870743..870787,870852..870933,
                     870985..>871526)
                     /locus_tag="TRUGW13939_10647"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493758.1"
                     /db_xref="GeneID:55998126"
     CDS             join(870513..870653,870743..870787,870852..870933,
                     870985..871526)
                     /locus_tag="TRUGW13939_10647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349651.1"
                     /db_xref="GeneID:55998126"
                     /translation="MAGRGYERPERHNEYFISGDGISREVIQADICRYLGNDALVKPG
                     SHQGRQGYLIRAYRNLTSEMITDLKADSARWEQEVARRADMGYSRASYASSSIHEMRQ
                     QQQGGGGGGGPSPATFNPPPNQYMDPYPQQPQYGGGHQPPHYGTPAYTSSQSPGFPQN
                     AYASPPQQGPYSGQNPPPISAPDSHPAYTYTGQPNYPFEGRNAAPRYPGPGYENESDY
                     PNVTSGMGYPPVTTASGAPMETRYTPEAYPEQHRPGANRPQQNRDPHRRPR"
     gene            complement(<872163..>872771)
                     /locus_tag="TRUGW13939_10648"
                     /db_xref="GeneID:55998127"
     mRNA            complement(join(<872163..872273,872448..>872771))
                     /locus_tag="TRUGW13939_10648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493759.1"
                     /db_xref="GeneID:55998127"
     CDS             complement(join(872163..872273,872448..872771))
                     /locus_tag="TRUGW13939_10648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349652.1"
                     /db_xref="GeneID:55998127"
                     /translation="MVKRCGVKDTIKKMVKRMEKMEKVVKKMEKVEKMVKKMVKKMVK
                     KMVKKMVKKMVKKMVKKMVKKMVKKMVKKMVKKMVKKMVEKMENMEGGKDGQEDGKDG
                     KGGQKMQLKTPAMHLSTTSGPSPVRNNTARSIPKAPDECKPW"
     gene            <872932..>873814
                     /locus_tag="TRUGW13939_10649"
                     /db_xref="GeneID:55998128"
     mRNA            join(<872932..873192,873281..>873814)
                     /locus_tag="TRUGW13939_10649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493760.1"
                     /db_xref="GeneID:55998128"
     CDS             join(872932..873192,873281..873814)
                     /locus_tag="TRUGW13939_10649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349653.1"
                     /db_xref="GeneID:55998128"
                     /translation="MDVEFGQSHSPFTFPNFNNGDVLISIPPSEIYHLHADVLRRCSP
                     RFMGRLLAQEHAANLAKAAERAGAKTRFKLELEQSRDHPNGIFDVDRYGRATLSSMSP
                     HDFLSSIYETAITQHTIDCWRNLFGTFYNVEPDLKGSTLQTVLEKCVRLMDTAESIDA
                     AVAVRPHVDNALVRQGQLLYRSILASPIQWGNLALRVHSPTIFNDAVIHLVGKWNALV
                     KKDKKDMDPRLGAVCERKAAELYRIKGAAEMRVAGHIPSDCWRRAD"
     gene            <873860..>874360
                     /locus_tag="TRUGW13939_10650"
                     /db_xref="GeneID:55998129"
     mRNA            <873860..>874360
                     /locus_tag="TRUGW13939_10650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493761.1"
                     /db_xref="GeneID:55998129"
     CDS             873860..874360
                     /locus_tag="TRUGW13939_10650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349654.1"
                     /db_xref="GeneID:55998129"
                     /translation="MAIVIHHQWFHQVVGIERRGRDGIDGGAMLYKALHEGGSSYLNA
                     QDYINFHNLCPMSQKARTILYDKVRQIKWEVRTYVKALMQNKTQLELDSGDPIDHLLC
                     TKVTAADQPWNSDDDDSTFMPSFLSDSDDDDMEVEKEGGIPPGVPDTLGTNFHPPGSE
                     QTVDQS"
     gene            complement(<874767..>875123)
                     /locus_tag="TRUGW13939_10651"
                     /db_xref="GeneID:55998130"
     mRNA            complement(join(<874767..874813,874940..>875123))
                     /locus_tag="TRUGW13939_10651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493762.1"
                     /db_xref="GeneID:55998130"
     CDS             complement(join(874767..874813,874940..875123))
                     /locus_tag="TRUGW13939_10651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349655.1"
                     /db_xref="GeneID:55998130"
                     /translation="MSVPQFWSQPLRYIRWASHEKPAIFFSIVLGSLGPVALVSIPPV
                     RRYFGDVDPEPIPFTYPIPKGPRAIPKGFDDE"
     gene            <875561..>877110
                     /locus_tag="TRUGW13939_10652"
                     /db_xref="GeneID:55998131"
     mRNA            join(<875561..875696,875756..875866,875920..876629,
                     876682..>877110)
                     /locus_tag="TRUGW13939_10652"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493763.1"
                     /db_xref="GeneID:55998131"
     CDS             join(875561..875696,875756..875866,875920..876629,
                     876682..877110)
                     /locus_tag="TRUGW13939_10652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349656.1"
                     /db_xref="GeneID:55998131"
                     /translation="MRLLLSVLLGFWGACAYALSSSGSRLLVVLEEEKSLYSTFWADL
                     EGRGYDITFESPKNEKLSLFELGERSYDHVLILPPKSKGLGPALTPKLLVDFVNSDGN
                     ILLALSGKSSTSSAVSSLLLELDLHISPDRSSAVVDHFNYDVLSAAEKHDILLLPRPS
                     PPRPDLKPYFSGDGVLAFPRPVGQSLGNASPLLAPILRAPETAYSYNVKEDSGSAEDS
                     FATGSQLALVSTLQGRNSARFTVLGSVEALEDKWFSASVQGPNDKKASKTANREFAKY
                     LTAWTFQEIGVLKVGKVEHYLTDKEGNIEGEVNPIIYRIKNDITFEIELSEYEFDKWV
                     PFEAVPEDEVQLEFTMLSPFHLLNLQPKTRTENSTIFSTTFTSPDQHGIFSFRVNYQR
                     PYLTYIEEKHEVTVRHFAHDEYPRSWKITGGWVWIAGLWSVIGGFLAFVFVWLYSAPS
                     PSAEAKIKKVN"
     gene            complement(<877425..>878065)
                     /locus_tag="TRUGW13939_10653"
                     /db_xref="GeneID:55998132"
     mRNA            complement(join(<877425..877611,877725..877866,
                     878041..>878065))
                     /locus_tag="TRUGW13939_10653"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493764.1"
                     /db_xref="GeneID:55998132"
     CDS             complement(join(877425..877611,877725..877866,
                     878041..878065))
                     /locus_tag="TRUGW13939_10653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349657.1"
                     /db_xref="GeneID:55998132"
                     /translation="MPSSCRDIRTALAECLQESDCIMVQRNSPHDCLRPPLSDDLPTR
                     CQQLMKALTDCKRGLVDMRKRFRGNAPISVSREAEGGKSQTPDQLYAGKPAFSSVKET
                     SGNEAEMDPDKTRGL"
     gene            complement(878721..878800)
                     /locus_tag="TRUGW13939_10654"
                     /db_xref="GeneID:55998133"
     tRNA            complement(878721..878800)
                     /locus_tag="TRUGW13939_10654"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:55998133"
     gene            complement(<879376..>880113)
                     /locus_tag="TRUGW13939_10655"
                     /db_xref="GeneID:55998134"
     mRNA            complement(<879376..>880113)
                     /locus_tag="TRUGW13939_10655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493765.1"
                     /db_xref="GeneID:55998134"
     CDS             complement(879376..880113)
                     /locus_tag="TRUGW13939_10655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349658.1"
                     /db_xref="GeneID:55998134"
                     /translation="MKIELLSLVNRRRIRQLLEPIAALVDLEPVLKNGPHGSAFQPAQ
                     SQGDPIQIIDDENTGKPPQLIEMSDSFSGQLSSVSAYETLKAGCRVLYHRTQPFMPPQ
                     NQHYRWRIGVSTVKIGAQSFISGLNLFPSGSQSNITGRLLGFRNPASEVWIEIPPTSQ
                     VKALCAAFSSQGLRGIKFTFTNCDSTDWVGSSSDPRITQEILSTTENMNQHYLLVGLD
                     RFKIVSLGLGELTNYPGSSLESLPRNV"
     gene            <881661..>883271
                     /locus_tag="TRUGW13939_10656"
                     /db_xref="GeneID:55998135"
     mRNA            join(<881661..881695,881785..881864,881920..>883271)
                     /locus_tag="TRUGW13939_10656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493766.1"
                     /db_xref="GeneID:55998135"
     CDS             join(881661..881695,881785..881864,881920..883271)
                     /locus_tag="TRUGW13939_10656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349659.1"
                     /db_xref="GeneID:55998135"
                     /translation="MPRVPFIGRLFWAEYLALFTSLLLIFVEGVLRLITLCLPDAIIR
                     FCYRQSKSIFNTLSSPQNRSTRRPGNKQRTLAESIAQTTDFSELCELYGYETEEHIVQ
                     TGDGYLLGLHRLPYRRGEEEEHVNTGKSGVRKKVVYLHHGLLMNSEVWVCLTDEQRCL
                     PFQLVERGYDVWLGNNRGNKYSKKSTKSSPASADFWDFSIDEFAFHDIPNSIEYILGV
                     TEQPSLSYVGFSQGTAQAFAALSIHPTLNQRVDVFVALAPAMSPAGLYNGIVDSLMKA
                     SPQVVFLAFGRKSILSSTTMWQSIFYPPIFVRIIDISLRTLFNWTGENISQSQKLAAY
                     PHLYSFTSTKSVVHWFQIIRNRAFQMYDDEVGGPLAVGTNSRYYKPVRYPTKNIKSPI
                     VLLYGGSDSLVDIGVMLRELPRKTIVREIPKYEHLDFLWASDVDEQVFHHVYEALDQH
                     ARGQSTASFPSRLLLENKTNGYSEGDSIASGVVNNEQH"
     gene            complement(<883604..>883861)
                     /locus_tag="TRUGW13939_10657"
                     /db_xref="GeneID:55998136"
     mRNA            complement(<883604..>883861)
                     /locus_tag="TRUGW13939_10657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493767.1"
                     /db_xref="GeneID:55998136"
     CDS             complement(883604..883861)
                     /locus_tag="TRUGW13939_10657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349660.1"
                     /db_xref="GeneID:55998136"
                     /translation="MPRHTYREEHPFPKRAFGRVLDDDRPVDDFENTVRQQEEQTKAA
                     QRGPSPPNRAAATHEYAPHMQHQPGGSEGKTASKYRSVSKH"
     gene            <885062..>888305
                     /locus_tag="TRUGW13939_10658"
                     /db_xref="GeneID:55998137"
     mRNA            join(<885062..885075,885135..885189,885258..886655,
                     886709..886852,886900..887073,887131..887220,
                     887274..>888305)
                     /locus_tag="TRUGW13939_10658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493768.1"
                     /db_xref="GeneID:55998137"
     CDS             join(885062..885075,885135..885189,885258..886655,
                     886709..886852,886900..887073,887131..887220,
                     887274..888305)
                     /locus_tag="TRUGW13939_10658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349661.1"
                     /db_xref="GeneID:55998137"
                     /translation="MKFAKELNEELVPEWRLKYLDYKLGKKKIKAIRRALQRANRTPV
                     RRHDPYYGTTSQGLAPNASTSAARFPLDYNGSPSRNSAPRTAEQRPLRTPGSRFANTV
                     GSYGSIISEPATQDFTRVPTLQLPDPALEPDSPTAIHKNGSPTTNPAQDGPSNYSQPP
                     SYSLVTKNRGHRRFSSAGEGHSKAANFLRRVFTAGDLESPGRSYQSSISNEVTQKEDD
                     FFDFLDSELHKIETFYQQKEVEATHRLQALRQQLHMMRDQRTAEIHNAKRTKSPERDG
                     EHGSYRNVIPNNKWAHAIVGKPHFGKNSRALASLQTPQAPRPMDPQSIFGRRDFVQRP
                     ELAQVPYRTAKKKLKLAVQEFYRGLELLKSYAYLNRKAFRKINKKFDKSVDMRPTLQY
                     LSNKVNKAYFVQSEVIEGHMAVVEDLYARYFEGGNTKIAASKLRRKHRSRDYSPTTFR
                     IGLLLSAGIVAAIQGLILAIRLLEDGDSTVKVQTSYLLQIYGGYFLIVFHFMIFCLDC
                     MVWTKAKINYTFVFEFDTRHVLNWRQLTEIPSLFFLLLGLFMWINFSWVNDMFIYYPV
                     VLIFVTVLILFFPFRVFYHHSRAWWAFSNWRLLLAGLYPVEFRDFFLGDMYCSQTYAM
                     GNIELFFCLYATAWNNPPTCNSSNSRLLGFFSTLPAIWRGFQCLRRYRDTKNVFPHLV
                     NFGKYMGTLVFYMCLSLYRIDKVTHYQIPFIVFGVINSIYCCLWDVAMDWSLGNLYAS
                     HTGLRDVLAFRRVWIYYAAIVLDVVIRFNWIFYAIFINDIQHSAYLSFIINITEICRR
                     GVWTIFRVENEHCTNVHMFRALRDIPLPYKAEDEMEDTPAAALDGDHSDDEEQPTPQA
                     HATPSRPSPETDLELSAGRTPTLRARYPTASGRRMSRVGTLVATAHSQDFQRKRPADG
                     LGGSSSTAPVLGDTDDSTDDDDEKDTDTDQPDFLEDPEIPSSITPRANTPNRNT"
     gene            <888677..>889614
                     /locus_tag="TRUGW13939_10659"
                     /db_xref="GeneID:55998138"
     mRNA            join(<888677..888829,888890..888960,889020..>889614)
                     /locus_tag="TRUGW13939_10659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493769.1"
                     /db_xref="GeneID:55998138"
     CDS             join(888677..888829,888890..888960,889020..889614)
                     /locus_tag="TRUGW13939_10659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349662.1"
                     /db_xref="GeneID:55998138"
                     /translation="MAANTRYQPAPQRDSFDEPEYSQAPPAYGSNDATASAEPRSEDD
                     NVPDDFKFGGTVAEATLPIRMQFIRKVYSILTVQLLLTTVLSSISFFSESYRNWIHEH
                     FWVMIVSLVGAIGFMFLTYWKRKSYPTNLLFLSGFTAFEAYAISVVTSYYNAHIVVQA
                     LVITLAIFVALTVFACQTKYDFTHWMPYLFGGLWLLIIFGFMAAFFPYNSSVELVYGG
                     VSALIFSGYVLVDTQLIMRHYHIEEEIAAAISLYLDIINLFLSILRILNSQQNN"
     gene            complement(<890116..>891860)
                     /locus_tag="TRUGW13939_10660"
                     /db_xref="GeneID:55998139"
     mRNA            complement(join(<890116..890916,890965..891193,
                     891249..891603,891670..891743,891802..>891860))
                     /locus_tag="TRUGW13939_10660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493770.1"
                     /db_xref="GeneID:55998139"
     CDS             complement(join(890116..890916,890965..891193,
                     891249..891603,891670..891743,891802..891860))
                     /locus_tag="TRUGW13939_10660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349663.1"
                     /db_xref="GeneID:55998139"
                     /translation="MDGEVVAAGSIAAGAYRGRRRRGKRDVFQGSASWISSVINLVNT
                     IVGAGVLAMPLAIAHMGIVLGVLVVIWSGIAAGFGLYLQSRCAQYLDRGSASFFALSQ
                     ITYPNAAVFFDAAIAIKCFGVGVSYLIIIGDLMPGVVEGFVGGVPESEFLLDRRFWIT
                     AFMLIIIPLSFLRRLDSLKYTSVVALISIGYLVILVVYHFGKGDTMADRGPIRIIQWA
                     GIAPALSSFPVIVFAYTCHQNMFSILNEINDNSHFQTTSVVFASIGGAASIYILVAIT
                     GYLSFGNNIGGNIIGLYPTSVSATIGRAAIVVLVMFSYPLQVHPCRASIDAVLKWRPA
                     PRASNGNDVSPHRFPLLPRANRGPEPIGDVRFAAITTGIIVLSFITAMTVSSLEAVLS
                     YVGSTGSTSISFILPGLFYYKISSPESAAHQQLMKEDDEADDDALSDDGVPGDDHQSL
                     LSGSGLLSSSGILGGTRHWRKSLLRRLSLALTVYGIVVMVVCLGMNIFFHVSKES"
     gene            complement(<892537..>893651)
                     /locus_tag="TRUGW13939_10661"
                     /db_xref="GeneID:55998140"
     mRNA            complement(join(<892537..893199,893261..893508,
                     893594..>893651))
                     /locus_tag="TRUGW13939_10661"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493771.1"
                     /db_xref="GeneID:55998140"
     CDS             complement(join(892537..893199,893261..893508,
                     893594..893651))
                     /locus_tag="TRUGW13939_10661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349664.1"
                     /db_xref="GeneID:55998140"
                     /translation="MSVTQSVQGKTAIVTGAGSGINLAFATLLLENGCNVLIADLALR
                     PEAKVVVDKYSSRSGSARAVFQKTNVIDWKQLEEMFTVAEREFGEVDIVCPGAGVYEE
                     HWSNFWRPPGAPESRDAPLGGRYALLDINLTHPIRVTQLAISHFLRHRKNNSGRKHIV
                     HISSIAGQGKSMAAPIYVATKHGINGLVRSLDDLDDKFGIRVTAVAPGVIKTPLWLEH
                     PEKLKMIREGKDEWVTAEEVGEVMLALVQQDEVSSIIGDKHRQGTLYRVQGGTILEVS
                     KTVREVNAFNDPGPAGRAGNTVADSAVLINEIYDLLSQPNWGKAKL"
     gene            <894176..>895683
                     /locus_tag="TRUGW13939_10662"
                     /db_xref="GeneID:55998141"
     mRNA            join(<894176..894454,894517..>895683)
                     /locus_tag="TRUGW13939_10662"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493772.1"
                     /db_xref="GeneID:55998141"
     CDS             join(894176..894454,894517..895683)
                     /locus_tag="TRUGW13939_10662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349665.1"
                     /db_xref="GeneID:55998141"
                     /translation="MSKILSNSLVRNMATTTTAAATSSSSLTKAAGDISSVFPSLRPD
                     YKPEPLPPRFKDLKQELFQKNEAALKESWDRLLPSLKEEVEKIRELGSDIIPSVSYSD
                     LVAGKMSAQTLADIKHRGSVVIRNVVPRDTALEWKARTKGYIAANKEKVKAFPADSPA
                     VYELYWAPAQTEARAHPNVLKTQGFLQQLWHSSDPDTRLSVTNPLTYADRLRIRQPGD
                     SKFTLGPHVDGGSLERWEDPEYASVYTKIFQGKWEEYDAFDAKHRVKAKMDMYNGAGA
                     CSMLRLFQGWLAMSDTGPGEGTLHVCPMITHSTAYTMLRPFFDLESSLPNMDVTFPGS
                     VPGACQEYNPVTHPHLDLLTTMVPVPRVEPGDYVAWHCDSLHSVDKEHNGAGDSSVLY
                     IPATPLCDMNVDYLLKQREAALQYSPPWDFPGAGGPGETGFKGAVDWSSVSPEGQRAM
                     GLGSLKWEVSESMSEGERQAIATANKICFEN"
     gene            complement(<895850..>898814)
                     /locus_tag="TRUGW13939_10663"
                     /db_xref="GeneID:55998142"
     mRNA            complement(join(<895850..895888,895946..898205,
                     898264..>898814))
                     /locus_tag="TRUGW13939_10663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493773.1"
                     /db_xref="GeneID:55998142"
     CDS             complement(join(895850..895888,895946..898205,
                     898264..898814))
                     /locus_tag="TRUGW13939_10663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349666.1"
                     /db_xref="GeneID:55998142"
                     /translation="MMWFQTAVVLLASCATKSLAIFADEVNHLDFHHALVGVPSLQST
                     FFHRPSSTSNASLLYTISENLIVGAINPKDGAVVWRQDLARWAGSSSAEGFLRASDGE
                     STVFSAAGENVVAWSATDGKLAWDSKLNGEAVKDLELLELEDGRTTNNEIRDVLALYG
                     GKQGLLRRLDGSTGEVKWEYKDDSGDTPFQVSSSATEVFYISLQSALLKGHKIKVTAL
                     DSQTGRQTRNYILSSEGEVSTPESILFVGTNTASPFVAWADKSNKALKINILGSKQVH
                     TLNIENAKGDEIRKITVHGPEGLNTLPHFLVDYETDSESWAEVYHIDLKSSSISKAYQ
                     LPRLAGKSVFAVSRKAANVFFTRVTEIEVSVVSSASHGILGRWPFNKPSNENIRNALA
                     EVVSKGDSVAVRFAYVLDSGDLHLNRNGKAEWTRYESLSGAVAAAWAEPTSSEELVHE
                     LELEGHEDILAAYIHRVKRHARDLQHLPKWLQELPKRILTSFISAEVTNLDSFGLRKL
                     VLVATKRGRVIAIDTGNHGAVSWNTKVTDTADWKVKGIKTESGIATVYSEDGNSVDLN
                     VTSGEIVTQKTSESKARSVTFVPDETGTKSVTIPIAQDGTPLEPLHNPGYLVTLSDDG
                     RVLGWAAGDNKAPVWQFLPSQGERVIHATSRPSHDPVASIGKVLGNRSVLYKYLNSNL
                     ALVTSVGQTSATFYLLDAVSGTILYSSKHEGVDTTQPITSAISENWVACSFWADLTEA
                     SESKGYQLVVSELYESPVPNDRGPLDSATNYSSIAGPNTLSRPYVVSQSFVIPEPISH
                     MAVTQSRQGITVRQLICTLPSSNAIIGIPRNVLDPRRPVGRDATAGEMEEGLFRYSPY
                     LEFDGRWYLTHSRDVADIQKVISSPTLLESTSLIFAFGGDIFGTRATPSQAFDILGSS
                     FSKLQLLATVVALAVGVWFLGPMVRKKQINLLWKR"
     gene            <900704..>902271
                     /locus_tag="TRUGW13939_10664"
                     /db_xref="GeneID:55998143"
     mRNA            join(<900704..900832,900898..901042,901121..>902271)
                     /locus_tag="TRUGW13939_10664"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493774.1"
                     /db_xref="GeneID:55998143"
     CDS             join(900704..900832,900898..901042,901121..902271)
                     /locus_tag="TRUGW13939_10664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349667.1"
                     /db_xref="GeneID:55998143"
                     /translation="MLKFISGLVLYFQSGKQHVAPVTEQTRNERLPELLFANIPQCTL
                     KCIYPQALECGCAYSDFQCICSSIGEIAEDEQVEFCITQCPQNEDQRYAPSRILDFCE
                     LLGVEVHLPKYMDQFANLHRRQSDLPITYPDASYTDPVYTDPGYSDPGYSDPAYSSQT
                     TSYILNPATVFITSTSSAKPTSTGTNTDTTTPTSTPAPTNTNPSGNSGSGESSSSSSS
                     SSSSGGLSTGAKAGIGIAVPVAVIILVLGIFLFYRRRKAAKNNNQLDSNGGDPKKSVP
                     FGGVEADAGPPPAEADGNPLNEADSGSILPSPESQNQPRTTVPIYELSGKSTAIRPPP
                     PAALAPHRQNESLNRQYSVTSSTSISRKAVESSPTQTESEIEGGRALSSKDPASAVND
                     AQPSENINNSEQQSSQQKEPETELNAQTSASVEQNDLQQLEEEMAQVRAQRERLQHLQ
                     MLEEREEQLKKQIAARKAAAKSTE"
     gene            complement(<903247..>904843)
                     /locus_tag="TRUGW13939_10665"
                     /db_xref="GeneID:55998144"
     mRNA            complement(join(<903247..903423,903477..904415,
                     904487..>904843))
                     /locus_tag="TRUGW13939_10665"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493775.1"
                     /db_xref="GeneID:55998144"
     CDS             complement(join(903247..903423,903477..904415,
                     904487..904843))
                     /locus_tag="TRUGW13939_10665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349668.1"
                     /db_xref="GeneID:55998144"
                     /translation="MKGIFGLSLLPLLAVASPIIPSSIHNGAAPILSSSNAEEIPDSY
                     IIVFKNHVDSASAAAHQTWVQDIHMQHNELRKRSFPFTGGLFQGLKNSFDIAGSLLGY
                     TGHFDENVIDAIRRHPDVEYIEKDSLVHTMEDPSVEKNAPWGLARISHRDSLSFGTFN
                     KYLYAAEGGEGVDVYVIDTGTNTDHVDFEGRASWGKTIPAGDADEDGNGHGTHCSGTI
                     AGKKYGVAKKANVYAVKVLRSNGSGSMSDVVTGVEWAATQHIKKVKDAKAGKAKGFKG
                     SAANMSLGGGKSVTLDKAVNAAVDAGIHFAVAAGNDNADSCNYSPAAAEKAVTVGAST
                     LADERAYFSNYGKCNDIFAPGLNILSTWIGSKYAVNTISGTSMASPHVAGLLAYYLSL
                     QPASDSAFAVAEITPKKLKESLISVGTQGALTDVPSDTTNILAWNGAGSNNFTEIIAK
                     GGYKVKSVGEQVDEMIVNAQEVMNEELGAIYSHIKDAVVA"
     gene            <906280..>914131
                     /locus_tag="TRUGW13939_10666"
                     /db_xref="GeneID:55998145"
     mRNA            join(<906280..908782,908835..909199,909256..912952,
                     913006..913160,913233..913538,913589..913801,
                     913887..914051,914099..>914131)
                     /locus_tag="TRUGW13939_10666"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493776.1"
                     /db_xref="GeneID:55998145"
     CDS             join(906280..908782,908835..909199,909256..912952,
                     913006..913160,913233..913538,913589..913801,
                     913887..914051,914099..914131)
                     /locus_tag="TRUGW13939_10666"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349669.1"
                     /db_xref="GeneID:55998145"
                     /translation="MTGTPAQRRSPSPSSSTTPERALAELTPVIQSLRETCDRDPFDT
                     NAALASIEHVLRLRHSLIDSERPRESKDAFRNLGAFQTVLHLARHLARLYDPKTQSTD
                     IINNLLTLFKDVLSVLSECLKDHPGNRRYFAKKIDSGGSAVIEETLKLFVDKFDDGGF
                     RTEQLYGAVLAAALNQETASDFFTVLSAKYAPKSDSTAIENVRSGVDKMLGPAETVEL
                     HEFIGPFLRTWIYQISRSTTSTVQRLAIPACLYRLASNSRQNMITLHSTGMFSSVLPM
                     LFDDKLSLNERILYRELAALLAAQGINKLDDATYLYQKACDSADVSRFLLHAVQASKA
                     PPDIEFDLSSHGFSSIEISTLGRPFPPVSSSGYTLSVWARFDRFDPQSHTTIFGAFDA
                     KQICFVLAYIEKDSRHFILQTSISGERPSVRFKTATFEPGRWYHICLIHRKPRPGSSP
                     RASLFVDGEFVEQLKIDYPNTPLARSTTKHPRVQAFLGTPQDLAVRLGKGVCTSRWSL
                     ANAMLFDDTFSDDLVSVFYHLGPRYHGNFQDCLGSFQTYGASAALNLRNESLHPGKEE
                     HSDIVTAIRQKASSLVQESSLLLNISPTAILDDDDSNFVDETQLVKSLSKQAAKNLQQ
                     MIKAGSNAIAINGAIPSINDALTRSHGVAILTGDPVVSVPQALDDSSWRIGGCAAVHL
                     HMLQVATTPENTILAVQILFEAIEDSWRNSEAMERENGYGILALLLREKLGFPQSSQA
                     GGALKISTVCSDNRERSSLAIELLRHILSFVGYNYDEPNKSIITNPLAYRILLVDLDV
                     WRFGEPSLLQMYYSQFTTFAAESQHRRFNAKRLSRMRVNKRLLDALKGEDFSEETLNL
                     FIPAFRSLFESCISAELLRSLSLFITFALHEGKVPKLNKKKSIRFESRARQSSNSSDR
                     SAKKSMPKSKIGLELLRMYADYLCAAGDYVTLKKFARAVTNKWLLYLICEDEPEVVIV
                     ATKILARLIIVHGGGYSKKLADKSGGYAIMGSRLKRWWNIATLWPLCFTLLFGLDVAE
                     VDLDAATEHSSLLETLISKNYVKVVFPEVLPVIIGMLETGMNNTVFTKVSEKDQGVIM
                     NAVKFLSGMHLKSREFREFAATSSYAQQLLRVLFPVAGSGPINADIEAQFRDSKFSIQ
                     HNSLVHRPAMASAPVLHTSTVTPSEPSVTKNDGSLRRSSSFVLISSDKTQHSSSSAQL
                     HRLSTPNLEIDESLESNSLVLEILGLVLRVFLDQIIERKDFTGLGLFLKSPPGPADHQ
                     MYFMSWILRSVLAELQATFSINENLLQEARVLTNLGRFMTHVSESLFEGWFLNGASST
                     VDLAGFVLEYLSRPEISSLKIIRLCNQAISNIRSVLFKVIMLKLSDVDELDSLSFLNR
                     LGYWQTIILASGDSETEYRKLFYYLLYTKLLSNKQEVRLAAITLWRIVLVQKPLETAS
                     ILNHAPASLQHRLSNGFEELVGMDDEAFLNWIDEQREDLDAFFFGSITKFWDNFVTEE
                     NHKTEESNRTRIAKRKERLKLWIQEENLDEELNRKHGTTFDHWTSNIYASEFLKHQRL
                     LQDQHDNYSFMWSHLSQLTADLYRFGGLLEKHEEVRWRLDQTEGRSRMRLRVIPDEST
                     ERQDYQPKRKASEPPAPKVNSSLRATADSETISGAPMANDLVEEPVEMGAVGGDGEDR
                     GSLEDSFEMIDDPRVDIDDYEDKNRKVMRSLQRGDQVKSVCNMSRIMGLEACEGLLIL
                     GKNFVYILDNFFQRTDGEIVNVWQAPPEERDPFVRMIAGRESDERKSREHETRSWKWL
                     DLISVSKRRFLFRDVALEMFFTDGRSYLLTLISSRARDELYNQLCAHAPAIGGNISLT
                     RPEDIWRFETLRVQDDAPQSFGSKFASVFGQSSLNPATRKWVKGEISNFHYLMLVNTL
                     AGRTFNDLTQYPVFPWVLADYTSEELDLDNPRTFRDLTKPMGCQTFERESEFRERYKS
                     FAEMGDENAPAFHYGTHYSSAMIVSSYLIRLQPFVKSYLLLQGGTFDHADRLFYSVGK
                     AWESASRGNMSDVRELIPEFFYLPEFMVNSNKYDFGLRQNMSKAIDSVELPPWAKGDP
                     KVFITKHREALESPYVTEHLHEWIDLVFGFKQKGEAAIEAANVFHHLSYQGARDLDNI
                     EDPVERLATIGIIHNFGQTPHQVFPRPHPRRDDSNRKESRLDTLAESLTRVPLSLLDI
                     QERVSSLCMRQDRLLCTAAFRLNVPPSYDKYLEWGFSDGSVRFYAADSKKLLGHFEHL
                     HVGQLSSALFADSQTLVTAGSDCIVSVWSFISNNRSMELSPQACLFGHRSPVSVLAAS
                     RSFSTLLSASLDGQIMLWDLNRRCFVRQLPAEGPVECARINDMTGTIMVCRGRRITLY
                     SLNGALLLDQDICETSDDGIVSCAFYEGAGNEWLERELLFTGHKRGLVNVWSKVVRNG
                     RFDLDLIRQLHHVDHSKDTGANVVAGISCILPLPTTVYTGDEAGRVYEWDCIQRRS"
     gene            <915022..>916382
                     /locus_tag="TRUGW13939_10667"
                     /db_xref="GeneID:55998146"
     mRNA            join(<915022..915060,915132..915150,915216..915227,
                     915295..915413,915475..915639,915695..916078,
                     916146..>916382)
                     /locus_tag="TRUGW13939_10667"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493777.1"
                     /db_xref="GeneID:55998146"
     CDS             join(915022..915060,915132..915150,915216..915227,
                     915295..915413,915475..915639,915695..916078,
                     916146..916382)
                     /locus_tag="TRUGW13939_10667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349670.1"
                     /db_xref="GeneID:55998146"
                     /translation="MSSSLDQLKATGTVVVCDSGDFATIGKYKPQDATTNPSLILAAS
                     KKPEYAKLIDVAVEYGKKTGSTVDEKVDATLDRLLVEFGKEILQIIPGKVSTEVDARF
                     SFDTKASVDKALHLIKLYESIGISKDRILIKIASTYEGIKAAKILQSEHGINCNLTLM
                     FSNVQAIAAAEAGAFLISPFVGRILDWYKAANKRDYTPQEDPGVKSVQNIFNYYKKYG
                     YKTIVMGASFRNVGEITELAGCDYLTISPNLLEDLLNSTAPVPKKLDASDVASLDIPK
                     RAYLDDEALFRFDFNEETMAVEKLREGISKFAADAVVLKDLLKAKIQA"
     gene            <919124..>919919
                     /locus_tag="TRUGW13939_10668"
                     /db_xref="GeneID:55998147"
     mRNA            join(<919124..919136,919295..919474,919531..919682,
                     919743..919839,919897..>919919)
                     /locus_tag="TRUGW13939_10668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493778.1"
                     /db_xref="GeneID:55998147"
     CDS             join(919124..919136,919295..919474,919531..919682,
                     919743..919839,919897..919919)
                     /locus_tag="TRUGW13939_10668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349671.1"
                     /db_xref="GeneID:55998147"
                     /translation="MVKAVAVIRGDSNVKGTVTFEQSDENSPTTVSWNISGHDPNAER
                     GIHVHQFGDNTNGCTSAGPHFNPHGKSHGAPTDEDRHVGDLGNFKTDAQGNAVGSTQD
                     KLIKLIGAESVLGRTIVVHAGTDDLGKGGNEESKKTGNAGPRPACGVIGIAA"
     gene            <920468..>923189
                     /locus_tag="TRUGW13939_10669"
                     /db_xref="GeneID:55998148"
     mRNA            join(<920468..920605,920670..>923189)
                     /locus_tag="TRUGW13939_10669"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493779.1"
                     /db_xref="GeneID:55998148"
     CDS             join(920468..920605,920670..923189)
                     /locus_tag="TRUGW13939_10669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349672.1"
                     /db_xref="GeneID:55998148"
                     /translation="MPLEARVKSVLSGDTLVLSHVTNRGQERTLSLAYVSAPRLRREG
                     DEPFAFASREFLRELLVGKVVQFQVLYAIPTGVKREYGIVKLPGTNASLPELAVQEGW
                     VRVREEAGKRSDETEESLALLENLRALESQARADGKGVWGSSEKGSLETDYEVSDGKA
                     LVEQYKNKQLDAVVERVLNGDRYLIRLFLEQNRHLQTLIAVAGVRAPASPRVTADGTQ
                     QPGEPFGDEAQQFVEARLLQRKVKSQLLGVTPQGQLIGSVLHPNGNIAKYLLEAGLAR
                     CFDHHSTLLGGGMLSFRQSEKLAKDKKLGLFTGHVASKGPAGSADSDYIVGRVLNADT
                     IFLRNKAGAEKKISLSSIRQPKPSDPNQAPFAADAKEYLRKKVIGKHVKVTIDGKKPA
                     TEGYEARDVATVVLGNTNIALSLVEAGYASVIRHRQDDDDRSPEYDSLLIAEESAKSE
                     QKGMWAAKAPKGKQYQDYSETLQKAKMEVSILQRQKRVPAIVDFVKSASRFTVLVPRE
                     NAKLTFVLSGIRAPKSARNPGDPADPFGNEAHEFANKKVTQRDVEIDVENIDKVGGFI
                     GVLYINRENFAKLLVEEGLATVHAYSAEQSGHGPELFAAEERAKEARKGVWHDWDPSK
                     EAEEEAAAEVVAGNGAEGNGETAERRKDYRDIVVTHIDPATAQLKVQQVGSGTSALTE
                     LMNSFRSFHINKANDSPLPGPPKAGDFVAARFSEDNEWYRAKIRRNDREKKTAEVLYV
                     DYGNSEVIPWSRLRPLSAQFSMQKLKAQAADAVLSLLQFPVSEDYLADAVQVIEEQTA
                     ERELVANVDYISPEGTLYVTLLDPGASQKLEESINAEVVREGLAMVPRKLKAWERASA
                     ATLAHYKKVEDEAKQNRRGMWEYGDLTED"
     gene            <923788..>925265
                     /locus_tag="TRUGW13939_10670"
                     /db_xref="GeneID:55998149"
     mRNA            join(<923788..924071,924127..924268,924335..924712,
                     924780..>925265)
                     /locus_tag="TRUGW13939_10670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493780.1"
                     /db_xref="GeneID:55998149"
     CDS             join(923788..924071,924127..924268,924335..924712,
                     924780..925265)
                     /locus_tag="TRUGW13939_10670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349673.1"
                     /db_xref="GeneID:55998149"
                     /translation="MGFWSRKQEEPPAEDGESTPPTTTKGDLNKIAAENDVTASASQA
                     AGTAWLAGHLNHLTPEQEEKLVEFKALVEEKEYYKPGKDGEPASHTDATLLRFLRARK
                     FDVQGAYKQFTETEDWRKAEKIDALYENIRLESYERTRQMYPQWTGRRDRRGIPVYLF
                     EVKHLTNKNVSSFSSEVTSQGASETHKDSTIPARLLCLFSLYEHLLQFVHPLCSALAR
                     PNPETPIVSSNNIVDISGVSLMQFWNLRSHMQDASVLSTAHYPETLDRIFIIGAPSFF
                     PTVWNWIKRWFDPVTVSKIFILSSTEVQSTLETFMEPESIPSQYGGKLDFEWGDMPNL
                     DEPARKLAGAIEKTEQEGGYLKGPMRYLGDHIEVLGTDQGQPRRQTIPVPAATTSTTT
                     TDTEDSAPVQDPSEKVEELAKADEIAPSAVETGAPVA"
     gene            complement(<925719..>926549)
                     /locus_tag="TRUGW13939_10671"
                     /db_xref="GeneID:55998150"
     mRNA            complement(join(<925719..926239,926293..926419,
                     926484..>926549))
                     /locus_tag="TRUGW13939_10671"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493781.1"
                     /db_xref="GeneID:55998150"
     CDS             complement(join(925719..926239,926293..926419,
                     926484..926549))
                     /locus_tag="TRUGW13939_10671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349674.1"
                     /db_xref="GeneID:55998150"
                     /translation="MAERILLNEFKALSKEKWVNIELHDEDIFRWDVALIVLNPDSMY
                     YGGYFKALMEFPRNYPYSPPGFRFYRPIWHPNIYNNGELCISILHAPGEDEMSGESAA
                     ERWSPAQRVESVLISILSLLDDAECSSPANVDAGVQLRNDKDAYKTRVQQNVDASKMD
                     IPEGFVMPTFESTMTDAAAAEKSAAANAYDSDFWADSGDDDDDPFGGSDSSDFGMDDN
                     DDDMGVDESGDGTDDDTGV"
     gene            <928388..>933422
                     /locus_tag="TRUGW13939_10672"
                     /db_xref="GeneID:55998151"
     mRNA            join(<928388..928452,928580..>933422)
                     /locus_tag="TRUGW13939_10672"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493782.1"
                     /db_xref="GeneID:55998151"
     CDS             join(928388..928452,928580..933422)
                     /locus_tag="TRUGW13939_10672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349675.1"
                     /db_xref="GeneID:55998151"
                     /translation="MGLQCHGPIWVIDDLTPCFQRNYLQIFFPLITCGLSLLLIAFGI
                     GYPRLAEWRRSAYRPLVNDNTDDETEEEEDVTDLVLHKSASRISHGDFEVNRAPGQLL
                     IVITELIGLLIEIGVSITVLVTQAWGHNGNVAAAAKLVSWAYIFALVVARFVLSALDK
                     QTKPRLWNHTTSLYGIQWLLVIFVFRSEVIHPHSRHALVLSSVEFAVSTVLVFLSITT
                     RRGNKSVLLQREDDLEPPHQPYASLLSLITFSWLDPLIRQGYYQPLELEDVWNLTVSR
                     HASTILNQFRQQYKNYKLLWKLLRYFDKDLMTQAAWTVFSNLFTFIPTLLLKAILEYV
                     EDPRSTPANAAWLYAILLFVSGAMQGIADGQALWIGRNNIGLKLRAIVIGEIYSKAMR
                     RKAGATTEAKEEDEEVSKKKKKKSDKEEENPAQMARLGTIINLMAIDSFKVSEVSAYL
                     HFLLASVPTQVIIAIVLLYRVLGFSSFAGIALMVLILPVNLFIARSFRHIQNEILAKT
                     DARIHSTNEVLQNIRIIKYFAWERRFKEIVNEKRQEELKALRHRYILWSCAATVWYGT
                     PILITFTTFLLYTVVEKKPLAPSIAFPALSMFSLLRVPLDQLADMIAHVQEAQVSIER
                     VEKFLGEEETQKYSQLRNHHPEEPPKIALENATLTWGSKSSRDTQDASGDAFQLINMN
                     VSFKLGALNIIAGPTGSGKTSLLMALLGEMRLLTGHVHLPGVTTNRAELPVDPETLLT
                     ESIAYCAQEAWLVNDTIKENIVFASPFDKQRYNAVIQACALERDFTILEAGDETLVGE
                     KGISLSGGQKQRISLARAMYSSARHLLLDDCLSAVDSHTAKHIFHEAIRGSLMAHRTC
                     ILVTHNVALTVPEADYVVVMDNGKISTLGTSDKVAASGALGKELLESRPTSRAGSKAP
                     SRVSSDLEEQVERVNGDSNGTTNGAAKAVPGAQASEGKKSGQTHKESKATGSVKWSTI
                     KMYLVAMGPWYYWIAGVGVFVAQQIGNAATNVWIRQWANAYNVQQDKPADVDSYGIMS
                     DLKAPSFVAGSVPRMSSWGGVQLNPFRSSETGSQVDVNYYLGVYALLGTVYVLVSLIR
                     ELVLFWGSLHASWEMHEKLLTAVLYAKFKFFDSTPLGQLMNRFSKDVEAVDQEVAPVT
                     IGMLHSLASVIMIVGIVSYITPGFLIAAVIITLTFSAIGAFYLNASRDLKRLESVQRS
                     PLYQQFGETLTGIVTIRAYGDPERFIIDNHRRIDSYNRPHIYLWAANRWLAFRADMIG
                     ALVAFLSAAFVLLNIGTVDAGAAGLSLTYAVTFTENVLWLVRLYAEAQTNMNSVERVR
                     EYLEVEQEAEKVIEDRRPPSGWPAKGAVDFVDYSTRYRSDLDCVLKDVSFSVNPGEKV
                     GIVGRTGAGKSSLALALFRGLEAETGTIKIDGIDIGTIGLQDLRESITIVPQDPTLFS
                     GTIRNNLDPFDLFSDEQIFVALRRVHLIGQDTSGLATPASPSNRSLENVPAAAGPVVQ
                     ENKNIFRNLESPVAESGSNLSQGQRQLLCLARALLKNPRVLMMDEATASIDYATDAKI
                     QETLRELEDSTIITIAHRLQTIIDYDKVLVLDHGKVIEFDHPWTLINKENGSFRGMCM
                     NSGNTEVLFEGAKKAWESKRLVETD"
     gene            complement(<933924..>935464)
                     /locus_tag="TRUGW13939_10673"
                     /db_xref="GeneID:55998152"
     mRNA            complement(join(<933924..934858,934911..934978,
                     935034..>935464))
                     /locus_tag="TRUGW13939_10673"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493783.1"
                     /db_xref="GeneID:55998152"
     CDS             complement(join(933924..934858,934911..934978,
                     935034..935464))
                     /locus_tag="TRUGW13939_10673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349676.1"
                     /db_xref="GeneID:55998152"
                     /translation="MLLSGLICSTALGLAASVAGQIQAPAIAGVAPPISNADRLYTGD
                     QSSNTITVIKPLTGEVLGTIALGKQRLTDVLNPQYIQAVNTHGLGFSRDGKYIVSLSV
                     TSNTVTVIRCVDNSIVSQTFVDRNAHEAFFASDNRTVWVGTRGVDRIDIVDGINGGIV
                     GYVNTAGGPSKVLFSPDGKLAYANHIRSPTVSIIDVETRTVVRSITGLADKFSSDMML
                     SADGKRLWAAHKMVDKVSVISLQSNRVVSVLETGPETNHPNFADINGTTHGFVTVAAE
                     NLTRVYTQPDPEHAPVYLTSIKANVIEPHGLWPSPDNSYMYVLGEHSDAVDFVDLSTM
                     RVTKTVHIGQEGQALVYVAGAVPEGSGDGTQNLGRQGLSRQRPLNKLLVGETHSDNVT
                     ATALVTVRRQAGLDMFQVIGRGLKLNTTYTVSASCLQCKAVRIPLVEFSASTPSGPGC
                     GTAPQVLAFFKFIGVYSMESLKLVEVY"
     gene            <936154..>936822
                     /locus_tag="TRUGW13939_10674"
                     /db_xref="GeneID:55998153"
     mRNA            join(<936154..936593,936645..>936822)
                     /locus_tag="TRUGW13939_10674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493784.1"
                     /db_xref="GeneID:55998153"
     CDS             join(936154..936593,936645..936822)
                     /locus_tag="TRUGW13939_10674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349677.1"
                     /db_xref="GeneID:55998153"
                     /translation="MLARALVIAVSAIGALAADAVFNPPKTELFLSIAYQVGIPVNTT
                     TPSGVVGTVPVRGGDIKGSLFNGYIVPNLTSSVEKYQPVVNNVVTTVSLPTHSSGRLE
                     VIVADLSSKSYDGRFVFENSAGDRIFAEILGSTAYGKDLHGFGYAKLETTAPCLQWIN
                     TAMFIAEWQGVFYRGSGTTVEIFHVNTGGRVDGQPIDAIPPSADI"
     gene            complement(<937123..>938737)
                     /locus_tag="TRUGW13939_10675"
                     /db_xref="GeneID:55998154"
     mRNA            complement(join(<937123..938629,938688..>938737))
                     /locus_tag="TRUGW13939_10675"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493785.1"
                     /db_xref="GeneID:55998154"
     CDS             complement(join(937123..938629,938688..938737))
                     /locus_tag="TRUGW13939_10675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349678.1"
                     /db_xref="GeneID:55998154"
                     /translation="MPQKGYPKVRTGCLTCKKRKVKCDEARPYCNRCIATSRKCDGYS
                     YAPSSHGSKYSWEQLLAPRIQFALGAPGASSTSTDGRAMAYFHATVAKTFSRMLGGTN
                     WAPRLSQMAQSEPAVQHAALAISAMYEQRYEKPLGNFQWPGESKSAIQHYNAAIRCII
                     AKHQSYSLDTLLLVCAMFVCIEFLRGDAGTAISHIRSGILILKSQQVESELGSIFYHW
                     YALPFVFGIGTISFPLIQRPKYLTNASFKALTQAQEIIDRLAIRALHLGQAGDGYRLG
                     AASDAQVSPMLSHEQHQLQVALHIWWLSFSHLQQSSELSTGTDIRIPLLEMQWLVWKV
                     YISSCLSLRETIYDTYMDYFQRILQNATALGPCKKKGGFTAQPVFDIGMGYFTSVYFV
                     VVSCRHLKMRLTALQMLKVSSQSKEMMWDMAIFYAVGKRLIEIEHGITLTGEAMKEIC
                     QSIDPPEFPPDSQRIRGYFIEPGATQKANGDRQDDRRQMLEHKVRFIMRDVENSKTSE
                     HICRISVARA"
     gene            complement(<940119..>943645)
                     /locus_tag="TRUGW13939_10676"
                     /db_xref="GeneID:55998155"
     mRNA            complement(join(<940119..942762,942812..943170,
                     943226..>943645))
                     /locus_tag="TRUGW13939_10676"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493786.1"
                     /db_xref="GeneID:55998155"
     CDS             complement(join(940119..942762,942812..943170,
                     943226..943645))
                     /locus_tag="TRUGW13939_10676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349679.1"
                     /db_xref="GeneID:55998155"
                     /translation="MSKFEFGTRYLPRLPNSNKNRRDDSSNNKTKTPVSAANPDIRKY
                     VNRMQKQGTKEGWLASPEIPTSQEIMCVKGDIDLEENCINIEPNHVDGPWPSVEDYLR
                     THYELLREDSVALLRDSVAYLRNKPSMTDTKNICVYDQVHITGMTFETKGVAIKVSFS
                     TARACKNIVWDYSTRLISGSMVALSPAKDCFKSQCVIAIVAARPLHQVKKYPPLVDLY
                     FANPDEAYFDPQQEWIMVQPRTGYLESVRHTMATLQLMNDECFPLQEHICNLNEDIDV
                     PEYVKSDPEMRISPDQIVDVLSDWPQEPANDLDISQWEALHHILTKRLAIIQGPPGTG
                     KTHVSVTALKLLLHNRKPRDPPIIVAAHTNHALDQLLNHISEVVPDYVRLGGRSIDEN
                     VRKRTLYEVRKSISIPPLSGGALGRAYHKLKIFRENIENLLRAFTMDSTGPLPATFFR
                     DQKVISSEQYDALCNGAEGWTNSNLEEQADPIISWVGDMLFENSVTYRYEDRGYEEDE
                     MDLEYEQLREMEQEKGISDDDFETLKGPFVPLKENVRGRSNIDDELIEYLSIDNLWDV
                     PPQNRGTIYNVLCRIAKEKLLSTFREHLKQYNRSVTERFIGKWEEDYAILKNTKLVGM
                     TTTGLSKYRALVSALKPKIVMVEEAAETIEAPVTAACVESLEHLILVGDHKQLQGSCS
                     VTDLEGDPFFLNMSMFERLVQNDVDYRALLLQRRMVPEIRRLLTPIYNNLKDHPSVNN
                     LMKVPGMGDIRSFFFCHQWPENSDSLSSRYNAQEAEMVVTFFLHLFFSGVDPSEITVL
                     TFYNGQRKKILKLLKENRHLQSRHLKVNTVDSYQGEENDIVLLSLVRSNEKGEIGFLS
                     IENRVCVALSRARRGFYMFGDAQKLASKDPLWWEVVKMMGEGDEESRRIGFHLPLTCD
                     KHQNKEFVSKPEDIKDLNGGCRLPCETVLGCGHPCPVKCHGFDHALIQCKERCGKALS
                     CGHSCREACTAPTCSCHCGYKTIKASSLAKPSKGSSIQSSSPSKASVPEPRRQQQQQQ
                     TFKTDKERIQAFQKYAQGGSREHDRMLDKKFSAEATEKILVRLDAEESANLFTEQQQQ
                     QPAQDLDVRVLSPVGDEESGGARTRWVQSFTPAIPTVEQQSVAVEGDLIDLD"
     gene            complement(<944325..>945867)
                     /locus_tag="TRUGW13939_10677"
                     /db_xref="GeneID:55998156"
     mRNA            complement(join(<944325..944406,944471..944544,
                     944600..945017,945069..945538,945590..945637,
                     945699..945743,945814..>945867))
                     /locus_tag="TRUGW13939_10677"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493787.1"
                     /db_xref="GeneID:55998156"
     CDS             complement(join(944325..944406,944471..944544,
                     944600..945017,945069..945538,945590..945637,
                     945699..945743,945814..945867))
                     /locus_tag="TRUGW13939_10677"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349680.1"
                     /db_xref="GeneID:55998156"
                     /translation="MASSLKNVVVIGGSYVGRTTAQELARVIPTTHRVLLLEPHSHFN
                     HLFTFPRFSVIPGHEHKAFIPYSGLFSSVPNSSLHTVVSARVLSIQAQHVKIDREWQG
                     STQIPFEYLAIATGTRLKEPAAMRYDDKASSVVYLKKHQDSVKQSKSITIVGGGAVGI
                     QMATDLKEFYPEKEVTLVHSRAHVMPHFHEKLHGIIAKRFDALGIQLITGSRVVVPPN
                     GFPRDGESVEVELTNGTKLKTDFVILATGQRPNNSLVQDLSSSQPGSLINPDNGFIRV
                     KPTMQLLDDKYPNVFAVGDIADTGVQKAARPGSAQAAVVAKNIQSLIEGQVPENKFTW
                     GASGIHLTLGLKQHIKFRNPNLAEGQSEPVVIEEDDGEEDLGVEGMWSRMGVEVDGPS
                     RYHL"
     gene            complement(<947130..>948082)
                     /locus_tag="TRUGW13939_10678"
                     /db_xref="GeneID:55998157"
     mRNA            complement(join(<947130..947828,947899..947975,
                     948031..>948082))
                     /locus_tag="TRUGW13939_10678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493788.1"
                     /db_xref="GeneID:55998157"
     CDS             complement(join(947130..947828,947899..947975,
                     948031..948082))
                     /locus_tag="TRUGW13939_10678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349681.1"
                     /db_xref="GeneID:55998157"
                     /translation="MTDHPQYHLVGTFTRYSSWTARVETVLEYFKIPYTSQMVDFEDI
                     RTVSISGLVPVLESRSLGIMINDTLSICEFLAESNPHLNLWPSDPKLRALARSAAAEM
                     HSGFTTIRNTYHTNFIAQYTGNIPVPEQARKEIIRILTIWDNARKVTKARLAELGEKD
                     EGFLFGGFSIADAFFWPVLWVDNPIHFSINDHEKRITDHRQRFRTYNLPLDSATPDAL
                     KWMATMWNDPSIKKLVGNYYRQAERPETRIEKYENIFADREDIHSSVFPEDWRFSEP"
     gene            <948747..>950757
                     /locus_tag="TRUGW13939_10679"
                     /db_xref="GeneID:55998158"
     mRNA            join(<948747..948789,948851..950483,950544..>950757)
                     /locus_tag="TRUGW13939_10679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493789.1"
                     /db_xref="GeneID:55998158"
     CDS             join(948747..948789,948851..950483,950544..950757)
                     /locus_tag="TRUGW13939_10679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349682.1"
                     /db_xref="GeneID:55998158"
                     /translation="MASIVDDDDDRDIAGSQDGSSDNEDEQMRDADDGDGDNEQDQDV
                     DQEPDQEQEQDADSPSNNSQTSDGPGEASQRDAGTSAATDYLAMFRPGVRPECLTATT
                     YDILPTTAAPQSTSINTITATADMRWVFTGGSDGFIRKYNWADSINGKLMLTVAQRHP
                     FVDSVVKAGVLMNYWENMDGPLLSPVYSLASQSEGLWLLSGLESGNIRLQSVRHEEGK
                     EIALLKNHTSAVSVLNITSDEQSLLSGSWDKQVLEWDLNVGKVKNSFKSGAGQISAIE
                     IRPESSLPVPQDTLMTQPSGTFSSNNDQSDSFATANDAGAPQNTGDDLNHSAESPSDS
                     LFGGTDSLFGDADGNIADGGAPSGDAGNVDEDALFGGSLEMDMQPLEQEPQAEPGAGT
                     QPNGNEAAPPPSTETNPEPSSSSLKTESQPIKQPMPAMEPVVNGLPHAENLEFSTIKQ
                     EHQTSENASHITSDTTFLAASIDGPICIWDRRQPNPVARITPRNVPPWCMNACWSPDG
                     NYIYAGRRNGTVEEYSLHKGLRSPERVFRLPIVGGAVTALKAMPNGRHLLCGSHDILR
                     LYDLKEEATKHSAVPFLLIPGHRTGVISQLYVDPTCRFLLSASGNRGWEGNTTEVLLG
                     YEINV"
     gene            complement(<951152..>952132)
                     /locus_tag="TRUGW13939_10680"
                     /db_xref="GeneID:55998159"
     mRNA            complement(<951152..>952132)
                     /locus_tag="TRUGW13939_10680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493790.1"
                     /db_xref="GeneID:55998159"
     CDS             complement(951152..952132)
                     /locus_tag="TRUGW13939_10680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349683.1"
                     /db_xref="GeneID:55998159"
                     /translation="MVLLTSGTVATLLIPITCVCTFSIFLAGYALQQHSVRKIQDAIR
                     PYDVIPTIPDEFSHDNTRETITDPKTGELVTINKGNFAYVQLLSEPNPSDICSSILFF
                     KKLIDGESEIGDRLFMYPEEWDMIASSDPNINAALSTLQTASKKYDFWLLPISMNLVT
                     QQGYSLTDSKLLRLGEIQFMRYDSVLYLRSPGFLLDAKELDKMLLSRPLPLKYDINRL
                     ESYRNEAWIGMPLLAHQEARLPPVYLISVNTMRNRVEARTHIPNVAMRGFGDLAAGPT
                     YKCTSGIDPAYVFFEWDEDRHNTKQEDNPYYHQWRKEQTQVCKEVNFDLY"
     gene            <952454..>953194
                     /locus_tag="TRUGW13939_10681"
                     /db_xref="GeneID:55998160"
     mRNA            <952454..>953194
                     /locus_tag="TRUGW13939_10681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493791.1"
                     /db_xref="GeneID:55998160"
     CDS             952454..953194
                     /locus_tag="TRUGW13939_10681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349684.1"
                     /db_xref="GeneID:55998160"
                     /translation="MASHRADASTFLDNRGYSGPLIRGVNPITLFEKAVRDRITDSYY
                     WKEQCFGLNSATLCDRAIELTSIGGTYGLSQKPTPFLCLAFKMLQLSPDRDIVLEYLN
                     FTDPGSGDEATENDEEVVKGKGDFKYLRALAAFYIRLTFEPVDIYKYLEPLLLDYRKL
                     KQRRRENYILTNMDQFIDTLLTKDRVCATSLWKLPPRQQLEDLDLLEERISPLADELD
                     ELDDESEASYHSRGSDNSDQASNDGQED"
     gene            complement(<953388..>954957)
                     /locus_tag="TRUGW13939_10682"
                     /db_xref="GeneID:55998161"
     mRNA            complement(join(<953388..953868,953916..954381,
                     954435..>954957))
                     /locus_tag="TRUGW13939_10682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493792.1"
                     /db_xref="GeneID:55998161"
     CDS             complement(join(953388..953868,953916..954381,
                     954435..954957))
                     /locus_tag="TRUGW13939_10682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349685.1"
                     /db_xref="GeneID:55998161"
                     /translation="MANLQSWSSQWLIVLALTTAVLAFYSFDKLKKEGILGRARRAST
                     AKTPPRSVSPEKLALGGLLPTSYSDVLPPSRREAMRSLASKKPATSSKEVSEKDILRN
                     ILPMTENYETAKGSLYTSMGFSMDEIKEMGDFPDFATLSGVPLPNAHGDNFDIDKALP
                     RPYRPFRWAYHQTMSLKKLETDWWIELENKYKKRIAQRKDLYAKHGKEVLDWLPGSEI
                     ACKELMEMVIQYICARYPRLFSLKDDRILVNGILGTEQDIRAKHPLEVLMDNVPEDFA
                     ITMRDDKTGYYSFRAGVICSSLGWNVSTKIGLQLHEVHAPIPDYKEKMKFSMDRFFSK
                     MPADKPIQRGSWGLEVDCPLYMPPGDPHELHRLSQSPDLSIDDCYLRVDWQTLRRLPI
                     SGSIVFNFKAVFTPVTEFRDEPKVPALVAKVLREGKKNLMEYKSTWHVEHVVLPALDK
                     WNKEQEDSGMIEKNWEVSTLDEDPLFKGWEDKWHRQQGF"
     gene            <956978..>958402
                     /locus_tag="TRUGW13939_10683"
                     /db_xref="GeneID:55998162"
     mRNA            <956978..>958402
                     /locus_tag="TRUGW13939_10683"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493793.1"
                     /db_xref="GeneID:55998162"
     CDS             956978..958402
                     /locus_tag="TRUGW13939_10683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349686.1"
                     /db_xref="GeneID:55998162"
                     /translation="MANNQGREKSLEDAKHEEKVGFYLQGHRRETAGIWDLSAELIDM
                     VANYLDDQTLCRFAATSKRHWEMLQSTCHQNALNGEGLIEEKMAALDRGDLIDVPMPL
                     FNKAVANGNLCAVRSFLAHKVNPNSSYRYLPGARISISALYQAMELCNAIDMADLLLS
                     YGANPSLGNLWTDELHLYRPFEPLRIPVWQAARNENSELVCLLLKYGAKIDPRHGVHE
                     FIMNCNETVVSHMIDNGFDPFEPSNSGRDYMYFHDAAANKNGRGVFDLMASLSLSRPG
                     RLDHLEQEINRCDGNGMTPLIMAIENDREDTVLALLEYGARPNILDQSFCPLTQHPLT
                     RACIYNLETAVSALIRAGANINFREIYCFHAIHYAVKVSASMTEIILKAGADVRSVTG
                     YGNTPLHIACMSEDSTFKEHFMPEDSNKYSKFMRRDVDLKIVELLLAWGAPVDAKNKT
                     GLTPIDIARDHSVVAALKKSQSAG"
     gene            <959190..>963161
                     /locus_tag="TRUGW13939_10684"
                     /db_xref="GeneID:55998163"
     mRNA            <959190..>963161
                     /locus_tag="TRUGW13939_10684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493794.1"
                     /db_xref="GeneID:55998163"
     CDS             959190..963161
                     /locus_tag="TRUGW13939_10684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349687.1"
                     /db_xref="GeneID:55998163"
                     /translation="MVNLTGSSLPATPQRKDGKLLRQQIESLNHEFDLRIPNPELFSP
                     GSQSTAERPKEEECRAWLHTLFWRDSKAFERGLDSFREEIRAEIKATREKNWIHKPRQ
                     DSGTIPSRDQYLQTDNYRRISADEWQHRLHVLWNILRSEVWLLKGGVNPSHSSQALGR
                     PRNLANGGPRASDNGRESPAITTTPQAKRKSDFEEQVFYTAPNSPTLSPEDRYPSLGD
                     LDEYNGPNGANFFFEETTMEATDDLNLGDQTSRKSRKRQSKITDHMLVSKSDRSSENK
                     SFQNPQPNQNANTATPGTSFATTIGSVFDPPDRGIETSFGTDITEPLDDVLTQADSIE
                     AAMRSDDASMLLRSIEGERSISLGAHQDYVAAEQDLLDTLIRNGPFSNRMSFLDKVPL
                     RAKYELERVRLEWGVDHKLILAGEKPHEKHADLWSWLRNLSVRVGKSLPEKSSLKVWD
                     AAIGRFQGDRHSEVVVLTGALDWCDETESGIFKLRLNPLKLDRTCRFYRRFGSDRFLS
                     ITIPASSQAPRYIRDSNVSLREVTAKWLSSYDQFLLGRVWRAFYIEEYKNKSKTKTGE
                     PRFRVDLFAVDGVDFFKKLHAPVLSPPGQSCDVHTRMTVEQLLEWHIPRRENSHQTDC
                     KVFNRIHLGLSKTWATKTLRPDQTRKLPDIEGKPVMNDGCALMSRPLARAICEDLGID
                     GNTPSCFQGRIAGAKGLWMVDKERAEDDFWIEISDSQLKVKPHPSDFYGFVDEQKMVF
                     EVAGWSKPLRPSELNAQMLEILANRGQPKERVAELARTAITDLYMEFKTVIEKDSIPL
                     ARALMQKIRPMPEDGSSRNNIRRIDQWIIKDTEAVIRLLEAGFSPRNFVPLRDRLWRC
                     LVDTLNRYVNDCHVPVPLSTYAYCIADPYGVLEEDEVHFGFSSQWKDCPEFEDAIVDG
                     VDILVGRTPAHCPWDIQRRKAVWKQDLRHFKDVIVFSTKGDTALASLLSGGDYDGDRP
                     WICWDPKLVDSFNNAFPPPDHVPDAEHFGLITHARPMGSVESTEDFLEGVFKFNLAMS
                     NLGRCTVEHGKIAYDEPDGIGSPVALELAALLSHLVDSRKSGVQLTDDGWKQYLKKIS
                     PRARRVPAYKDVDAKQGKNGNINDFLKFKVAVAEKDTALKKFHELCKSAGEEMRDADL
                     VRPWQAVWTRAVRENDEESPLLLTTLNIIKEQIGQARDKWSNSCNSTSDIPLSVKVEF
                     AAEHLNRIERPDTPHPLGHTWQNSEYEWQTILASGAYYFYWRSAFPLYAAGETLCWIK
                     TGKEPARLIRDYIYVSMKVNSKVARRLADEEVDDTPNDDSEYSDDSDGYDGESVFDAV
                     LSA"
     gene            <964203..>965822
                     /locus_tag="TRUGW13939_10685"
                     /db_xref="GeneID:55998164"
     mRNA            join(<964203..964551,964624..>965822)
                     /locus_tag="TRUGW13939_10685"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493795.1"
                     /db_xref="GeneID:55998164"
     CDS             join(964203..964551,964624..965822)
                     /locus_tag="TRUGW13939_10685"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349688.1"
                     /db_xref="GeneID:55998164"
                     /translation="MEEERRIEQIGSGQDPAFQRHESPAFSQQAHAFAPTATPGVAAL
                     PPPAANMSRDPSSAAAPVSLSSMPPTPSSSSTLSYDPSRTMMDVDGDRARRAASVLSM
                     DDIEAAQALEGLRSDFGHSPPQQTSHSQQPSHSSDTPASTQPEPLLSLLTSTHPFISS
                     AISGSVSAYESSKSYSTRFKYGAEFIERNIGSPVVNTVGTVSRKTGVEGGLRWAFQRR
                     DTNDFEEQNKRRKIEPADIEKAALQQRLRSASDTSYSETLPPYDDQKSPNYDEINRDS
                     MQAESEQSQRSWHNRLVISTSGLSVAMSDESIRRLAYCLKWLKWANERLNNAVLALKN
                     VLSKWEESKQGSSTDENSSQNRAMLSKHIQVVKEDVLRTLKQVVDIVSKYAGGALPEN
                     AGRLVRRHLVSLPQRFKLASTSNSSTESGNSGSDVATNARRVLVLAQEGLDMMTQVHG
                     VVDDTLVSAQTWCERLNRKLPDLANDQQNPSEATQQENQAMSIDIKSPIVDAPHREVE
                     MTDADAV"
     gene            complement(<966491..>967939)
                     /locus_tag="TRUGW13939_10686"
                     /db_xref="GeneID:55998165"
     mRNA            complement(join(<966491..967489,967547..>967939))
                     /locus_tag="TRUGW13939_10686"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493796.1"
                     /db_xref="GeneID:55998165"
     CDS             complement(join(966491..967489,967547..967939))
                     /locus_tag="TRUGW13939_10686"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349689.1"
                     /db_xref="GeneID:55998165"
                     /translation="MNKTTAVQLRSGSTSRHKKSQRNSTNSSKPTQRLILHPPKLPQQ
                     PKLMLRSSKQSLSNRTVCDWMDVSLVGNGSDASYSYGDICTVQAILKNFNGLSSAPSI
                     IDDVEGKLEDLATSTGSTVDDYTSAEVEMNGILQEALDCHHCDDAINFDPEIMESDIR
                     HGIYRCSEDPPFVLNQPCEDIAPDEMPQEVCAPGYLQLATQAQQDRYLELVGGHINRN
                     RENKIFAGMEEVDQGYESKFAFYCVDYHIHQHYIHRRSALNLCRTNDEMDDFRSWKYK
                     LALWTARQHRPLRLDSHDMVDQLMTHGHNTNANGNVTTTAAIKPMSLATMEGEPNPFA
                     TSRSTSPTSSTYSSHSSPSTAASSPPGPSPVRPPSPPILPWHKQEFSISSQITLHRRL
                     TNPRERAARVRAARKQFQNIMKRRALQRREGLVKAEHEAAIAWARWHQGKDAPLAIPR
                     DRDIAQLLQYYGR"
     gene            complement(<969165..>970163)
                     /locus_tag="TRUGW13939_10687"
                     /db_xref="GeneID:55998166"
     mRNA            complement(join(<969165..969412,969472..969855,
                     969911..>970163))
                     /locus_tag="TRUGW13939_10687"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493797.1"
                     /db_xref="GeneID:55998166"
     CDS             complement(join(969165..969412,969472..969855,
                     969911..970163))
                     /locus_tag="TRUGW13939_10687"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349690.1"
                     /db_xref="GeneID:55998166"
                     /translation="MSGSPIDKNAVFVHDNTVPPVHNSLLALFSLKGKTAIVTGAGAG
                     IGLCVVQGLAEAGANVALFYNSNDKAPERAAEIAQKYGVKAKAYQADLRDHKKAEDTI
                     NQAVNDLGGRLDIFIANAGIPWTQGASVDGPIQHYLDVVQTDLDATWYCARAAAAHWR
                     RQKDEGTDLFGNKLENFTYGSFVATASMSGHIVNIPQLQAPYNAAKAGVIHLVKSLAV
                     EWAKFARANTISPGYMATEISNFIPQETHDLWKSKIPLGREGMPEELKGAFLYLASDA
                     SSYTTAADLLVDGGYAAP"
     gene            <971849..>974560
                     /locus_tag="TRUGW13939_10688"
                     /db_xref="GeneID:55998167"
     mRNA            <971849..>974560
                     /locus_tag="TRUGW13939_10688"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493798.1"
                     /db_xref="GeneID:55998167"
     CDS             971849..974560
                     /locus_tag="TRUGW13939_10688"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349691.1"
                     /db_xref="GeneID:55998167"
                     /translation="MVGLPIVIAVAVGCSAFLIVGAILGVVVWWRMRQDRLSLAMAHA
                     RQTITHQGPACSSFVTESPIESPLPTYPYPYLRHDYIPIGSQESIQPWAPAAKKSSPP
                     TLKKEKSKSIRRSISKSLSKSLSIGRSNQKSRQPDPMPVSPLDETFLPPFPNAKEKEP
                     KSAIAGFSELPTEITPRNTPERERDDDIQLEILNNRPSSTAWPLLQQDRISSVSGGQA
                     TLFNRYPSRLRSGSITAQTAGTVPEMPMPPPPVGLAQPYQLSHEDSLMGMSSLSLETA
                     NSSILDDGLRRSMSVDGEHSHSPSLPPCPTFTPFSPYDIVIGGSVARNCASERRSQAQ
                     RLSSSTARLTYMSAESDDRASPRRSLTTREVSPQPSGWTASEVPRRSETVFSSSSTGR
                     LSSRPASNVSASSPSGRYSATGQGLYSRQEFGTQSHQQARYSMYETLQAKEENNSSFS
                     KSVGDRPRSIQTQSPKATRDSPGRAPLPSAMKSAQSMRKGHRRQNCVRISIHPPITFG
                     GPAFSPMLEEPEEILDLEKDFAVPKSQHQSTPLSVRRTESKYQPKHGRHRSTGSILEE
                     PVILADSAGINSRIPRPSSSKKRPHSRTSSADDVFMSENRVIIPDRSPGPVPEEDHSL
                     SSTPSPEKHEPLWCLPHSDAFVGCSPILPTNASTGSPRRPAPRGPRIQPIRSQRNTVP
                     SPSSSQPLANGVYTFTAGSSSSDGSPTSKVGRSHTLAASPTKDVRKSITLLRRMNSEA
                     WDDESKQYRRMGRNASLTKPRINKFSTPPQSNRSSIMSNDSLTIWEDASEDDASTPPP
                     ARRKNHRFKILERIDSEGATEENMSNASAQRQQTIRQVPLSSSIVTFGDNERHVKASS
                     DNGTDEIVNKPAKRASVVSTPNAKAHGYGIMSLTPGSLYDGDGFLKE"
     gene            complement(<974890..>975902)
                     /locus_tag="TRUGW13939_10689"
                     /db_xref="GeneID:55998168"
     mRNA            complement(join(<974890..975559,975625..>975902))
                     /locus_tag="TRUGW13939_10689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493799.1"
                     /db_xref="GeneID:55998168"
     CDS             complement(join(974890..975559,975625..975902))
                     /locus_tag="TRUGW13939_10689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349692.1"
                     /db_xref="GeneID:55998168"
                     /translation="MEILRTPPQAASFTPLAEHQSRTPESFYEGAPVLHYHSARCKIV
                     ILESELARSPALRTLRGSSASDTNGSGAAPDAEEKETVIDGVDVWAASDKFLLYRTEA
                     SSGVAIPYPLISLHAVQRLKLPASSEEVQGLYMQIANPIPSDNGGAEEDEEEDSINLT
                     IVSPPTAAPAVEETDPAAEGAEIKPEETATQALFAAVSACSNLHPDPVTTGDEEEGED
                     YDGNEQPGVGGLLQAGLIMSGAADGGLPPPVDGSSGWITADNMHEYFDEEGNWIGEGE
                     PPSLPGLGPGAGNTHDRDDGPAQNGEGNDDDETKWRRTD"
     gene            <976269..>978753
                     /locus_tag="TRUGW13939_10690"
                     /db_xref="GeneID:55998169"
     mRNA            join(<976269..976316,976369..976822,976877..>978753)
                     /locus_tag="TRUGW13939_10690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493800.1"
                     /db_xref="GeneID:55998169"
     CDS             join(976269..976316,976369..976822,976877..978753)
                     /locus_tag="TRUGW13939_10690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349693.1"
                     /db_xref="GeneID:55998169"
                     /translation="MSEFKLSASLEGHGDDVRAVAFLNSNVVATASRDATVRIWKQVS
                     SPPPVFDYTIAAHGSAFITSLAYYPPTAEHPEGLIFSGSQDAIIEARQPSKASADNAD
                     AMLLGHGHNVCSIDVCPEGGWVVSGSWDATARLWRVGKWETEVTLDGHQGSVWAVLAY
                     DQNTVITGCADRLIRIFNTSGKLLKTIKDSQDVVRALCKLPEGHPSGAQFASASNDGV
                     IRLFTLNGDVVAELAGHESFIYSVAVLPSGELVSSGEDRTVRVWNGTQCVQTITHPAI
                     SVWNVAVCKETGDIITGASDRKARIFSRDNSRQADPETIQQFDSAVRESAIPQQQVGD
                     INKEKLPGPDFLKQKSGTKDGQVQMIKEDNGSVTAHTWSSATQEWIAVGTVVDSAGSS
                     GRKTQYLGQDYDYVFDVDIEDGKPPLKLPYNLSQNVYEVATKFIQDNELPISYLEQVA
                     NFITQNTQGATLGQTTESQQPASSDPWGQERRYRPGDAAAASQAAPTPSLPESRQDVL
                     PQTTYLSIKSANIKLILKKLQELNEQVIAAGSKEVSFNPPELNTVLALCNQLDATGSV
                     PKDPATVESGIQLLIKAATKWPAGSRLPSLDLLRLLAAATPVTAEALYQGQDVVSALQ
                     QSGMFEGPVNGNNAMLGIRLFGNLFETPLGQELAVSKFDEIVRNVSSVTTAAISAPNR
                     NITIAATTLYINYAVYFSTNGRATSVESAEHALQLLEELTKIFSKEKDSEAVYRGLVA
                     VGTLVTTLGEEVKSAAREIYDLNSVLSTVSSSGAGREPRVKGVVGEIRKALS"
     gene            complement(<978897..>979850)
                     /locus_tag="TRUGW13939_10691"
                     /db_xref="GeneID:55998170"
     mRNA            complement(join(<978897..979337,979392..979486,
                     979538..979603,979666..979774,979839..>979850))
                     /locus_tag="TRUGW13939_10691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493801.1"
                     /db_xref="GeneID:55998170"
     CDS             complement(join(978897..979337,979392..979486,
                     979538..979603,979666..979774,979839..979850))
                     /locus_tag="TRUGW13939_10691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349694.1"
                     /db_xref="GeneID:55998170"
                     /translation="MSLKAISSKDAAALDKDLMDIGGFSLDQLMELAGLSVSQAVYRF
                     HPLTKGKRVLVVCGPGNNGGDGLVAARHLAHYGYAPSIYYPKQGKNELYERLKIQLQN
                     LQVPFVPDFTAALQSTDLIVDAIFGFSFQKPLREPFPSIIRQLEETKIPVLSVDAPSS
                     WDIQEGPPKAGGEEPGATFMPAALISLTAPKPCVKWYKGRHFVGGRFLTKEIADKYDL
                     DLPEYSGIDQIVEVGVNADEKL"
     gene            <980146..>980661
                     /locus_tag="TRUGW13939_10692"
                     /db_xref="GeneID:55998171"
     mRNA            join(<980146..980222,980340..980535,980611..>980661)
                     /locus_tag="TRUGW13939_10692"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493802.1"
                     /db_xref="GeneID:55998171"
     CDS             join(980146..980222,980340..980535,980611..980661)
                     /locus_tag="TRUGW13939_10692"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349695.1"
                     /db_xref="GeneID:55998171"
                     /translation="MVVRIRLSRFGPRHSPFYNIVVAQARTARDSKPLEVIGTYNPIP
                     QKPTNLSEEEALVAKPFKEISLDRTRAKYWLGVGAQPTDGVWRLLTLLGLLEAKPKKF
                     AAQKD"
     gene            <981049..>982527
                     /locus_tag="TRUGW13939_10693"
                     /db_xref="GeneID:55998172"
     mRNA            join(<981049..981362,981427..982108,982177..>982527)
                     /locus_tag="TRUGW13939_10693"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493803.1"
                     /db_xref="GeneID:55998172"
     CDS             join(<981049..981362,981427..982108,982177..982527)
                     /locus_tag="TRUGW13939_10693"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349696.1"
                     /db_xref="GeneID:55998172"
                     /translation="TLTTPLPLTCCCRRISLPSNSSSTFTSYRKVRLSSQWKCTPKIF
                     PASGFEVIDQSVEIDEETLSTYQPEKYYPVKQGEILNDRYQTLAKIGYGVTSTVWLTK
                     DLVASTYVVLKVFVTGQDRDHERELNVYKHMGLQETRHPGRNFVRKLLDHFYIQGPHG
                     RYVCLVHEPLGMSADLLIKMSPGQAMSLDDMKPGIRQLLVALDYLYSECHIIHTGNIS
                     ILLTSLCYGSNSDADLQLKNLLLPGPETSYLSRFEEAEVADPSPRKILHDRELYRSLS
                     FLPRGGGLPLLTDFGEARPGDKENNDDIMPNVYRAPEVMLRSNWGYKVDIWNVAMVAW
                     DIVCSRTLVNGKNADGIFDDRVHMAELVALLGPPPAEFREQRHLSSVFWDESGNWKET
                     APIPSTTLESLAANIQGEDKEGFLRWLRMALQWQPEERAAALELLYDEWLMKGLGE"
     gene            <984261..>986057
                     /locus_tag="TRUGW13939_10694"
                     /db_xref="GeneID:55998173"
     mRNA            <984261..>986057
                     /locus_tag="TRUGW13939_10694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493804.1"
                     /db_xref="GeneID:55998173"
     CDS             984261..986057
                     /locus_tag="TRUGW13939_10694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349697.1"
                     /db_xref="GeneID:55998173"
                     /translation="MVGTSSTQSSRTSPGSYSTSTTQRAQSVSSSSSSPQSLSQGPSA
                     AHNAMSTDVYNPAVSQPPTSLSSSFSYPFSPIGPPSSFDGLGANTMRLGDADLSPPMN
                     GFHRPPPANNGAAILMRKLPKNTSRDALRSMLLFAKDFVDADFIPSDMPEDANFFCAI
                     ARFNTVAAAEEARALLDGKPNTSNDANMIVEMYAGPLPNRRNTIDHTSARGLSGPTAR
                     QSSRFNGTFQTLSNGISQQPNANEALPAPDSNSRMNSLFSPQSPLGNGLGELPRVSGK
                     SVIDQDLDEDTGELLKDPVGYAQNGHSAMPLQQRRSTNPQIPTGRFAGLSLATNVSSP
                     PLQGYSNGNGGRMNVPTPSTGIPPNMAGNTGFHFPNQHNPRHSLPAANPNDLNPPCNT
                     LYVGNLPADTQEEELKALFSKQRGYKRLCFRNKQNGPMCFVEFDEVAMASKALNDLYG
                     YKLSNSVKTGIRLSFSKNPLGVRSGQPGSSVNPATPLSPQTPIHGASGINSMSNPMFS
                     TANGPPPGLSAPPGLALPMGIRNGSIPPNQNPHPPMTNGASFNGNNGLGIRANGMNPI
                     GSNSLNGGLPGGAPSAGMGAFGNVYPDYMMGR"
     gene            <987614..>988872
                     /locus_tag="TRUGW13939_10695"
                     /db_xref="GeneID:55998174"
     mRNA            join(<987614..987967,988201..>988872)
                     /locus_tag="TRUGW13939_10695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493805.1"
                     /db_xref="GeneID:55998174"
     CDS             join(987614..987967,988201..988872)
                     /locus_tag="TRUGW13939_10695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349698.1"
                     /db_xref="GeneID:55998174"
                     /translation="MFNWLLGEGASLKHHIPGDTNYVTDLKERMNPRGGSNRSRSDGA
                     DGEDNSASSKRPFPLNSSFVSSPILGEDLRNEIYKRVVKQNKSVRTVSVELQVDMRRI
                     GAAVRLVELEKRMEKEKKSMAIPYARAVHEMVPTTPLAEGGQRQPIHEPINELPVHRL
                     TQPQIFYPVSESRQFTRVDAGRVFSGAPALETDEEKTLTVQSLIKPGTKRIEKVGKGD
                     NEQHVLLPADARIPHPQLIELERDFIAKPHEPKERWEKYHERIQKSDALAQKRKADAK
                     KRAEERTIRIEPENSRFEFRFNDVVVSKETTGPDGRGHSAPGRRYGVPTYDRKKGQVK
                     IPTKVEV"
     gene            <991141..>992245
                     /locus_tag="TRUGW13939_10696"
                     /db_xref="GeneID:55998175"
     mRNA            join(<991141..991479,991535..>992245)
                     /locus_tag="TRUGW13939_10696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493806.1"
                     /db_xref="GeneID:55998175"
     CDS             join(991141..991479,991535..992245)
                     /locus_tag="TRUGW13939_10696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349699.1"
                     /db_xref="GeneID:55998175"
                     /translation="MTCYQPPSDPFDLTRPMVIPAGGRIADSIDPSDLMSTFPSSDAD
                     WMGKSSLEFLPWDLSGSNDQQEAFNLSEEVADGLEFPNPYINGDYTSPMGYRGYTVAT
                     EDALSYASPVSDGESGTWSPTHNNDKSNSQSPAPADNTKGPGSATSPSTGHRHAVRMP
                     LATAGGSPVAPAEHTVYESSSSASLRSRKLSNATASSSSPLSLTAATTTTTTTQTSYH
                     SNTPPVRSATEPDPAAVMKRKKAAHNAIEKRYRTNMNAKFLALGNSIPRPGPFATQLA
                     SNKGSRKHSLCSSRRDSLANGTQQQQQQQNKSEILTNALSYIQELQEENSRLKGELMV
                     LKENLLPRGPFTWRR"
     gene            complement(<993185..>994504)
                     /locus_tag="TRUGW13939_10697"
                     /db_xref="GeneID:55998176"
     mRNA            complement(<993185..>994504)
                     /locus_tag="TRUGW13939_10697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493807.1"
                     /db_xref="GeneID:55998176"
     CDS             complement(993185..994504)
                     /locus_tag="TRUGW13939_10697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349700.1"
                     /db_xref="GeneID:55998176"
                     /translation="MSQNEIANNGWDLIAAASQKALNEQLAKIHPVTLKKQIEMELLG
                     SKEKVDVDLVFNGPELRVRDGSGRQVDVLLPVQGTVKVDGILKANIVIPKGEKVTVTT
                     ELMQIENKLVPHPDEKQTNYDLMIDFKSEKAIVDMKLNIPTADLAFLIETMKVLVQKE
                     LHGGKEYKVASFALSNEKAKEYKSLIPHTADFSFVQDVKDPGRSNLLVLMQSVSEGKP
                     DGGILFKKPLLASNQDFMVLASNKLFLEHFVLPPLIENLKKNAKDGDSLPKTMLIKKV
                     GGSDSELYQLYNKSNINLSFDHDPWIDTMTAEIDTTEKALYFNLLVKVDATFIHIHGS
                     AWDKSWQQFQVDQAKQTVTLKQIKEDKGKDTSMEWWKWLLACLDWIVLLVVGIIYAVV
                     ENKITDLGGTFVQTAPLVVQWPNQKYVSLKGMSTPSHVVLDLDVHFS"
     gene            complement(<996450..>1000703)
                     /locus_tag="TRUGW13939_10698"
                     /db_xref="GeneID:55998177"
     mRNA            complement(join(<996450..996746,996797..997443,
                     997506..998974,999337..>1000703))
                     /locus_tag="TRUGW13939_10698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493808.1"
                     /db_xref="GeneID:55998177"
     CDS             complement(join(996450..996746,996797..997443,
                     997506..998974,999337..1000703))
                     /locus_tag="TRUGW13939_10698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349701.1"
                     /db_xref="GeneID:55998177"
                     /translation="MAQSLQVAPKLQDEVEAIQPANSGDSDNPFNWPTRTKWTVTLTT
                     CFVCFIVGLNATGIASAPTPINDRFNVSDESFPNSFWPVASWTIGAAIVPMVVLPLME
                     KHGTRVGYISCYAIFFVFVVPQAVAPNFATLIVCRFISGSAAGVLQNGMDGIIADIWD
                     GPVQRSLPVTIYVTALLAGISLGPVYGGVVVHNLYWRWVFYIQLVIYGVTFIVVLLAM
                     KETRSPVILSKRLRREGKEKSNDSVSTQDGSSPPSPAKFLYDTLILPARLLCTEPVVF
                     FFTLLSALSYGIAFISTQSVTQVFVTNFAFAEYEAGLVQASIVVGEILGFIACLFQNA
                     WYARVGRANPHKSEADISEIRLYSSIPASFIGLAGGLFWYGWTSYASLPWILPAIGLA
                     MTMFGVTVVMQAIMMYITDAYAKYAASASAAVCFGENMFAAFLPLAAQSLYTNLGFQW
                     ASSLLGMSHGIARLSQRLRRKIGSDSVEKFTKQKKKLRRPRPDGQQAGPDSSCGDLTI
                     SHPHPDHHHHHRQLASGLHESDSFSSSIPVDYLSSVEDLASRGRGAAACVSAPSIPDE
                     EAPSGQRQRQQQQQQQQRTSQHSPTDTDDVGTIYDREDVEKPPPLSSTNLDDRATISL
                     GQSALLATTGGTTYSPTTPSTSFANPHSRHIANSGTSTSTPVSFSQTVDERDGASPAA
                     ISSDGNDTIEELPPGQNPSTSHSTAITRKQSLIPQSQQYLVNRVLGSGLHHRDSDPFA
                     LPYQPPAPMAPRKIWVKRPDASATLVSMSEDSVVDELRDHVLRKYSNSLGRTYDSPDL
                     TVRICPRAPLGPDRILSPEESLFALIDQNYPGGQTMAEALVVEAPQRRTPIKPSPRQS
                     YYYHAEPGEQGEYFPLMPVPISIGTPPAHPSSSSASNVSTHQTPSMSVLTTGKVPPLP
                     SPGSRANRHASWRPPFVRHPTSSPTLIGGAKEQNLAVNGQAVPPQASLPTPPAPAAPP
                     SESPTHNVLNPPVAVPSPRPVRRTKKVASPRNNTAFGGLIEGTVPPINVLIVEDNVIN
                     QKLLEAFMKRLSVRWQCAPNGEVAVKKWRQGGFHLVLMDIQLPVMNGLDATKEIRRLE
                     RLNGIGVFSKTVSGRSRAESTGPGAEGSLKEEDTLQDLSLFKSPVIVVALTASSLQSD
                     RHEALAAGCNDFLTKPIGFPWLEQKVTEWGCMQALIDFEGWRKWRGYEDSPQNTNSTQ
                     LVSSPTQKGGFQAVKALGTKPTSKVSVVEGDSSGSSSGKDEDGENHGPVKSTVPA"
     gene            <1001105..>1001938
                     /locus_tag="TRUGW13939_10699"
                     /db_xref="GeneID:55998178"
     mRNA            <1001105..>1001938
                     /locus_tag="TRUGW13939_10699"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493809.1"
                     /db_xref="GeneID:55998178"
     CDS             1001105..1001938
                     /locus_tag="TRUGW13939_10699"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349702.1"
                     /db_xref="GeneID:55998178"
                     /translation="MESDFDRITFYDISMRPPTEVHCCSPNPWKTRYALNFKDVSYST
                     SWVPLPSISKVRRGLDLPATRKFADGSDFYTLPIISDPSTNSIVGDSFDIAVYLQQTY
                     PNSGAGNLLPPQKLDYTFSQNQALAVPLSNRTAAGFEEYAQFNINVDAAFTTHVLLMV
                     QNLPFDPATAEQSKTESLRRAGLTNWADLDIHGAAREQLLNSFQDALAELAKLYEKDP
                     SGPFVLGTQPSYADCIVGGWLRMSSVCLPASEWEQLRGWHDGVFGRLHDTLQEEFGQM
                     N"
     gene            complement(<1002329..>1003647)
                     /locus_tag="TRUGW13939_10700"
                     /db_xref="GeneID:55998179"
     mRNA            complement(join(<1002329..1002611,1002670..1002718,
                     1002781..1002837,1002915..1003044,1003102..1003192,
                     1003257..1003342,1003400..1003434,1003491..>1003647))
                     /locus_tag="TRUGW13939_10700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493810.1"
                     /db_xref="GeneID:55998179"
     CDS             complement(join(1002329..1002611,1002670..1002718,
                     1002781..1002837,1002915..1003044,1003102..1003192,
                     1003257..1003342,1003400..1003434,1003491..1003647))
                     /locus_tag="TRUGW13939_10700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349703.1"
                     /db_xref="GeneID:55998179"
                     /translation="MSGNERIPVAANVLGTIGTVFWCVQLVPQIWHNWRHKKTDGLPQ
                     SMMLLWAVSAIPFGVYMILQDVNIPLQIQPQLFGFFGFISWGQILYYNHNFSKFKASA
                     LVVILVLLCGGIEAMFILTLRIPYSKGITWPDLIFGIIASIMLALGFLPVYLEMWKRR
                     GRVVGFNWVFLSIDTLGALFSLFALAAQGTFDILGGVLYVVVFLCEVAIYGSHITWRI
                     RHRKLLQTAKTSGKTVDELLDEKKGGHVENVSSLPDLEKGVQNEKEEARPTGDVSTDM
                     GQPRGSVNQDLPLPAQRSE"
     gene            complement(<1004902..>1005962)
                     /locus_tag="TRUGW13939_10701"
                     /db_xref="GeneID:55998180"
     mRNA            complement(join(<1004902..1005429,1005480..1005602,
                     1005658..1005813,1005894..>1005962))
                     /locus_tag="TRUGW13939_10701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493811.1"
                     /db_xref="GeneID:55998180"
     CDS             complement(join(1004902..1005429,1005480..1005602,
                     1005658..1005813,1005894..1005962))
                     /locus_tag="TRUGW13939_10701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349704.1"
                     /db_xref="GeneID:55998180"
                     /translation="MNRFNAGNIIGDPFALATISISILAWIISFVASIIANIQVDFPN
                     LVWWATAYMLLCIIGVIVVIGSDTSLVYGVAITGYLSSGLVLTSLAVNSLVSEPQASK
                     QAASAGYILLSMVNIIWIFYFGSTPQATHRRTIDSFALNKEGTPYQNSRPASHAFGAR
                     PDTTASQAPQMYTSAQLSGFETSSPMSGYPGGPPGSDKRNTNATAFGVGPNPVNPNNG
                     GNPEVSNEVSQPTEYPYKAKAIYSYDANPDDANEISFAKGEELEVSDVSGRWWQAKRA
                     TGETGIAPSNYLILL"
     gene            complement(<1008040..>1011711)
                     /locus_tag="TRUGW13939_10702"
                     /db_xref="GeneID:55998181"
     mRNA            complement(join(<1008040..1008446,1008500..1008803,
                     1009088..1009318,1009374..1009828,1009884..1011107,
                     1011166..1011306,1011368..1011431,1011494..1011538,
                     1011595..>1011711))
                     /locus_tag="TRUGW13939_10702"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493812.1"
                     /db_xref="GeneID:55998181"
     CDS             complement(join(1008040..1008446,1008500..1008803,
                     1009088..1009318,1009374..1009828,1009884..1011107,
                     1011166..1011306,1011368..1011431,1011494..1011538,
                     1011595..1011711))
                     /locus_tag="TRUGW13939_10702"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349705.1"
                     /db_xref="GeneID:55998181"
                     /translation="MAAEPSEEDINNFTGITGVFRDQAIGFLKVSISLRPAMTAINAY
                     FENPDALQQQPRNDWGGLDSASYSQNNQSVPTFNIENSDDVLGKGYSAPPSRPPSRMN
                     TNEVLSDLKNSGMGAPSSGADSSGQKLSAAQLEERELEQAVAMSLGQDITHQESGVIA
                     TDNSHFGPANQEYYDENTWGLTLFDQNTREEIISPDPEDRQRKDNEPAFFRPSQDSLF
                     VGGFLTILHSIPIAREALLLRDKTIPDYGHDAQWWNGQLVKAPRIVSLDDPYAEYQDW
                     EIFIHETQRLMAFLDSTKRAFGSTDALVSLKPISYYDQEKGVERFLEGWQEAALHATP
                     DNQLSMIFTSLAVRRAVSDFDEPNSKQFFVLSVQAPIDHGQTLYDVLDDAIWQDAPGQ
                     ELDDVWLGNVAEVLTIQLGNTNNVPINIKIPTVFYPDRYMEASRGVIHEVRLKILEVQ
                     ERIAEIEDVAALYRGSKPGSRTGMTNEELLEKAARAATIALPRYIPEGTAQIDSAELA
                     NNGERVAKQLREIAASLGEKLKKLEAQKQEARDSTRNFSKTMTEPSASPDEPPHFPYT
                     LRGVCTAPHVTYVLRRNSRGGSEDLIEMEDTNEDEWQWWRISFSTEDAKTQQAAKAEN
                     SERKNAAPKNADIIGFTTTKVREIEVLKAARDSSNVLLVYANPNSISFQSDIAPPALQ
                     EFVNADNISFKAELDAANRVYHDEEIGEPGDSVYEGWPDVNETLAPNRSDASNVNVFD
                     YEVNSFDDGPSSRDQEMQESNFGASSNSTPSTTLDAINIQPMNMSLENTAIASATVEL
                     LEGRLRRLEYLLNGDSRWSGQPTPASRPESLDDTAARRLARLEADLNALSKSKPAVRD
                     VLQLYTRFPDLFNDAPPESIPADLSTQNLASIVLSYASAFPETSSRLTSLNDLPVPDA
                     KASIALIELQPRLQRMLRIQEQQAQAVSELRARSAGLLRRWYELGLLGSSECWAGWES
                     RLQDVEHEVKRQEVLRDRRMNEI"
     gene            complement(<1012071..>1012509)
                     /locus_tag="TRUGW13939_10703"
                     /db_xref="GeneID:55998182"
     mRNA            complement(join(<1012071..1012160,1012282..>1012509))
                     /locus_tag="TRUGW13939_10703"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493813.1"
                     /db_xref="GeneID:55998182"
     CDS             complement(join(1012071..1012160,1012282..1012509))
                     /locus_tag="TRUGW13939_10703"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349706.1"
                     /db_xref="GeneID:55998182"
                     /translation="MMSFILTLLFVEALQAFGMSQEDILDGDKTECVPAGGKIVQRKS
                     IYLSVSILMTISSLQAIAAVEKSAASSALASTNSVDFIGFILGEDRLYYVLMKGLWQD
                     VSY"
     gene            <1013353..>1015536
                     /locus_tag="TRUGW13939_10704"
                     /db_xref="GeneID:55998183"
     mRNA            join(<1013353..1013484,1013554..1013624,1013690..1013837,
                     1013903..1014985,1015038..1015338,1015421..>1015536)
                     /locus_tag="TRUGW13939_10704"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493814.1"
                     /db_xref="GeneID:55998183"
     CDS             join(1013353..1013484,1013554..1013624,1013690..1013837,
                     1013903..1014985,1015038..1015338,1015421..1015536)
                     /locus_tag="TRUGW13939_10704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349707.1"
                     /db_xref="GeneID:55998183"
                     /translation="MKLHRPLYAAPSALMRRQCRNIHGLQSRYSRGLLTQSYARGPDQ
                     PPLIEKTIPDHFSSIVQQFGDRTAVVSRHQNDRLTYDTLDRMSNSLARGLISIGVQKG
                     DRVAIMLGNSIEYAAATYAIFKLGAILVPLNPSFNANQVVAALGHLGTTHLIISAEAN
                     LPRRPPRDNTPLIKHIVPDLQAAHLNSELIPTLKHIVIVDNSAGRIDTTAYSPLTPYS
                     SILSSLRPDGDRLSPQNLSNNDVVNIQFTSGTTSMPKAACLTHRSILNNGAHIGDRML
                     LTENDVVCCPPPLFHCFGCILGYMATATHGSSIVFPSESFNGLAALEAVREEKCTALY
                     GVPTMFIEELGLLDKGEVPSDGFQYLRTGIAAGSSIPAELMRKLHKRLNLTELTICYG
                     MTETSPVSAMTTTDDPMEKRINTVGQLMPHVEAKIVNPADNSGLLPIETKGELAVSGY
                     LLMKEYWDAPDKTAQVMLADENGKIWMHTGDEASMSPDGYITITGRIKDLIIRGGENI
                     HPLEIENCLLAHPAVSETSVVGVPDEKYGEVVGAFVVPAIPKAANKTGLGEEVLTEEL
                     KTWVRQKLSNHLVPKYIFFIASSDLFPKTASGKIQKYKLKETAIQLLKER"
     gene            complement(<1015706..>1017657)
                     /locus_tag="TRUGW13939_10705"
                     /db_xref="GeneID:55998184"
     mRNA            complement(join(<1015706..1016130,1016178..>1017657))
                     /locus_tag="TRUGW13939_10705"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493815.1"
                     /db_xref="GeneID:55998184"
     CDS             complement(join(1015706..1016130,1016178..1017657))
                     /locus_tag="TRUGW13939_10705"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349708.1"
                     /db_xref="GeneID:55998184"
                     /translation="MLLIPAMHMSKAQLGPGQQHSMDPCSAGLLHRGLGETTSSLRLE
                     SFSKSIACGTIHTSQMLVVPSCPTFCPEAVAISPPKPKRLSRRYHASTEPLMLRPSSP
                     HQQDYSKLAPPTGGDFRPMTASNPQNRSSLSRKSTSSIRSFFRRDNYHHPAKTRRIGS
                     RSHREAVVSQQSQEPQSQSDSSSFSIPSDCMSQLETACMNASSAPSQTPSPLQKAARS
                     LSFRNRIKFAALPRPRPAPKKIVRSPTAGTPQHRNTPEFSIPARAGVGSKSRRLSAEL
                     PEDFNVDSCELSREYCNGRRIPGRHGKEIGKGTTATVRILYKKGCSKDVRYAVKEFRK
                     CGRNEDRREFEQKIKSEFSIANSLQHPNIVKTIRLCRNHGRWNHVMEYCDQGELYSLI
                     QKGYLEEEDNLCFFKQLLRGVAYLHQHGIAHRDIKPENLLITTEGQLKITDFGVSEVF
                     SGIHPGLRSADGQCGKLMDGTQKCSPGICGSLPYISPEVLAENGDYDPRSLDVWSCAI
                     VCMTLFFHGIPWQTAKPEDPDYAKFLAGWHKFLLRNPKGKITKREYPSCGRAFATLPS
                     NGLSRLVLKMLHPDPEMRISIEDALEDRSMRRIVCCSPDVGQVAESDTMLDDSVAVGK
                     MHNHIPPEKT"
     gene            complement(<1019071..>1019571)
                     /locus_tag="TRUGW13939_10706"
                     /db_xref="GeneID:55998185"
     mRNA            complement(<1019071..>1019571)
                     /locus_tag="TRUGW13939_10706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493816.1"
                     /db_xref="GeneID:55998185"
     CDS             complement(1019071..1019571)
                     /locus_tag="TRUGW13939_10706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349709.1"
                     /db_xref="GeneID:55998185"
                     /translation="MLFHKTRQSLTNERIEASRREKEKPLACIIFFFASQMTYNLQNP
                     ATGLKSENAAGGSEARNHQLDSLLAEVREHANQSPYVTRFEAIPVEMAPPGRPRGTSS
                     QEMHDTLLLASFKSKNAWRQWIQTSEWKHFMQETADKGVFRRIPHVRCAHSLKGLRNP
                     LEVLMA"
     gene            complement(<1019878..>1020442)
                     /locus_tag="TRUGW13939_10707"
                     /db_xref="GeneID:55998186"
     mRNA            complement(join(<1019878..1020258,1020329..>1020442))
                     /locus_tag="TRUGW13939_10707"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493817.1"
                     /db_xref="GeneID:55998186"
     CDS             complement(join(1019878..1020258,1020329..1020442))
                     /locus_tag="TRUGW13939_10707"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349710.1"
                     /db_xref="GeneID:55998186"
                     /translation="MSTTQEPDIASPKLAGNEDEATATATATCFCGSVQLAFPTEGPG
                     LVNTFICHCKDCHKITASMFSSCFTIANSHLQHVRGRDNLKTFERSHTIASGNTVTSN
                     FCATCGSLMYRVSSGYPGISVLRIGTVDDFNLHETKLRPQDEAFAESRVPWLQGLHRE
                     PESK"
     gene            complement(<1020980..>1021636)
                     /locus_tag="TRUGW13939_10708"
                     /db_xref="GeneID:55998187"
     mRNA            complement(join(<1020980..1021399,1021478..>1021636))
                     /locus_tag="TRUGW13939_10708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493818.1"
                     /db_xref="GeneID:55998187"
     CDS             complement(join(1020980..1021399,1021478..1021636))
                     /locus_tag="TRUGW13939_10708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349711.1"
                     /db_xref="GeneID:55998187"
                     /translation="MSASPPPASSRLKPPASVQVKNRRKRFLDQHPEYFSADLEMAGP
                     RAPSRLHSDTPAERESEGRAKGFSGILQADLLRSEAKMDALAHPDPNAMLSYRQGPNG
                     EIVAEDEEDIPANKEEGEKRWRWEMEMRFLKGADYDFEYEKVDENDEYDDWNEEQERY
                     FDGEEPEWIISEDRDGKDSADNLEGETGIQDF"
     gene            <1022032..>1023781
                     /locus_tag="TRUGW13939_10709"
                     /db_xref="GeneID:55998188"
     mRNA            join(<1022032..1022954,1023011..1023311,1023368..>1023781)
                     /locus_tag="TRUGW13939_10709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493819.1"
                     /db_xref="GeneID:55998188"
     CDS             join(1022032..1022954,1023011..1023311,1023368..1023781)
                     /locus_tag="TRUGW13939_10709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349712.1"
                     /db_xref="GeneID:55998188"
                     /translation="MVCYDLAKAVAIIYLASVYSVLSQLALAPVYGSTPARLYHQALC
                     STAVLAGYVLGSRSSLISHKGRQFLPTLAFLIPNIQFLLFPFSSQLGNPTGPLLTELL
                     TIAPLIFLSAAASSTVLKPLNLQHYGAIISELIPPIGGLLFFNLAQTTAQSAIPLHLD
                     SALFITSFGLQVGLAVLYTVVVPQRLFWVLCTVPVVIFSLRANVHMPFAYTTARLNST
                     LQEVNYSLVDRQESLTGYISVLDNMQVGFRAMRCDHSLLGGHWTHLPSGYNPRVSDPI
                     YAVFTMLESVRLVEPENNGLVKKDTESNALVIGLGIGTTPAALIQHGIHTTIVEIDPI
                     VYKFALQYFQFPRNHTAIIDNAVTFVETAQRQTQQYDYIVHDVFTGGVEPVDLFTLEF
                     MQGLYALLKDDGIVAINYAGDLSLPGAGLIVRTIRSVFPQCRIFRENNGLEKSDTDPL
                     GFTNMVIFCKKSSTAPLTFRAPNEDDYLGSQSREAYMYPQHEIDPKVFDAAYDTTDQQ
                     ILQAGKTRMIEAYHMKNAIGHWNIMRGVLPAKVWENF"
     gene            complement(<1023842..>1024696)
                     /locus_tag="TRUGW13939_10710"
                     /db_xref="GeneID:55998189"
     mRNA            complement(<1023842..>1024696)
                     /locus_tag="TRUGW13939_10710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493820.1"
                     /db_xref="GeneID:55998189"
     CDS             complement(1023842..1024696)
                     /locus_tag="TRUGW13939_10710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349713.1"
                     /db_xref="GeneID:55998189"
                     /translation="MTSISSLPAHAASNSAPSPPFVHVDGIPNFRDIGGYSITDSSST
                     RRGFIFRSALPTRVTADGIKTLAQDLGVHTIYDLRSNVELRKDNAPSLLTSAEGITVL
                     HRPVFPETDASPRALAKRWANYMSDNGTEGFVAAYAEILREGAGAYKVIFEHVRDHPQ
                     KPLLLHCTAGKDRTGVIVALLLLVAGVKEYDVVGDEYALTETAFDPKIRAALAEKTLK
                     EMGPNADEAGVKRMFSAQKENIIATLELIDKNYGGGEGYLKTALGFEDTDIELIRKNL
                     TAGEKGIF"
     gene            complement(<1025327..>1027230)
                     /locus_tag="TRUGW13939_10711"
                     /db_xref="GeneID:55998190"
     mRNA            complement(join(<1025327..1025485,1025553..1026196,
                     1026250..1026343,1026403..1026779,1026850..1027011,
                     1027089..>1027230))
                     /locus_tag="TRUGW13939_10711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493821.1"
                     /db_xref="GeneID:55998190"
     CDS             complement(join(1025327..1025485,1025553..1026196,
                     1026250..1026343,1026403..1026779,1026850..1027011,
                     1027089..1027230))
                     /locus_tag="TRUGW13939_10711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349714.1"
                     /db_xref="GeneID:55998190"
                     /translation="MSTEPQNSGGPGSRPSSKDGNKKNIWSSMLDNVASGKRLPEKNI
                     VVLGGTPESQREFLDTLSSDPSDPQLPNERRRGKVAPVANEFALGYTYQDVLDADQED
                     ILARLSIYMLSDPSPSFAPLIRPLLTPQSIPETLIVVLLDWSSPWTWLRQLREWIRLL
                     RSVLISLDDETKIVMEEVMSEWKDKKRGLDSSSTPGVANSGGPVTIPLGPGEWDEGLG
                     VPLCVVCQGANKIEQLEKENGWREEEFDFILQFMRTVLLKHGGSLIYTTPFLANSLQS
                     LIHSSLSIHSLLKRQSLKHNVIDRDKILVPANWDSWGKIRIIREGFDIEGVGDAWSIE
                     IQETSRHWANGSTGDEAQNSSDSAAPSAEDGTSAVVIYEQTIKDPKQHLGAPGSNTHA
                     DRSQIEIETQDMQGFLGQQVDVLEQLKVDDEKDRAANKVPKQLDMSPDLEESGRVNEH
                     IGPVQFNMGGIQVDADDMLRKLKEREANRTPKKETVPASAADEKAHNQALANFFAGLV
                     KKPGGSPRSSPAPGSSN"
     gene            <1027779..>1028630
                     /locus_tag="TRUGW13939_10712"
                     /db_xref="GeneID:55998191"
     mRNA            join(<1027779..1027834,1027901..>1028630)
                     /locus_tag="TRUGW13939_10712"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493822.1"
                     /db_xref="GeneID:55998191"
     CDS             join(1027779..1027834,1027901..1028630)
                     /locus_tag="TRUGW13939_10712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349715.1"
                     /db_xref="GeneID:55998191"
                     /translation="MNAIRQIQALNKRELENAVPPEASWHADYRDSAYINIGGLPFDL
                     SEGDIVTIFSQFGEPVHVNLIRDKETGKSRGFAFLKYEDQRSTDLAVDNLGGATVMGR
                     VLRVDHTRYKRREDEGEEDNVASIMGPAAGASRGSHDDTDERRRRRTSDADEKPRPML
                     KEEVELAELMRDHDEEDPMKEFLVQEKKEEVARALEELKSKSSRRHRRPDDNRERSSK
                     HRHHRHRRSENRSRSRERSHRDRGETSRRDREYRDRSDYADRR"
     gene            complement(<1028983..>1030352)
                     /locus_tag="TRUGW13939_10713"
                     /db_xref="GeneID:55998192"
     mRNA            complement(join(<1028983..1029513,1029564..1029920,
                     1029983..1030080,1030147..1030185,1030244..>1030352))
                     /locus_tag="TRUGW13939_10713"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493823.1"
                     /db_xref="GeneID:55998192"
     CDS             complement(join(1028983..1029513,1029564..1029920,
                     1029983..1030080,1030147..1030185,1030244..1030352))
                     /locus_tag="TRUGW13939_10713"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349716.1"
                     /db_xref="GeneID:55998192"
                     /translation="MDTRQVIDESTGPVSLSAAFNSDTSCFSVGLDTGFCVFNADPCE
                     LKVSRDFNAGIGIAEMLGQSNYLAIVGGGKQPKLPQNKMVIWDDVKQKAVITLEFRTS
                     VLRVRLSKSRIVVALLNSVHVFAFSTPPQKVSVFETSDNPLGLVCLGNKLLAFPGRSP
                     GQVQLVELETGNVSIIPAHSSALRAMVLSPDGQVLATASETGTLARVYSTRNCAKIAE
                     LRRGVDHATIYSLAISPSSTLLAVTSDKSTLHVFDLPQPQTLARRSQSPSSPSEEGIN
                     QKWGFLGKIPLLPRVFSDIYSFANAHFEIGDEFPTGAPYIPPLGSSVGQPSKGVLGWT
                     NDQTILVVGAGRDGRWEKFIIHEGEDGKRFCIRGGWKRYLGGG"
     gene            <1031163..>1032665
                     /locus_tag="TRUGW13939_10714"
                     /db_xref="GeneID:55998193"
     mRNA            join(<1031163..1031183,1031304..1031373,1031439..1031555,
                     1031615..1031702,1031760..1032362,1032422..>1032665)
                     /locus_tag="TRUGW13939_10714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493824.1"
                     /db_xref="GeneID:55998193"
     CDS             join(1031163..1031183,1031304..1031373,1031439..1031555,
                     1031615..1031702,1031760..1032362,1032422..1032665)
                     /locus_tag="TRUGW13939_10714"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349717.1"
                     /db_xref="GeneID:55998193"
                     /translation="MSSGLNAIRRKKNVKKGIQFCLMVCGASGTGRTTFVNTLCSKKV
                     LEHKDADDAENAHVEEGVRIKPVTVELELDEEGTRISLTIVDTPGFGDQIDNEASFSE
                     IVGYLERQYDDILAEESRIKRNPRFRDNRVHALLYFITPTGHGLRELDIELMKRLSPR
                     VNVIPVIGKADSLTPAELAESKKLVMEDIEHYRIPVYNFPYDIEEDDEDTVEENAELR
                     GLMPFAIVGSEEVLEIGGKKVRARQYPWGVVEVENPRHSDFLAIRSALLHSHLADLKE
                     ITHDFLYENYRTEKLSKSVDGASANQDSSMNPEDLASQSVRLKEEQLRREEEKLREIE
                     LKVQREINEKRQELLARESQLREIEARMQRETSSQLGPSEELNGEA"
     gene            complement(<1034125..>1037908)
                     /locus_tag="TRUGW13939_10715"
                     /db_xref="GeneID:55998194"
     mRNA            complement(join(<1034125..1034199,1034265..1035127,
                     1035184..>1037908))
                     /locus_tag="TRUGW13939_10715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493825.1"
                     /db_xref="GeneID:55998194"
     CDS             complement(join(1034125..1034199,1034265..1035127,
                     1035184..1037908))
                     /locus_tag="TRUGW13939_10715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349718.1"
                     /db_xref="GeneID:55998194"
                     /translation="MADLGSQQGRSFRPSPYGQSSNFQRDAAFSDIFGSAPQGRAQTM
                     TAQTPHLPTERAHTMSSHIAQPQMPQRMPAPGRQMPAGPGQSVPNGYGNPHMNGGNIS
                     SHAPQNYPRQYQRGSAYPLPQRVDTRPNQIPQYSNAKMPAPQGRPAPPPALNTDAYRS
                     RSMAGVPRMSAAPVYAQPPNSFNHASAHAIRHQQYNAPAARTPQGRTVPERHDDARTM
                     SLSSYSSHLDYAQTPYGRTVPVRRPPSGPDQIPSQLLPAPVQAQVQSQTPTIVEQQTL
                     DGEGPRQRRPSETSLTSRTMSMASTLTPDRTMSLQSKSVQKSNSQSTQSTAATAVAQR
                     PVRKPLVYPAMLARVADVFRERIPLGERQKNGLSYQNAFSGAEAVDLIAYIIRTQDRN
                     LALLLGRALDAQKFFHDVTYDHRLRDSPVELYQFKETMTEETPSSEVNGVFTLLTECY
                     SPTCTRDNLCYSIACPRRLEQQARLNLKPQPGLHHSSSKGSLHADDDNDDQKLWINMV
                     PKEVADTIDDREKKRQEIIFEMMYTERDFVKDLEYLRDFWMRPLRSAGNTSLSPIPEH
                     RREKFIRTVFGNCLEVLKVNSGLCEALNSRQKENHVVRTIGDIFLQHVPRFDPFIKYG
                     ANQLYGKYEFEKEKASNPAFARFVEETERLKESRKLELNGYLTKPTTRLARYPLLLEQ
                     VNKYTADESSDKQDIPKAIGIIKDFLSRVNTESGKSENHFNLVQLNAALKFNPGDYVD
                     LKLTEENRQMLSKMAFKKTSTDSSEVTAYLFDHAVLLVRIKAVNKREEYRVYRKPIPL
                     ELLVIAQMDEVIPKLGLAKRSSSSLIPSKAAVINAPVPKEGLPITFKHLGKGGYELTL
                     FATTQTQRRKFIELVEEQQRKLRERNSNFYSKTILSESFFTTANRVNCLVPTDGGRKL
                     IIGTDNGIYLADRWPKDKSAKPRRILDATAVTQIDTLEEYQLVLVLANKTLSSYPLEA
                     LEVNEGQNPLARRPKKIQGHTNFFKVGIGLGRHLVCSVKTSALSTTIKVYEPMENLAR
                     GGRKPALGKMFRGGQDTLKPFKEYYIPAESSSVHFLRSTLCVGCARGFEVVSLETTES
                     QSLLDQADTSLDFVARKENVKPIHIERMNGEFLLNYSDFSFFVNRNGWRARPDWRISW
                     EGTPNAFALSYPYILAFEPNFIEIRHIETSELIHIMTGKNIRMLHSSTREILYAYEDE
                     EGEDVVASLDFWNRPR"
     gene            complement(<1038157..>1039062)
                     /locus_tag="TRUGW13939_10716"
                     /db_xref="GeneID:55998195"
     mRNA            complement(<1038157..>1039062)
                     /locus_tag="TRUGW13939_10716"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493826.1"
                     /db_xref="GeneID:55998195"
     CDS             complement(1038157..1039062)
                     /locus_tag="TRUGW13939_10716"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349719.1"
                     /db_xref="GeneID:55998195"
                     /translation="MPVSKKDKGAKGIPRDTNRSSDSCLLPLSERDTKKGVCYAARTK
                     EKNGANFGEYSLSAMIATVFLHVTEEAEQKTLAAARLRPCANETAVGIGRVSTDGRET
                     GSRMRKDASFSEIDTRAKPSNRQNARGGRRANSIGDRQAVRKVGKLVREQHRTRRTCS
                     CSSPDCASGPRRPAVAGVLLCGGPSCKFLRARLTQRDPTQPGCTTPCLLHHERCPPPP
                     PPPRPHIPLRPPPRNYGLSHSQHCETHRGFSIEPLFSPLEKDAEGMTAGPCSELRPRL
                     VTSILDFGDHRDCSPALLRTVHGIQ"
     gene            <1038887..>1041912
                     /locus_tag="TRUGW13939_10717"
                     /db_xref="GeneID:55998196"
     mRNA            join(<1038887..1038945,1038995..1039008,1039073..1039227,
                     1039276..1039388,1039456..1039540,1039594..1039679,
                     1039732..1039769,1040370..1040762,1040825..1040914,
                     1040972..1041096,1041190..>1041912)
                     /locus_tag="TRUGW13939_10717"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493827.1"
                     /db_xref="GeneID:55998196"
     CDS             join(1038887..1038945,1038995..1039008,1039073..1039227,
                     1039276..1039388,1039456..1039540,1039594..1039679,
                     1039732..1039769,1040370..1040762,1040825..1040914,
                     1040972..1041096,1041190..1041912)
                     /locus_tag="TRUGW13939_10717"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349720.1"
                     /db_xref="GeneID:55998196"
                     /translation="MADSEYSPKFAPFFSFVRAASRCCDDIWRYVKILFSLVLRSTVY
                     LHTTAMGAAYGTAKSGIGIAGIGQYRPDLIMKSLIPVVMSGIIAVYGLVIAVLISGAL
                     NPPPTQNTSLYTSFMHLGSGLSVGLAGLAAGYTIGIVGDAGVRAYMQQSRVYVGMILI
                     LIFGEVLGLYGLIVGLILNSRSGGTSALRLAISEIVQTLRFKRTNFFFSRSPYTTLAF
                     HFAIETCFVVTMATETVQPTTHEEGTNGDLTEPGAQYKCDGNNADQEKQQISSVLVSP
                     KNPSDGYAVADSPGVRHLGESSHGLSVYDFELIKTLGTGTFARVWLTRLKNSPRKDKV
                     YALKILRKADVIKLKQVEHVRNERRTLAAVAGHPFITSMITTFSDEQSLYMLLEYCPG
                     GEIFSYLRRARSFNEATSKFYAAEITMIIQYLHDVQGVAYRDLKPENILLGADGHIKL
                     VDFGFAKQVGNRETYTLCGTPDYLAPEVIHNCGHGLAVDWWALGILIYEFLVGQPPFW
                     DQNVMRLYEQIVEGRLRFPQTMSPAARDIISQLCKTDVTKRLGHIQGGAARVKAHPWF
                     DSINWDDLYYRRIPGPIIPRVGHVADAANFEEYPPPPHPDTLEVYTDDMREKYEPLFS
                     DF"
     gene            complement(<1042849..>1044027)
                     /locus_tag="TRUGW13939_10718"
                     /db_xref="GeneID:55998197"
     mRNA            complement(join(<1042849..1042895,1042968..>1044027))
                     /locus_tag="TRUGW13939_10718"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493828.1"
                     /db_xref="GeneID:55998197"
     CDS             complement(join(1042849..1042895,1042968..1044027))
                     /locus_tag="TRUGW13939_10718"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349721.1"
                     /db_xref="GeneID:55998197"
                     /translation="MAPLRRGLVAIVLLFAFVLLLRSSSSTSSSSSSSTTSDDTPPEN
                     AEKPVNVPPQARTHAGKRQHAQVTLEDMANRPLRERLRYQYPYDLDTKFPAYIWQTWK
                     YAPSSSWFQDELRPQEESWSELHPGFVHEVLADKTAEHLIRYLFGAIPEVIEAYESLP
                     IPVLKADLFRYLILLARGGIYSDIDTEALQPAINWLPDDMDRLSVGLIVGIEADPDRP
                     DWHDWYSRRIQFCQWTIQSKPGHPILRDIVATIVEDTLRMKREGILTMSRMDKSIVEF
                     TGPAVWTDSIFRYFNDPEYFKNEETRNVTYEDFTGLTVQKKVGDVAILPITSFSPGVR
                     QMGAEEPDHPLAFVLHDFEGSWKPQEERHIGVEW"
     gene            <1046441..>1048012
                     /locus_tag="TRUGW13939_10719"
                     /db_xref="GeneID:55998198"
     mRNA            <1046441..>1048012
                     /locus_tag="TRUGW13939_10719"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493829.1"
                     /db_xref="GeneID:55998198"
     CDS             1046441..1048012
                     /locus_tag="TRUGW13939_10719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349722.1"
                     /db_xref="GeneID:55998198"
                     /translation="MMNPAFRGAARRASCNWRAANPARRANLGLSSTYNTSPQWRLIH
                     SNSRRSPQPAVSHEQIQDSSNPAMSFPCLDAQDARTATLSARSLNSGPEPSYTTGHHE
                     NFHSKEPFLLDWGGILPEFNIAYEAWGTLNADKSNAILLHTGLSASSHAHSTPSNSKN
                     GWWEKFIGPGAPLDTNKYFVICTNVIGGCYGSTGPSSIDPSDGKRYATRFPILTMEDM
                     VRAQFRLLNSLGIKKLHASVGSSMGGMQSLAAGVLFPERIGRVVSISGCARSHPYSIA
                     MRHTQRQVLMMDPNWQRGFYYDLIPPHSGMKLAREIATVTYRSGPEWEKRFGRKRADP
                     SKQPALCPDFLIETYLDHAGEKFCLEYDPNSLLYVSKAMDLFDLGHDHQKETRARREQ
                     NAKNAAQGKVETNDASCSLTLPDQPYEEQPSVTSSVTPMNEPATGELTTGPPEDLVRG
                     MAPLKDHPVLVMGVASDILFPAWQQREIAETLLASGNKHVEHVELGEDVSLFGHDTFL
                     LDLENIGGRLGKFLG"
     gene            <1049451..>1051172
                     /locus_tag="TRUGW13939_10720"
                     /db_xref="GeneID:55998199"
     mRNA            <1049451..>1051172
                     /locus_tag="TRUGW13939_10720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493830.1"
                     /db_xref="GeneID:55998199"
     CDS             1049451..1051172
                     /locus_tag="TRUGW13939_10720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349723.1"
                     /db_xref="GeneID:55998199"
                     /translation="MAYHHTRRYSSFYEYAENNYPDQEFDESYDYARYSTRDDRPQRR
                     GPEQKVAEKGKEEESESMSSWLQRQAGSHNVQLAAAAVLSGAAVAAGIFSFQSVKRRE
                     AVKNLKASIPGLDDRHHAEALNEYGVADTLQKLSPEDERSAALARRAQEGDYDDDLIL
                     EQLARNRVFLTHDGLQKLRSSFIIIVGCGGVGSHATSALTRSGVSKIRLIDFDQVTLS
                     SLNRHAVATLADVGTPKVQCIRRRLEQVVPWVQFDCRNELFGANVADKLLAPWSLNGP
                     NGQKPDYVIDCIDNIESKVELLHYCHKNSIPVISSMGAGCKSDPTRIGVADISASSED
                     PLSRSTRQRLRLLGVSTGIPVVFSTEKPGPGKASLLPLPEEEFAKGKVGELGVLPDFR
                     VRILPVLGTMPAVFGYTIANHVICDVTGYPIDYSLAGKGRDKLNDSVYAGLQAVINKL
                     VRVEGGTHLEGMRIPLSKDEIGYLLDEVWRGRSVVSGITNKLALIPWERPAQGFVIDP
                     QWAQEGQRLVALDVKKLVCMTKEEAARHERDVLRGGKKVEDLYDEKILQLVEARFKEA
                     EVYEQYR"
     gene            <1052431..>1053775
                     /locus_tag="TRUGW13939_10721"
                     /db_xref="GeneID:55998200"
     mRNA            join(<1052431..1052433,1052484..1052656,1053337..>1053775)
                     /locus_tag="TRUGW13939_10721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493831.1"
                     /db_xref="GeneID:55998200"
     CDS             join(1052431..1052433,1052484..1052656,1053337..1053775)
                     /locus_tag="TRUGW13939_10721"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349724.1"
                     /db_xref="GeneID:55998200"
                     /translation="MPIFPTPTPGSALTDFIDITNAQLFGQQLVTSQSPNTTLRLELQ
                     HLRDFASEILMQRMGSFLRFLDVAYTVIKTNTAYGYLQYNGTMSSKEKEAVCESFLKA
                     SKPTILLITSGAGGVGLNLQSASILIQTEVWWNKNTERQAYARIYRQGQSKQVKIFRL
                     RGLNSAIDKTILDCQKRKTYTNEKIMRLLVRRHDDPVVVPEFTP"
     gene            complement(<1055323..>1056461)
                     /locus_tag="TRUGW13939_10722"
                     /db_xref="GeneID:55998201"
     mRNA            complement(join(<1055323..1055641,1055869..1056326,
                     1056441..>1056461))
                     /locus_tag="TRUGW13939_10722"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493832.1"
                     /db_xref="GeneID:55998201"
     CDS             complement(join(1055323..1055641,1055869..1056326,
                     1056441..1056461))
                     /locus_tag="TRUGW13939_10722"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349725.1"
                     /db_xref="GeneID:55998201"
                     /translation="MLSSSKAGLSPDGRELLTDDVSECANDEQLRQLVRSIETGLLIP
                     LKAQGGKTPTDITPSPRPGVEDSIENLKTQNIEPITGGPQSQLRHHCLERDGYKCVAT
                     GRYSGDHAHPQNAPTTYLEAAHIIPFALGSFQPNDGEAMDRHAKIWVNLRRFFPVLRR
                     SRASQNHACIGNFLHMSGQAEIIDKVLKDFEDCGGLASDGSSNLEDLLAVSRLSLLHT
                     NVNEMPDSKKPTEKQRHMEKSRPMAQQGRQRAKRFDSENQPWGYDLI"
     gene            <1057493..>1058921
                     /locus_tag="TRUGW13939_10723"
                     /db_xref="GeneID:55998202"
     mRNA            join(<1057493..1058075,1058138..1058616,1058670..>1058921)
                     /locus_tag="TRUGW13939_10723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493833.1"
                     /db_xref="GeneID:55998202"
     CDS             join(1057493..1058075,1058138..1058616,1058670..1058921)
                     /locus_tag="TRUGW13939_10723"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349726.1"
                     /db_xref="GeneID:55998202"
                     /translation="MADEKRPSIIDTRHYPDNLAVSSSDNDERKTPQRDGRTAFFQSF
                     PRSLGQRPLIDYVKNTWGSSRSRPRANSASSSRSSSGKPLRFFLSMISAPKFRRYVLV
                     YIALVASFYIGWSSFLQPILEERAGLVRALDLETMKQVGGWFGTNTRPVFADIVPIRS
                     LDPVLVPASKEGDSGDVQQRRLVFVGDVHGCKDELERLLKEVSFDAEAGDHLVFTGDM
                     IHKGPDSVGVVELARGLKASCVRGNHEDRILLLRSQMKVDGTFSHPENDFNPNDASQR
                     KVARELSDEQASWLQDCPVILKVGQVGGIGDVLVVHGGVVPGVGLERQDLSSVMTMRT
                     IDLDTHVPSASKKDGVPWFKLYNKYQELLSQHIENSVDGLYGSLSGTTTVIYGHDAVK
                     SLNIQKYTKGLDSGCVYGRKLSALVVENGGKQEVVQVKCKKHAKS"
     gene            complement(<1060603..>1062599)
                     /locus_tag="TRUGW13939_10724"
                     /db_xref="GeneID:55998203"
     mRNA            complement(join(<1060603..1062100,1062154..>1062599))
                     /locus_tag="TRUGW13939_10724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493834.1"
                     /db_xref="GeneID:55998203"
     CDS             complement(join(1060603..1062100,1062154..1062599))
                     /locus_tag="TRUGW13939_10724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349727.1"
                     /db_xref="GeneID:55998203"
                     /translation="MKDLESGDRRSDRAVNETTDELARSDDSLDLPDDEVEHGLLGGR
                     SSRHADTGEHSFSSSRRLGCCASFLRGPEPPRKHRIEPFFKSFQTAPIRMVDRWLPTQ
                     KSKLIALAVFLALWASIFLTILDWSIVRPEVPGYGAPNRLSCGSRLWHNGTLCGINGD
                     ACRPFDTDGFAFRCPAGCLGELILEPYTVGDQEVNYKSLVIGGASETDPESSYRGDSF
                     ICGAALHAGVISNAVGGCSILRRTGEKNSFGSVKQNGISSFSFDSYFPLSYTFEKGTA
                     VCRDPRWPLFSLSVLFTAVISLCTTSPAAFYMSIWFISWFQVALVSDPPFSSDYLEVV
                     STAMGRFLPAAFVGWAIYRFSVRDTLTGLTAQWEKTILWLGPFWVGALNTDTFDKIPI
                     SRLTPHDIKQQPGAIPALIIIVGVIVTTVVTQAYVIWTEGKLPHYLVIYGVMAGSLVV
                     MIVIPQLNLRIHHYILSLLFLPGVAFQTRPCLIYQGLLVGFFVNGIARWGFDSILQTP
                     AALLGDAQIGSLLPTIAAPILQPDGNGVSFSFTNLPQDITGIAVLVNDVLRSHLYLDA
                     SSSSANGSSTDAIEERDGRDATTPDTLNVDWARLHQGLPEYFRFSYIKTSSLGGLWYE
                     DFTKAGVLKADGEWVDMPPGPSR"
     gene            complement(<1063177..>1063826)
                     /locus_tag="TRUGW13939_10725"
                     /db_xref="GeneID:55998204"
     mRNA            complement(join(<1063177..1063245,1063301..1063488,
                     1063540..1063702,1063764..>1063826))
                     /locus_tag="TRUGW13939_10725"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493835.1"
                     /db_xref="GeneID:55998204"
     CDS             complement(join(1063177..1063245,1063301..1063488,
                     1063540..1063702,1063764..1063826))
                     /locus_tag="TRUGW13939_10725"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349728.1"
                     /db_xref="GeneID:55998204"
                     /translation="MPVISRLFSVVLRIAELAFAAVVAGIIGHYLHLQANGDGDPWKG
                     REIYTEVIAALSLLLGLLWLIPTAHTFFIWPLDVVISLCWFAAFGLLVDAVDDSSCGS
                     VFDWGGLFHDNFCSRWKAAEAFSFLSAIIWLVSGVLGIYFVWRVDRSRSGYVYGRYNV
                     "
     gene            complement(<1064705..>1067828)
                     /locus_tag="TRUGW13939_10726"
                     /db_xref="GeneID:55998205"
     mRNA            complement(join(<1064705..1065375,1065447..1065676,
                     1066376..1066559,1066620..1067453,1067507..>1067828))
                     /locus_tag="TRUGW13939_10726"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493836.1"
                     /db_xref="GeneID:55998205"
     CDS             complement(join(1064705..1065375,1065447..1065676,
                     1066376..1066559,1066620..1067453,1067507..1067828))
                     /locus_tag="TRUGW13939_10726"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349729.1"
                     /db_xref="GeneID:55998205"
                     /translation="MAPARVDEPLLDNTPSPGSSSDKENRTLPVPRGGKRKSDQGMPS
                     HALPSESSVTKRRRLAEKNANATTQSQVQSSQRPTSDFYDPDQDVTERREIRKSLRNL
                     TRDLHDYRNEYLQAGNKGILSTIQKANDIFVRVKQTSDATVDSHLLVNAADLSYKKSA
                     QLATDGAVAGIDVDEFVSKCMSFMRQGPATEPSSIPSSTQRRTHRRPDGAQSDEDEGD
                     ALNWDWLGRAACFPHNARPSLSSFLLGPLSVQKRSRQFTQRRAANRIDRSQVVQPHDL
                     AEEDLDKQETSNLTAMCTSINELLRKTQKENQHAANEELSALTEEPTDEELQEAMDRH
                     NISDDGGLSLFRFCINPDSFGQSVENLFYVSFLIRDGIVGISFDSRGLPTLQAATPFA
                     PSEAQAKGVQRHQAVFSLDFDTWEDLVKVYDLENRKSIIPHRNEEEIQNNRPQGCPKN
                     PLPFPNATTEPNHPGKNNNWSQELEKVFAMASKLFTGDPTKVMVIRQVTPQITTLSVP
                     FSRFGLIKFGGRATFVKLATGNMLVVSPVALTPEVQETITSQGGNIKYIAAPDLEHHL
                     YLSAWKKAFPDADIIAPEGLHEKRQSNPEHKDTHFTHILTKANKHDIHISEEFDREFD
                     IEYVDGHGNKEIVFLHKPTKTMIQADLIFNLPAKEQYSHTNESPTSGIWTKIFSPLVS
                     ANPPPATWHKRFVWYITANDRKSVGESVARMNAWDFDRIIPCHGDVIETGGKAVFQNV
                     FEWFLK"
     gene            <1068275..>1071055
                     /locus_tag="TRUGW13939_10727"
                     /db_xref="GeneID:55998206"
     mRNA            join(<1068275..1068333,1068391..>1071055)
                     /locus_tag="TRUGW13939_10727"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493837.1"
                     /db_xref="GeneID:55998206"
     CDS             join(1068275..1068333,1068391..1071055)
                     /locus_tag="TRUGW13939_10727"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349730.1"
                     /db_xref="GeneID:55998206"
                     /translation="MEAFTFATSTQVNFPVHVKIGALEGKQKQLPYSTLLKNPELRHL
                     ASNQSSVSDLFITVQLWSDSKPLGVPLQTSYKSFKASRTWNEWLQMPVSVKDAPLQSQ
                     LAITIWDLSPLGGNASYGHDVPFGGTTISLFDADGKLRMGRQKCKIYKNKAADGFSST
                     TTPAMPPAKRRKINDSIPLDQSAEELELERIEGLIKKHEMGELHRIDWLDQLVFRQLE
                     KIKIGAEEAGRKRAARLQAIKGTGGQRHEGDGEGDSEDADFDDENFVLYIDFPRFDHP
                     IIWADHDYPAPPVSSYSPHTQTNQHVPHKPPPEVQLGPGIEDTHDAGNNRVVRVYDPE
                     AGQTGNPCEDKHRRLVRSHRTGTMDRDLKPNPKNRDELNVIMSYGPAHELTAEEKDLI
                     WRFRYYLTRDKNALTKFVKSVNWRDAGEIRQAKEILPKWTEIDVDDALELLGPTFDNG
                     DVRAYAVDRLRKAGDDELLLYLLQLVQALKFEKTPEDSIEEVAHDSSLANFLIARAAN
                     NFMLGNYLHWYLMVECDETGIANIETHRRLFARVEFYFMTELERVHPEHRKTLLRQGE
                     LITVLTRVAKEIRFSRENRAVKIEKLKKYLKDPKNEIVNIDPPLPLPLDPSVTITGCY
                     PEDSNVFKSSLSPLLLNFKTSDGRKYPVHFKVGDDLRQDQLVIQIITLMDRLLQKENL
                     DLRLTPYRILATGSTAGAAQFIPSTSLSAASAKYKGSILAYLRANNPDESEPLGVRRE
                     TMDTYIRSCAGYCVVTYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAPMMK
                     LCKEMVEGMGGADSQHYLQFKQHCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEPD
                     KAVLKVKERFHLELTEEEAIRHFEQLINDSVNAIFGVVIDRLHDFVQGWRT"
     gene            complement(<1071394..>1073414)
                     /locus_tag="TRUGW13939_10728"
                     /db_xref="GeneID:55998207"
     mRNA            complement(join(<1071394..1071817,1071874..1072805,
                     1072857..>1073414))
                     /locus_tag="TRUGW13939_10728"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493838.1"
                     /db_xref="GeneID:55998207"
     CDS             complement(join(1071394..1071817,1071874..1072805,
                     1072857..1073414))
                     /locus_tag="TRUGW13939_10728"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349731.1"
                     /db_xref="GeneID:55998207"
                     /translation="MESRRSKTTLISAFRPRSTRETSSLRHRLERTPRRRQTDQPDAS
                     DHENDLDAHSIITPSKHTPRTWRILKGSVATGGPLRPFRLLKQDILNLRRRYISDWAF
                     FNQQILASAIFVFFTNLLPGITFASDLFVLTGANWGTIEVVLSTGLCGIIFSLTSIQP
                     LTILGVTGPFSVLGETIYSLTQDSFKIPFLPFMAWSLIHAGWLHYLLAIFNAHDWTMR
                     YVTTFSTEIFSLLNSVIYFHKAIQELQRAHDSLSFAAFLYAIIGAIGTMLLAIFLSTA
                     ESWRPLFHRYVRLGLSEYAAAISIIIFIGIPHIGELAQLDKMTLNVSNSFRPTSPDRT
                     IFFVEFWKLPVSWIFAAIVPGIIITVLFFFDHEVSSIICTIDRYGTRKPGGFAWDIVL
                     LGTTTAMCGILGIPPANGLLPQAPLHSESLMHTEKEQYTVTVDGEEINRTREIRGVYE
                     QRWSTFLHAGGIMLFVSPPFMKVLGLTPTSVLAGLFLFMGEQSLSVNPILYRLFYLLT
                     PPSELPLLPAALYNKGSKSERPSYIPIHLYTILQIILTAVIFVLTLTKAAPAFPVLII
                     ALVPFRLFVMKRWWNREVLRFVDAWACREGTPEDEEDQKAQRETADQIDEAIFTADVY
                     PMERLSNATDLQP"
     gene            <1073857..>1074953
                     /locus_tag="TRUGW13939_10729"
                     /db_xref="GeneID:55998208"
     mRNA            join(<1073857..1074117,1074168..>1074953)
                     /locus_tag="TRUGW13939_10729"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493839.1"
                     /db_xref="GeneID:55998208"
     CDS             join(1073857..1074117,1074168..1074953)
                     /locus_tag="TRUGW13939_10729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349732.1"
                     /db_xref="GeneID:55998208"
                     /translation="MAAKFIPRTVFPFSESIPRSYFLGHHKAGLEKMKQKVDSVNYVI
                     ECRDIRIPVTSINPLFEEALGAKKRLIVYTKRDLLDTDSVFRKNKERMRKLDEKTPVF
                     YTTSTFATSAKPILEQLKSDAQRLQEFGSCQVMVVGMPNVGKSTLINCLRNTGVFKPK
                     AAYTGAEPGITRKVGTPIKILDDPNQSAVYVLDTPGVFVPYMPDGERMLRLALCGCVK
                     DTIISPVTIADYLLYHINLNTPAVYERWSKPTNDISHFLDQFAHQTGILGKGGIPNTD
                     QAALNFVHKWRAGEMGSFLLDDLQLELSERKRARHLEKPSFGGKGKWEAKIEADKIAG
                     RSRKERKREERKQT"
     gene            complement(<1075144..>1076153)
                     /locus_tag="TRUGW13939_10730"
                     /db_xref="GeneID:55998209"
     mRNA            complement(join(<1075144..1075896,1075968..>1076153))
                     /locus_tag="TRUGW13939_10730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493840.1"
                     /db_xref="GeneID:55998209"
     CDS             complement(join(1075144..1075896,1075968..1076153))
                     /locus_tag="TRUGW13939_10730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349733.1"
                     /db_xref="GeneID:55998209"
                     /translation="MLGQVNPSQRGLARKESTSVCVLSELKFTELAPPHDFVALVHAF
                     GFDTQYKLGLIFVPSVNMARNSEKAQSMLFRFRAAQAADLGILDIGRTRRPKAITQID
                     SIPTAEKWRGQVLKEISRKVSRIQDPSLSDYQIRDLNDEINKLFKEKWMWEMQIRNLG
                     GPNYMRGGGRVYDDEGREIPGGGKGYKYFGRARELPGVKEMFDAATRKARPEEADETG
                     SGKKAAEMLRKHVDAAYFGYGRDEEDGILLSYEQKREKEAVEGMVKRGEDDNEDGWEP
                     LPGDAGDGVEWRLPTLEEVQEELVERRRRRLLDKIS"
     gene            complement(<1076548..>1083971)
                     /locus_tag="TRUGW13939_10731"
                     /db_xref="GeneID:55998210"
     mRNA            complement(join(<1076548..1076994,1077048..1083036,
                     1083087..1083271,1083325..1083468,1083525..>1083971))
                     /locus_tag="TRUGW13939_10731"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493841.1"
                     /db_xref="GeneID:55998210"
     CDS             complement(join(1076548..1076994,1077048..1083036,
                     1083087..1083271,1083325..1083468,1083525..1083971))
                     /locus_tag="TRUGW13939_10731"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349734.1"
                     /db_xref="GeneID:55998210"
                     /translation="MQPSSLNNSPRRTNPFGRHSPSPSPSPQVPPSRPKSAVFPTSFT
                     DSDRKPHARNSSLSQFSAVALGSNTRDRSSSLRQSVHASGTFAPQFIKSEELAKGIDS
                     IHELEGNNDFSGKRYVWLKDAEKAFVRGEVVEERDNGELLVRCEDGSQREVNSDHVDK
                     VNPAKFDKADDMAELTHLNEASVVHNLHLRYQSDLIYTYSGLFLVTVNPYCPLPIYTN
                     EYVRMYKGQNREDTRPHIFAMADQAFRNLVEEGENQSILVTGESGAGKTENTKKVIQY
                     LAAVATSEATASRSTGKQFSNLSQQILRANPILEAFGNAQTVRNNNSSRFGKFIRIEF
                     TRSGQISGAYIDWYLLEKSRVVKPNARERNYHVFYQLLQGAERKVRENLLLSDLQIVD
                     FAYTRDGNDSIAGVSDTEEWNALMEAFQVMNFSDNDRMCILRTVAAVLHLGNITVVKE
                     SIRADQAALTPEAYKSLDKACRLLGVDMELFTKGLLHPRVKAGREWVEKVQTPEQVRL
                     ALDALAKGIYERSFGDLVNRINNQLDSSSVTTDDTFFIGVLDIAGFEIFEKNSFEQLC
                     INYTNEKLQQFFNHHMFVLEQEEYAREQIEWQFIDFGKDLQPTIDLIEVTNPIGIFSC
                     LDEDCVMPKATDKSFTEKLHSLWDRNSPKYRSSRLSQGFVLTHYAAEVEYTTDDWLEK
                     NKDPLNDNVTRLLSASSDKHVANLFSDYVDADDAQGFSRSRVKKGLFRTVAQRHKDQL
                     SSLMNQLHSTHPHFVRCILPNHKKRPKLFNAPLVLDQLRCNGVLEGIRIARTGFPNRL
                     LFSEFRQRYEVLCRDMPKGYLEGQNAAQMILTKLGMDKTWYRVGLTKVFFRAGVLAEL
                     EEKRDALIREIMTRFQSVARGFVQRRIANKRLYRAEATRIIQKNLHVYLDLQANPWWK
                     LFTKMKPLLGATRTAAEVKRRDEKIQNLEVKMQHDLADRHKLEEDKRRADLEVNRIKQ
                     TLESERALALDKEDIFKRLQVREVELSEKLAGAITDQEKLEDQLDELIDAKRKAEEQL
                     DSRKVQLEQAGQIIARLEAEKQELQERLSALESQTRELENTHSTKDSRLQNLTQEIKM
                     LQSQVGLKDRKLQDLETKLLKSDQDLDVKLAKTTKELDSSRKQVKDLFDENKAIRQEI
                     SELSTTSTGYEEMLRRKEGELSVLRNDTKRHEEDKKALEAEKTTLSSRFNDMQTRIRE
                     LQAQADAMKFEKLTLEREAADVKKMLEAKMNEDAEAGHSRRLLDQQVQDLKAQLFQLQ
                     TDLSRERQSRDDVQMLGEHKLTELKGKYESLNEAKIIIEKEMYIQQDTLRRATESRTV
                     AEQARKELQAELIKLRERFANAEKARIDAESSMERSIINQANERQAIMRKDLDATSAR
                     LQEADAEKSRLSVQVQELTQMLADSETFRERHDQTKERMERELVTVKGRLTASENDNR
                     ALLNKIQQKNLDIARSNSKASDNQRTRILQLQNEKTKLEEEFKNIQRQLGDAQVTITS
                     VEKQKEKLALTVEDLNHEVAREHKASRNAEKTSSTATIQLSEANRNLETERQLRNQAQ
                     ANTRQLQTALDQSHKEIEDCHRQLILLHKVFDPETTEAPKSWEAVQPDLSKKVDLAQL
                     LEMAHNELRVSEEKHSRVESQLAEMRRRHEDEMKEMDARYSSSKRALLEEIDNNQVTS
                     TRSPTHLRKNSENVKRYSNPSTPNRRFNFNEAAQDSGRSDRTVDTTTFQKRMDMEAEL
                     EELQNKLQMTEMQNRYLQNQLGNATPVRDMWQDESPSIRRVQLLERENGRLHDKLDDS
                     AKKVSALERMVQSGDLSLRDVQAKSHEELFDLLTSQEQSRRSLLGVHKNAMAELTDAK
                     SQFEKLKRNKTSLEVELRDARSDLQDSESAREQDAASRNQLLQEFSDLQIRLDSEESK
                     VIDLTSSLNLYKSRADEYFSKLEQAEITVLKAARAEQFAKSQAKEAEETFATVMAERQ
                     HMDSLVEDLQRQVQSYEEKVEDLSADLDGALQGKRRLQNELEDYRNQRASDIEDKEAS
                     LEQTRKKYQREFTTLTNEIEIERENVLHVRDENSRLREELEDLRSKWDNEVLNSSTWA
                     KEKSRLEMTLQDVSTSRDQAANAHNEAQSKVVSLLSQVRNLRTSVDDVSAERDILIKD
                     KKTLESRLQEAADRLEDLANGDSPSMRNAAGMDREILELKSKMAQHEDVSVAAVGKMR
                     RAEALNTEIQKELAAERESNAHLFKDKAALEKQLKEVQLRCMDLETKGYSSASQDIKF
                     LHKRVKELENQLEDQESKYNAEQRSVRNVDRTVKDLQSQIDRRDKMNAQLSDDINKSR
                     DKVERLLQTIEELQSSDSQSQLQAKRAERELREERERALRMERELEGWKQLRIERGSV
                     VGRTNALSEVESRRGSGVYVANGAVEIPQRKFSNTKGFL"
     gene            <1084747..>1088521
                     /locus_tag="TRUGW13939_10732"
                     /db_xref="GeneID:55998211"
     mRNA            join(<1084747..1085380,1085432..1087177,1087257..1087885,
                     1087933..1088173,1088322..>1088521)
                     /locus_tag="TRUGW13939_10732"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493842.1"
                     /db_xref="GeneID:55998211"
     CDS             join(1084747..1085380,1085432..1087177,1087257..1087885,
                     1087933..1088173,1088322..1088521)
                     /locus_tag="TRUGW13939_10732"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349735.1"
                     /db_xref="GeneID:55998211"
                     /translation="MSQYPLGSANYAPQWPANPPQSSSDRSSSTYYSMNTTLAAGNFA
                     TMPFNPNPPTQLPGLGMANGPAPPPYFPQTFPDSQMAVHFGGQLNGAGAYPLDNSLST
                     PPFGFSQPLKAIQPLSSHPAPRSHEKSHLPTQNDTDREEGEVSDFSGNDTASQQAGSS
                     VRSKLLSRSRANEPFPPHSTGPLSIPRNHNYEPISISSSDNSQSHEEGSESPYNPPMT
                     ITALPDASEERTHTSSETCLQDGPSTNRLITTSPIVGKTVSQIRVMAQGALLGLAPHN
                     IRFNELAKENIDPDILRQLYNEIGIKITNSVSDVKSLNKSGNVAPVVAPKEPTKYTRG
                     QAITTPEAQQDSIRRNTPPQKEKGSSVASTSKPLERKELIARMLAAKANKAPANTRPK
                     SPESRPESASGIQQGTVLPKDPIVPPKISQATQPKEKNKAQTELARQRIEQLKKMGLK
                     RQQSQSESVSTPRALSTDSTQQAATLSHPLPERPPIPDQPTIFTEMQTPQIPGLQKHA
                     SAESHPSPIPPGIGNTEIDTATPRKNTVKRPRASDFDEIIPKSKKPSVAQDRLVIDIS
                     DDESMEDEDDALMPDVNDDTPSSQMSNFPRSSGPSYQRSSASATPQNRLQDAESLRQK
                     HIQIQAMRRRIAEFERKKMAKKSHPMESTVSTPGSFKVTSEQDDATQSQAEEEPLAPI
                     AATLARSKSATGSIDSSAQSAAYTDTSNLDRIRQKLLRKQEIESGLPTLEDEIQRVET
                     KLAEFRRLEEELLAEISKGREGRKQLVDELQSLVLETQEIEALQETQHAPATEVTSKP
                     QDDGSLDNTTSSQDSSLNSMKMEISHPAQSTKHRTLSVNPISLEEASDDNDMVESKSS
                     SSEASGSSMSESSGDSDRDSTEVGPELEHHVPQSQPSNGFPPAQEAPVDDSSAAERPV
                     LQNSTSVAKPSEEASGLQELTKVLDNDEPLEVEDSADEAYSPKLDAGGDEEEMDINSV
                     VSGSSHGDADMKLTPKFQEQVVIASKNDALDNAPHRGNTTLKFSPYESPLKYFRAYRY
                     HPNFDKEVGDGYRSLTYSHKINPSQAMCPYESAGGVCNDNTCEFQHWRDMVMPDDKIL
                     VEMGNQREGESPEEKERFLEGLKEMINTMQRDQVKDFSTVASEIAAYRRRFLSDPSRI
                     LPL"
     gene            complement(<1096221..>1096517)
                     /locus_tag="TRUGW13939_10733"
                     /db_xref="GeneID:55998212"
     mRNA            complement(join(<1096221..1096423,1096490..>1096517))
                     /locus_tag="TRUGW13939_10733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493843.1"
                     /db_xref="GeneID:55998212"
     CDS             complement(join(1096221..1096423,1096490..1096517))
                     /locus_tag="TRUGW13939_10733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349736.1"
                     /db_xref="GeneID:55998212"
                     /translation="MGFLDRLQSRLEVYRLEQRYTRRRQRATLFNDAQYVDGEYVYTS
                     PSPTSPAGSMSKNSTGSNWRPSAWGRSTSDSR"
     gene            complement(<1097914..>1100429)
                     /locus_tag="TRUGW13939_10734"
                     /db_xref="GeneID:55998213"
     mRNA            complement(join(<1097914..1098029,1098097..1098313,
                     1098373..1099419,1099475..1099743,1099796..1099910,
                     1099970..1100029,1100076..>1100429))
                     /locus_tag="TRUGW13939_10734"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493844.1"
                     /db_xref="GeneID:55998213"
     CDS             complement(join(1097914..1098029,1098097..1098313,
                     1098373..1099419,1099475..1099743,1099796..1099910,
                     1099970..1100029,1100076..1100429))
                     /locus_tag="TRUGW13939_10734"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349737.1"
                     /db_xref="GeneID:55998213"
                     /translation="MMLQAARSPCAHLPHLRANFHLRSQQTFVLNRSRICAFTTGSRL
                     WREQKPAQPSQLPQSPAELAPQPGSTRHATKKPAAANQPEKKGGFLSEATVTNKEQRN
                     ADWAIMKEMAKYLWPKDDWGTKLRVGSALTLLIGAKILNVEVPFYFKNIVDSMNIDFA
                     AVGGTAYTVAGAMIIAYGATRIGATVFQELRNAVFASVAQKAIRKVAGNVFNHLLRLD
                     LNFHLTRQTGGLTRAIDRGTKGISFLLTSMVFHVFPTALEISMVCGILTYQYGFQFAA
                     ITVGTMVAYTAFTITTTAWRTKFRKQANAADNKGATVAVDSLINYEAVKYFNNEAYEG
                     ARYDRALKAYENASIKVTTSLAFLNSGQNMIFSSALAAMMYLAADGVATGQLTVGDLV
                     MVNQLVFQLSVPLNFLGSVYRELRQSLLDMETLFNLQKVNVTVKEQPDAKVLDLSRGG
                     EIRFENVTFGYHPDRPILKNASFTVPAGAKFAVVGPSGCGKSTILRLLFRFYDVQEGR
                     ILIDGQDVRDVTLESLRQSIGVVPQDTTLFNDTIEHNIRYGKIDSTSEEVQKAAERAH
                     VHELIQRLPDGYNTAVGERGMMISGGEKQRLAVSRLILKDPPLLFFDEATSALDTYTE
                     QALLQNINSIIKEKARTSVFVAHRLRTIYDSDQILVLKDGHVVESGTHTELLEQKGVY
                     ANLWHAQEVSLAQDVDLERQLETGPESEVPEASAPTDLSKPAK"
     gene            <1100920..>1102478
                     /locus_tag="TRUGW13939_10735"
                     /db_xref="GeneID:55998214"
     mRNA            join(<1100920..1101112,1101169..1101287,1101344..1101415,
                     1101464..1101634,1101694..1101812,1101863..1102079,
                     1102134..>1102478)
                     /locus_tag="TRUGW13939_10735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493845.1"
                     /db_xref="GeneID:55998214"
     CDS             join(1100920..1101112,1101169..1101287,1101344..1101415,
                     1101464..1101634,1101694..1101812,1101863..1102079,
                     1102134..1102478)
                     /locus_tag="TRUGW13939_10735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349738.1"
                     /db_xref="GeneID:55998214"
                     /translation="MSLTLHKGATALSRANGCSLFRCQPILRHGVRSIQVKAAPRGQS
                     TTVNGVDLPISSTPDSAASADAKFNVVGTPYSLLSVSLSASQNLYTRRGTLVGLSGKP
                     DNVISTLSVLEPFRRAVVGIPFLYQKISSPTPVQALVSVQSPATSFSVVHLDGTVDWM
                     VAQRRALLAWTGHSLSIRPRINTNLSVVHWGSSQVTGRGLLALVGRGQVYSIELKAGE
                     QYIAHPSNVLAYTISTTPPQPYRFKSTSLRFQIPGMQVPEFLLKSRYLRDLTASDTWK
                     TSMRILHNVRTWARRTIWGDRLFLQFDGPATLLVQTRATRVRDILSDREVNEIADTPA
                     GTTLNAANKLEDSASAAQKSDYQKAAEEAVSQAPVPSRTVDELTQEIKGVSQSIATVQ
                     GGKVQFEKPGAKSEPTKSQ"
     gene            complement(<1102970..>1105043)
                     /locus_tag="TRUGW13939_10736"
                     /db_xref="GeneID:55998215"
     mRNA            complement(join(<1102970..1104020,1104073..>1105043))
                     /locus_tag="TRUGW13939_10736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493846.1"
                     /db_xref="GeneID:55998215"
     CDS             complement(join(1102970..1104020,1104073..1105043))
                     /locus_tag="TRUGW13939_10736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349739.1"
                     /db_xref="GeneID:55998215"
                     /translation="MARLNASNPVGQYGRRPNMTKSPSSLFSKTAHSPLRPKPKTKTT
                     TANLDFKIFEDAQSADDEAEESHAGSQTTTPAVPLKLAHANSITSGLSKCASQDSSSS
                     ASNRSRRSSSDEDESSDKENLFIEDEAEEASEEEEEPEEERNIEGYTEREEFDSPQPS
                     LVDRQIPRYMRYREPEAEADSDTQSERSADDEEGYSSLDGFIVSDNDISYQNSDSDLP
                     DDNEGEEEEEEVKPPSPKPLRRRLLRGRKPRESGINLEELSISEEGPTENSPKASPSH
                     TPSEDKHSPQVTSSFTRLLPDSHGEKETARPKNEQVKRSPLRESINSLPSISDSPTKK
                     RLDRRMETPPPSPSKVALPSPSKTNYRIPPSPHRQSSDAFWSQDTTNSWNDQWSPPKK
                     NTKGRALERLLAELEIGLEEDSSINSTRSSTTGIRSKESTPEMTVKTPSKTAIKKAEV
                     AQRKEVAARKKAFDDRKTALAQDFLTTLDEIVSGGQVKNLAGQTGGIKVIWSKTLRNT
                     AGRANWKREKINQPDRQAQYVHHASIELAERIIDDEDRLLNTLAHEYCHLANFMISGV
                     RNQPHGASFKAWGSKCTDAVRQHPEYKNYPVEVTTKHSYKIDYKYVWICVDCGNEYGR
                     HSRSIDPTKARCSLCKGGLQQIKPKPRNVSPKKNNVNAATQSVDKISLD"
     gene            <1109308..>1115258
                     /locus_tag="TRUGW13939_10737"
                     /db_xref="GeneID:55998216"
     mRNA            join(<1109308..1109492,1109548..1114833,1114892..>1115258)
                     /locus_tag="TRUGW13939_10737"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493847.1"
                     /db_xref="GeneID:55998216"
     CDS             join(1109308..1109492,1109548..1114833,1114892..1115258)
                     /locus_tag="TRUGW13939_10737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349740.1"
                     /db_xref="GeneID:55998216"
                     /translation="MSGYNQGQGHYDEGYSHQGHQPHGDAAHGDAAHGDGYYQDEHGS
                     YYDQNDYSHYGDGYYDQSGYYGEHQGGGGYYEGGGGGHDNYYNDQYYDQGHGGQGDYA
                     QGGRGRRRNGESEEDSETFSDFTMRSETARAADMDYYGRGDERYNSYNDSQMGGNGYG
                     YRPPSSQISYGGNRSSGASTPVYGMEYGNALPAGQRSREPYPAWASDAQIPLSKEEIE
                     DIFLDLVNKFGFQRDSMRNMFDHLMTLLDSRASRMTPNQALLSLHADYIGGDNANYRR
                     WYFAAHLDLDDAVGFANMTLGKGNRRTRKARKAAKKAAQQNPENEEATLDAMEGDNSL
                     EAAEYRWKSRMNRMSQHERVRQIALYLLCWGEANQVRFTPECLCFIFKCADDYLNSPE
                     CQNRVEPIEEGSYLNNVITPIYQYLRDQGYEILEGKYVRRERDHNKIIGYDDINQLFW
                     YPEGIERIILEDKTRLVDIPAAERWDKLKDVNWKKVFFKTYKETRSWFHMVTNFNRIW
                     VIHLGAFWFFTAYNSKALYTKDYQQQKDTQPPGSYVWSAVALGGGISSLIQIFATCAE
                     WAYVPRKWAGAQHLTKRLLFLLAVFAVNVGPSVYVFGVSKNGRDTIAYVLGIVQFFIA
                     LATFFFFSIMPLGGLFGSYMKKNTRQYVASQTFTASFPKLTGNGMWMSYGLWVCVFAA
                     KLVESYFFLTLSFKDPIRILSPMKIRHCLGDTYIPESLCKAQPQILLGLMFFTDLTLF
                     FLDSYLWYIILNTVFSVARSFYLGVSIWSPWRNIFSRLPKRIYSKVLATTDMEIKYKP
                     KVLISQVWNAIVISMYREHLLAIDHVQKLLYHQVPSEQEGKRTLRAPTFFVSQEDHSF
                     KTEFFPAQSEAERRISFFAQSLSTPIPEPLPVDNMPTFTVLIPHYSEKILLSLREIIR
                     EDEPYSRVTMLEYLKQLHPHEWDCFVKDTKILADETSQFNGEYDKNEKDAAKSKIDDL
                     PFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTISGFMNYSRAIKLLYRVENPEVVQMF
                     GGNSDKLERELERMARRKFKICVSMQRYAKFNKEERENTEFLLRAYPDLQIAYLDEEI
                     PETEGEEPKLYSALIDGHSELLENGMRKPKFRVQLSGNPILGDGKSDNQNHSIIFYRG
                     EYIQLIDANQDNYLEECLKIRSVLAEFEEMTTDNVSPYTPGLPTANSNPVAILGAREY
                     IFSENIGILGDVAAGKEQTFGTLFARTLAEIGGKLHYGHPDFLNGIFMTTRGGVSKAQ
                     KGLHLNEDIYAGMNAILRGGRIKHCEYFQCGKGRDLGFGSILNFTTKIGTGMGEQMLS
                     REYYYLGTQLPLDRFLSFYYAHPGFHINNMFIMLSVQMFMITMINLGALRHETILCHY
                     NSDVPITDPLLPTGCSNLVPITNWVNRCIVSIFIVFFISFVPLVVQELTERGFWRAAT
                     RLAKQFGSLSFMFEVFVCQIYANSIQQDLSYGGARYIATGRGFATARIPFGLLYSRFA
                     GPSIYLGARSLLMLLFATSTMWTAALIWFWVSLLALCISPFLFNPHQFAWHDFFIDYR
                     DYLRWLSRGNSRSHSFSWIGFCRLSRTRITGYKRKVLGSPSEKLSGDVPRARITNIFF
                     TEVLGPLVLVAVTLVPYLYINARTGVKPDSNNKHTSSLLRVGIVALAPIAVNAGVAGA
                     MFGMACCMGPLLSMCCKKFGAVLAAIAHGVAVVILLVVFEVMFFLEEFNFPRCVLGMI
                     AMAAIQRFVYKLIISLALTREMKHDQSNIAWWTGKWYNMGWHSMSQPGREFLCKITEL
                     GYFAADFVLGHVLLFLMLPALSIPYVDKFHSVILFWLRPSRQIRPPIYSLKQSKLRKR
                     RVIRYAIMYFFLLVIFVLLVAGPLIARSHIDMSSFEKKLSSNSLLSGLMQPLDNNGAN
                     NDTWTGKTGNNLPGDNTGAASIPVNELWTQSTSTSTAGAKMMFVL"
     gene            <1115833..>1117528
                     /locus_tag="TRUGW13939_10738"
                     /db_xref="GeneID:55998217"
     mRNA            join(<1115833..1116164,1116228..1116738,1116798..1117289,
                     1117346..>1117528)
                     /locus_tag="TRUGW13939_10738"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493848.1"
                     /db_xref="GeneID:55998217"
     CDS             join(1115833..1116164,1116228..1116738,1116798..1117289,
                     1117346..1117528)
                     /locus_tag="TRUGW13939_10738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349741.1"
                     /db_xref="GeneID:55998217"
                     /translation="MMEVYETQQVLADSLEALSSLFHRVPGSAIFLRYVKSSYQNDPV
                     RSAVELFLFLFAVRYLLAPKYSTKPGIVKLSEEEIDDLVDDWTPEPLVASPTALERNE
                     VEKRTVIVGPTGPKVKLSNGRTVTNLASYNFYNFTSNETLKEKAIQTLRTYGVGPCGP
                     PGFYGTQDVHMKTEADVAAFLGTAACIIYAQAFSTVSSVIPAFSKRGDIIVADKGVSY
                     AIRKGIQISRSTVRWYEHNDMEDLERVLEKVTREQARKPLTRRFIITEGLFESYGDMI
                     DLPRVVELKFKYKFRLLLDETWSFGVLGRNGRGVTEHQNVDPTEIDMIVGSLAGPVIA
                     GGGFCAGSEEIVHHQRISASAYTFSAALPALLSTTASETITMMQSNSDLFVQLRSNIK
                     TMWSQIDPRSDWVYCTSAPENPIMILAIKPEVVSSRRLSVEDQQSLLQDVVDETLANG
                     VLITRLKSLPDNVEPKQHVLPALKVCLTTGLSKREVEKAGTIIRHAITKVLSKKR"
     gene            <1119035..>1120418
                     /locus_tag="TRUGW13939_10739"
                     /db_xref="GeneID:55998218"
     mRNA            join(<1119035..1119101,1119164..1119312,1119366..>1120418)
                     /locus_tag="TRUGW13939_10739"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493849.1"
                     /db_xref="GeneID:55998218"
     CDS             join(1119035..1119101,1119164..1119312,1119366..1120418)
                     /locus_tag="TRUGW13939_10739"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349742.1"
                     /db_xref="GeneID:55998218"
                     /translation="MKYSGLGLGVIALLHSVHGHVHYNANHLSQRASETVSCPKEKIT
                     NTVIVHINQSGRTLSIETQSARPPVTSVNSQNASPSPPQARVIVQSGTTLPTPTAEVI
                     SPGPEQQQNLPVPGFTPPIDTHGINGIDDDDDVNNINDSSDTNSFDILFPSHGKNVQR
                     NKYGISYSPYNAGGGCKGQKEVDHDIKSLRQYSLLRIYGVDCNQARTVTKAARENNMK
                     VFAGVFNIANLDQDLQEIIDVADGDWSLFHTISVGNELVNRAQNSAAEVAGSVNAARN
                     KLRQAGYQGPVVTVDTFNQIIEHPELCEASDYCAANCHAFFDSTQTPENAGSYVHDQA
                     RQVSEAAGGKKVIITESGWPYAGTPNGNAIPSRPNQEAALRSLQKSFPDGGLILFSAF
                     DDKWKSDDAGTFNTEKFWGITELGDTINFR"
     gene            complement(<1120663..>1122492)
                     /locus_tag="TRUGW13939_10740"
                     /db_xref="GeneID:55998219"
     mRNA            complement(join(<1120663..1121774,1121813..1121831,
                     1121902..1121988,1122039..1122139,1122198..>1122492))
                     /locus_tag="TRUGW13939_10740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493850.1"
                     /db_xref="GeneID:55998219"
     CDS             complement(join(1120663..1121774,1121813..1121831,
                     1121902..1121988,1122039..1122139,1122198..1122492))
                     /locus_tag="TRUGW13939_10740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349743.1"
                     /db_xref="GeneID:55998219"
                     /translation="MRIWIELNCHLADGILSVYTNQEDDSDTLHFMAAFLLFDGRHSD
                     TTFQLMNEEGCFSRLLELVRSQSPDIDDGAGLHRLLMDLLYEMSRIQRVKIEDLVLVE
                     DEFVKYLFEIIEGLSNDANDPYHYHVIRVLLVLNEQFMVSAHDPVSGASSSPPTNKVI
                     KAGNASMRETSLQLLTLKLLYLIFTTPSTYEYFYTNDLRVLVDILIRNLLDLPEDSVA
                     LRHTYLRVFYPLLAHTQLQHPPHYKKDEIRRTLGLLVHSQFDGEEDDYERILHFAEAD
                     ETTKRLVARCSQVEWLRDPKPVSTSETLPAEEEEGASDGTGISIVGIKESDEDNTVLA
                     ASPDSATLSPTLMNSRSPTTPSSFSRHQAERLGMHLEPASASTLSVMEVAAQNEKPGV
                     MTPSRKDTRSSDQSFEAILSVRTKQKPEPPRARRTRGQQAREEDEGGGEKLAVESEQK
                     PATSIDRQNSGENSLASSVSTMARSTSRPAPALPPPRRSAHPMPAAATVDGSSVKPGV
                     KPEPPKTRRWRHGQKPSTEQSMGEEVENA"
     gene            complement(<1123378..>1126195)
                     /locus_tag="TRUGW13939_10741"
                     /db_xref="GeneID:55998220"
     mRNA            complement(join(<1123378..1123417,1123478..1125085,
                     1125144..>1126195))
                     /locus_tag="TRUGW13939_10741"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493851.1"
                     /db_xref="GeneID:55998220"
     CDS             complement(join(1123378..1123417,1123478..1125085,
                     1125144..1126195))
                     /locus_tag="TRUGW13939_10741"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349744.1"
                     /db_xref="GeneID:55998220"
                     /translation="MLRTRRYRVFLIFSVILGLAFLQFVRSREWSSTETASNSIPALK
                     IPPPSQNGDSSSSHGFSPSNNNYNNPGNDRINDRIHAEKPVDSPPKPPVNKQQPTNVE
                     TDSIEAEIKPYKAPEKPSLGLGAADRLDTGIPKKQVSIIEEDERFGASGQSRLEVNLP
                     SNDLSKPHWKRLPEHFPVAAADLIRLPSGSSKTLPKLQAAVKDESSAESLKRTQRLSA
                     IKAEFVHAWKGYTKEALGHDEVRPVSGGFRDPFAGWGATLVDTLDTLWIMELEEEFAA
                     AVEEVKKIDFTTSFRKDIPLFETVIRYLGGLLGAYDISGGKYKVLLDKAVELAEILIG
                     SFDTPNRMPVTYYHWAPDYVSQPHRADTRVVMAELGSLSVEFTRLAQLTKEDKYYDAI
                     ARVTNALEAAQDDTRIPGLWPLLLDASGCKKASNVVSRPSFPNLAKKEAPNLPKPTPG
                     VVGTIKNMNKRSLGLAANAEPANYDTETGQATTSNPFPKKECVQQGLASPPGATADEF
                     GLGGQADSTYEYLPKEYMLLGGLNDQYRTLYESSMQAVRETLLFRPMIEEPRDIRFLA
                     KVTVSDDASNPQKQSLNYKYEGTHLTCFAGGMFAVGAKLFGLKGDMDIAAKLTDGCVW
                     AYESTTTGIMPEGFEILSCDDPLSCPWNETKYLDIMDPNEKDRINKAENWYQLQLKDA
                     KEAFEKSRQDKLSVANSVATQDTNTPEVYPSKNVNKNVKRAGLTDTSTGDDEHAYVTA
                     TEAITDRTELGKPASNVEDSGFQAPPKPTVISHKDYVDRRVKEERIPKGLTKIPSRKY
                     ILRPEAIESVFIMFRLTGDDYWREKGWKMFEAIVQHCRTDIAASAITDVTSSAPVFSN
                     EMESFWLAETLKYFYLLFSDPSVVSLDDYVLNTEAHPLKRPIS"
     gene            complement(<1127086..>1129966)
                     /locus_tag="TRUGW13939_10742"
                     /db_xref="GeneID:55998221"
     mRNA            complement(join(<1127086..1129213,1129275..>1129966))
                     /locus_tag="TRUGW13939_10742"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493852.1"
                     /db_xref="GeneID:55998221"
     CDS             complement(join(1127086..1129213,1129275..1129966))
                     /locus_tag="TRUGW13939_10742"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349745.1"
                     /db_xref="GeneID:55998221"
                     /translation="MMNSNMLSRILPSTGSPSIYEAIRHDDEASDSDAEERAAMALDE
                     ENLHDSLHDYNPDDVADSQVTTQSTAFLGQRRPNKSRLGWTGPGAGPSRPRWMQASRR
                     IGVDEGDDDVPASLLIEGQDLEDMPNPPAPPHQIDDERDSFPGDGPSSGISPNRWEAR
                     RDNNSFLPPPIISGARRLGGISGMVSASSKDKAMWRWANVENLDNFLKEVYIYYLGNG
                     ISSILLSRALNLLTLAFVVGFTTFLSSCVNYSNVRNSKALDEILVPKCMTKISASTTL
                     FLWLFTFFWIGKLIEFILDVRRLRHMHDFYLYLLKISDPEIQTISWQEVVSRLMALRD
                     SNPSTAAGISARHRKFMGSQSKQRMDAHDIANRLMRKENYLIALFNKEVLDLTLPVPF
                     LRNRQLFSRTLEWNLNMCIMDYVFNEQGQVRPLFLRDTHRRALSEGLRRRFIFAGIMN
                     VLVAPFIVIYSMMHYFFRYFNEYQKNPSQIGSRQYTPLAEWKFREFNELWHLFQRRIN
                     MSYPFASRYLDQFPKDKTVQVSRFVAFITGALASVLALASLLDPELFLGFEITPDRTV
                     LFYLGIFGSVWAVARGLVPEETDVFDPEFALVEVTDFIHYRPGHWTGRLHSDEVRQEF
                     AMLYQMKIVIFLEEILSILFTPFVLWFSLPKCSDRLIDFFREFTVHVDGLGYVCSFAV
                     FDFKKGTNAGPGNGTARQNRPAKDLRDDYFSTKDGKMLASYYGFLDSYGANPRAGGGP
                     GARRRFHPPPSFPALGSTPEVDATPRVDRTELTPHVRQAPMMGAHSTMRASRFGGPPA
                     PGSPLHSMLLDPHHQPSASGIRATNRNGPQGRFHKPLPAPTGTDAMEGVKESFTAQSP
                     QKDLIGQSGRAGDDSTGAVATSDNNLEGSWRINLAGEADDSDSVEEGEEVEAVVKGPG
                     GVLGLIQQFQKANNEGRGGGAAVGI"
     gene            <1131317..>1132502
                     /locus_tag="TRUGW13939_10743"
                     /db_xref="GeneID:55998222"
     mRNA            join(<1131317..1131411,1131467..1131843,1131898..>1132502)
                     /locus_tag="TRUGW13939_10743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493853.1"
                     /db_xref="GeneID:55998222"
     CDS             join(1131317..1131411,1131467..1131843,1131898..1132502)
                     /locus_tag="TRUGW13939_10743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349746.1"
                     /db_xref="GeneID:55998222"
                     /translation="MSLILSISSLLLASTLVSADATTYDVNSICTCDQMMRYYQTSIA
                     GLWGTTYWGSAILMASLADISSLDPSYNNTYFSAYATTYSDAPATVGSGFIDGYYDDE
                     GWWANAWLTVYDLTQDPDYLNMAISLYNDIAGGYNTPCGGLYWSKDDTYIASISNELY
                     ITLAASLANRVSSDQAQGYLDAATAGWDWFFNIGVVGEDWLVVDGVNVSTCLPVGIQY
                     SYNQGVILSAAVELYQATGNETYLEYAGNIANATTAINSTLTGANGVIVDCHNGPCDT
                     TGAMFKGSFFRGLRQLQLAYPHDNWVNYIETNAQSLWNNALNDTDGQCNTGADFSGPM
                     SAVNEVTQGAALDCLVAAWAVTST"
     gene            <1134808..>1138636
                     /locus_tag="TRUGW13939_10744"
                     /db_xref="GeneID:55998223"
     mRNA            join(<1134808..1137670,1137726..>1138636)
                     /locus_tag="TRUGW13939_10744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493854.1"
                     /db_xref="GeneID:55998223"
     CDS             join(1134808..1137670,1137726..1138636)
                     /locus_tag="TRUGW13939_10744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349747.1"
                     /db_xref="GeneID:55998223"
                     /translation="MEQERSNGFRRNSSHHGIYSRPIERRPSKKSSSKDRHGMVYPDS
                     FQQATIRTVTPDSVSDTGNQSSLSEPDFAPATTASPRSTARTRNTDWDRRREFSPYHS
                     AGDEEDPTSEAKGQRARSKTTTLDEQRSEISPSFLTRTRNRLGSINATATPLNTKVSE
                     ESVGSIGYPSIIQSPTYAGQTGSRQRLTKPPLGGVPGLITGVSRNPATFLSPLSNADS
                     AKILQLMKTTCGRMHGILSFRTAPNTQWSSGYCAINVASGSLIYQAKGEVAQAKTLIP
                     DLRGCHVRTLFDTELQSTYLSVFTFSSGLGLQLKPHVNETFDSWLAALLCWQPIRPKG
                     VQNKRTKPQSVTIGDRRFNDSRRNSESTSQKEAAIIKIGNMLLWEKPTVSGARPVPGW
                     KTLSYRQQKQNPVWQSVSGALHENGYFKLFTEASHRSEQSLLAVIQLSRLARSAVQQL
                     EPSVLGGEYCIAIYPQYAAVAASDSTERPVFLSLETRVLFEVWFVLLRAFTIPELYGP
                     ETAISEDPVIRPQNAFNPTNTSIADMFRNERFVSVRITEAKLTNTNKKELDPSSGRIH
                     PISSEATLSSDYYAEVLLDGEVRAKTAVREKTSNPFWREDFTFTDLPPILSNVSVLLK
                     TLNPAQKDWTLIAHGPYTLDAQVNPMSILDDLEVSSHDATCGRVDLHLDELESGIDHE
                     KWWPIIDHRDQVVGDMYMKVRLDETIVLMSHEYEPLSELLHAFPNNLTIHMVQILPTD
                     LNVLSSLFLNIFQVSGQAADWIAALVEDEIDGFGRDTASTAHNRFRYTARLHSNDSKE
                     SGQEREVIVRDLGRSATIEANLLFRGNSLLTKALDMHMRRLGKDYLEDTIGERIRDLD
                     ESDPECEVDPMRVERPEDLERNWRNLIGLTSLFWKSIAASASKCPPELRRIFRHVRAC
                     AEDRYGDFLRSVTYSSVSGFLFLRFFCPAILNPKLFGLMKEHPRPRAQRTLTLIAKAL
                     QGLANMTTFGSKEPWMEPMNKFLLSSRSAFKEFVDSICSISAERPTQVVTPQYATPIQ
                     ILGRLPETSKEGFPSLPFLIDQSRSFAALIKLWLKNAPSRLREMEETDPNIMRFNALA
                     LQIQQRTRDCFSKAEQAERPNGNYEVKWEELVESMDRSITFYDDASKAETPATETPFT
                     ALPVSSNKRNSIGYFPARPTSRRSIDTGGEGDEDTPPSSSSATWEHHRLPFTRARSSD
                     PRENGTSSRNSSQHSLENPEGSKSRHSTIGRDTASKLRLLDFVPGPSRRKNKE"
     gene            complement(<1139467..>1141187)
                     /locus_tag="TRUGW13939_10745"
                     /db_xref="GeneID:55998224"
     mRNA            complement(join(<1139467..1139686,1139754..1140555,
                     1140623..>1141187))
                     /locus_tag="TRUGW13939_10745"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493855.1"
                     /db_xref="GeneID:55998224"
     CDS             complement(join(1139467..1139686,1139754..1140555,
                     1140623..1141187))
                     /locus_tag="TRUGW13939_10745"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349748.1"
                     /db_xref="GeneID:55998224"
                     /translation="MRGQTEELSEFEKQRLANIAERDALLKKLTLEAQSSGLFAKSSP
                     KTTTTTGAKKDATSSRSKKKAAPRIKKEDEAPPVRRMSSRLRGITADSEVAKRKADVA
                     FEEAQNVERAKRMRKSDFFTLDNMLVSGQKLSGDALIGIDVVTKGVAKPYERTFGDED
                     VKKTTDKELKALREEMSNLQLWDQWEPNSLKMTPERIYTMTFHPSETKPLVFAGDKMG
                     HLGIVDASQKRPEIGEDEDEEPDASITTLKPHTRTISSMVIPPQKPTHLYTASYDSSI
                     REMDLEKTTSEEKYAPETRSMDEPISGIDMASDDPNCIYWTTLSGSFSRYDLRSSKKS
                     NSITEWQLSEKKIGGFSLLPSHPHFFATASLDRTMRLWDLRKLSHENPEPVGYHESRL
                     SVSHAAFNTQGQIATSSYDDSIKLYDFANKGIASWEIGHKLDDKEMKPDTVVRHNCQT
                     GRWVTILRPQWQQNPQSSIQRFCIGNMNRFVDIYSSNGDQLAQLGGEGITAVPAVAVF
                     HRSKNWVAGGTASGKLCLWM"
     gene            complement(<1141612..>1142561)
                     /locus_tag="TRUGW13939_10746"
                     /db_xref="GeneID:55998225"
     mRNA            complement(join(<1141612..1141944,1142010..>1142561))
                     /locus_tag="TRUGW13939_10746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493856.1"
                     /db_xref="GeneID:55998225"
     CDS             complement(join(1141612..1141944,1142010..1142561))
                     /locus_tag="TRUGW13939_10746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349749.1"
                     /db_xref="GeneID:55998225"
                     /translation="MAALSDCRLASKATSNIAKAFTSTQSTIASRSLSRKYALNRNCA
                     ITVHQPICSRRLSTAPRLSSQLRCYHSQFHPPLPTHEYTNSQTAILSAALKHIPDHGF
                     TKQALMLGARDMGFLDVSIQLFSRQEMDLIVFWLASRRGLLRSKVENGLFEGKGQLGV
                     DEKIKTLILERLKMNNEIIHRWQDALALMSFPSNIPLSLSELHSLSSDILYLAGDASI
                     DASWYTKRLSLSTLYASSEVIMTRDSSPDFSFTEGFVERRFQDNGAISDKVGGVKSYL
                     GFMAGTAVGLGRSWGLKI"
     gene            <1147629..>1149824
                     /locus_tag="TRUGW13939_10747"
                     /db_xref="GeneID:55998226"
     mRNA            join(<1147629..1147769,1147825..1148173,1148249..1148301,
                     1148410..1148417,1148475..1148568,1148630..1148743,
                     1148814..1148865,1148946..1149421,1149477..1149630,
                     1149688..>1149824)
                     /locus_tag="TRUGW13939_10747"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493857.1"
                     /db_xref="GeneID:55998226"
     CDS             join(1147629..1147769,1147825..1148173,1148249..1148301,
                     1148410..1148417,1148475..1148568,1148630..1148743,
                     1148814..1148865,1148946..1149421,1149477..1149630,
                     1149688..1149824)
                     /locus_tag="TRUGW13939_10747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349750.1"
                     /db_xref="GeneID:55998226"
                     /translation="MTVLHNLLPLPLFSAHWHDRVIMDYLTFCVVSHSAHINITQIAD
                     CHFRERSRSPRGDRPRRSRSPRRSRRSYSPRSRSRSRDEYRRSERRSRSPMSGAGGTS
                     GGSGYGGRGGPPSGRSFEDRSVARDQMMQTVRDSSQQDRRVYVGNLSYDVKWHHLKDF
                     MRQAGEVLFADVLLLPNGMSKGCGIVEYATRDQAQHAVNTLSNQNLMGRLVYVREDRE
                     AEPRFTGPPSSRDFGGGAPSRGAPGGGGRQLYISNLPFNVGWQDVKDLFRQAAQQGAV
                     IRADVLSDPSGRPKGSGIVVFESADDARVAIQQFNGYDWQGRILEVREDRYAGGGPGG
                     GFGGRGGGFGGGFGARGGFQGRGGFGGRGGGGFGGGYGRGGFGGGAGGGFAGGAGGAG
                     AGGGSYDAPPPPPGPPNPFTDYATSGGEKSAVIYVRNLPWSTCNEDLIDLFTTIAKVE
                     RAEIQYETNGRSRGTGVVEFESADVAETAISKFFGYQYGGRPLGITFVKYAHPSGPED
                     AMDATETPGGLTQDQIM"
     gene            complement(<1150802..>1153445)
                     /locus_tag="TRUGW13939_10748"
                     /db_xref="GeneID:55998227"
     mRNA            complement(join(<1150802..1151906,1151992..1152329,
                     1152380..1152867,1152923..>1153445))
                     /locus_tag="TRUGW13939_10748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493858.1"
                     /db_xref="GeneID:55998227"
     CDS             complement(join(1150802..1151906,1151992..1152329,
                     1152380..1152867,1152923..1153445))
                     /locus_tag="TRUGW13939_10748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349751.1"
                     /db_xref="GeneID:55998227"
                     /translation="MTTAQSPSQDGYMPNDQSHLSRGFSLGSGSRPNSYIANSIVPSD
                     FAVSQPTHITEPSTLPYTSRFNEDMDGSRRSSAVIDGFPTGASGLQRSDSQASHTSAA
                     PSRSGTLKKKPSLSRKGSLKRTGSRRSMRAGSVRSMNLGEKEKYGDEEPGSAFYVPIP
                     TTGNPTDELAARFQSWRKVLKDLVVFFKDIQKSYETRAKLLLSAGNLVNNMTLPPTFL
                     ESGGLADATEILRDYHKQGVAEANKAREVETEVILQLTGLRSDLQQKTKEIKSLSGDF
                     KNSVDKEVENTRKSVRNLQETLGLVDVDPSATSGKHDPFILRLQVDKQLEKQIEEENY
                     LHRAYLNLEHSGRELESIVVGEIQKAYNAYASILKRDADEAYDTVEKLRAGPISMPKD
                     HEWNNFISESDQLVDPRVPVRSIQSITYPGKDHPAAAEVRSGMLERKSKYLKSYTPGW
                     YVLSPTHLHEFKSADRIASQTPIMSLYLPEQKLGSRSQPDSTSHKFMLKGRQTGAMHR
                     GHAWVFRAESHDTMLAWFDDIANLIGRTGEARNAFVRRHVRSLSGNSFRESSISSDGV
                     MDEDEADQTPYSSQSAVLRRAPSGAAVTPAQRPQPGGRFPSDIQIDRNLQATLSRSSG
                     ESNGDREGLADGEGTPFDQSQPISQDPNDPTQHQLPYRSNNEHETYAGEWIAASSPSD
                     RDPSRTQEHVSELSSQQEPQLVSPSHAPIIVNNEAQHTEQGNTNVDPNSANSPTPFVY
                     AGVGPNISDVSELQRQESQHSRQTHSTYSLSASTPTTTTSPVSESNAATRPGAQSKES
                     ASTIDLLNMPGKYPRTMTG"
     gene            complement(<1155559..>1156329)
                     /locus_tag="TRUGW13939_10749"
                     /db_xref="GeneID:55998228"
     mRNA            complement(join(<1155559..1155650,1155713..1155907,
                     1155964..1156083,1156143..>1156329))
                     /locus_tag="TRUGW13939_10749"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493859.1"
                     /db_xref="GeneID:55998228"
     CDS             complement(join(1155559..1155650,1155713..1155907,
                     1155964..1156083,1156143..1156329))
                     /locus_tag="TRUGW13939_10749"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349752.1"
                     /db_xref="GeneID:55998228"
                     /translation="MASQHTEERIYHPQDAIANTIKSATLTGGAGLLTSAVQNTLAKQ
                     NVGPLGIFFRTGGTIAVFAAMGGTYTFVRTASANLRETEDPYNGALGGFFSGAILGLR
                     ARSFPATFGYGAGLAVVLAAFESTGGTLWGYKEKKNLDKYEELEKLRTAYRQPAEKTF
                     AELGEGRGIYGPGYAERRRERIKEAYGIDVPATSSTS"
     gene            <1157129..>1161219
                     /locus_tag="TRUGW13939_10750"
                     /db_xref="GeneID:55998229"
     mRNA            join(<1157129..1157153,1157215..1159209,1159270..1159900,
                     1159965..1160385,1160437..1160608,1160666..>1161219)
                     /locus_tag="TRUGW13939_10750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493860.1"
                     /db_xref="GeneID:55998229"
     CDS             join(1157129..1157153,1157215..1159209,1159270..1159900,
                     1159965..1160385,1160437..1160608,1160666..1161219)
                     /locus_tag="TRUGW13939_10750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349753.1"
                     /db_xref="GeneID:55998229"
                     /translation="MTSLYQRAGKTAPRFLQDLNLYDPQNPPASGRNLLSDTPPIFQE
                     GDTGPLEWLSPTACNHTYTLKPNQTYVLPSEQRRGRGAVSTVSAVCSKCRCHLQVKVS
                     YPGNAGPTSNHLHHLVYQSGTRRTTPKGQHVESYYYGCSYPMCGTSVSVGVMSSVLHP
                     EHVQLLTDLELVNKRADEAIAAHPERLEGIARPHPFTVLSNLSAYLNNALHDSERSKP
                     ISAINKRFVVCFGVDGQPCKDLLTYLAFSPNEGFWNPPTPDTSAEQPYRDELNIFLDN
                     TIHELSVLIQQRPSSEKKTPYSLEPLAPARNELFDALEASNYSKATRFIEFQMPGQPC
                     YEDLGALEDMSSDLIIEAYQRQVAVDPAKGPHYLQCLKLIAQLRGGPDGYTINESVMM
                     AYSKGAYTIEDLHNAYRYFSLNPDDPTLTEELIVGSFYSYISSSTQETEARQQLFRIG
                     DARRSERIKSVAEDRVSTAEQAQVFLGVEENTPDDFVITMYTTKINDSPSSKGIAQKA
                     LSLIAEARNSEGLRHFITTGESGVGEMDVGDAYRLLQIPDRTVGDDAIIAAYTICVDE
                     APAQVETYSRALAIIAKEKDSPMLSSFVSDSVAQSDRNLAEWPVGLQNIGNTCYLNSL
                     LQFYFTVKPFRGMVLEFEDAKTDLSEDSLRKKKVGSRKVSKFEIERSQKFLRELRTLF
                     QNMITTPRASVRPEQELARLTLISSTNEAEIRRRSTVSGLRPSLLGEINGMPVAGPLG
                     PPQPAEANSSDNIPTENIISAEDTQVKDPVASDIDSEATLVSEPTHVKEDQAGSVQQT
                     IEESDNQNPPNDVSQPAENVEPPNRPPPVPPRPAEAQRSKQLIEEVELGAQQDVTEVI
                     NNVLFQSECAIKPRTLESDGEQVDIVKDLFYGKTKSYITAKDEIRSKEEFWSDIKIDV
                     ATGSRDIYSAIDGAFDIQDVLVDDAIAEQFGSISKLPPILQIQVQRVQFDPVKKVSFK
                     STHHLDLKETIYLDRYMDTQKEEIINRRRDCWGWKKKLKSLDVRKAELLRLNETDGQN
                     MPTLFKNTSQLLEDLSSLNEQDQDGNNSVDINAHLASELEQFSQITQTELAYIEQETN
                     DTQTMISSQFSDYKRLAYRLYAVFMHQGSVEFGHYYIYIYDFDKEVWRKYNDNEITEV
                     QDTSEIFGKSERNSERANPPTPYFLVYVNAAMKNRLVEPVCREIEPEPSTVNVSVGPN
                     TEGAMDVDTKPLSYEEVWTENGTPGTQTNSFSDISALPSQNYDLYGKRPVVQADQLAP
                     SFW"
     gene            complement(<1162297..>1168492)
                     /locus_tag="TRUGW13939_10751"
                     /db_xref="GeneID:55998230"
     mRNA            complement(join(<1162297..1162934,1162986..1163300,
                     1163357..1163423,1163480..1163612,1163684..1163821,
                     1164640..1164659,1164742..1166303,1166381..1166554,
                     1166871..1166892,1167252..1167848,1167909..1168382,
                     1168469..>1168492))
                     /locus_tag="TRUGW13939_10751"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493861.1"
                     /db_xref="GeneID:55998230"
     CDS             complement(join(1162297..1162934,1162986..1163300,
                     1163357..1163423,1163480..1163612,1163684..1163821,
                     1164640..1164659,1164742..1166303,1166381..1166554,
                     1166871..1166892,1167252..1167848,1167909..1168382,
                     1168469..1168492))
                     /locus_tag="TRUGW13939_10751"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349754.1"
                     /db_xref="GeneID:55998230"
                     /translation="MSSQRYERVNAHDEDDEDSHVEAFPPVSNLAPPIPSSPPPSFHS
                     RSSSPSSHRLFHEDPMHGAANNDMEDAFDDGEDSDDGDEPDDRQRLMRGDPTVASPET
                     VPSADNTTTESPQSSSTQRRGTLLPTFSPSAASRSVGMGSSNDGVFANLNAKPERGEK
                     DEDLPPSYEQAAADATPPYWETTIMAPGMSSDEVYVDGLPVGSIFSFIWNGMISMSFQ
                     LVGFLLTYLLHTTHAAKNGSKAGLGLTLVQYGFYMKGSGDSRSGKDNDEYTPPPDPNS
                     HNFDPNSIGDNAAAGVGAQGNGDSSNGAMAAITTNEWISYALMIVGWFILIRSVSEFL
                     RARRHEQLVLQSPDRGLSVPVIAEGERSETVHNTGRKLADTNFASRRFMAETAPVEAR
                     SLSSVTAIAANPPAYPRNPTQERLDRLVLYIVKVPGSRDVILTPLKPPTKSNISSEAV
                     NSSLYYLHVASEADEDVLRSIGSENGQQQHQDGHMSGLPTETVPRLNDFHRKPVGGAA
                     ESQPTPPSPPPPPHREFPPSPVIPRKPTTASNSPVSPINPPYPHGEDRNEVPDYHNHH
                     GPPLEHNDDSNHFTIPRRPVTIYDDALLGAVPRPSLTIQAPAEEDYSNNYGRERPRLS
                     MENEYPGQERRHSQMAEKVPSPITPNQRPSSSFKITIIRRDPASGHQWNVGTMSSFDE
                     DNGSIHVEITNPGYGKFLNNESFSLAAVGQTLPGVGHAENTAAEAIKAMMHNTPRNDG
                     PPDTVFHREVTPIRHNHPQGSHQRSGSADSKVADMVVNPKVSRGYYSFTSPWNGNCAF
                     VASINGLGIKCKHTIPGPSMSGPQENHNNNAEVTVSELRFNIPFPLDQHFRSPLLSVW
                     GEKGGKRGALAQMITSNIQKVQQARTRARSESNPIRPPSGSSSEDLTADEDRLDFSLA
                     REPGGGGMDGRSAKLGKLIIEDEGIKMIDLVVAASMGNTQYSLPSNTRVTVTMSDLHQ
                     RKTFKVFNQDFVVDDRYNVTKELGQGAYGIVCAAVNSQTNEGVAVKKVTNVFSKKILA
                     KRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQPLT
                     DAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
                     NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQL
                     NQILHYLGTPAEETLCRIGSPRAQEYVRNLPFMPKVPFQRLFPGANLDALDLLDRMLA
                     FDPSQRVSVEEALEHRYLQIWHDASDEPSCPTTFDFHFEVVEDVGEMRKMILDEVINF
                     RAVVRQQQQAAIQAQQSQQAPQNVPIPDHNQQNTWKQDEPRPQEATLSNSHQNDLEAS
                     LQRGSDFVH"
     gene            <1168902..>1169347
                     /locus_tag="TRUGW13939_10752"
                     /db_xref="GeneID:55998231"
     mRNA            join(<1168902..1168916,1168997..>1169347)
                     /locus_tag="TRUGW13939_10752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493862.1"
                     /db_xref="GeneID:55998231"
     CDS             join(1168902..1168916,1168997..1169347)
                     /locus_tag="TRUGW13939_10752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349755.1"
                     /db_xref="GeneID:55998231"
                     /translation="MSKSAQTAYTRIAQILQKWPVDRVRPEPVSIQHYLRTHLPKAQG
                     GLSESPSPSPISDSSINALNSLLKNSYNQRYPLPKKLRFPASRPDHYDVLLKEFEEAP
                     TRTWFQRIQKRFSGFLRLK"
     gene            complement(<1169544..>1171208)
                     /locus_tag="TRUGW13939_10753"
                     /db_xref="GeneID:55998232"
     mRNA            complement(join(<1169544..1169857,1169912..1171091,
                     1171146..>1171208))
                     /locus_tag="TRUGW13939_10753"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493863.1"
                     /db_xref="GeneID:55998232"
     CDS             complement(join(1169544..1169857,1169912..1171091,
                     1171146..1171208))
                     /locus_tag="TRUGW13939_10753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349756.1"
                     /db_xref="GeneID:55998232"
                     /translation="MPSQIASCFRLARQFSANPNKHQQFLARAFSSSVRRNEINKVFP
                     SAAEAIKDMKSNSTVLAGGFGLCGVPDTLINAVRANPQITGLTAVSNNAGVDGSGLGL
                     LLASKQIKKMIASYVGENKTFERMYLGGEIELELTPQGTLAERCRSGGAGIPAFYTPA
                     AFGTVVQTGELPLKHNADGTVALYGDARDVKVFDGKSYVMEHAIKGDYAFVKAWKADK
                     LGNCQFRFAAANFNGAMGRNAKMTIVEAENIVEVGEIDPAAVHLPGIYVKRVIRGTED
                     KKIEKYTFAKDEGDDMSALGQGETANKRERIVRRAAKEFKNGMYANLGIGMPMLAPNF
                     VDPSVEVMLQSENGILGLGPYPRKGSEDPDLINAGKETVTLNPGAAVFGSDESFGMIR
                     SGRIDLTILGAMQVSARGDLANWMLPGKIKGFGGAMDLVSNPSATKVVVTMEHTDKKG
                     NPKILKQCEFPLTGRACVSRIITELAVFDVDFTKGLTLVEIADGVTVDEVKAKTEAPF
                     QVADDLKKML"
     gene            complement(<1171662..>1173486)
                     /locus_tag="TRUGW13939_10754"
                     /db_xref="GeneID:55998233"
     mRNA            complement(join(<1171662..1173310,1173372..>1173486))
                     /locus_tag="TRUGW13939_10754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493864.1"
                     /db_xref="GeneID:55998233"
     CDS             complement(join(1171662..1173310,1173372..1173486))
                     /locus_tag="TRUGW13939_10754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349757.1"
                     /db_xref="GeneID:55998233"
                     /translation="MSPNIPAEVSESSQKKSASDHWFDEVNHKAASQIGGLGDDPPFL
                     LDNVDVQIGEKHVTTAPDPEDPILSYMRTNDWERENEDLRGIIDDLTLDVKRMKRKLR
                     RYREANPRHLRDDKLFEIRAHRLSVRRKRQLENILERFAADVSVPPRLSKDNSLPNAN
                     SLLSEEARMGMLVVLIECLCSPINTSHHTSSRKSNLLQGNQDGWFSINEMLGCIQQAS
                     SAVSQHKFSLETLKKHSTRLDISTDGNYLRWKAAKGDPVESRATQDEIQVDNQNFFKS
                     RASTRVPLGFDKMDVMSTIKKNPYYTPSAFLKHGSEAEADSLSMTNSEAESTTQFTVV
                     HPNPQTSKSPKLSSSAPHGRMAYYKNASFYMDYSCDSIDHADLCQDPHQYDKKRKRRR
                     PSESHVSNRFAAYRTEHKENNDKQHEVSSPGLSLNEVPLTPIADGTRARPIELEASGV
                     GDVIPSDNFAVHVTVKYTSVPNSVHTTMTSRAPDNRLSKNRIIPRPKVHSTFKAHVVA
                     SIHEELAPSSLPPPTYGVFSSDSSDDEDEISPSELNYSGYGVDKPTHAVSIQKWRAEV
                     VSSLEHDTVGAVSRAEDVEAT"
     gene            complement(<1174715..>1175647)
                     /locus_tag="TRUGW13939_10755"
                     /db_xref="GeneID:55998234"
     mRNA            complement(join(<1174715..1174741,1174806..1175269,
                     1175326..>1175647))
                     /locus_tag="TRUGW13939_10755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493865.1"
                     /db_xref="GeneID:55998234"
     CDS             complement(join(1174715..1174741,1174806..1175269,
                     1175326..1175647))
                     /locus_tag="TRUGW13939_10755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349758.1"
                     /db_xref="GeneID:55998234"
                     /translation="MRFSLPNAVLAALPILLADRLSASAASDLNLNETTRVDCYSDVP
                     GYKNNGTYTWQTDGYCQEQCVQLGYPVMALYDGLQCLCGDEIPPNATKTTGCDSKCSG
                     FPSHICGGKSAYEVFLTGTTPTVAVMGEDSASTSSSTTTTAGVSVITKAGQTIVVTAS
                     NQPSTSSKSGGGVNTAGIAAGVVVGVVALSVIIGAAFFFLRRKRARKLEEEYRRNAEI
                     SAFAQKKPNTPSSDSRWDGDYMAQRRQSNGSIDDDQDFSRRILTVTNPDGRL"
     gene            complement(<1176915..>1177931)
                     /locus_tag="TRUGW13939_10756"
                     /db_xref="GeneID:55998235"
     mRNA            complement(join(<1176915..1177140,1177194..1177271,
                     1177329..1177347,1177401..1177645,1177711..1177775,
                     1177860..>1177931))
                     /locus_tag="TRUGW13939_10756"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493866.1"
                     /db_xref="GeneID:55998235"
     CDS             complement(join(1176915..1177140,1177194..1177271,
                     1177329..1177347,1177401..1177645,1177711..1177775,
                     1177860..1177931))
                     /locus_tag="TRUGW13939_10756"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349759.1"
                     /db_xref="GeneID:55998235"
                     /translation="MNFFGPNVWCGKQIVFPNDPNVVWATFSCKREDDLKDKHAVKIY
                     MQAPWIDAEFTSAAARKAQTDTNRSIFMASEINALRKFAENRANNAPHLVAELHTKQS
                     DDGIIPTGFISYILTTWCPGVPLGDAFEEALGDTKRCGIVSYGPKPDDLLWDAANKKC
                     YMANFQWSGPPRSFDIAEQAWRRWRLQPGPPNHMLVKVILKGLVRDNPMGNVSSLWQK
                     VVNTSCTKSGDSLPRE"
     gene            complement(<1180778..>1182417)
                     /locus_tag="TRUGW13939_10757"
                     /db_xref="GeneID:55998236"
     mRNA            complement(join(<1180778..1181778,1181862..>1182417))
                     /locus_tag="TRUGW13939_10757"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493867.1"
                     /db_xref="GeneID:55998236"
     CDS             complement(join(1180778..1181778,1181862..1182417))
                     /locus_tag="TRUGW13939_10757"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349760.1"
                     /db_xref="GeneID:55998236"
                     /translation="MALAVVILAGRKKLTVEAASSNNADDARPVSVSACLNKTGASLV
                     YPRESIYANFSVSQNTNYHTHPEIIVIPSSTEEVAATVRCVAAEKGRTKISIRGGGHS
                     YAAYSLSGQVVIDSSQMRSITFDDDRKQVTVKFGQSLGQLALAMGKGKYALPHGTCPT
                     VGISGHSLGGGWGFTSRKWGWLVDRIVSVEFVDINGNIKILNPSSTGDDAELWWAVRG
                     AGANNFGVVTSFTYLMETAPSEIINYGLNFATYTDCVRVLLALQEIGSIPADDPDGLP
                     VEFGGELILNGDYANTESACMLTGQYLGNKSDYTTTINRLLEMLRERGVAALESGSYA
                     REFSDWITALTDLMGPLDTSVATSQPYYAQSLLDDGDPDHTLETIEAVADALMASVDI
                     NGTHTHISFDLNGPGSATNRRPVSDGMSFEHWQSLFLVQIYSNGFPGFDNPNSRTSAV
                     NRITNIADTIKQSKSKKSNWHAYQNYVDPYLQNFGMAYYGSALDRLKAVKRSADPDTI
                     FDHPQGLGHA"
     gene            complement(<1182932..>1183935)
                     /locus_tag="TRUGW13939_10758"
                     /db_xref="GeneID:55998237"
     mRNA            complement(join(<1182932..1182937,1182965..1183300,
                     1183362..1183540,1183590..1183601,1183655..1183692,
                     1183754..1183814,1183869..>1183935))
                     /locus_tag="TRUGW13939_10758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493868.1"
                     /db_xref="GeneID:55998237"
     CDS             complement(join(1182932..1182937,1182965..1183300,
                     1183362..1183540,1183590..1183601,1183655..1183692,
                     1183754..1183814,1183869..1183935))
                     /locus_tag="TRUGW13939_10758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349761.1"
                     /db_xref="GeneID:55998237"
                     /translation="MSRRTSNLSSGSDQGTGGVTGDSSQEKQKKLLQADTGHFNMVRT
                     LHLADLITELNGFCGFMSVLSSMRYLTNPEDNAPLWAALIFMPFGLFFDFMDGRVARW
                     RKKSSLMGQELDSLADLISFGVAPASVAFAIGIRSPVDHLLLSFFVLCGLTRLARFNV
                     TVAVLPKDKTGKSTHFEGTPIPTSLSIASLMAYWVSQGWTHENLPFGLAAQDTIFEFH
                     PVALLFVLWGCLMP"
     gene            complement(<1184388..>1185289)
                     /locus_tag="TRUGW13939_10759"
                     /db_xref="GeneID:55998238"
     mRNA            complement(join(<1184388..1184629,1184680..1184708,
                     1184771..1184916,1184977..1185077,1185131..1185178,
                     1185232..>1185289))
                     /locus_tag="TRUGW13939_10759"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493869.1"
                     /db_xref="GeneID:55998238"
     CDS             complement(join(1184388..1184629,1184680..1184708,
                     1184771..1184916,1184977..1185077,1185131..1185178,
                     1185232..1185289))
                     /locus_tag="TRUGW13939_10759"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349762.1"
                     /db_xref="GeneID:55998238"
                     /translation="MSFRGGGRGRGFATGANRGGRGGFQPSFGPPAQVLEMGSFMHAC
                     EGEMVCESINPKIPYFNAPIYLENKTPIGKVDEVLGPINQVYFTIKPQEGIVATSFKA
                     GDKFFIGGDKLLPLEKFLPKPKAPPGAKRPVGARGGGPRGGRGGFGGGFGRGAPRGGA
                     RGGRGGPGGFRGGRGGSFGAPRGRGGSGGFSRGAPRGGSRGGFRGRG"
     gene            <1185523..>1187872
                     /locus_tag="TRUGW13939_10760"
                     /db_xref="GeneID:55998239"
     mRNA            join(<1185523..1186031,1186085..1186925,1186979..1187666,
                     1187718..>1187872)
                     /locus_tag="TRUGW13939_10760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493870.1"
                     /db_xref="GeneID:55998239"
     CDS             join(1185523..1186031,1186085..1186925,1186979..1187666,
                     1187718..1187872)
                     /locus_tag="TRUGW13939_10760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349763.1"
                     /db_xref="GeneID:55998239"
                     /translation="MASEGSKELPTRPAGDTKMANQGNSLPDFILERNRLFEELWQEH
                     VKEQAEKPRSEITVTLDIGDGNPSTIIAKSWETTPGSFLRDVPKEISANVVIAKIDGK
                     ELWDLNRPLEKDCKVSLLPFDHPEGREVFWHSSAHCLGEACELEYNCLLSHGPPTLQG
                     FFYDMAIPDGLVVKESDWSTLDKKAAQVFKERQSFDRLEVTKENLKKMFAYSKYKLHY
                     IDNLVQGEKSTVYRCGTLVDLCRGPHIQNTGKVKAFKIMQNSSAYFLGDQTNDSLQRI
                     RGVAFPDKGAMKEHLKFLEEAAKRNHLRIGKDQELFFFDDAAPGCPFLLPNGTKIFNG
                     LQKLLRTEYRKRGYQEVQTPNMYDVSVWKTSGHWAHYKDDMFKLDVEKREWGLKPMNC
                     PGHFMLFGHRDRSYRELPLRIADFGVLHRNEASGALHGLTRVRKFQQDDTHIFCTPDQ
                     IASEIDGLFDFLKSIYGLFGFTFKLKLSTRPEKYMGDLEAWNFAEEQLRLALNKFKGN
                     DWELNEGDGAFYGPKIDITIADALQREFQCATIQLDYQAPINFRLEYITNEKITAGGD
                     QEKKEGQEKKEGEEKSKEIGVGRARPVVIHRAIIGSFERFLGILTEHFAGKWPFWLSP
                     KQILIVPVMPDLNDYAKELQQILQADKLSVDIDISGNTLQKKIRTGQLSQYNFIFVVG
                     AQERDSRTVNIRNRDDPASQAKGELIPLEEARVKLTALRKERRLVNSL"
     gene            complement(<1191253..>1193981)
                     /locus_tag="TRUGW13939_10761"
                     /db_xref="GeneID:55998240"
     mRNA            complement(join(<1191253..1192901,1192961..>1193981))
                     /locus_tag="TRUGW13939_10761"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493871.1"
                     /db_xref="GeneID:55998240"
     CDS             complement(join(1191253..1192901,1192961..1193981))
                     /locus_tag="TRUGW13939_10761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349764.1"
                     /db_xref="GeneID:55998240"
                     /translation="MDRELIGYNYSPYHHGASIGRPLSAASSTSTAYSSASSPQESSH
                     RLAARAPAPTSAPSNTMRRANTMAEIPLPITYTPTTHRISKAKKGKRVHACEFPGCNK
                     VFTRAEHRRRHELNHNPEASFPCTYDGCRKAFHRSDLLARHMERQYVSPDSILISPVA
                     ANRLSSELDGQSDSASGRSWRPQGKTTITSVPNSMVTSMPLDVSSASYPTSQVSTPMS
                     VGSPVIGGAIHPDLGSDLALPWSGMEIPFQPRPTVFGSHIRDSSDDMPFYSSPETCGS
                     PASDYVMPHPPSAPTSVMEPYAYHDLAASPLQLPTSREWDGVDIVPAPNMMPVAMDGH
                     QMIQPVEHSPVQLSHVGRDEWYALRRELTSAPGVVSGTDSMEILDTLKWQDCFEYYWQ
                     HFHPLFPIIHRPTFLATKPSPLMAGAMVAIGSQYDTRPNSKEYSLSLLEACLKLLAKR
                     SPITSRSRVADIQTVFLLEFLSKFTSRKADVQISHRFRSLYGSFIQDRHWVHVNPLAV
                     LNTLPAQFPPEALKSAQNFWAEHETRRRVLQAAFILDIQQSALFGQPPVLLQPSSAPA
                     NAWQSNSRMMDIPFPCASDLWESNNPGDWLVSARSYIPVSLATAAASFNQHSGLRPDQ
                     IDTFQSSLLVAYGLSGRAQGGDPESSLRGFTALEDAAGDTPIVASPHARTLFIVHTML
                     ATRYTPVHTLLSVSGESWLFNQKLAHEGDFRSAKIALRQWVSDTEDVKKAVWHAVRAL
                     RYIVDDPDVLLSISATPAQWNNFLPAPPRSSASNMLQTNWSIYICALICWAYGFEPNN
                     YPAQSADDDVAGLSRAYIYNMITLAPMWEHVSRNHIPPLLRCNTTPLLKFIRVSRFRE
                     ARIGGLLNEGDQVLARLSEPRGAHGGIKGMWSF"
     gene            complement(<1201662..>1203100)
                     /locus_tag="TRUGW13939_10762"
                     /db_xref="GeneID:55998241"
     mRNA            complement(join(<1201662..1202402,1202458..1202776,
                     1202826..>1203100))
                     /locus_tag="TRUGW13939_10762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493872.1"
                     /db_xref="GeneID:55998241"
     CDS             complement(join(1201662..1202402,1202458..1202776,
                     1202826..1203100))
                     /locus_tag="TRUGW13939_10762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349765.1"
                     /db_xref="GeneID:55998241"
                     /translation="MVVFVDYDEEDSYNDAYHHRPQDVEPAFYSGIQSNGRIAASTVT
                     TKYPNASSRSSCVDIAAGRDSASRSIESTGQAETLNLDAFGRSLGCYPVVRELARYLD
                     LNSLDALSRTCRQYRVNLMPFRDQLIKRTLRCENEYIQTLNELLAKGAAIPESIKHVV
                     RLMNQGNADAARLTSGKIGKCARDMVGDCRRCGRVVCRNCTIKPPSAVMLKNRLRRLC
                     TTCQTAPLVDHLSPEKWTSNSESDHPPAFTYLAFARTPCDCENAVWLCQTCGHSLRNR
                     DTTYRRIWTWRTHYSTYLGGGLGTGIGEGCQGVKCGKGADCLAAQVIEVEVDAEADES
                     MMATPDPHNHGHDDHTHSDRELTPWGLPQGRLDNVQHDDTPGYFQQEIVGIGGVVKRK
                     SKKRVAVGACVDEHEDERETGKYLLYEESGQDRACCGWCWRVIPSRKDLEGH"
     gene            <1203663..>1205639
                     /locus_tag="TRUGW13939_10763"
                     /db_xref="GeneID:55998242"
     mRNA            join(<1203663..1203827,1203890..1203908,1203966..1204315,
                     1204368..>1205639)
                     /locus_tag="TRUGW13939_10763"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493873.1"
                     /db_xref="GeneID:55998242"
     CDS             join(1203663..1203827,1203890..1203908,1203966..1204315,
                     1204368..1205639)
                     /locus_tag="TRUGW13939_10763"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349766.1"
                     /db_xref="GeneID:55998242"
                     /translation="MTLTAKAIYPNAAPAFINFPSRRSTVHSTKGIVACTQPLAAAAG
                     QRILREGGNAADAAVATAAALNVTEPSSTGIGGDMFCLFYNGETKKITAMNGSGRYAM
                     KASLEDVRKDLKLSPDDAGAIPLTSALAATTPGAAAGWVDTIEKFGSGKLSLQQILAP
                     AIELAEEGFPVSELSSNFWQSGEQQVRNASPNFREMLKNDASAKDGVRAPLPGEIMKN
                     PTLGQTFRALAAEGKKGFYEGRVANELVKVVRDLGGYLTLDDLKSHAETGSQEVDAIS
                     LTFSGQGVGKKQGHSSPEGGVEIWEHPPNGQGIVALMALGILEELERSGQIPHFTPEQ
                     HNSAEYLHAVIESLRIAFADASWWVTDPDVVKVPTNELISRPYLAERAKLFNADKATD
                     ILDHGSPAHNHCDTVYFAVTDKDGNGISFINSNYAGFGTGIIPAGCGFTLQNRGSNFS
                     LSQDHPNVLAPGKRPYHTIIPAMITNLDGSLHSVYGVMGGFMQPQGHVQVLLNMLAFG
                     LDPQAALDSPRICIGAGMPEAGRVLDRTVYVEDGVSEAAIQGLRKLGHRVEVLKGHER
                     GMFGRGQLIRAHRDDGKLIYSAGSDPRGDGMAIPM"
     gene            <1207600..>1211547
                     /locus_tag="TRUGW13939_10764"
                     /db_xref="GeneID:55998243"
     mRNA            join(<1207600..1207849,1207910..1209529,1209584..>1211547)
                     /locus_tag="TRUGW13939_10764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493874.1"
                     /db_xref="GeneID:55998243"
     CDS             join(1207600..1207849,1207910..1209529,1209584..1211547)
                     /locus_tag="TRUGW13939_10764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349767.1"
                     /db_xref="GeneID:55998243"
                     /translation="MQYAKLPQFQYQKFEGQHHYQSYNPQTLGFTYHPLSPKPASSGP
                     EKDNKEVTDTEPEKENTEQVTEESPPAPAEESPAPPQDEATNSADAAPEAETAETAEA
                     PAEPEQTADNAESQEKAPDDTGDATPSSEEPNEPGNDAAGADETAEPPANEQPAVEEA
                     SSPEGDASGETSPAENAPAEEGASTEPPTETPAETPAEDTPAPTEEAPVEEPPAEESA
                     AAEAPAEETPAEETPAEGPPVEEAPVEATPAEAPSEEQSAEQAPAEETATDKPAAEQP
                     SEDAPAQGESTEKAPEDNTTATEEPPKEEPAEQAEKVEITEPAASNTPETKDEAAKDD
                     WAPIGKKGKKGKSAKKKKGAAADKVQEPVEQAEPDKATAAETTPDAITPEAEDSSKAP
                     EPGAEPPGKKNKKKKDKKNKKKGAAAEETPSAGETPPAEEAPAEMPTEEKREEEVAAE
                     NLQENSEQKSLEDEAAEAATTEATPTEEPAVGELATEEPTVTEEPTVTEEPTVTEEPA
                     ATEEPAATEEPTVTEEPTVNEEPTVTEEPAATEEPATEEAVAKEPAAEEILAEGATAE
                     EPVPEELADKESPAEAAEEEQPGEDVLDSWDMDDDFGETEDLKETSNEDEPGKNGEND
                     DETFPECDPCAEQGQVEAEKEAEARQAQEDAEEVDPAESLSQLENGNWDDLEDIGQAE
                     AAAEEDLSTQEESKAEDDVAAPAEATEEPNQEEPTPVIAEEPEASGDGEETPESEHHA
                     EVADATESAAKGDDSAVEAQVSQEAATKEAPTAEEPETAPAEVADAEEEKPAEPAEPA
                     EPTAEPTAEPAAEAVIEPTAEPVTVPAEEPVAEPVAEPTTELVEELAAEHAEPVAEPI
                     EEEAPAEVIQDETPAEAEATKEAPAEEASPPAPEEAPAADVQPEEQQLEAEVAEEAPL
                     DNANEPAPAPPVEEEPVERAVEPVEPEPAHIGEVSVEETPAEEVPTAAEVEGEVTYIE
                     REPPETSEQNGSDECAVDDTRDGSLDATAEESGHSRRRRRRTSAWTRDRVPSKGSMES
                     YRGHLERPKGDGGILKNRWAMALDEARRQQEAKQRKEAKLKLERAQEKQRRDEAAAKA
                     KRAAERAAEKEKARLAEKRASKDSAQRRPRHVSSDHSSGSRSKRRDPSPQQEGDGLGR
                     KVIDALTTGESNTNGPLLTINAVKAVANISAAPEPVKRSSTNQSGRSSRRSQEEKQSG
                     GSSGKRPSDRREKQHDRRKDEGPSDQRTRRHDERRRTERSEEADRRERRHKKREPSPP
                     PNSRLKSLMKSISVF"
     gene            complement(<1212032..>1214020)
                     /locus_tag="TRUGW13939_10765"
                     /db_xref="GeneID:55998244"
     mRNA            complement(join(<1212032..1212325,1212383..1213150,
                     1213208..>1214020))
                     /locus_tag="TRUGW13939_10765"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493875.1"
                     /db_xref="GeneID:55998244"
     CDS             complement(join(1212032..1212325,1212383..1213150,
                     1213208..1214020))
                     /locus_tag="TRUGW13939_10765"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349768.1"
                     /db_xref="GeneID:55998244"
                     /translation="MPSPVEKPAVAEELHNSQSQESIQVVQNAHASSTEGLSLSDAST
                     MIKELHSSQSQDSIDVIPHLCRSTEGLASSNASTTAEKLPVVKEQRNSQSEENIETHQ
                     HPDQNDCSDASTIANDDTPAAVRQTTTTDLGPAIIVPRLKRRGLFAQLALVPEVENAK
                     TYSRKTRWFLTIVVAAAGATAPMGTSIFLPSLHEVTADLKSTETVVNLSIALYNLAMA
                     IFPLWWSSFSEAFGRRSIYITSFSLCVVFNTLSAISTNVSMLIVMRLLSGGAAASAQA
                     VGAGSIADMWEVRERGRAMSYFYMGPLCGPFLAPIIGGLLANKWGWRSTLWFMVIFAG
                     VVLFIILFVLPETLAVRRNPLREAEQSDTRPPLDRSTSKVSSTAVARGATKWLKALKM
                     VFIDPLAIILYLKHLPILLTIYYSAVTFGSLFVLNISVEQTFQRPPYGFSTLITGLLY
                     LPNSLGYMITSVFGGRWMDNIMHREAVKAGRYDEKGKLIYLPEDRMKENALIGAFLYP
                     APLIVYGWTVRYGVHWIVPMIANFAFGIGSMLIFAVSVTMLTEFLPRKSSAGVALNNF
                     VRNLFSCVGAMVASPIINAIGNGWLFTILGLVGFVSGAAVLTSMKKFGPRWRRGLIDH
                     "
     gene            <1215392..>1216368
                     /locus_tag="TRUGW13939_10766"
                     /db_xref="GeneID:55998245"
     mRNA            join(<1215392..1215892,1216006..>1216368)
                     /locus_tag="TRUGW13939_10766"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493876.1"
                     /db_xref="GeneID:55998245"
     CDS             join(1215392..1215892,1216006..1216368)
                     /locus_tag="TRUGW13939_10766"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349769.1"
                     /db_xref="GeneID:55998245"
                     /translation="MAEVPEIPPSAIRDHMAKFDGENYVKGWASLWDNKAEGETLPWD
                     RGSHSPALEDFLVQKRGFIGSPIAEGPDGQKYRRKALVPGCGTGYDVLLLASFGFDAY
                     GLDYSEAAVETAKKEAAKSKDNYAVRGPAVGRGNVVFVQGDFFKDDWLAKLELAPQSF
                     ELVYDYTFFCALEPRLRPQWAMRHQQLLASPPRGNLICLEFPTTKNPKWGGPPFASPS
                     FAYMEHLSHPGEEIPYDSDGKVKFDPLRETSALGLERVVHWQPVRTHKSGTDENTCEV
                     LDRVSLWRRRA"
     gene            complement(<1216399..>1217349)
                     /locus_tag="TRUGW13939_10767"
                     /db_xref="GeneID:55998246"
     mRNA            complement(<1216399..>1217349)
                     /locus_tag="TRUGW13939_10767"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493877.1"
                     /db_xref="GeneID:55998246"
     CDS             complement(1216399..1217349)
                     /locus_tag="TRUGW13939_10767"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349770.1"
                     /db_xref="GeneID:55998246"
                     /translation="MDELQARHRKEQRDLQARITQKKKNATKKNRKGVNDECDKLQQE
                     LHEKQKLEIAQLDGAPVSSAADNLENLDLKDDENESTENIPTAPPTSTPPATNNDDAP
                     ASRGKKPNRQKARLARREAERVAQAEVAAEEAAKQTDHRGNEKEVMDAEFKRIGLKEI
                     EINPDGHCLYSAVACQLDDLGLDLKPDPNRIVLQPTTLSRIDTVASAKHDGYRAVRAV
                     TADFIKEHQDDFVPFMEEPLDEYTKKIRLTAEWGGQLELQAIARAYGVDINVLQGDGR
                     IEKIESADDNADTKRQIWLAYYRHTYGLGEHYNALVQKAT"
     gene            <1217695..>1221721
                     /locus_tag="TRUGW13939_10768"
                     /db_xref="GeneID:55998247"
     mRNA            join(<1217695..1217724,1217785..1218019,1218095..1218398,
                     1218465..1218623,1218926..1218994,1219195..1219393,
                     1219448..1219520,1219615..1219736,1219798..1221524,
                     1221592..>1221721)
                     /locus_tag="TRUGW13939_10768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493878.1"
                     /db_xref="GeneID:55998247"
     CDS             join(1217695..1217724,1217785..1218019,1218095..1218398,
                     1218465..1218623,1218926..1218994,1219195..1219393,
                     1219448..1219520,1219615..1219736,1219798..1221524,
                     1221592..1221721)
                     /locus_tag="TRUGW13939_10768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349771.1"
                     /db_xref="GeneID:55998247"
                     /translation="MDVQSLFNVKGKVVLVTGGAKGIGRMITEGYITNGATVYISSRD
                     AKACEQAVGELNALGKGKAHAIPADFYKEEDIKRLAEELGKRESKLHVLVNNSGSNWG
                     APYDEYPSSAWTRVLTLNLQRVFDLTKLVTPLLEKGASEGDPSRIINIGSVDGLRVPA
                     LETFAYSASKAGLHHLSRVLANHLGKRNITSNTLACGPFRSKMMAATLRDMEEVIVSG
                     IPLSRIGTPEDVAGACLFLSSRAGSEHRLAGWKNGVEQSKIHEACESKNAALKPPLLS
                     PLSFTGWRSRGALIMTSQNRLERSVSIVSDPFSDPDVYYGEDDARNRLSHRRTFSADM
                     RSVNREDIKEFLGKLPARRGSHDESSQTPRKFLVDVDATIATLLEREDTDRNLEITIE
                     DVGPKTMSLGTAGSHGYNKFDVRGTYMLSNLLQELTVARGYGRKRIVLDEQRLSENPV
                     NRLSRFIKKMFWNALTRRIDGSNIAVAGLDPKDWTGDPRPRIYIPAGAPEQFEYYTRI
                     AEEHPEIGLDVQRLETPITPEYVKNLNLKPGLLACAMEEFTNPETGKKDLRGVPFVVP
                     GGRFNELYGWDSYMESLGLIVSDRVDLAKAMVVNFCFCVKHYGKILNATRSYYLLRSQ
                     PPFLTDMALRVYDKIKSEPDALEFLRNAILAAIKEYYSIWTAEPRYDPVTGLSRYRPE
                     GLGVPPETEASHFLHLLTPYAEKYGMTFKEFVTAYNDGVVKEPELDEYFEHDRSVRES
                     GHDTSYRLERICANLATVDLNSLLYKYEVDISRSIRTYFKDKLDIPHEFRTAQSEKIE
                     FETSAVWDRRARKRKMTMDKLLWDEEKGMFMDYDTVSHERKTYESATTFWAMWAGIAT
                     PAQAAKLVKLALPKLEEYGGLVSGTKESRGEISLTRPNRQWDYPYGWAPQQMLAWTGL
                     LRYGYQEEAERLAYKWLYMITKAFVDFNGIVVEKYDVTRPIDPHRVEAEYGNQGSSQT
                     GFGWVNASFVYGLDILNAHQRRALGAVTPYETYSKAVDQQFPY"
     gene            <1223211..>1225111
                     /locus_tag="TRUGW13939_10769"
                     /db_xref="GeneID:55998248"
     mRNA            join(<1223211..1223420,1223500..1223655,1223716..1224058,
                     1224111..1224663,1224751..>1225111)
                     /locus_tag="TRUGW13939_10769"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493879.1"
                     /db_xref="GeneID:55998248"
     CDS             join(1223211..1223420,1223500..1223655,1223716..1224058,
                     1224111..1224663,1224751..1225111)
                     /locus_tag="TRUGW13939_10769"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349772.1"
                     /db_xref="GeneID:55998248"
                     /translation="MGAQDFAAEDQKYLDEVNAVKQWWSDSRWRYTKRPFTAEQIVAK
                     RGTLKVEYPSNVQSKKLWKLLEERFNTKTASFTYGCLEPTMLTQMIKYLDTIYVSGWQ
                     SSSTASSTDEPSPDLADYPMNTVPNKVNQLFLAQLFHDRKQREERITTPKEKRDQVQN
                     YDYLRPIIADADTGHGGLTAVMKLTKLFVERGAAGIHIEDQAPGTKKCGHMAGKVLVP
                     INEHINRLVAIRAQADIMGVDLLAIARTDSEAATLITSTIDYRDHAYLIGSTNPNIQP
                     LNDLMVAAEQSGKVGDQLQAIEDQWTAQAGLKKFDDAVVDVINAGVLANKAQLIDQYL
                     KAVKGKSNTEARAIAKGITGVDIYWDWDAPRTREGYYRYQGGTQCAVNRAVAYAPFAD
                     LIWMESKLPDFKQAKEFADGVHAVWPEQKLSYNLSPSFNWKAAMSQEEQVTYIERLGK
                     LGYAWQFITLAGLHSTALISDQFASAYAKQGMRAYGELVQEPEMERKIDIVTHQKWSG
                     ANLIDHSLSMVTGGISSTAAMGKGVTEDQFKK"
     gene            <1225735..>1227584
                     /locus_tag="TRUGW13939_10770"
                     /db_xref="GeneID:55998249"
     mRNA            join(<1225735..1225892,1225951..1226981,1227039..1227392,
                     1227517..>1227584)
                     /locus_tag="TRUGW13939_10770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493880.1"
                     /db_xref="GeneID:55998249"
     CDS             join(1225735..1225892,1225951..1226981,1227039..1227392,
                     1227517..1227584)
                     /locus_tag="TRUGW13939_10770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349773.1"
                     /db_xref="GeneID:55998249"
                     /translation="MAARDESINIKPLEFTSVEEVAKKSATARGAFYDSKTRSADFRK
                     LQLRKLYWAIHDNQDRIHEALARDFGKPSYEAYLTESSWMMGDILFTLKNIDKWLKDE
                     SAPDIALPFKPLSPKIRKDPMGTVLIVGPCNYPFQLTMVPVFGAIAAGNSVVIKPSEQ
                     TPNSAVVMQEIVEAALDPSCYTIVQGGIDQMKALLDERWDKIFFTGSHAVGRIISKAA
                     APYMTPVVLELGGLNPAIVTRNANPRIVARRLLWAKSMNAGQTCTAQNYVLIEKSVLP
                     AVLEELKKAYKSFYPNGSKGSPEYSRIVSDRAFQRLKKMIDDSKGKIIFGGATDEKER
                     YIEQTFIQVDSLEDSMIVNEAFGPICAVVTIDNVDEAISIAKKVQDTTLGIAVFGNSA
                     EQQKVMANLRSGSVSLNDAQPHINTLAFGGIGESGSGAYRGRSSFDTFVHRRPYTNTP
                     GWMDALLDVRYPPYPASKLRMVNATMVGTPDFDRNGRQSRFTWLKYIIGGSPKSAATR
                     VAAAAVDDQPATNGHQDTNGVGSEIPKV"
     gene            complement(<1228275..>1230203)
                     /locus_tag="TRUGW13939_10771"
                     /db_xref="GeneID:55998250"
     mRNA            complement(join(<1228275..1229628,1229684..1230103,
                     1230160..>1230203))
                     /locus_tag="TRUGW13939_10771"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493881.1"
                     /db_xref="GeneID:55998250"
     CDS             complement(join(1228275..1229628,1229684..1230103,
                     1230160..1230203))
                     /locus_tag="TRUGW13939_10771"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349774.1"
                     /db_xref="GeneID:55998250"
                     /translation="MSGAIKALYIYDEYNAPILEHTYRSRLPSASSLIRLFLAHPAPR
                     PSLIYLPEASPPVTVFSIVHSNLLFLSPSDVDTEPLLVLEFLRRVVDVLEEFVGAPLL
                     ATKLQTSYDVVAQLLTEMCDAGLVSSTEINSLQENVETPNWMNKFLSGVGLPGTSSPG
                     LTPLNPHKAQLSSTAASAASGPAIPWRRPGVRHTSNELYVDIIETLSVTIAPSGRLLS
                     ALVSGTIAFTAKISGVPDLLLALTTPGGQRAINQKMELPVFHPCVRLARWRERPGELS
                     FVPPDGRFILAGYEADLLPIDPNIDAPPRHMEKLFLPAFVDIKKSLGPSGKDFEVRLT
                     LNTSFPGANSGFRPSGGGRNGSGSSTPSFLGAGSSANGSSSPTLEEVVVHVPVSKAVR
                     NITDMRPSRGDTIYSPGDSYLEWRIPTKDAGTVSGTATLRCTVLGYQDDLDDAEAELA
                     AGQEMLQGYYDADSYQQDPTTYAAEPGPSGKPKKARKQKSTKTKKTKKTKSKKVSTAT
                     LDPQSTITPSKLSPSETPPPQNPPFRETASRKEKLLSALMPTSASVSFSVKGWLPSGI
                     RVDSLNIDPRKSRGLGEGVRPYKGVKYLCVSRKGVERRC"
     gene            <1230568..>1230917
                     /locus_tag="TRUGW13939_10772"
                     /db_xref="GeneID:55998251"
     mRNA            join(<1230568..1230676,1230736..>1230917)
                     /locus_tag="TRUGW13939_10772"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493882.1"
                     /db_xref="GeneID:55998251"
     CDS             join(1230568..1230676,1230736..1230917)
                     /locus_tag="TRUGW13939_10772"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349775.1"
                     /db_xref="GeneID:55998251"
                     /translation="MNPPKDRAPWELKAEEVEKQMAGKEQFEDCLSCRATGSAAFIGL
                     GVYSYYTGIRNLKQREQIIMRSASKYKMGSRQLGIATTSAALVAVGIWRAFN"
     gene            complement(<1231282..>1232058)
                     /locus_tag="TRUGW13939_10773"
                     /db_xref="GeneID:55998252"
     mRNA            complement(<1231282..>1232058)
                     /locus_tag="TRUGW13939_10773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493883.1"
                     /db_xref="GeneID:55998252"
     CDS             complement(1231282..1232058)
                     /locus_tag="TRUGW13939_10773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349776.1"
                     /db_xref="GeneID:55998252"
                     /translation="MDSMRSLNTSLPSSTSYSQPPEQLLQAFKAAALSVTNLYKSAAS
                     DQAQAKQAGYQEAIEDLLHFLDRENLGLGDGEGWKVRQWATERAEGTFDSDDDDKQTR
                     SSPPAVLRKEQRDKPQQDSSSSPQVESPIEPHASTNHEQSTALPTGDSSTLMRPSIFT
                     FSAGPQFPSMSPDMDTQTPDHTPVNSASSVDTPGVGISVLPRNPWSANRHNNSTRRSS
                     ARDSGTSFGNKRKHHVPDFFDVSGLNGRDLFGGGKRGRFA"
     gene            <1232770..>1239606
                     /locus_tag="TRUGW13939_10774"
                     /db_xref="GeneID:55998253"
     mRNA            join(<1232770..1232937,1232999..1233025,1233078..1233218,
                     1233282..1236248,1236306..1236409,1237951..1238299,
                     1238355..1239367,1239591..>1239606)
                     /locus_tag="TRUGW13939_10774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493884.1"
                     /db_xref="GeneID:55998253"
     CDS             join(<1232770..1232937,1232999..1233025,1233078..1233218,
                     1233282..1236248,1236306..1236409,1237951..1238299,
                     1238355..1239367,1239591..1239606)
                     /locus_tag="TRUGW13939_10774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349777.1"
                     /db_xref="GeneID:55998253"
                     /translation="RPRSYSIASGVQTSKMAPSRNLPDSDASSQADTPMTDGNDDSTA
                     RISVDEPDYPMADYQETPDYTDSDTNPNTTASSVAGDSPHTDGRKRKAEESQLKKILK
                     KQHGRLDESKEDDSIRRFRYLLGLTDLFRHFIETNPNPRIKEILAEIDRQNSDETAKT
                     KGSSRKGGAGGDRRRRTEKEEDAELLSDEKRGGETTTVFRDSPSFVKGEMRDYQVAGL
                     NWLVSLHENGISGILADEMGLGKTLQTIAFLGYLRHICGITRPHLVAVPKSTLDNWKR
                     EFERWTPEVNVMVLQGAKEERQKLIADRLEKEDFDVCITSYEMILREKSHLKKLPWEY
                     IIIDEAHRIKNEESSLAQIIRLFSSRNRLLITGTPLQNNLHELWALLNFLLPDVFGDS
                     EAFDQWFSSQDSDQDTVVQQLHRVLRPFLLRRVKSDVEKSLLPKKEVNLYVGMSEMQV
                     KWYQKILEKDIDAVNGAAGKRESKTRLLNIVMQLRKCCNHPYLFEGAEPGPPYTTDEH
                     LVDNAGKMIVLDKILTRMKKQGSRVLIFSQMSRVLDILEDYCVFREHSYCRIDGSTAH
                     EDRIAAIDDYNKEGSDKFIFLLTTRAGGLGINLTTADIVVLFDSDWNPQADLQAMDRA
                     HRIGQKKQVIVFRFVTEKAIEEKVLERAAQKLRLDQLVIQQGRAQQQGKGAASKDDLL
                     GMIQHGAADLFKNPGGTLASGGDITDDDIDKILRKGEERTAELNKKYEKLGIDDLQKF
                     TSDNAYEWNGEDFTNRKKDIGISWINPAKRERKEQFYSIDKYYRQALATGGRTADTKP
                     KVPRAPKQVAIHDWQFFPPRLHELQEKETAYFHKEINYKAQLVEGTEDDLSEREANRD
                     LEQQEIDNAVPLTEEEQAEKVRLSELGFSTWNRRDFQQFVNGSAKFGRTDYAGISTEV
                     DSKEPQEVKEYAKVFWERYDEISDYPKYLRVIEQGEEKVRKNTHQRKMLRKKLDMYRV
                     PLQQLKINYTVSTTNKKVYSEEEDRFLLVMLDKLGKEDDSDAIQIFERMREEIRESPL
                     FRFDWFFLSRTPVELSRRCTTLLNTIAREFEGDPKANGEGGKGRGRDRVEEEGDEDED
                     EAPAKKKTKGSAVNKKLNTVKGGSKGTSTNTSRAASVSSTTKSKGKKNSMASKINLIL
                     NPKYQRNGLKSYVHLLRKYGFNPTLEGPYFHASSVTQQGKFSAQGHRPVGGRARVSRI
                     LQKKTDGQSGDVPADDVQNDSLYLAQVGIGSPAQTLKLDFDSGSADLWVWSTELPSST
                     QQSGSSHTIFDPSKSSSWQEPSGETWKISYGDGSSASGDVGNDVLNLGGLEIKGQAIE
                     LAKTLSSQFEQSEGDGLLGLAFGSINTATPNKVKTPVENLIANNLFPQDSQLFTAHLG
                     ASGEKGDTSFYTFGYIDQDTVSATGNKISYAAVDNSQGFWTFQSTSATVNGKTVDRSG
                     NTAIADTGTTLALVDDDTVKAIYDAIPNSKYDSSQQGYVYPSDTAVDKLPSVTFAVGD
                     TQFAVHKSALGFADAGSGFTYGGIQSRGSNTFDILGDTFLKSVYAVSMAIVLCVCVLE
                     LIRISRFSMLATPSLALSRSPTQMLPPAPNAFLQQIMRTEKS"
     gene            complement(<1239610..>1241523)
                     /locus_tag="TRUGW13939_10775"
                     /db_xref="GeneID:55998254"
     mRNA            complement(<1239610..>1241523)
                     /locus_tag="TRUGW13939_10775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493885.1"
                     /db_xref="GeneID:55998254"
     CDS             complement(1239610..1241523)
                     /locus_tag="TRUGW13939_10775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349778.1"
                     /db_xref="GeneID:55998254"
                     /translation="MISLTSRSFRICDRSRPVFGALLRQNSISGVRFASLTSAIERGK
                     RRSVAVEERGGRSFGENKRTWEERGKRSSEGGDRRSREGRDKRSFEGNSKKPWEERGK
                     QSFEGKDKRSSEERGKRSFEGNNKKPWEERGGRSFEGNDKRSSEERGKRSFEGNGKKS
                     WEERGKSTSHSPRKESSKQWDQSSPRSRTPGPGFNLDEEEFIRTGKMRQKAKDTAIRE
                     DRHDEEPEKEISWIRREGNKDTLRKLKHGRNHHRYTNEFPERVKSQVLVPSAIPYTTA
                     ASVFVYGASAVEAALRCSRRKLYKLYIYQAEGEELTTQQNLLRKMALAQGVTVKMAFA
                     GWDTMMSKMSDGRPHNGFVLEASPLPTLPIANLEPVPDPTANVFHVKLNPQSEEEAKV
                     NGSSNEVQRAERYDEASRSRFPLILLVDGIVDPGNIGAIIRSAYYLGVDGIVYAGRNS
                     APMSPVTAKASAGATESMTFLKTVNPQEFVQASRKNGWRFLAADSPRNVFERSSDVIS
                     VDRAAGTNTTSLLTEAPTVLMLGNEGTGLMERLKVRADGLISIPGAHFRHQEGILSDA
                     AGVDSLNVSVAAAMLIEMLMRTPLQVTDLPALERQEKEKEKEKEKEKETLPPSVAQEA
                     VPQEVAPQSFDFN"
     gene            <1241840..>1246743
                     /locus_tag="TRUGW13939_10776"
                     /db_xref="GeneID:55998255"
     mRNA            join(<1241840..1242196,1242261..1246029,1246088..>1246743)
                     /locus_tag="TRUGW13939_10776"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493886.1"
                     /db_xref="GeneID:55998255"
     CDS             join(1241840..1242196,1242261..1246029,1246088..1246743)
                     /locus_tag="TRUGW13939_10776"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349779.1"
                     /db_xref="GeneID:55998255"
                     /translation="MASDDNQDFSPASEDADEFVADLLQQFSSVSGGAKEPATKSASS
                     TSIRNSFRAVNARSSSSASPSRESTIVAVEVPPPRSDVEYERLPGYSTARDVLRQKYA
                     DGESLYQVELQNWEKEWMALSDLKKLNNGLASLVRFQKQGPPTKRTSIRRRGDIVSAD
                     HIIYSDDEEDEEEEDDDDDDDDDDLIVAGPSTRRPGRPSRARRPGRPPRRSTTSEEED
                     ARPVRRPNRQTKLLETRRNTFWSSDENSSDDTGSGTRRRRSARQTNQRSSRKIRAQFS
                     DSESDMRSSRPGARFSTRTKNSGRKNLRERREDEISENEQAPTEKKYFGAKEKFYKVS
                     SDDPFRLRHRQVCEVCAGQGNDREKGSLVFCQGCTSAYHKACLGPRGSREHLVTKVDP
                     DHFVLQCRRCIGIAHKKDGAAPHLGQCVSCNETNPASRPFRERLNPRLEQQQRENNGG
                     VDPITTVEPSLINNPDHLLFRCIGCTRAFHFDHLPPKPDPKANDDAEMPDAESTPSEL
                     ANTRFKQYSRKWRCHTCTSASGEIEGLVAWRPVDADSYTPGFAVDDLEEKEKEYLVKW
                     KRTSYFRTTWMEGSWIWGITSPLMRKAFFRSPTSHKPHMTMTDAIPEEYLRIDIVLDV
                     KYTNIVSTHSKEIDMARVKDVKEAYVKYKGLLYEDSVWETVPSPSDGERWDDFKAAYE
                     DWVSKDYVRIPKGPALKQYLATVREQDFQTTLVKKAQPSSLTGGEIMDYQLDGLNWLY
                     YMWYKEQNCILADEMGLGKTIQIISFLATLVEDHRCWPFLIVVPNSTCPNWRREVKKW
                     APSLRVVTYYGSAIARRIAHDYEMFPNNARDLRAHIVVASYESMVEEKARKVLAGIPW
                     AGLVVDEGQRLKNDKNLLYASLSRINFPFKVLLTGTPLQNNTRELFNLIQFCDPTRSA
                     QDLEEKYETLTKENVPELHDLIRPFFLRRTKAQVLTFLPPMAQIIVPVSMSVVQKKLY
                     KSILAKNSKLIKSIFQNNQDQNNKQNERHSLSNILMQLRKCLCHPFVYSKQIEERTSN
                     PVLSHRNLVEAAGKLQLLEHLLPKLKERGHRVLLFSQFLDNLDVVEDFLDGLGLLYLR
                     LDGSMGAHEKQKKIDAFNDPKSEYFAFLLSTRSGGVGINLATADTVIIMDPDFNPHQD
                     IQALSRAHRIGQKKKVLVFQMMTRESAEEKIMQIGKKKMALDHVLIERIDADDDEGVD
                     LESILRYGAEALFEDDDTGDIHYDAESVEQLLDRSQAEDTEVGKDASAESQFSFARVW
                     ANGSGALEDRLGDSDAPAPPSNTLWEKILAERQKAAEEEALANAQALGRGKRKRNVVD
                     YTTKDNNKEEQSPPAKSKRPRVQLDSDAEFKSNNNASESEEIESEEEHTPVKKVKGRP
                     FKRVDPTRTSPPSLDGTSDARPSSNYIGRHLLPCVACNVMHPVGYCPLKLAGVEHCGL
                     CGIAHIGYQRTCPHLNSEEQILSMLQSLKQSTEPKWLVDRARHYLHMVKGDLVNRRKK
                     ADAAAKGLSGGPATIPPPPFSSVPRPSTTPASQSAFHVPSGNSPNIPPPPFSSISHPG
                     SNGQQPPPPPPSRFPPPLQPSHSSQSPRPFRLPRPHLPPRP"
     gene            <1248761..>1250034
                     /locus_tag="TRUGW13939_10777"
                     /db_xref="GeneID:55998256"
     mRNA            join(<1248761..1249057,1249127..1249208,1249273..1249482,
                     1249542..1249674,1249728..>1250034)
                     /locus_tag="TRUGW13939_10777"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493887.1"
                     /db_xref="GeneID:55998256"
     CDS             join(1248761..1249057,1249127..1249208,1249273..1249482,
                     1249542..1249674,1249728..1250034)
                     /locus_tag="TRUGW13939_10777"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349780.1"
                     /db_xref="GeneID:55998256"
                     /translation="MPELRPQFFLGRDDGSIVPLIALDELPPHVSIRGVPRNMSLGEA
                     EDMKNLGQIPWYGVYHVDLVKDRVGITTHPTNDTVAAITPYNGGSKGKSRLSEKKVNG
                     SPSKQIKVYCTYWIRHGECDFAQQGCRFRHVMPTDLPTLQSIGFSDIPSWYREKGGLE
                     SLRSGPSSTGLPKGNWRKPSTPPKTIAYHDEDTLGNGNPLGPTEKPGDKALDHHDNAR
                     PSPELIGRASGFENTAGYPYIQDTFLVSPASTPSMSHTVDSLSPRSSLGGHNLWSPTD
                     QKVKGRHTVASGGQACEKMVDDSEPEYRSITELLPYSVPEDRFGNITTERSTPERAMA
                     YWCWGPCF"
     gene            complement(<1250707..>1251969)
                     /locus_tag="TRUGW13939_10778"
                     /db_xref="GeneID:55998257"
     mRNA            complement(join(<1250707..1251305,1251375..>1251969))
                     /locus_tag="TRUGW13939_10778"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493888.1"
                     /db_xref="GeneID:55998257"
     CDS             complement(join(1250707..1251305,1251375..1251969))
                     /locus_tag="TRUGW13939_10778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349781.1"
                     /db_xref="GeneID:55998257"
                     /translation="MASTSKALSRAALMLSRRPPPGRPQVFNSQIASIGRQQTRFFSP
                     SPFSYDRKKDRDEPKDISPMDLEQIPDYSIKDFTKAEKTMYELMSPEEQALFDAENKR
                     FVDMWNDPAQRQRDSAMIEEGAKQVDREAEMRFEDVKDRGRGIWANEEDDEFAKTEDG
                     DDVFHDDEMTSMAHAELELHREVREFARIAAWDMPLLSKLAKPFELPKQNQILRFRYT
                     TYLGEQHPAEHKVIVELSTKDLVPKHLTEKQRETFLKLVGPRYNPDTDIVRMSCEKFS
                     ARAQNKRYLGDTIKSLFKEAKEGDAFTDIPLDLRHHKPKVQHTFPESWKLTETRRRQL
                     AADREGRINAEKARNSIVDGKESVAYAIRTQPSLSKFPHLHAAEGNAAVKETVPRGKI
                     QRLKR"
     gene            <1252428..>1253153
                     /locus_tag="TRUGW13939_10779"
                     /db_xref="GeneID:55998258"
     mRNA            join(<1252428..1252752,1252814..1252952,1253015..>1253153)
                     /locus_tag="TRUGW13939_10779"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493889.1"
                     /db_xref="GeneID:55998258"
     CDS             join(1252428..1252752,1252814..1252952,1253015..1253153)
                     /locus_tag="TRUGW13939_10779"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349782.1"
                     /db_xref="GeneID:55998258"
                     /translation="MDRTPRKVCFVTIGATAPFDTLLSNVLDQPFLEALGKNEYTTLL
                     IQYGKEGRVVFDDYIAKFPSGKPERYGLDIQGFDFKKDGLLPEMRSTKSDYKLDTVEG
                     MILSHAGSGSIMEALRLGVPLVVVPNPDLQDNHQEELAREIEKNGWAVTGKLDSLADS
                     VHKAEVLRTASRQWPPVNSGESKYQSGLAGVMADEMGFVD"
     gene            <1253794..>1255059
                     /locus_tag="TRUGW13939_10780"
                     /db_xref="GeneID:55998259"
     mRNA            join(<1253794..1254561,1254629..1254943,1254997..>1255059)
                     /locus_tag="TRUGW13939_10780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493890.1"
                     /db_xref="GeneID:55998259"
     CDS             join(1253794..1254561,1254629..1254943,1254997..1255059)
                     /locus_tag="TRUGW13939_10780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349783.1"
                     /db_xref="GeneID:55998259"
                     /translation="MAEASLHNVPIVIDNGSGTIRAGFAGEEIPSCYFPSFVGRPKHP
                     RVMAGGLEGDVFIGQKAQELRGLLKIRYPLEHGIVTDWDDMEKIWHHVYESELKTLPE
                     EHPVLLTEPPLNPRKNRDIAAQIMFETFNIPALYTSIQAVLSLYASGRTTGVVLDSGD
                     GVSHAVPVYEGFAVPNSIRRIDVAGRDVTEQMQLLLRKNGHVLHTSAEKEVVRMIKEK
                     VCYVSLDPKREEKDWINSYHKSESKTVDYALPDGHKIKIGQERYRAPEILFDPEIIGL
                     EYPGVHQIVQDAITRTDLDLRKALYLNIVLSGGTTLCKNFPDRLMREIKKVAVEEMKI
                     RISAPAERKYTTWIGGGILAGLSTFRKMWVSADEWHEDPEVIHRKFA"
     gene            complement(<1255500..>1258495)
                     /locus_tag="TRUGW13939_10781"
                     /db_xref="GeneID:55998260"
     mRNA            complement(join(<1255500..1257016,1257104..1257389,
                     1257453..1257860,1257923..1258001,1258056..>1258495))
                     /locus_tag="TRUGW13939_10781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493891.1"
                     /db_xref="GeneID:55998260"
     CDS             complement(join(1255500..1257016,1257104..1257389,
                     1257453..1257860,1257923..1258001,1258056..1258495))
                     /locus_tag="TRUGW13939_10781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349784.1"
                     /db_xref="GeneID:55998260"
                     /translation="MADPLSIAGTALGVVSLALQVRSEITSYCKAWRGAREEIQDVAN
                     KAEGLVVPLEALQEIIQDTQFTNPDIANDLLSKVDVLRVGIEKVQASVEKCRPDFEAF
                     AGESFSDKFRAHRKRAVYPFRKDALRALATDLDGMQMNLQTTLHIFSAQNVRLIPSMV
                     AMQGKLLREVQEMHLSLQRVSNGPSQPPPALLESWCTQQQKQEKVITSRSNAAAKKYR
                     YHSRLLGVTVAASFSLTRGAGGFSIAPYLSILIPVSRNSPAFRTMFFYPLMAKSLDPS
                     EFVDNTIELLKYLFEERQASPSDTTPDGESLLDAACFAFRQGSEYHRDAYTHFSRLLM
                     FLIHSGAVLDRSRLKYTGLDSFLGAFPLEEDEHGLHRLLIQQGGFATINGAFQTRLSI
                     PNMRRALEEDETAVHIPEIAKSIIQQSEVHLRQEIRSGASVNQIFGNSTLLQLSVSWS
                     KGIQILLEAGADINTFCYSYPLEMAIRGNYYESAKALLKSGCPLNLEYVSLSENLNDE
                     GKMSFLLIAELVSRRKRLLKVAQAHIPSRVLDELFPKENDSTIPDINVPKIIATLAER
                     GVRLDSSLEIESPGSIYHHAFVKPRTLDRLYEAGFDRVDLYDSTGRTPLMIPSVCQSL
                     NGYCQKRVKWLLSKGADPNRKLPWNTGGTAFHLLAVCMTNTLWPSTVRAWISGTPNIR
                     EKNEDPLLFTRYVLETAERDSCICACVTGPTTDGDEDEDEDEDGGEFRGCTPFTAALR
                     SLISPPPRFYTQEAERSGINSFAETIGFFISLVGTTTEIEHAVIRLMTFDALDLRHTC
                     CRDSNFQQTLKRPDEDEVHEIRDEEQRLLEGFERLVAELTSKFENSSLVIMDFLQGPW
                     YRDVVEYLSHLDPCDEEHVKGTQGIGLNLEVAGGVLDRTSLLVGSRIEELPDE"
     gene            <1259046..>1262342
                     /locus_tag="TRUGW13939_10782"
                     /db_xref="GeneID:55998261"
     mRNA            join(<1259046..1259211,1259265..1259969,1260552..1260819,
                     1260886..1261100,1261160..1261290,1261341..1261439,
                     1261495..1261708,1261759..>1262342)
                     /locus_tag="TRUGW13939_10782"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493892.1"
                     /db_xref="GeneID:55998261"
     CDS             join(1259046..1259211,1259265..1259969,1260552..1260819,
                     1260886..1261100,1261160..1261290,1261341..1261439,
                     1261495..1261708,1261759..1262342)
                     /locus_tag="TRUGW13939_10782"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349785.1"
                     /db_xref="GeneID:55998261"
                     /translation="MSNSSNHELRIAVIGSGTIGLSFAALHLSHPSKATQVVIYDPRP
                     DLKEYIESTLPNYLDSSLSSLSSLLDSNRLVIGSSLPSAVEAADIIQEQGPENVAFKQ
                     SIWPQIEKAAPATALFWSSTSGIPASVQGADMQEPARLLIVHPFNPPHIMPVLEVVPS
                     GGANGSLASKPYIERTVEYWKALNRLPVILQEEVTGFVANRLSFALLREAVHLVNSGV
                     VTAEEVDRIVEESMGPRWAVKGPFWSYHAGGGKEKGLKGFLEKIGDTVQACWDDAGTP
                     SLQRDGNGPSAWERSPYQLPLPTALQLLTFIPSVDLVYDCSSAHMSQWEASNDLEGAA
                     GANDDFDSHAPGPSQAFAPLKEQHDDGYYAGGGGQDAYVGDDTCRNCGQPGHFARECP
                     EPRKGGGACFNCGEEGHNKADCPNPRVFKGTCRICNEEGHPAMECPQRAPDVCKNCRK
                     EGHKTSECKDNRSFDLNDVPDKTPQEAWAGLKKADEERDLDDFRDAFKVYAKAEPAVT
                     FVDIEKKLRAENANVYLIALEKQKEGFESYTLIDLQGKLDCTYVVSFFFSAKPQRVSF
                     KERWPESPEQNLERLEDAGFAYDRMIPKCGNCGELGHGSRGCKKEREEIVRMTVTCVV
                     CNEAGHRARDCTQERKSKFGCRNCGAEDHKAAECTEPRSMEGVECRRCNEMGHFAKDC
                     PSAPAQFAKACRKCGAEGHISRECTEEQNMDLIVCKNCDATGHYSRDCPKPRDYSRVK
                     CNNCGKMGHTVKRCSQPVAEEDTTMIAGEEDAEVAPPPAASGTWGNGDAGDGW"
     gene            <1265101..>1266877
                     /locus_tag="TRUGW13939_10783"
                     /db_xref="GeneID:55998262"
     mRNA            join(<1265101..1265320,1265381..1266512,1266580..>1266877)
                     /locus_tag="TRUGW13939_10783"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493893.1"
                     /db_xref="GeneID:55998262"
     CDS             join(1265101..1265320,1265381..1266512,1266580..1266877)
                     /locus_tag="TRUGW13939_10783"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349786.1"
                     /db_xref="GeneID:55998262"
                     /translation="MAKSYLGLRGTKLNIAVGVIAGLDFFLFGYDQGVMGGLLTLDSF
                     IATFPQLDTSSDNYKSLSQAGQLRQSNIQGISVAGYNLGCFVGSIVCIFVGNKLGRRK
                     TIFVGSAIMVVGAILQCTAFGLPHFIVGRLITGIGNGLNTSTVPTWQSECSKAHRRGQ
                     LVMVEGALITGGICFSYWLDLAFSFLDPNTVSWRFPIAFQIIFAVIILAFVMLLPESP
                     RWLIFQGREDEATEVLGALLDLPTDDVLIENEFSAIKDTVLEAANTSWRDLFTMGEDR
                     HFHRVVLAYVNQMFQQISGINLITYYAPVIYQNSIGMGSLMSRILAACNGTEYFIASW
                     LPVFIIEKAGRRPLMLVGAAGMSISMVILAVCTSFEGNSQAGIGAAVFLFVFNTFFAW
                     GWLGMTWLYPAEIVPLRIRAPANALSTSANWIFNFMVVMITPPAFQSIKYKTYIIFAV
                     INAFIFPVVYFFYPETSYRSLEEMDAIFRKTTSIWDVVKVAADEPLRYGKNGELLINY
                     TETDEHFRRASHVSEKRGNKQHADPAYQAELGHAEEISDTS"
     gene            complement(<1267673..>1269195)
                     /locus_tag="TRUGW13939_10784"
                     /db_xref="GeneID:55998263"
     mRNA            complement(join(<1267673..1267693,1267745..1268671,
                     1268943..1269035,1269104..1269136,1269193..>1269195))
                     /locus_tag="TRUGW13939_10784"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493894.1"
                     /db_xref="GeneID:55998263"
     CDS             complement(join(1267673..1267693,1267745..1268671,
                     1268943..1269035,1269104..1269136,1269193..1269195))
                     /locus_tag="TRUGW13939_10784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349787.1"
                     /db_xref="GeneID:55998263"
                     /translation="MTSSAVISNTENLLKYLSLDQKGKVLAEYIWIDAEGGVRSKTKT
                     LSKAVTSADELPEWNFDGSSTGQAPGDNSDVYIRPVAIYPDPFRGGDNILVLCETWDS
                     DGTPNKFNHRHEANKLMDTHASQHFWFGLEQEYTLLGPDGWPFGWPKGGFPGPQGPYY
                     CGVGTGKVYCRDIVEAHYKACMYAGINISGINAEVMPAQWEYQVGPCEGIEMGDHLWL
                     SRFLLHRVAEEFGVQISFHPKPIQGEWNGAGLHTNVSNDDTRADGGMKAIEAAMKKLE
                     SRHVEHIAVYGEGNEERLTGRHETGSIDKFSYGVADRGGSIRIPRQCAKDGKGYFEDR
                     RPASNADPYQVTGIIVETLCGGAN"
     gene            complement(<1271257..>1273483)
                     /locus_tag="TRUGW13939_10785"
                     /db_xref="GeneID:55998264"
     mRNA            complement(join(<1271257..1271802,1271861..>1273483))
                     /locus_tag="TRUGW13939_10785"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493895.1"
                     /db_xref="GeneID:55998264"
     CDS             complement(join(1271257..1271802,1271861..1273483))
                     /locus_tag="TRUGW13939_10785"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349788.1"
                     /db_xref="GeneID:55998264"
                     /translation="MATPSSRQNPGATPTHLTSSPHPSAVSMGRGLSHKSPSTKTPSG
                     SGPGHGLQQQQQQQQQQQPSSFSYQGATPLAAAVALEDPVSFSSPSALLALGSFTGMS
                     PAMNVQEGLVGSGMNESDIQALGLGLGGGGSARNHEEERRKHIEVVEQLLRERVSGRG
                     VSREAVERLGQLEGFESIWQENSLSIAGNSVDLEIEFYPGEDNVKDVSLSYASPEVEG
                     EGERRDEATAIVKGDLMQTLEERENGIWKPLWGFHENLARLARLDKLSQEVNCFEAVE
                     GLFESLQKVWEAEEKRDSYRDTYEHSCRGSVGRPNLHRAGRVGMGLEYWVDDHRLLHT
                     NTSPDAMAVDGSDHNTEGLKTRSATIECEAGYPSLRISKEWVAGDILTTIDAPDDSSG
                     PETIVNWTEPPPTLHSSANGLDSGMGGGGTPNRRFVAKLDPPVDVPLLVANDIYRNLG
                     MQVPQEYRTTTYDALLVNGWTRGTTESTSASSDTLESVRRRRQATVLSFNAENEPVQN
                     GHSYSFQAFEAAPGRVIREFPFSHPRQLAEIFPILRQYGLLATLIRKLFPPVKGGGKT
                     NITPQLSSETSKTMSMYQEKTRTDDHITVLSNNDPDEELLDRLLGSANSDTGLEGEKA
                     NNKDVSVDITLRTQVAQPPLIMLLITVPESRTKSSAGPELQNVSVDLEIRLNGRVKVT
                     QVSGLSENDAAISKRLNRVLEVSEDLGVLVEYVIGQLQGA"
     gene            <1273901..>1274803
                     /locus_tag="TRUGW13939_10786"
                     /db_xref="GeneID:55998265"
     mRNA            join(<1273901..1273996,1274050..1274477,1274538..1274617,
                     1274667..1274697,1274746..>1274803)
                     /locus_tag="TRUGW13939_10786"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493896.1"
                     /db_xref="GeneID:55998265"
     CDS             join(1273901..1273996,1274050..1274477,1274538..1274617,
                     1274667..1274697,1274746..1274803)
                     /locus_tag="TRUGW13939_10786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349789.1"
                     /db_xref="GeneID:55998265"
                     /translation="MATMAIGPRRAWNIGRWANVRSVSTLQGHPYIYTFPDSARPGHH
                     VLSLLSSEPPKAELAIGTTSKLPPTPDSFTENSKFLQILQEVVSEYATEDPEVKSQAQ
                     VMISTAGANLGSGGVFFAQNRKPHRPRYGGGGGTGGDSAGGASGQGGAGSGGRGGWIH
                     VSDSRRPPEYGRIAWPEDIFGSVEVDSNGEFVGEKGNYQSSGTYRIITRDGILGLSPF
                     LREKLVQRLRKQ"
     gene            complement(<1275207..>1277111)
                     /locus_tag="TRUGW13939_10787"
                     /db_xref="GeneID:55998266"
     mRNA            complement(<1275207..>1277111)
                     /locus_tag="TRUGW13939_10787"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493897.1"
                     /db_xref="GeneID:55998266"
     CDS             complement(1275207..1277111)
                     /locus_tag="TRUGW13939_10787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349790.1"
                     /db_xref="GeneID:55998266"
                     /translation="MGPAVPLPLSDEWDDDVDSYIDALLSFATTTPLFLNLCGGVHIL
                     DFLTSDPDLYTTLLPEDWRRFFDQHELYDILDLLLKEDVAHFPVEEDNHTIKGSSWKN
                     GPPPPPSLVRYIRDIRRLSLKRKVTPPPTRPSSGQASAIPRRVAVGMKSKKLHEVEHF
                     SKYVDSFATNVSQTRDEPVTHIVDFGSGQNYLGRTLAHSYNRHIIAIERRHAYIQGAR
                     GMDVHAKMAEKKVNVVKKRMQSNANGPDDDGDDASAQACESCPPQGGEEDKQQNEDDV
                     TVFKVFSELDINQDDLPSIVNTSTHKPKEEENRGPRGAMDYIEHEIKDGYLEPIIQHV
                     VDPTKTEGDSTETHGETSNDARVVVVSLHSCGNLLHHGVRSLVLNPSVVAIAMVGCCY
                     NLMTERLGPATYELPVLRHMHQRLAVGANENDPHGFPMSSMFEQYAYPGGKGITFNIT
                     ARMMAVQAPYNWSVEESRNFFTRHYYRALLQRIFVDRGTVPRPKLANLDALIGGDNNN
                     DDDEPLIIGTLRKTVYETFPTYAKAAIAKLAKNPVHSEKMTRLNNEITTEDLEKYVAD
                     YAYAKKNLSLVWTLMAFSSAVVEAIIVIDRWQFLREHMASGLVRECWIEPVFDYAESP
                     RNLVVIGIKN"
     gene            <1278403..>1279515
                     /locus_tag="TRUGW13939_10788"
                     /db_xref="GeneID:55998267"
     mRNA            <1278403..>1279515
                     /locus_tag="TRUGW13939_10788"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493898.1"
                     /db_xref="GeneID:55998267"
     CDS             1278403..1279515
                     /locus_tag="TRUGW13939_10788"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349791.1"
                     /db_xref="GeneID:55998267"
                     /translation="MPIDDHLFGRVPDVLFLILSMGDAATIPALCRLNRATYETIKAH
                     ETLICTAFLRHHDISPPLDRILTMDPVSGQRAALDFLSLQKFMYRRETARKLASRVAR
                     SGWGAWWAIKGSGEMDAEAEMFRQRVERGLYVMFHMSDIARSVEETPVQPYSLAFSIY
                     RVILCSCLFRLPFDRARANRSWWFPRHMSHIYVVLLRKPQQREVGKQRWRFRQKLDLE
                     RRIDFHIALQMLRQFLETIIFAHSPDDDRSISSLKEDLDVTNWFLLRQSAHSLSRIFL
                     ELPDAKCCSIEDRARKNNAKDHRDNPVCTYSEVLKEYWDARRGDSAVDCKQCETWLRS
                     SSTETILNDFFGLHAYNLGKEWVRQMRGEGELLFEM"
     gene            <1279976..>1280862
                     /locus_tag="TRUGW13939_10789"
                     /db_xref="GeneID:55998268"
     mRNA            join(<1279976..1280007,1280067..1280710,1280786..>1280862)
                     /locus_tag="TRUGW13939_10789"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493899.1"
                     /db_xref="GeneID:55998268"
     CDS             join(1279976..1280007,1280067..1280710,1280786..1280862)
                     /locus_tag="TRUGW13939_10789"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349792.1"
                     /db_xref="GeneID:55998268"
                     /translation="MSDDPFLQVQSEVLNTLQTTRPLYASFLRIRSLTTSSSNPELQQ
                     SRTELESTLTDLRADLADLVESVRAVELDPYRYGLELDEVERRRKFVAEVGGEIESMA
                     GEMAKSVVEQQQQEHEQQQQRKNQSLPNPAEFDTDDDNNNNERGDYYSAYEEQRQVEM
                     MSNQNEQLDGVFRTVGTLRQQADTMGRELEDQTVLLDDVDFLADRVGGKLASGMKRIG
                     TIVKKNEDTYSSCCIAVLITVLILLLILVIAL"
     gene            complement(<1280940..>1282184)
                     /locus_tag="TRUGW13939_10790"
                     /db_xref="GeneID:55998269"
     mRNA            complement(join(<1280940..1281049,1281112..1281993,
                     1282067..>1282184))
                     /locus_tag="TRUGW13939_10790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493900.1"
                     /db_xref="GeneID:55998269"
     CDS             complement(join(1280940..1281049,1281112..1281993,
                     1282067..1282184))
                     /locus_tag="TRUGW13939_10790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349793.1"
                     /db_xref="GeneID:55998269"
                     /translation="MSDEGRALEDLISLPTIPREAGRKIAQLEQEFVRAEIEQLRKQI
                     PALRPLYAKRNELAASKELQEADFWPRVFANAPQEVDEYILATDAAVIGQCLRNLTVE
                     RFEVDDQGNGGDPRSVRFVFEFASGDENPYFSNTKLVKEFYYRKSVTKTEKGKRRVWD
                     GYVSAPVRINWKKDQDLTKGLLDATCDLYEAEQKDTKVNRVKLPEYEKLVKKLEQVEA
                     EAFAGDEDDEADDDSGLAASSPAGVSFFAWFGFRGGNATAEQSVAAEKEELERWQKIE
                     KGEKVEDDDDDDEEDEDEDDDYDEEEDSLEAAEVFPDGEEVAIALAEELWPNALKLYV
                     QSYEDIDDFDDEMDIESIDEDEEEADLPPSKKVKT"
     gene            complement(<1282935..>1284049)
                     /locus_tag="TRUGW13939_10791"
                     /db_xref="GeneID:55998270"
     mRNA            complement(join(<1282935..1283349,1283406..>1284049))
                     /locus_tag="TRUGW13939_10791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493901.1"
                     /db_xref="GeneID:55998270"
     CDS             complement(join(1282935..1283349,1283406..1284049))
                     /locus_tag="TRUGW13939_10791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349794.1"
                     /db_xref="GeneID:55998270"
                     /translation="MTQHSKTIAVVNATGRQAASLIRVASALGYTVRAHTHTLKGVIA
                     AELQSLPNVTLIQGSLLDNAPLMDEVLRGAQLAFINTVSQAGDEVAMGRQLADAAKRG
                     GSIQHYVYSSMPDHSVHGPWPGLPMWACKFTVENYVRQLGIPATFVYAGIYNNNFTSL
                     PYPLFQMELQPDGSFEWAAPFPPDMPLPWLDAEHDVGPALIQIFKDGPQKWNGHRIAL
                     TFETLSPIQVCNAFARALGRRCHYRHTSKIEIKVNIPTGYREQLDGLARLFGELEAPY
                     FPHPEFNTPAAGSPKGLGPAGGKGAGAGVMQGPGGVVSQRVTDEARRLWQGWRDMEEY
                     AREVFPVEEEANGLQWML"
     gene            complement(<1285870..>1287684)
                     /locus_tag="TRUGW13939_10792"
                     /db_xref="GeneID:55998271"
     mRNA            complement(join(<1285870..1286187,1286239..1286603,
                     1286663..1287233,1287298..>1287684))
                     /locus_tag="TRUGW13939_10792"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493902.1"
                     /db_xref="GeneID:55998271"
     CDS             complement(join(1285870..1286187,1286239..1286603,
                     1286663..1287233,1287298..1287684))
                     /locus_tag="TRUGW13939_10792"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349795.1"
                     /db_xref="GeneID:55998271"
                     /translation="MENHHLSSSAPESQVLIIMTGGTICMQRSPAGFVPARGFQETCL
                     AKIPSFNDGSAGPHMPMKVVVDASGETKSYPSLRTPPSLYERQVRYTVLEFEELLDSS
                     SIDSKGWAEIAQAVYNNYTLFDAFVVLHGTDSLAYTCSALSFMLQELGKPVILTGSQA
                     PMLELQNDASDNLLGSLVVAGHFMIPEVCLYFNYKLFRGNRATKVAASDFAAFDSPNA
                     PPLAVTTSMRTLVNWDLVRRPTSLEHFSIRTNLDTSHVACLRIFPGIQPEMVDAVLRL
                     DGLRGLVLETFGAGNAPGGKDNAMTKVLASAIQRGIVIVNITQCLSGHVSPVYAPGMT
                     LFRAGVVAGQDMTTEAALTKMAYLLAQPESTPESVAKEMAVSHRGELTNHSQTVFRHP
                     DGALSARLTALTALGYAIAQGDLEKVKEQVQAENIWILNDADYSGNTPVHIAAHSPSL
                     EILRYFLLQGASVHLRNSAGRTPLFLAASAGLSEHVVLLRKSGAHLHGDERPVAEMQA
                     RQRPGVWAQAGVRAKTLKEREQDEAEDWSWTTMAGSAP"
     gene            <1289340..>1290997
                     /locus_tag="TRUGW13939_10793"
                     /db_xref="GeneID:55998272"
     mRNA            join(<1289340..1289520,1289577..>1290997)
                     /locus_tag="TRUGW13939_10793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493903.1"
                     /db_xref="GeneID:55998272"
     CDS             join(1289340..1289520,1289577..1290997)
                     /locus_tag="TRUGW13939_10793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349796.1"
                     /db_xref="GeneID:55998272"
                     /translation="MTRVLATSLAIAVAFVSLADAASNNFWRLPCMSRSGAARMDPLM
                     APGKTSDHLHTIFGSGGFSESVTQADLLDSDCTSCEVTQDRSAYWTPPLMFKYPNGST
                     VMVNQDGGMLAYYFVYGEDPKPFPEGFRMMAGNQFLRNFTGPVPDPAKSDWTADEQTQ
                     FSLSQKALGFNCLHYNTTDEGSLQRHYLPEKSFLDENCWDGLRLELMFPSCWNGKDVD
                     STDHKSHMAYPNLVNDGTCPDGFETRLVSLFFETKYDTQDFAGVDGEFIFSMGDPTGY
                     GYHGDFIQGWQTGFLEQAMSGCTNPSGQVQDCPLFNTQSNEEAASCQFPVPSALKEEN
                     PLFNLHGLLGDVPIQLGPAQATLYGEAASALATGLGIIATSVADAVSSILPAAPNPPV
                     EAHPTTTAPPVVSAKQNANVAQAAPTTTTTSAPPPPPPAPTTIITTTSPVQPVPTTIE
                     KAVEFDIVYIDQEVVVQLGDNGVPLTTLAPVDRTVSTLTTSSTTTITELVTPTAAAAK
                     RDQLPGHIRPPFHRHSHHRRHGARH"
     gene            <1291608..>1292767
                     /locus_tag="TRUGW13939_10794"
                     /db_xref="GeneID:55998273"
     mRNA            join(<1291608..1291719,1291769..1291923,1291976..>1292767)
                     /locus_tag="TRUGW13939_10794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493904.1"
                     /db_xref="GeneID:55998273"
     CDS             join(1291608..1291719,1291769..1291923,1291976..1292767)
                     /locus_tag="TRUGW13939_10794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349797.1"
                     /db_xref="GeneID:55998273"
                     /translation="MAENLPPMQYRFLGRTGLKVSAISLGGWLTYGGHVDDEKTYSCM
                     KAAYDVGVNFFDTAEGYEGGKSEIIMGQAIKKFGWKQQDLVISTKIYHGQANAANPAN
                     PLNNKGLSRKHVIEGLDLSLKRLDLPYVDIVYAHRPDRQTPIEEVVRAFNHVINQGKA
                     FYWGTSEWSASEIASAWRVADKLGLIGPVVEQPQYNLLARERVEAEYRWLYAEHGLGL
                     TVFSPLKQGILTGKYNDVAAPPPGSRLAEGDGRSAFITNFAKTFGDETWKANLAVVAR
                     LKPIAEELGATLAQLALAWALKNPNVSSLITGASRPEQVFENVKALAVVDKLTPEILA
                     KIEEAAQNAPEAQPLRFV"
     gene            complement(<1292827..>1293958)
                     /locus_tag="TRUGW13939_10795"
                     /db_xref="GeneID:55998274"
     mRNA            complement(join(<1292827..1293510,1293584..>1293958))
                     /locus_tag="TRUGW13939_10795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493905.1"
                     /db_xref="GeneID:55998274"
     CDS             complement(join(1292827..1293510,1293584..1293958))
                     /locus_tag="TRUGW13939_10795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349798.1"
                     /db_xref="GeneID:55998274"
                     /translation="MSTSFTSIPSIDLSPTTNKQHQLSQLHHALTSVGFLYIHNHGVP
                     ADAITDLVNALPHLFSLTDTAKEAIALHHSPHFLGYSSVGAETTAGKLDCREQVEYAT
                     ELPQTWSAENGMALYERLKGPNQWPAEYPSLRPIVERYIRELTQLGERFLRLVAEALG
                     LPLPEMFFPFLSEQHRLKLVHYPAVSSSSLSDDSRQGVGPHKDSSGWWTFLLQASPPH
                     IKGLQALNREGQWIDVPNVPGTFVVNIGQAFEVVTNGVCKATIHRVLSGQDERFSIPF
                     FQGVRGDLTKQEAVDTLKEYFQPRRQRRSLEEDIDSPFLKGKYNTWGESQLRTKIRSH
                     RDVGRKFYADVYEKYIND"
     gene            complement(<1295549..>1296563)
                     /locus_tag="TRUGW13939_10796"
                     /db_xref="GeneID:55998275"
     mRNA            complement(join(<1295549..1295720,1295948..1296180,
                     1296231..>1296563))
                     /locus_tag="TRUGW13939_10796"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493906.1"
                     /db_xref="GeneID:55998275"
     CDS             complement(join(1295549..1295720,1295948..1296180,
                     1296231..1296563))
                     /locus_tag="TRUGW13939_10796"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349799.1"
                     /db_xref="GeneID:55998275"
                     /translation="MKSEEFLFHQELLLNFQSISEQLDIQRVGVDGVKRYEFDTIIDQ
                     KTIRRGRRSTPVIEYWVQISTKPLQTVSWSVSCKQFKKSRQIRSTESRFFRTRCVGPD
                     LSKHLVFLKLALWTMIPSDRNCVMKLTDWRMATTLATHHLIVRKARMVVDHYIQWVKI
                     YVHHCTSSDKHGNLVDELVISIESAIYSETPASGAGQKAIVDVARHAWDKELVPLSSN
                     PVSCNFGSSVTLVATRLLESLDRASID"
     gene            complement(<1299566..>1300828)
                     /locus_tag="TRUGW13939_10797"
                     /db_xref="GeneID:55998276"
     mRNA            complement(join(<1299566..1299866,1299918..>1300828))
                     /locus_tag="TRUGW13939_10797"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493907.1"
                     /db_xref="GeneID:55998276"
     CDS             complement(join(1299566..1299866,1299918..1300828))
                     /locus_tag="TRUGW13939_10797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349800.1"
                     /db_xref="GeneID:55998276"
                     /translation="MLAHISQLALFLELVSCISIPNQGNSLNLAPAPHHVAVSKHHRR
                     EAHSRRSFNKRSNSTLIRPTNSNLQYAVEVKFNGVPRYLLLDTGSSDTWMFGRDFQCL
                     SNTSCNTGPPYTGEIDTITGETFNMVYGNLENVTGEVGYADVSVAGLSVENQEVSVLT
                     EGFWQGDGVLSGVLGVGSSGLTNVFQEPNPADLHPYSPVLESMYNRTGQIDPVFSLAL
                     QRGDDAGYLAFGGLPPVDFEHDFASTKIVGVPFGTHGKEREFYAIENSGFELNGKTHN
                     ASFRAVVDSGTYANRFPTAVADKINAAFKPPATYLKEYDAYAVPCNATAPELGISIGG
                     KTFYIHPTDMVMPVGQDDICLTSIFRGFDLDPSVYPDGLYIFGDVFLHNVIAVFDIGN
                     EQIHFAPHNNY"
     gene            <1301399..>1302971
                     /locus_tag="TRUGW13939_10798"
                     /db_xref="GeneID:55998277"
     mRNA            join(<1301399..1301499,1301534..>1302971)
                     /locus_tag="TRUGW13939_10798"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493908.1"
                     /db_xref="GeneID:55998277"
     CDS             join(1301399..1301499,1301534..1302971)
                     /locus_tag="TRUGW13939_10798"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349801.1"
                     /db_xref="GeneID:55998277"
                     /translation="MQAITITITRPEEMNRELSLQVNLAVHLNQPYRHIVPACRSVDP
                     GLAACTNLTSSLGASKVAVSPLDLRYIASREDYWNALQSEYQPSCIVYPASAQDVSLA
                     LQAIRAFGSRFAVKAGGHNTNNFFSSVDSGVLIDIGSMNAKSYDPSTTLATYEPGSTY
                     GELYDYYAQFDRTILGPTLAGVGTGAGLGGGLGYLSPQYGMACDDFRELEVVLPSGEV
                     VDASAESYPDLFFGLRGGGGNAYGIVTRYTVQSRPATQFAAGNVIYLFEQTDAVASAI
                     RDFMQYNPDPKASIVATYMKLPTPGLGLNLDEAILLFLVYDGLDPGDVFGNFTSIPYL
                     LNTMAIRTYPEVINMPIPFLTQLTRGDNTFRVGVHRVNDDSYQTTIHQWRDWAETHKS
                     SYELLSFNFEPVPRSLTDASNSQNGGNAIQMPDGPWFWISYILETLPGLPQAEYEAIQ
                     ASFRDMVEASGNADGLPLFISDASADQNPLSTFSTFARLQEIKNTYDPDNFFAEKTGG
                     WSFT"
     gene            complement(<1303140..>1304372)
                     /locus_tag="TRUGW13939_10799"
                     /db_xref="GeneID:55998278"
     mRNA            complement(join(<1303140..1304182,1304252..>1304372))
                     /locus_tag="TRUGW13939_10799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493909.1"
                     /db_xref="GeneID:55998278"
     CDS             complement(join(1303140..1304182,1304252..1304372))
                     /locus_tag="TRUGW13939_10799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349802.1"
                     /db_xref="GeneID:55998278"
                     /translation="MAKVPSKTVVIVGASWAGINVAHGLLKQVPNVNVVLVNPSEDFY
                     FNIASPRVIARPQAFSRDKYMYPIQELFEKYPAEVRAGFGFVLGKATAVDIDGKKVYV
                     TEQGAEKERYIAYDYLVISSGSTTKATLGGSSLKVPFKASKDSNTDIDIKNAQDSIQA
                     AKSVIIGGAGAVGVEFAAELAEERPDIKVILVTPTDRVLPTLKNGPRSKAEKVLKAKG
                     IEIVTKEAVEAANFDSVANKWTVILTTGNTMTADVYIHAAGVVPNNEFIPRALLDEDG
                     WVEVDRHFRASRIPLSANIYAVGDITSHTQRIAARMPTITGAVVSNLKADILGKGARS
                     TFDAAKQSVLLAVPLGKSDGTGQMGWFVFPGFVLAIFKGKDFMTGQGRKLVSG"
     gene            complement(<1305012..>1307162)
                     /locus_tag="TRUGW13939_10800"
                     /db_xref="GeneID:55998279"
     mRNA            complement(join(<1305012..1305166,1305229..1305634,
                     1305690..1305812,1305876..1306219,1306284..1306404,
                     1306457..1306682,1306737..1306812,1306867..1306915,
                     1306979..1306999,1307061..>1307162))
                     /locus_tag="TRUGW13939_10800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493910.1"
                     /db_xref="GeneID:55998279"
     CDS             complement(join(1305012..1305166,1305229..1305634,
                     1305690..1305812,1305876..1306219,1306284..1306404,
                     1306457..1306682,1306737..1306812,1306867..1306915,
                     1306979..1306999,1307061..1307162))
                     /locus_tag="TRUGW13939_10800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349803.1"
                     /db_xref="GeneID:55998279"
                     /translation="MSSSDEQGREAPVSADPRESNRDELVADEDAALLQTMGYQQVLH
                     RSYTLFENFSTTFAALYFVGGVRVTYSTGIASGGNLAYWTSYLVTLVFTFISAAVIAE
                     VCSASPSAGSIYLWAAEAGGPRFGRLMGFVVAWWSTTAWTTFCASNTQAAVNYMLSEI
                     NVFNLSFPTDTSDVKFRAVQWICTEILLALAAVINFLPPKSFRWIFYLSSALVVLDFL
                     LNMIWLPIGVAQTWGFRSAHEAFMTTYNGTGAPAGWNWCLSYLATAGILIGFDASGHV
                     AEETKNASITAARGIFWSTVVSGLGGFVVVIMFLFCAPDADTLFSFGAPQPFVPLYAV
                     VLGQGGHVFMNVICVVALWFNTAIAIVAASRLVFAVARDGVLPFSGWVSRVSPEGQPR
                     NAVIVVWGVAAVVTCTILPSAVAFTSLISAAGVPSAAAYGLICLGRVFLTPNSFPTPK
                     WSLGRWSKPFQVISIFWNGWVVAVLYSPYEFPVSGETLNYAPVIMGAVTILALISYWM
                     TPEESWLPRNRISHFIHSKGEATETTTEVAEN"
     gene            <1307883..>1308593
                     /locus_tag="TRUGW13939_10801"
                     /db_xref="GeneID:55998280"
     mRNA            join(<1307883..1307922,1307986..>1308593)
                     /locus_tag="TRUGW13939_10801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493911.1"
                     /db_xref="GeneID:55998280"
     CDS             join(1307883..1307922,1307986..1308593)
                     /locus_tag="TRUGW13939_10801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349804.1"
                     /db_xref="GeneID:55998280"
                     /translation="MSKTLFAASDFTNGLQALDEAIGNDYWLSPFTPITLLSAGGFIA
                     VTFLRCRQSTEDFDYLLEPQWAYDDDVKKPLNSAIENAAKVLGFDPEWANEDMGAFVS
                     KQDRERLFQQAEEQNIVLWQGENLKVLAVPLKWALERKLRRLQHNKMNISKRDSDLND
                     ALALLKYLKDKERAPLDQEHIRTLSITSRELPPDQRTMEWIAEAYQAKYGEKVFV"
     gene            complement(<1308627..>1309388)
                     /locus_tag="TRUGW13939_10802"
                     /db_xref="GeneID:55998281"
     mRNA            complement(<1308627..>1309388)
                     /locus_tag="TRUGW13939_10802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493912.1"
                     /db_xref="GeneID:55998281"
     CDS             complement(1308627..1309388)
                     /locus_tag="TRUGW13939_10802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349805.1"
                     /db_xref="GeneID:55998281"
                     /translation="MASNRRPRPKITWWMRVKRYILAFQSPLRLRSSLTRLRHHHKYP
                     FLALVRLFLPLPRWHFRPDPVPFKVMLDNVPLWECRADLADLRNMRAIPLWRARDTPI
                     RSLYRIYEAIAARYHVAIGSEVEYFWYQNRRSWEVQRIPDPCDPDPVRYAILACIAEE
                     LANAFNWRLSIGLRRDRSKHIIRETRDDELPEFTPVTAPAWVKRVPALDFDLISDLPS
                     GVLNSSGKLVLEKGGNSGFFAERNIIIDTGYFYTV"
     gene            complement(<1309827..>1313079)
                     /locus_tag="TRUGW13939_10803"
                     /db_xref="GeneID:55998282"
     mRNA            complement(join(<1309827..1310711,1310760..1311166,
                     1311226..1312135,1312406..1312700,1312768..1312898,
                     1312957..>1313079))
                     /locus_tag="TRUGW13939_10803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493913.1"
                     /db_xref="GeneID:55998282"
     CDS             complement(join(1309827..1310711,1310760..1311166,
                     1311226..1312135,1312406..1312700,1312768..1312898,
                     1312957..1313079))
                     /locus_tag="TRUGW13939_10803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349806.1"
                     /db_xref="GeneID:55998282"
                     /translation="MHSLALLSLPLLGSVAAAESVTSLFLPGFDAQKLFGSVMGSTGS
                     TTTFFVNCPAGTDALDCGVAPGLTAIAGPKTAELQYHDQDLVSIHLRCDMSNPEVADC
                     VETIGGVSAPYPGTSTGTFTGGDIATMYLPVTITTGAASTGASVTASTASVTSVPASA
                     AATTAAPSATTLSGTNTASADNSKLAAAYPSFQLPMISSPRFYLLVPAVPLTSMHHTY
                     LLHLASSTLSTLPTLHSCDMRAKTLAPFTFDLLPLGSVKPRGWVQDQLNLCATGLGGN
                     IYNFHRFIKGSRWFGGHAEYSPLNESAPYWYNYIVPLAYLLDDEELKKQANHFLDRTL
                     KNQHADGWIGPEHTKHGRGIWARCLVLMGMVNHALADPAQYERIVEAMLRFTRLANSM
                     FKDDFQGLIPHPGDEFDEFCITRAHELSTTLQWLYEQVNNRQDKEVIWETMDLAWKAT
                     RAGDRDWSKFFTEEEFPKEPAAQGSTLIKHVVNVSEALRYIPQLYRMTHDRDLVDRAR
                     ESVEMALKYHGTTFGALAGDEFLAGVHPKRGAELCGTVELIFSLSYLYRLFGETRYAD
                     QAELATYNGLPAGMTPDWWAHNYLTQSNEPWARNLENWPFYNCGGRALVYGLEVNYPC
                     CLVNHAQGLPKFAMNAFVASPDLRSIAHQFLFAAEATIPVQGDRPIHITSDTHYPFDE
                     SITYRIESSRSFDFYVRIPEWATSGSTVKKDLDNDTVQEETVQADSNSLYKVQISPGK
                     SSFRITLNARIRVVPRSNNAVAIYRGALLYAMEIPHKAKTGPPRHFAEWTPLPDDAKY
                     SQAIRDVEYIPTADWQVAIDPSQAHFHRVATKGNLPNPVFESGAPPVSITVAGSKISN
                     WPLEGDCAGLPPSNPSVTGKPFAIKLVPFASAKLHISEFPIVKLANVDLEKVQGSSCT
                     IM"
     gene            <1314337..>1315839
                     /locus_tag="TRUGW13939_10804"
                     /db_xref="GeneID:55998283"
     mRNA            <1314337..>1315839
                     /locus_tag="TRUGW13939_10804"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493914.1"
                     /db_xref="GeneID:55998283"
     CDS             1314337..1315839
                     /locus_tag="TRUGW13939_10804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349807.1"
                     /db_xref="GeneID:55998283"
                     /translation="MFPRSIKVLALGLGSLVTAGPCDIYSSGGTPCVAAHSTTRALYS
                     DYSGALYQLSRGSDGATTTISPLSAGGVADADAQDSFCASTTCLTTIIYDQSGNGNHL
                     TQAPPGGFDGPDTDGYDNLASAIGAPVTLNGQKAYGVFMSPGTGYSNNAATGTATGDE
                     AEGMYAVLDGTHYNGACCFDYGNAEISSTDTGNGHMEAIYYGTSTTWGTGSGSGPWVM
                     ADLENGLFSGSSSGNNADDPSISYRFVTAAIKGGPNEWAIHGGNAASGSLSTYYSGAR
                     PTASGYNPMSKEGAIILGIGGDNSNGAQGTFYEGVMTSGYPSDATESSVQANIVAAGY
                     AVTSLTSGPALTVGSSISLRATTDCCTTRYIAHTDDTVNTQVVTSSSTTTLQEQASWT
                     VRAALGGDSSCFSFESVDTPGSYIRHYNFALLLNADDGTQQFAEDATFCPLDGLNGDG
                     NSIRSWSYPTRYFRHYDNVLYVASNGGVDTFDATDLFNDDVSWVISTGFA"
     gene            complement(<1317500..>1318498)
                     /locus_tag="TRUGW13939_10805"
                     /db_xref="GeneID:55998284"
     mRNA            complement(<1317500..>1318498)
                     /locus_tag="TRUGW13939_10805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493915.1"
                     /db_xref="GeneID:55998284"
     CDS             complement(1317500..1318498)
                     /locus_tag="TRUGW13939_10805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349808.1"
                     /db_xref="GeneID:55998284"
                     /translation="MSSIWCTKRLVLPRLPQLKTCKNISTSSSAARTSGIFGDTITLP
                     SGRQLGYHTAGPITGTPIFYIHGHPDSGLTITGQLENRVARELNVRWIGPDRPGVGLS
                     SPYDAQKVLDYPSDIQSLAERLNLKRYYILGTSGGTGFALACAKNLPRSQLKGVGICA
                     GIGPYEGGYESMIEPQRKALEAWRDYPTELRNYYESEYVPLAQQTETTALSSRIHSDF
                     EAAFSGMDREVLLEENTFKMAVNVLRQSWMQGAWAHAKGMEFHWQPWGFTLEDVAFPA
                     VKLWYGEKDALTTPAMGRFMANRLEASVYKEFAGASHITIWRDGNLQEMVRDLLTV"
     gene            <1319726..>1323771
                     /locus_tag="TRUGW13939_10806"
                     /db_xref="GeneID:55998285"
     mRNA            join(<1319726..1319810,1319869..1320433,1320490..1320579,
                     1320708..1320759,1320816..1321076,1321129..1321246,
                     1321300..1321755,1321804..1321956,1322002..1322142,
                     1322194..1322781,1322828..1322961,1323013..1323159,
                     1323207..1323375,1323423..1323686,1323740..>1323771)
                     /locus_tag="TRUGW13939_10806"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493916.1"
                     /db_xref="GeneID:55998285"
     CDS             join(1319726..1319810,1319869..1320433,1320490..1320579,
                     1320708..1320759,1320816..1321076,1321129..1321246,
                     1321300..1321755,1321804..1321956,1322002..1322142,
                     1322194..1322781,1322828..1322961,1323013..1323159,
                     1323207..1323375,1323423..1323686,1323740..1323771)
                     /locus_tag="TRUGW13939_10806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349809.1"
                     /db_xref="GeneID:55998285"
                     /translation="MSWFVKAPPVAPCRSGAAGCSLRLLGVPALLQSRPFSTSSCKFE
                     RRRSPVRVPPETILKRFETTVSTTASTPSLVVPYTSLTVGIPRETFPNERRVAITPQN
                     VALLLKKGFSRVIVESGAGEAAQFTDEAYRKAGAIMAAKDAVWSQSDILLKVRAPSID
                     EPVNEVNAMREGKTIISFLYPAQNKPAVDALAARGLTSFAMDKIPRISRAQVFDALSS
                     MANIAGYKAVLEASNEFGRFLTGQVTAAGKVLVIGAGVAGLSAIASARRSGAIVRAFD
                     TRPAAREQVQSLGAEFIEVDLEEDGSGQGGYAKEMSKEFIEAEMKLFMEQCREVDIVI
                     TTALIPGKPAPKLITKEMVQAMKPGSVIVDLAAEAGGNCEATVPGTLAIYDGVKVIGY
                     TDLPSRLPTQSSTLYSNNITKFLLSLADKDKGFTVDLNDEVTRGAIVSYNGKVLPPAA
                     PPAPPPTSTTSTAQASAKEEVVALTPWQKTTRQVATVTAGMGSALALGKLTGPVFMGN
                     MFTFGLAGLVGYRAVWGVSPALHSPLMSVTNAISGMVGIGGLFVMGGGYAPTNIPEAL
                     GAVSVLLAFVNVSGGFVITKRMLDMFKRPTDPPEYPWLYAIPGLLFGGGYVAAAATGM
                     AGLVQAGYLVSSVLCISSISGLASQLTARRGNILGILGVASGFLASLLAVGFTPETLV
                     QFGAVAGIGGLLGAVIGRRITPTGLPQTVAALHSVVGLAAVLTSIGSVMADISHVSTL
                     HMVTAYLGVLIGGVTFTGSVVAFLKLAGRMKSSPIALPGRHIINTSLLGANMATMGAF
                     ITMAPGAPVVAAACLGTSTVLSFLKGFTTTAAIGGADMPVVITVLNAYSGFALVAEGL
                     MLDNPLLTTVGSLIGVSGSILSYIMCVAMNRSITNVLFGGIAPTQSNKKIEGEVTTTA
                     VEETVDALAGAENVIIVVGYGMAVAKAQYAISEITRMLRAKGVNVRFAIHPVAGRMPG
                     QCNVLLAEASVPYDIVLEMDEINDDFNDTDVTLVIGANDTVNPIAMEPDSSISGMPVL
                     HAWKSKEVIVMKRGMSSGYADVPNPMFYMPNTKMLFGDAKSSCDAIKNALEARK"
     gene            complement(<1323946..>1324784)
                     /locus_tag="TRUGW13939_10807"
                     /db_xref="GeneID:55998286"
     mRNA            complement(join(<1323946..1324538,1324595..>1324784))
                     /locus_tag="TRUGW13939_10807"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493917.1"
                     /db_xref="GeneID:55998286"
     CDS             complement(join(1323946..1324538,1324595..1324784))
                     /locus_tag="TRUGW13939_10807"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349810.1"
                     /db_xref="GeneID:55998286"
                     /translation="MNGFCLVTPASRGIGFALAKHLLQHTNTPVVATARRDCEGTRQR
                     LLDGIPGDKNLHVLPVDVTDESSIAALAAHIRHHFRNTPLRLALTMPGVLHVEKSPAQ
                     IDAENALDSFKVNTLGPLLLLKHLTPFLPTRSSPSLKRMEGCLPGHAVYAMMAARVGS
                     ISDNRLGGWYSYRASKAAVFQLAKTLDAYLQASSGERAMAVALHPGTVRTDFTREFWD
                     GGAREMLEPDEAAAKLLQVLCELDMAYGRGRCWDWRGEEVVP"
     gene            <1325560..>1327250
                     /locus_tag="TRUGW13939_10808"
                     /db_xref="GeneID:55998287"
     mRNA            join(<1325560..1325869,1325935..>1327250)
                     /locus_tag="TRUGW13939_10808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493918.1"
                     /db_xref="GeneID:55998287"
     CDS             join(1325560..1325869,1325935..1327250)
                     /locus_tag="TRUGW13939_10808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349811.1"
                     /db_xref="GeneID:55998287"
                     /translation="MTTDYLILGGGLAGCVVATRLKEYNPTATVTLIEAGPNAHGHEW
                     MIEPMGTFKLHLSDFEYNYLTVPQKQYNGRRVFITGGKQLSGSSSVNYAMWTRGGRDD
                     YDLWSKIVQDDKWSYEGLLPYFRRTETHHIESVDPRQHGSDGPIHTTASARKYPLKDL
                     IWDAFLSTGLGATKDANGGNPLGVAPYTENWRDGKRQPSGKAYGLKGVDVVTNTFVRR
                     IILEGNVAVGAELIDGRVIRANKEVILSCGSIRSPQLLLLSGIGPKEELAKHGIEQLV
                     DSPDVGANFNDHTCLTLFYKVKDPELSRVAGAAGWTDPSYLRGIPADVVVTANADKEK
                     LKEALIKDGHPNVDDSHPHLAPTRGHIEILPIYAPTEAPHTNLNVPFDGTCMTVGVLN
                     LLPTSRGSVTLASTDPTADPLIDPNYYATETDRVISRQGVRLALQALESSAGRQIVDE
                     EFLPPGTGKQLTQQSTDEEIDDRMTRFAATWFHPTGSCSMGKVVDTNLKVKGIENLRV
                     VDASVMPCPIGAHYQVATYAIAEQAADIITKGQ"
     gene            complement(<1329105..>1330586)
                     /locus_tag="TRUGW13939_10809"
                     /db_xref="GeneID:55998288"
     mRNA            complement(<1329105..>1330586)
                     /locus_tag="TRUGW13939_10809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493919.1"
                     /db_xref="GeneID:55998288"
     CDS             complement(1329105..1330586)
                     /locus_tag="TRUGW13939_10809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349812.1"
                     /db_xref="GeneID:55998288"
                     /translation="MESASVVSSSPPPEDKSYHHDEPLQLHSMPPWRRYESEEEEVSE
                     TSSVRAFTPETGSSNDNDPVVESGLPSPAREDSDSSASLYSRPLSVVTAKRNSTATYN
                     AYHEGDENESACGYVTPPVSPTSILPHSIGEADTSIVIEDDGEEAEEEEQIFEAKQVL
                     YTAPTSKPNIIVIHNLTSESMLWPHSGNEETPDPASNKGPENIRKRSSTASGLSPPDR
                     SKRYSAMFLRDDGELAYADPRSHVRARSAQRVGGSPYRSRAASPSVNRETRPQLLRRN
                     TSQRSTRSVYIAAPDEMLRPRTFRSASFASDNTSPSSRSSKQPSTLNSSTSSFHTSST
                     SSAEPDSDKSKLTPHPLSISTTSHPAPIQFTGPFGTSPRKPGLAPHVRSESLLDVDPI
                     SPAASSAYSPMEQTNPRMSMPKAQGLYSLRNNPALSLTTDFEPAVDQRHQQAQQANRD
                     WSFVSSPASAKTPKAGASAMKSLMGGFRGLGRPRKRSLAPAPN"
     gene            complement(<1334421..>1335548)
                     /locus_tag="TRUGW13939_10810"
                     /db_xref="GeneID:55998289"
     mRNA            complement(join(<1334421..1334749,1334808..1335090,
                     1335141..>1335548))
                     /locus_tag="TRUGW13939_10810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493920.1"
                     /db_xref="GeneID:55998289"
     CDS             complement(join(1334421..1334749,1334808..1335090,
                     1335141..1335548))
                     /locus_tag="TRUGW13939_10810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349813.1"
                     /db_xref="GeneID:55998289"
                     /translation="MSFDLKDIPLPTIDRPFGIQLWPYFNKAFELALGYPADDFRFVS
                     GETPMSTLQETAAALVTYYVVIFGGREVMKNFSALKLNTLFMLHNFVLTSVSGILLVL
                     FLEQLIPTIYHHGVFYAICSHEGGWTQPLVVLYYLNYLNKYFEFLDTLFLVLKKKPLT
                     FLHTYHHGATALLCYTQLLGLTSVSWVPITLNLLVHVVMYWYYFQSARGIRIWWKKYI
                     TILQIAQFVIDLVFVYFASYTYFSNTYFQWAPNYGTCAGEEFAAFSGMGILTSYLVLF
                     ISFYFVTYKKTAKTGRPRRNTGRQALIDMKDAQLPSVPVAGHANGNGAASRNGKGPVT
                     RSRKA"
     gene            <1336826..>1337624
                     /locus_tag="TRUGW13939_10811"
                     /db_xref="GeneID:55998290"
     mRNA            join(<1336826..1337022,1337211..1337256,1337328..1337445,
                     1337506..>1337624)
                     /locus_tag="TRUGW13939_10811"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493921.1"
                     /db_xref="GeneID:55998290"
     CDS             join(1336826..1337022,1337211..1337256,1337328..1337445,
                     1337506..1337624)
                     /locus_tag="TRUGW13939_10811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349814.1"
                     /db_xref="GeneID:55998290"
                     /translation="MASTTLFRLATRSVRPATFARAAYVRPSLPTRVTAAASFVAANN
                     FSISAKLRSGHEEETYEEFSARYEKEFDAVQDVFELQRNLNNAFAYDLVPSVEVVSAA
                     LRAARRVNDFPTAVRVFEGVRAKVENEGQYKQYLEQLEAIRTELGISLQEELYPKSD"
     gene            complement(<1338241..>1339617)
                     /locus_tag="TRUGW13939_10812"
                     /db_xref="GeneID:55998291"
     mRNA            complement(join(<1338241..1338397,1338461..1339079,
                     1339143..1339406,1339467..>1339617))
                     /locus_tag="TRUGW13939_10812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493922.1"
                     /db_xref="GeneID:55998291"
     CDS             complement(join(1338241..1338397,1338461..1339079,
                     1339143..1339406,1339467..1339617))
                     /locus_tag="TRUGW13939_10812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349815.1"
                     /db_xref="GeneID:55998291"
                     /translation="MAIARPIRLLGALCILLVIGVIFYVSHPTQSLISVGSRLQDGMK
                     SDPLLDPTGEPEGLLWRAEDHDYSPDSTESARINATLLVLVRNEELGDLVKTMEDLER
                     TWNNKFNYPWTFMNDKPFSEEFKRKTQAVTKAKCHYELVPKEHWEEPDWIDPELVKES
                     NKILEEAKIQYADKASYHRMCRWNSGMFYKHPALANTRYYWRVEPKVQFFCNVDYDVF
                     RYMQDHKKTYGFTINLFDAPETITSLWPETERFLSEHPEYLADNNMMEWLVDDKLRPE
                     HNKKANGYSTCHFWSNFEIGDMEFFRSEKYEAYFNHLDRAGGFFYERWGDAPVHSIAL
                     GLFEDASKVHWFRDIGYRHVPYFNCPNSPKCSGCKPGKFYEGADFLAKEDCRPNYFKY
                     VGTH"
     gene            <1340044..>1342828
                     /locus_tag="TRUGW13939_10813"
                     /db_xref="GeneID:55998292"
     mRNA            join(<1340044..1340112,1340171..>1342828)
                     /locus_tag="TRUGW13939_10813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493923.1"
                     /db_xref="GeneID:55998292"
     CDS             join(1340044..1340112,1340171..1342828)
                     /locus_tag="TRUGW13939_10813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349816.1"
                     /db_xref="GeneID:55998292"
                     /translation="MARSAAVGMLIDSLIVTITRSEKDSTSFQNAKARSNIILKEHSP
                     GNRTDPFAVDRHFDGLIEKFRVLNKDDFADSLGVRLSEAESQRISWMPEIFSLLQQLS
                     DRPANVAQVPRFSLAESEDSPALKWTELDPAGSAFAEEDIWAEVDYGGSSSEDEASTV
                     SSNVSIPRIIPQSAKPSQEEFEIPEEFIQSGEDEELIATIKTGHFWEYDSAAVREFSE
                     SHTRFITELQASREIIFMLQGLPTSLFWQLDNSIAVDRRFALRHASNAAFLQILRSCA
                     DTGARLGAVRRFVKSSQSVIFLQTFTRGLEILLHDFDTFLSGLQLRYLSTDQKVTVSL
                     LQLVEEVRTKVRVLLLLADLVAQLETAPSSQAFLCLDLLYDLVCSNQASGSEDDYKSL
                     AKLFFSCFEAYTQPIRMWMETGQLEKGQDTFFVTDIHRGSDLRTLWHDWYSLVETNGR
                     LNAPKFVKPNARKILTTGKSMIFLRNLNILPESLGFENRRPFVFEDVCPDGPALQLLP
                     FSGLLDKAFEDLIATNHQFASNFLRTQLDEQYGLWNSLSALQYIYLCKDITVSSLIDN
                     KIFELIDNGQGVWNDRFLLTELVQSTFDDIACVDPSRLLMRSTRTPYPDSGTQNRSVK
                     ILKVLSMDYILPWPVANIIPKSAIATYQRIFTFLMQIRRAKYVLERQRLRKEDDDSEG
                     FRVNIGDDGAGYIIRHSLLWLTNTIYSHFTELVIAMSTADMVKGLAAATDVDAMIAMH
                     EAYMSSLEQQCLLSDNLAPIYKAVISLLNLCVHLADIQSARHGQNRFEKSNRSFHSSS
                     GRRKHYRRHQHRRRGFNDFSDSDDDDDEKSNDEADNVHDHDDYDEGNTTNISFLESPY
                     SERLTHVREKFERLLAFIITGLRAVGRIDGQQSWEMLADRLAWKTRPNDVYR"
     gene            complement(<1343319..>1344937)
                     /locus_tag="TRUGW13939_10814"
                     /db_xref="GeneID:55998293"
     mRNA            complement(join(<1343319..1344722,1344773..>1344937))
                     /locus_tag="TRUGW13939_10814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493924.1"
                     /db_xref="GeneID:55998293"
     CDS             complement(join(1343319..1344722,1344773..1344937))
                     /locus_tag="TRUGW13939_10814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349817.1"
                     /db_xref="GeneID:55998293"
                     /translation="MKRAVSNLHGNGDERPAKLQRRDSPSTVPIPSNRQQEEQITAQP
                     LSPLSNNINTKQTGKQERGHSTIPPRSKSTNKRIFDWIPPPSEEFYDADVMDQPASKR
                     SRSRSISTDRGRPRSTSSDTTSSRDHKSSAYKDPNYVTILETKGCFMRPSEAGPVLED
                     IELCRRLLQQPIENPQGTLLDDNFIEDFYNSLRNRSEARLLVDLHPHLMPSAENQYIQ
                     GRRWLKNVIDGYNDPWLKTEPIHGPRPQPDHARGLKWSTFSEQQRRKLGIKPAEKSLY
                     IARDDMYFPYLTAEIKCGTQALEFADRQNMHSMCIALRAVVSLSQIASCPEKVHRRIL
                     AFSISHELDGLRIYGYYPEITDGRIEYFRWKVAQIDIWSREDKWTCYRFVENLDREFL
                     PIHIDRLMDLLAEIPEPQDFSFEIDNDHDIASGVGSQEWSGYSRAPSSQNLQPELCSM
                     IQVLQQQLEEQKTRLEEQKSREEEQKAREEEQKAREEKLLAKLEQQAAEQKVREEQQR
                     LREERLLKLLEQRQ"
     gene            complement(<1345554..>1349642)
                     /locus_tag="TRUGW13939_10815"
                     /db_xref="GeneID:55998294"
     mRNA            complement(<1345554..>1349642)
                     /locus_tag="TRUGW13939_10815"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493925.1"
                     /db_xref="GeneID:55998294"
     CDS             complement(1345554..1349642)
                     /locus_tag="TRUGW13939_10815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349818.1"
                     /db_xref="GeneID:55998294"
                     /translation="MTSSTESTYLSIPGTVAFSRSRGLAIASQIGAADVRAQWVHYVH
                     TSETLQETQRGVLEQLLQYGDITDIPPSFEQGEGTVKTFYVYPRVGTISPWSSQATGI
                     SHVCGLGKFVKRIERGLKISALFSEESKAEDEYLDFLHDRMTQVISQEEPNLEKVFSE
                     HPPLPLETVPLHSGEKSPVEILQDANKRLGLALDQSEIDYLVEAYAANGPVPRDPTDV
                     ELFMFAQVNSEHCRHKQFNASWAIDGRQMPYSLFGMIRNTHRKNGDYTVSAYSDNAAV
                     LQGENAGFWSPDSATREWTQLKEQVHILAKVETHNHPTAVSPFAGAATGSGGEIRDEG
                     AVGRGSRPKAGLAGYCVSDLLIPELRQPWELDIGKPHHIASSLDIMLEAPIGSAAFNN
                     EFGRPCTAGYFRTLLTEIDIGNGQKEIRGYHKPIMIAGGVGTVRPQHALKDPGIVKPG
                     SFLVVLGGPAMLIGLGGGAASSLTSGEGSADLDFASVQRGNAEVQRRAQEVINACVSM
                     GADNPIKFIHDVGAGGLSNALPELIHDSGLGATFELREVDNTDRSMSPMQIWCCEAQE
                     RYVMAIGEESMNKFTAIAKRERCGFSVVGRGEGNQDEDKRLVLMDRDSKEYPKPIDLP
                     LSVLFGKPPKMTRKVDSRKLKLPAFDTSLSTYLPKDLSSQQLFDEAATRVLSLPAVGS
                     KSFLITIGDRTVGGLTAQDQMVGPWQTPVSNVSVTATSLLQGVKTGEAMAMGEKPTLA
                     LISPAASARMAVAESLMNLTAADLINRLTRVKLSANWMSAGSHPGEGAAIYEAVEAIG
                     LDLCPKLGISIPVGKDSMSMKMKWTDEKSKESREVTAPLSLVISSFAPVSDFKKTWTP
                     TLRRFEDVGETVLMFVDLARGRKALGGSAVAQVFKQVGDECPDIRDVDLFRDFFDATQ
                     QLQESGIVLAYHDRSDGGLFTTLAEMMFAGRCGVELMLDDLQKNSDIGSCIETLFNEE
                     LGAVFQVRKKDETQFRSCFATCGPPPGLITRIGRVSEIQKQNLTMYHKHKLIYRQPRA
                     KIQQIWSHTSYHMQKIRDNAACADQEFANILEDTNPGLSWRPSFDPKDKGLPILTSLT
                     QFSPFSNKPRVAILREQGVNSQAEMAFAFNLAGFAAVDVHMTDIISGRVSLASFVGMA
                     ACGGFSYGDVLGAGQGWSKSVLLHEETRKEFKNFFDRPDTFALGVCNGCQFLSRLKEL
                     IPGAQYWPSFERNASEQYEGRVAMVHISDPDPSTPSVFLHGMNGSSLPIAVAHGEGRA
                     SFALTPEVTAQDFVKNNLAPIRYVDNETLKPTMTYPFNPNGSPEGIAGVRSSDGRVLA
                     IMPHPERTIIGGIASWLPAEAEQWGEVGPWGRVFYSARRWVG"
     gene            <1351006..>1352828
                     /locus_tag="TRUGW13939_10816"
                     /db_xref="GeneID:55998295"
     mRNA            join(<1351006..1351432,1351504..1352107,1352171..1352502,
                     1352563..>1352828)
                     /locus_tag="TRUGW13939_10816"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493926.1"
                     /db_xref="GeneID:55998295"
     CDS             join(1351006..1351432,1351504..1352107,1352171..1352502,
                     1352563..1352828)
                     /locus_tag="TRUGW13939_10816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349819.1"
                     /db_xref="GeneID:55998295"
                     /translation="MTSHEGEVPHRTLSRIPTYGNNPGEIDPTDLPLGQVNDDANLEE
                     YIVETRTGNIIKSVKSNVTDKMEDWKLVTFRIDDPENPKNWSKARKWYYTMVVAWTCF
                     VVAFASAVVTAGLEGPSKDFHVSEEVSLLTVTVFVIGFGVGPMVFAPLSEMIGRRPVY
                     AITLFIAVIFEIPCAVAPNIGTLIVCRAIDGIAFSAPMTLVGGTLADLWKNEERGVPM
                     AAFSAAPFIGPAIGPLAGGFLFDAAGWRWLYWIQLILSGIAWAMITFTVPETYTPVLL
                     KARAKKLRKSEDDPKYVTEQELDPRSTGEKLRIFMLRPFQLLFMEPIVLFISIYMSVL
                     YGLLYMFFIAYPVVYQRGKGYSPGITGLMFIPLALGVVASAFCAPLVNKHYIGLCQKH
                     NGKPPAEARLIPMMFSCWLIPVGLFIFAWTSYPRLHWIGPAIGGFPVGFGFIFLYNSA
                     NNYLVDTYQHQAASALAAKTFLRSMWGAGCVLFTIQMYNRLGYQWASSLLGFLALACC
                     AIPYVFYFYGERIRRHSHFAYCEDEETKAVPPEE"
     gene            complement(<1353388..>1354298)
                     /locus_tag="TRUGW13939_10817"
                     /db_xref="GeneID:55998296"
     mRNA            complement(join(<1353388..1354197,1354248..>1354298))
                     /locus_tag="TRUGW13939_10817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493927.1"
                     /db_xref="GeneID:55998296"
     CDS             complement(join(1353388..1354197,1354248..1354298))
                     /locus_tag="TRUGW13939_10817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349820.1"
                     /db_xref="GeneID:55998296"
                     /translation="MFYGDHQDHEDEERLKSVDSRSSENIPPNVIIRRASQCPDNHKL
                     LIIGIFAEVYLVDNEIIRKIPRSQSEEDMQPILREAMVYDTLGPHPRIAEWLSKDISN
                     FIDIKYYPHGDLVNYCQKNLIQPELRSKWYQQILESVEFIHSRGVIHSDLALRQFFID
                     NNLNVRLGDFNASQCSGHVALGYEKASHCLPRDYELPNTETSDVFALGSTLYELVTGN
                     APYSELSGPKSDDPDIIKAQIRRQHEVDHEIETRYKNRYFPDVSGLFGGEIIMGFWSG
                     EIPSARAALD"
     gene            <1354955..>1359836
                     /locus_tag="TRUGW13939_10818"
                     /db_xref="GeneID:55998297"
     mRNA            join(<1354955..1355826,1355893..1356137,1356192..1356326,
                     1356379..1356469,1356527..1357630,1358024..>1359836)
                     /locus_tag="TRUGW13939_10818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493928.1"
                     /db_xref="GeneID:55998297"
     CDS             join(<1354955..1355826,1355893..1356137,1356192..1356326,
                     1356379..1356469,1356527..1357630,1358024..1359836)
                     /locus_tag="TRUGW13939_10818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349821.1"
                     /db_xref="GeneID:55998297"
                     /translation="YYAELSIFDTTPDFMESFSASPNPDGVGPASSTSISDLPRSQID
                     AIIRTKRKAREPKACYPCHTRKVKCDRNLPCDGCVKRDHADLCSYERPSKKRHATPSQ
                     SYLENVSEYYSKEATPSMRMSNQDLPVKSATIETESPNGPLEPQISIPREDWDNVCNK
                     LKEMENTISGLRNGLEQVEAGNRSSAISDPLGIDTNQRSNRESPEREGIHTTHMYGEG
                     TVHLGSRSVLAYILNKSGSLQAQTLLEGGLLPKLGLDNETATYPFVDLWSSDTSSFDV
                     NAVCSALPNDQQIREFFYFYRDIAGTLYPVLVDVPGFEENLETFLQNRAASGGGLKTQ
                     RHFGINLAFIGLLFAVLASGCQSSDLPAKERELTSQVYVCCSYQCLRMCNFVSQPTLE
                     AMKTLLIIGNVLSYNMNPGVSYVLLGMTIRMSIALGLHAESNRFDFAERYTRRHIWWS
                     IAWQDSHFSLSYDRPSTVAISQPEIADRADAQAGNRDYFETMCRIISLTLEVVRERMV
                     TPHSHMSFKTIQAYKERIQQAMADADPHLRDRKYCRSPMHHLERLALKVHFSYITSEL
                     CRPALKAEADRNDPLFHKVREDCVDSLVGTVESYIELHSFSTHGSRSWITLQRAISCA
                     FLLAVIDEGKTEPKVRDLLHQLETIIAERASAEGEFGADGIGNEGTAFPQLVGTTASY
                     ADSGTASGATKAHLSAVEPLQEPRSASIPTFAPVNTHTQWTKPLIKSLRALQKLNIAF
                     SASHGSRENGDSNSSYGVQGIPPASAYTQNASRPTNNSTTPNIGSLPPPTPESSTSSD
                     WAFPGVLDRAAEYIHPPFKKQMAAKRNRLSDVQRKAIREWWFNQNPRPHQKAIVGWFF
                     QQYGKNVSQSSICDCVSSKYEYLDKVDASVLAETRPAYRIRNSHWPILEDRLARWQRD
                     CLDQGQRVTGDMLIEKAKEVYPQIPEYRDKQPPEFSSGWLSRFKERYLLSTPRKSSQA
                     KWKRDEARRRNIPLSTATATTAAAAAPSLLGFDSLPETEPTGIPSLVSLDNMDPELER
                     VSISRPSHRLPVSETQHSSALVSQSSSQSAAIDSGTVDATEEILSMRILCHVYKDEDI
                     YCMSETSLLWRKAPLPSIQSAQKQNSRLSFIMCTNHTGNDRLPLWIIGNTSSARSLND
                     LNIEALGGHWCSSKKGAEVDPPLMREWLLKFYDHIGKDRSILLLLDKKVASHTLGLEL
                     APPPANIRIQWLPPSSGSTKSPFQPFDHGIRHGLKMTYRRQWLQYIVKSKRQSADPFA
                     TVSLYHAVHWAINAWLSEMSGISIQKCFSKAIGATKNTICDGLLEFTGPSCGALYDET
                     HRIFVKNHQDIRDFHAFLDLEDGSNADVGRQQNISRQPMPVEEEDENETASMRIPTVE
                     QALQSVQILMCYKEYQSGTTRDEMKVLEQWKRDLVATTRTT"
     gene            complement(<1360080..>1362402)
                     /locus_tag="TRUGW13939_10819"
                     /db_xref="GeneID:55998298"
     mRNA            complement(join(<1360080..1362241,1362306..>1362402))
                     /locus_tag="TRUGW13939_10819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493929.1"
                     /db_xref="GeneID:55998298"
     CDS             complement(join(1360080..1362241,1362306..1362402))
                     /locus_tag="TRUGW13939_10819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349822.1"
                     /db_xref="GeneID:55998298"
                     /translation="MEKFLRSWRQDALNRSQNETAVYVGDKILALTNSDTDAFWLAQV
                     HFSNNNYTRALTLLSRKDLISRSTSCRYLAAHCYLKQNKFDSALSVLGEQNPTHLIHS
                     AGHSRRKIQHLNGHSHVTLRNGKSASSKAERFERSEEQDREDGNNLRFEAAMCYLRGL
                     CYAKQNAFDRARDCYKDAVRIDVQCFEAFDQLMKNSLMSPAEELEFLESLDFDSISVP
                     SDPSASQEAAHFVKMLYTTRLSKYTSPATLSDATETLSTHYNLATNPDILLSRAEALY
                     TQCRFTEALELTSSILTTPETGAIVTGSPRVPSQNLGHSPSVYPLHLACLYETGAINA
                     LFLLAHTLADNAPEESYTYLAIGVYYLSVAKIAEARRFFSKASLLDPHSAPAWIGFAH
                     TFAAEGEHDQAIAAYSTAARLFQGSHLPQLFLGMQHLALNNMSLAHEYLCAAYTMSSG
                     SPSGEAVSIPSTLSSGLPSLGGDPLVLNELGVVLYHQAQLGDAVGLFRQALGLAEALQ
                     CDPGAWVATRANLGHALRRMGNLEEALAEFDECLRVGAGGGSMGYSTTIGGVTTTSVG
                     VAGYEDRGLIGSLQTSRGLIYLQQGRTLDAVTVLHEAVRVLGVSGGEAAGGAGIAGTV
                     LSRAMELWTLEGRGKHDSIGAGRGKDKARPREELDVGESWTDNVVDSGTFDEAVEMEL
                     DTQAKGLLGNALARVRPRRAEKQPQPLEPTTLPEEMELEEPPENRSRGGSRPINNRQS
                     PTRRVQARNPAG"
     gene            <1362823..>1363863
                     /locus_tag="TRUGW13939_10820"
                     /db_xref="GeneID:55998299"
     mRNA            join(<1362823..1362839,1362912..1363042,1363107..1363207,
                     1363282..>1363863)
                     /locus_tag="TRUGW13939_10820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493930.1"
                     /db_xref="GeneID:55998299"
     CDS             join(1362823..1362839,1362912..1363042,1363107..1363207,
                     1363282..1363863)
                     /locus_tag="TRUGW13939_10820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349823.1"
                     /db_xref="GeneID:55998299"
                     /translation="MSERKVLTKYYPPDFDPSAITRTKKVPGAKVKLLTVRLMAPFSM
                     RCTSCGEYIYKGRKFNARKETTEEKYLSITIYRFYIRCTRCSGEITFKTDPKNMDYVC
                     ERGAKRNFEPWRTNATNHQDETEQEVLDRLEREENEEREQLERDKMAELEEKMLDSKR
                     EMAVADALDEIRTRNARIERGEARGEEVALANVVDEADEARLRAEKEDEEAARRAFMT
                     STGEKVKRLVEDDEADHAAAVDDKPKNVTPAAPSFTRTKKPKKPFSAGLGIKKKTSLV
                     "
     gene            complement(<1364339..>1379536)
                     /locus_tag="TRUGW13939_10821"
                     /db_xref="GeneID:55998300"
     mRNA            complement(join(<1364339..1365022,1365071..1375867,
                     1375951..1376108,1376188..1376296,1377026..1378858,
                     1378918..1379230,1379292..>1379536))
                     /locus_tag="TRUGW13939_10821"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493931.1"
                     /db_xref="GeneID:55998300"
     CDS             complement(join(1364339..1365022,1365071..1375867,
                     1375951..1376108,1376188..1376296,1377026..1378858,
                     1378918..1379230,1379292..1379536))
                     /locus_tag="TRUGW13939_10821"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349824.1"
                     /db_xref="GeneID:55998300"
                     /translation="MFNRSNLPFGQRPPQGQDPRSRNGYDTVMGDAGSNSRGYGGPPP
                     PSQRGPPSSQRRPAPQGEGVWTLRSEKSPNTAYTYGNLVAVSSLDFPLTAFGPEFYLL
                     VNDLYVFSARPLDGFPQGYIGFAERQRMWARIAVTDSVRAQIYNPFNQERKAYLGSTD
                     IEIGFAGKSKTEEHYDQNDLGNSVREKFQNQILAPGQRVLMDHRGIPLALTIKTVELM
                     DLMSEKQQESATDGVATDPTARGILTPHTVVNFYKDAKSGINLKASDRRPAANSIIRP
                     DFKFENMGIGGLDSEFSTIFRRAFASRIFPPGLIDKLGIQHVKGILLYGPPGTGKTLI
                     ARQIGQMLNAREPKVINGPEVLNKYVGQSEENIRKLFADAEKEYKEKGEESGLHIIIF
                     DELDAVCKQRGSGGGGGTGVGDSVVNQLLSKLDGVDQLNNILLIGMTNRKDMIDDALL
                     RPGRLEVHMEISLPDEQGRAQILKIHTQKMRDNNVMEPDVDLLELAQLTKNYSGAEIA
                     GLVKAATSFAFNRHVKPDTVAGIKEDVTELKVKRDDFYNALEEVKPAFGVAEEQLENC
                     VQQGILHYSHTIKEILNEGHLFIKQVGATGATPLFSVLFHGPSASGKTALAARIAIDS
                     GFPFIRLISPEDMVGYSETAKIQHITKVFTDAYKSNTSIVVVDNIERIIDWVPIGSRF
                     SNSVLQTLMVFLTKPPTHGRRLLILATTTERSLLRELDMYNSFNADIMVPTVDSYEEL
                     RHILEQSEAFTPEEIERSLGGIYSIDEDKKIGVGIKRILLGIETAKQDPDKAGRFSNT
                     PFSVISAIVFSFGAAAIMAERGIDLFVDRLGSEKFENSKKANVAVELRDSIENYCTAA
                     NYPVFLAKIWPVFKKILKGDPVFTNLSYEQKLRNCLLETLHRLPTASPDVEPYAVDMV
                     DTLMQLVRVENEENAVLCMKIIMDLSRNQVKATTSRVQPFLELIQEMFQTMEEVVRET
                     FDSPNQGGTPGLPSTPGVLPQNFQSPRPASPSTSVADLGTEQQANHHLQKGMQSFKLL
                     AECPIIVVSVFQAHRASVATNVKLFVPLIKSILLLQAKPQERAHAEAAAQGKLFTGVC
                     KDIKNRAAFGEFITAQVKTMSFLAYLLRMYAQQLQDFLPTLPSVVVRLLQDCPREKSS
                     ARKELLVAIRHIINFNYRRIFLEKIDELLDERTLIGDGLTVYETMRPLAYSMLADLIH
                     HVRDHLTRDQIRKTVEVYTKNLHDEFPGTSFQTMSAKLLLNMAEKISKLEDKQDARYF
                     LIMILDAIGDKFAAMNHQFENAVKTSRAFKKRTDLTPDSYLVDRDSPPDWDEIDIFSA
                     VPIKTSNPRDRGGDPVSDNIFLFKNLINGLKNIFHQLKNCNPTHIQIDPNNTPINWPE
                     VSYGYNAEEVKVIKKLFHEGARVFRYYGVDQPSPDVHYSSPFEYLASQYTAPMSREEK
                     ELLESFGTVFHCIDTATFHEVFHSEIPYLHELMFEHGALIHLPQFFLASEATSPAFSG
                     MVLQYLMERIHEVGTSDMAKAKILLRMFKLSFMAVTLFSSQNEQVLYPHVTKIVTKCI
                     ELSVTADEPMNYFLLLRSLFRSIGGGRFELLYKELLPLLEMLLETFNNLLMSARKPQE
                     RDLYVELTLTVPARLSHLLPHLNHLMRPIVVALRADSDLVGQGLRTLELCVDNLTADY
                     LDPIMSPIMDELMTALWDHLRPHPYSHFHSHTTMRILGKLGGRNRKFLNHPPELSFQQ
                     FADDAPSVDIRFIGPNEKRPFPIEIGIDLAYAKLLETPKASSAKTSDIYYKQQAYRML
                     SSQLKLYIGHENLPDDLASLIRLQAEDLLEGKIQGPVDILDKSERSVSISKKVVQEET
                     LKKLLKACFFATTIPELEPAASSFVADVCRHIVVVEIGRAFAQARHTRKAFDVNSGEG
                     PVYLDSRLLADVIVDCFSSDNPKTRDSAKVGLDVIKESAGIIFGAPDKAAKLPFWQHL
                     GRVFCHSCHSEEWFTKAGGSLGIHLLATELELGDSWLYERQTEFVRALMYVIKDTPPD
                     LPASTRIRAQETLSLILKRCNKGISKDDLKNEKSRLHTLCGFFIYELSHMNKHVRETS
                     QKAFAVLAEVIGCEVHELMLPVKDRLLQPIFNKPLRALPFPVQIGFIDAITFCLSLHK
                     NIVTFNDALNRLMLESLALADAEDESLASKPNEFKNAEMIGNLRVACLRLLSMAMGFP
                     EFATGPNASSRGRVISVFFKSLYSKSPEIIDAANAGLRDVLTQTNKLPKDLLQNGLRP
                     ILMNLQDPKRLTVAGLDGLARLLTLLTNYFKVEIGQRLLEHMKVIADDATLQKVSFNL
                     VEQNAAMKIVASIFNIYHLLPPAATTFMENLVNKVLDLEDKLRRTSNSPFRKPLVKYL
                     NRYPKDSWAFFQQRFSDERYGRFLGQVLADPESAILRSAVVADTDGFKTAAFGSESTD
                     GKNTAAINAIHIVHSICTHGPTRKWLVNQNDLKLKLLNAGRDLQFKLRHDKLPASERL
                     RVEQAEDQLMEIFTIYLSESLQDLDFLFELISGLSSDELKRTLAFPKFIYKHIILNES
                     IDYRRSVIMRCLDLYGQRGSSQKMKTYAFHNLVNPIFAMDVKLTWDSPPNSPKLIDKS
                     MAESIQSRLWRPQVGDITEESNQAGVDHSRMESLQLTALLIKYHHQTVQESRKDIIKF
                     AWNYIRLEDIINKYGAYVLISYFIAHYETPFKIVIQVYVALLRAHQNEGKALVTQALD
                     VLAPVLPTRISAAAQNAQQGAQQSNQQNTQQPSQQGNQQGNQQAVDLRYPLWTKWPRR
                     ILAEETANLQQVMSIFQFLVRQPDLFYESREHFVPLIIPSLAKIAVPPNPSSESKKLA
                     LNLIGLIWHWEEKRVQEINSGRAISESPNSKKRKLDDSQQPESPSLAPPSAQSDYVVP
                     QDMRANLIRYLISFITTLPERFPVPAFKLRDLPTQKTQLPVISGEMVKKAIQLLRNLL
                     QPEYWGDLEIDLYPKVIEPILASEKAEKPDEKYITTMVNTLQVLRVLIASKPSEWIVN
                     RVPYIQKLLEKPLRSENPELQDCLHGVEDEMDISPKLPPPVKYVLDALPDDQPDEEDA
                     MDVDSTPSEFVTYLSAIATEGLSGSNYISGLNTLWTLSQKKPSEMDNHIVQVMKTFSQ
                     KLAKDHVAAYTNNQAAVQPGAKPGENGAVPDQQEFEIGVDLILKTIDLISVRMSNLGD
                     QRRPFLSVLAQLVERSQNAKLCSKILGMVEGWIFHSNESWPTLKEKTAVLHKMLLFES
                     RQDQTMLKKFLDLVIRIYEDSKITRTELTVRLEHAFLIGTRAQDVEMRNRFISIFDKS
                     LTRTASSRLSYVLTSQNWDTLADSFWLAQASHLVMGSVDMNTTARLHPDDLNVYPISF
                     LFSAVEQDSRKADVMVDSQLETFVTDRKRFISDIGDVRVRDLLEPLCQLQHTDSKTSY
                     KLWTTLFPIVWSTLAKEERIDLEKGVVTLITREYHQRQIDKRPNVVQALLEGAVRAKP
                     RFKIPPHVMKYLSRTYDAWYTSAVYLEESANNPIIDTAIVRESNLDALVEIFAGLQED
                     DFFYGTWRRRCKFVETNAALSYEQHGMWDKAQQLYENAQIKARSGAMPFSQAEYILWE
                     DHWLICAQKLQQWEILSDFAKHENLNDLLLEAAWRNIEHWQNEGNREQLESLIKSVSD
                     APTPRRTFFQAFMSLLNFHLKKDGIQEFNNICDESIQLSIRKWHQLPNNITHAHIPIL
                     QHFQQLVELHDASVICSSLSQTNERNLDTKSAELKLLLGTWRDRLPNVWDDINAWQDL
                     VTWRQHIFQLINGTYLNLLPPQTNNVASNSYAYRGYHETAWIINRFAHVARKHQMPDV
                     CINQLSRIYTLPNIEIQEAFLKLREQAKCHYQNPKELTNGLEVINNTNLNYFGAQQKA
                     EFYSLKGMFLAKLDHVEDANESFGVALYYDLKLAKAWAEWGQYNDQRFKSDPTDYELA
                     GNAVSCYLEAAGLYKNAKSRKLLSRILWLLSLDNEEGRISNAFENFKGDTPVWYWITF
                     IPQLLTSLSHREARLCKAVLVKIAKLYPQALFFLLRTNREDMISIKKSHDVKQEKLNR
                     AKQQASPNPKAESLSGSRPGTATSGGPTQTTPNSANNTPAQTTNPQSNDQANGQANGQ
                     PQTATPTQNANTGQDSGAQQQTQPQAQGQSQQPAQQQLKPQQPGQQQQQAQQGQAQAQ
                     NPNNSTPSQPAAGAEPEKEPLKKPWEYSEEIMSGLKTAFPLLALSMETMVDQIQKNFK
                     CPPDEDAHRLIVALLNDGLAYVGRSPAAYAQDFKLPPATEANITRFAETILPAHIRKS
                     FEADFVVKKITMFEYVQKLRRWRDKFEEKLDRRPQSQFLEVYSPHLSEFRFLKFEEVE
                     VPGQYLLHKDKNQDFVRIDRFLPDVNLVRGIGVCHRRLKIRGHDGSIHPFAVQHPAAR
                     HCRREERILQLFRIFNGVLAKRKESRRRNLYFHLPLMVPLAPHIRLVRDDPSYISMQG
                     IYEDYCRRTGMNKDEPVLFTMEKMRGLAEMKQTRPLEQQQILRTEILTAVQEKWVPND
                     VLLDYFQKTYPNYADFWLFRRQFSYQYAAICFMTYVMHMGNRYPNKISISRATGDIWG
                     SELIPTVNPAKAFFYNPEQVPFRLTPNIQTLMGPIATEGVFASTLMSIARCLTEPRQE
                     LEQQLSVFVRDEMIFWATAHHRSTLTENQLRELVQNNSDIIVNRAVSLASPPEGNLPA
                     NQTTIDLISKAVNPQYLASADALWMPYL"
     gene            complement(<1380666..>1383068)
                     /locus_tag="TRUGW13939_10822"
                     /db_xref="GeneID:55998301"
     mRNA            complement(join(<1380666..1381002,1381056..1381183,
                     1381245..1381415,1381473..1381826,1381883..1382482,
                     1382543..1382920,1383045..>1383068))
                     /locus_tag="TRUGW13939_10822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493932.1"
                     /db_xref="GeneID:55998301"
     CDS             complement(join(1380666..1381002,1381056..1381183,
                     1381245..1381415,1381473..1381826,1381883..1382482,
                     1382543..1382920,1383045..1383068))
                     /locus_tag="TRUGW13939_10822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349825.1"
                     /db_xref="GeneID:55998301"
                     /translation="MKGFRQRVHEQLSRAKDSNKSSKKRDSSSNASNASLTPAQQAQS
                     SSPNHVTPTSSSTSVNDPRGSKDNLSPASANSAAAQQGATGQAGMDQFLVPSAQVESG
                     THAVEAVNIPGTPTRQGQQPLTPSVVISPSAPHVPPPGAAETMPGDLAPPKKSHAFDR
                     LHSTPKDISEGIRTPKRQHSSRFDISDQRQRELEKLPGFHEVPPNRRQDLFMQKIDQC
                     NIIFDFNDPTADMKSKEIKRLALHELLDYVANNRSVITEPMYPRVVDMFAKNLFRPIP
                     PPVSPQGEAFDPEEDEPVLEVAWPHIQVVYEFFLRFIESQDFNTNIAKQYIDHQFVLQ
                     LLELFDSEDPRERDFLKTTLHRIYGKFLNLRSYIRRSINNVFFQFSYETERFNGIAEL
                     LEILGSIINGFALPLKEEHKLFLTRVLIPLHKVKCLSMYHPQLAYCIVQFLEKDSALT
                     EDVVLGLLRYWPKVNSTKEVMYLNEVEDIFEVMDPAEFAKVQEPLFTQLAKSVASPHF
                     QVAERALYFWNNEYFCNLVSDNVETILPIMFAPLYENSKGHWNKTIHSMVYNAMKLFM
                     DINPQLFDDCMQEYKEHQSGADEREKSRQQRWDLVVEQAEKRKNGCVPTQPLLPTSNS
                     GKAEEIDPITQDSQKRLNALKLDESATPKENTLNSVSHT"
     gene            <1384509..>1386513
                     /locus_tag="TRUGW13939_10823"
                     /db_xref="GeneID:55998302"
     mRNA            join(<1384509..1384655,1384719..1385106,1385159..>1386513)
                     /locus_tag="TRUGW13939_10823"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493933.1"
                     /db_xref="GeneID:55998302"
     CDS             join(1384509..1384655,1384719..1385106,1385159..1386513)
                     /locus_tag="TRUGW13939_10823"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349826.1"
                     /db_xref="GeneID:55998302"
                     /translation="MVAEDNVHPRYAPWFQIPARRIVAVEHPGIVKNVDRAIATLQGE
                     KGLANILDPSKPATRGLLFLRPEDPMARPIESVNRPSNNILLKVTVPKWTGRKRKRGS
                     DEPFTDSKSTPEAVERERQSSAFRQQSLRDNATKYTVEPVGMVERTHNYRSIPDYVFS
                     TTASPFTQRVRETIFTPDFEKMRQFDMSMSKGELTNVDLIPPPAFSKAHIPFQYTYRQ
                     NPTVKVFQDTAGNVNSINTQTPNKVRTHQVIFDVPKVPSEPHKECPPVSELDQELQET
                     IAILETLFAERPAWTRRGLRNALKTPEQRTALRHAIGYVGYIFRSGPWRDAIIKLGHD
                     PRTDVEFRNFQTFVFRVQAREPDVARDGGGSAKRHTGVAASGPRDFSGLDISGIPTVT
                     RDELPDSHLWTGKAPLPLDGKIWMVCDIVDPIIKELLYPTNPAPDFLRSECDPVSDGW
                     YGSGTLAKVKTIMRQKINALTQQHREPADSEYECILGFPDHHAADDPSLEAFYVNPET
                     ATPRELMLATEVRTTLKGAANWKTAVSAGRPSNAVAEDEEGEEREAIRRVMEENEPLS
                     DDEDDNDVGNGDEEDEDEEDIDDVNEGEARAQPAKRQRTAKGKAKAKAKPKGKGKQKR
                     VRIDD"
     gene            complement(<1387056..>1388012)
                     /locus_tag="TRUGW13939_10824"
                     /db_xref="GeneID:55998303"
     mRNA            complement(join(<1387056..1387846,1387904..>1388012))
                     /locus_tag="TRUGW13939_10824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493934.1"
                     /db_xref="GeneID:55998303"
     CDS             complement(join(1387056..1387846,1387904..1388012))
                     /locus_tag="TRUGW13939_10824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349827.1"
                     /db_xref="GeneID:55998303"
                     /translation="MSALTIAPSFGPRPLVQSRMRGALRPTKLSTVNRLNATPRPTPL
                     KRSIVYSSDEENIAPSFGKLDSTKRKRSSEDDEQLFESPKALKTTRMSSASEVNKPVE
                     TPTPRKVSVTIGKPAGRSPLGKSTKAFGRRSQRTPLGRLAQAPAPITKSPAPQSTRQP
                     ASWFFDIHVDTPDEEASNTMQHFAGRLDISDDDEARAKADDRGKENIPPHELGIAMPP
                     AAQPLMSTARHGKNMMASSRSPLVELKPSDYYPADLKGVFDTVVINEASTPTVSKELI
                     PSEPDLSNTEAEFVTETEKNAQI"
     gene            complement(<1388139..>1388680)
                     /locus_tag="TRUGW13939_10825"
                     /db_xref="GeneID:55998304"
     mRNA            complement(join(<1388139..1388450,1388519..>1388680))
                     /locus_tag="TRUGW13939_10825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493935.1"
                     /db_xref="GeneID:55998304"
     CDS             complement(join(1388139..1388450,1388519..1388680))
                     /locus_tag="TRUGW13939_10825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349828.1"
                     /db_xref="GeneID:55998304"
                     /translation="MRNHALPEHAAWPAAPPASHDALRAVIGGRDIVQREEFLVLMHA
                     REKIKKTDILSRLRAFLRRASSTTATISISPRPPPSFPLSASVSPPASCVAPSFFPRS
                     RARPLPTTALITITPPPPPLPPYPLLSLSLLILRVGKQLLLLVPPTRYCTQRKLV"
     gene            complement(<1389731..>1390873)
                     /locus_tag="TRUGW13939_10826"
                     /db_xref="GeneID:55998305"
     mRNA            complement(<1389731..>1390873)
                     /locus_tag="TRUGW13939_10826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493936.1"
                     /db_xref="GeneID:55998305"
     CDS             complement(1389731..1390873)
                     /locus_tag="TRUGW13939_10826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349829.1"
                     /db_xref="GeneID:55998305"
                     /translation="MAPLIRIIGSLNADMVSVTPRFPNAGETITATSFTTSAGGKGSN
                     QAVACGRLSRRKPSSTGAAASSTPVNVEMVGAVGNRDGHFQALLRPTLEESGLGTSRI
                     RVVDDYTGVAVIIVDESAGGENRILFSPGANYSGMQPIPEVIQTGLAAPVPDIIVMQG
                     EIPIDTVIGILRDINQFKQKNREAGRKGIESGPEVMFNPAPAPPDGLPTDVYAAVDHL
                     IMNETEAELMAPNDQELLRVVPGAADANRRDQVARYFHQLGVTFVLITLGSKGAWYSA
                     GDAAAASGENQTRFTNEIPAAQVSRVLDTTAAGDTFVGGYAVYIARWREQRRLQGKAA
                     VDLAADEKKERYQVVMDEAMKRAGRASARCVERQGAMDSIPWEDEI"
     gene            <1391466..>1393793
                     /locus_tag="TRUGW13939_10827"
                     /db_xref="GeneID:55998306"
     mRNA            join(<1391466..1391602,1391656..1391782,1391842..1393244,
                     1393301..>1393793)
                     /locus_tag="TRUGW13939_10827"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493937.1"
                     /db_xref="GeneID:55998306"
     CDS             join(1391466..1391602,1391656..1391782,1391842..1393244,
                     1393301..1393793)
                     /locus_tag="TRUGW13939_10827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349830.1"
                     /db_xref="GeneID:55998306"
                     /translation="MDRRVPYSLSVLAPSQDGADESRLAIQARLREFILAFQLDNSFI
                     YRDQLRQNVLIKQYYCDVDIAHLISYNEELAHKLTTEPGDIIPLFEAALKQCTQHIVY
                     PSQRDITLPPHQLLLHSSASHISIRDLNATNISHLVRIPGIVIGASTISSKATVISLR
                     CKSCEYMDHITVDSGFSGLTLPRRCGRRPQPGEQRSDPCPMDPYVIAHEKCDFVDQQV
                     LKLQEAPDQVPVGELPRHVLISADRYLANRVVPGSRCTVMGVFSIYQAKGGNKAAAVA
                     LRNPYLRAVGISSDVDHTAKGAATFTEEEEQEFLEMSRRPDLYEAFARSIAPSIYGNM
                     DMKKAIACLLMGGSKKILPDGIKLRGDINVLMLGDPGTAKSQLLKFVEKASPIAIYTS
                     GKGSSAAGLTASVQRDHNTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAME
                     QQTISIAKAGITTILNSRTSVLAAANPTFGRYDDLKTPGENIDFQTTILSRFDMIFIV
                     RDGHDRARDERIARHVMGIHMGGKGMEEHVEAEIPVEKMKRYISYCKSRCAPQLSEEA
                     ADKLSSHFVSIRKQVHRAELDANARSSIPITVRQLEAIVRITESLAKLSLSPIATTAH
                     VDEAIRLFLASTMDAVTQGEGQGSKELMEEVAKVEDELKRRLPIGWSTSLANLRREFV
                     DGRGYSEQALNRALLVLQRRDTVHIRSGGSQIYRNGV"
     gene            <1394464..>1397934
                     /locus_tag="TRUGW13939_10828"
                     /db_xref="GeneID:55998307"
     mRNA            join(<1394464..1394710,1394768..1397651,1397715..>1397934)
                     /locus_tag="TRUGW13939_10828"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493938.1"
                     /db_xref="GeneID:55998307"
     CDS             join(1394464..1394710,1394768..1397651,1397715..1397934)
                     /locus_tag="TRUGW13939_10828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349831.1"
                     /db_xref="GeneID:55998307"
                     /translation="MSGAPSPRKSIDSLASINSISTPSLQQYAQSSQSQSQHESPRIA
                     PSQRIPQRRSSTASSIVSIGGMLDSSRHHGSIAELGQNAISTLLQPPIVRTGLVPYSQ
                     VPTTGYKPPTSKDIPPVTLTNVPNVESKDFQPYLEQVGSLYDTFQRAKEGNEENESPL
                     VRGNKGGLSPNPAPVRLDENDSRRPSGIERRLSGVSASSRAVSPFDMRGRRRSSYGKG
                     PQAVTPLSTIPNVYFEEDFHLENPRTFDVVSERSEVVRQPSKPPGAEIAANGSTLEPP
                     TTGRKVLATNAILQEKLSWYMDTVEIHLISSISTASKSFFTALGSLRELHAEAADSVE
                     RIKTLRMDLNKIDKEMAMGGLKVVHLRQRRDNVRKLADAMTQLHEVVEAVTECEKLVD
                     QGDIEDAIGGLDEVERLLAGEQASRSRGESKSESKSRVPVDLRGIHALQGVDEELSQL
                     RQRIGMGYEIRFLNDLLTDLRQHISGVPANVTLQRWGLSFQRNRVGHRPTPSISPAYL
                     SFNAEVRSKLHVQLMGLGRSHYMMPAATSFKAAILREMKGLIRKHLPSSSDDDNESMM
                     SASTHGGRQLSSQEKSSILARNLRALDAGDAYEMLQEIYTNVSEALRRLSVQVKVLLD
                     ITSGLGTSTSPSLGRSRSPEPRSMEELLRSKGRAADVAAAQEEILQVLDMSSLLGQAV
                     DIVQSQVVKVLKVRSEQTSHLPLEDFLKYFNLNRLFADECEAISGRSGTSLKTVVDNQ
                     IRDFIVRFSDAQRHNIVEVLDSDKWDAKDFGDAENAVLDKVIRASTGDVDSWSRASKI
                     WESQTEKSSAEPVTENGAAVNGSGKEKIRTATFDEQKYILPQSASTMMRSIEEFEHLT
                     SNIPSMTQEIGLNLVECLKLFNSRSSQLILGAGATRSAGLKNITAKHLALSSQALSFI
                     VALIPYVREFIRRQSSSGQLIAEFDKVKRLCQEHQNGIHEKLVDIMSSRSTNHVAAMK
                     KVDWDAEKDPRAVSTYMETLTKDTATVHRILARHFPDATLMMVMGPVFASYREQWTKA
                     FQEATVKTESGRQRLLSDAEYFKSRISKIDGSGDLGDLLVQVTNAKTIVPEKNGDHDA
                     QSPTGSPPVPEKDTPVSAEKEPAAEAKS"
     gene            complement(<1398333..>1398658)
                     /locus_tag="TRUGW13939_10829"
                     /db_xref="GeneID:55998308"
     mRNA            complement(join(<1398333..1398497,1398569..>1398658))
                     /locus_tag="TRUGW13939_10829"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493939.1"
                     /db_xref="GeneID:55998308"
     CDS             complement(join(1398333..1398497,1398569..1398658))
                     /locus_tag="TRUGW13939_10829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349832.1"
                     /db_xref="GeneID:55998308"
                     /translation="MPRGAEYDNGVPQSDNAIENGPNKAHGTNPGSDIDRSYKAANLP
                     ETTGGNNLASGGGSSGPRVSGSGKGGHDPKTLGEKKGLKA"
     gene            complement(<1399171..>1400364)
                     /locus_tag="TRUGW13939_10830"
                     /db_xref="GeneID:55998309"
     mRNA            complement(join(<1399171..1399842,1399896..1400045,
                     1400099..1400270,1400330..>1400364))
                     /locus_tag="TRUGW13939_10830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493940.1"
                     /db_xref="GeneID:55998309"
     CDS             complement(join(1399171..1399842,1399896..1400045,
                     1400099..1400270,1400330..1400364))
                     /locus_tag="TRUGW13939_10830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349833.1"
                     /db_xref="GeneID:55998309"
                     /translation="MSTDKITFLTNWHATPYHAPLYLAQSKGYFKEEGLKVALLEPND
                     PSDVTEIIGSGKVDMGFKAMIHTLAAKARGFPVTSFGSLLDEPFTGVVYLKDSGITTD
                     FKTLKGKRIGYVGEFGKIQIDELTKYYGMTPDDYTAVRCGMNVTKAIIRGEIDAGIGL
                     ENVQMVELEEWLASQGRARDDVQMLRIDQLAELGCCCFCSILYIANDSFLAENRDKVE
                     KFLRAVKRATDFVIAQPQVAYEEYVDVKPIMGSAVNRKIFERSYAYFSRDLKNVPRDW
                     AKVTNYGKRLGILDASFQPNYSNELLSWALDADSTDPLGDQKRMAELQKKVAKDGGFQ
                     RLEVASSA"
     gene            complement(<1401345..>1403775)
                     /locus_tag="TRUGW13939_10831"
                     /db_xref="GeneID:55998310"
     mRNA            complement(join(<1401345..1401453,1401517..1401712,
                     1401777..1403139,1403200..1403475,1403535..1403632,
                     1403697..>1403775))
                     /locus_tag="TRUGW13939_10831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493941.1"
                     /db_xref="GeneID:55998310"
     CDS             complement(join(1401345..1401453,1401517..1401712,
                     1401777..1403139,1403200..1403475,1403535..1403632,
                     1403697..1403775))
                     /locus_tag="TRUGW13939_10831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349834.1"
                     /db_xref="GeneID:55998310"
                     /translation="MATSETPKRDTRNHQLFEIATEVANRVGGIYSVLKSKAPVTTAE
                     YGDRYTLIGPLNRASAAVEVEVMEPTDPAITETIASMKERGIDIIYGRWLIEGAPRVL
                     LIDTGTGYRYLEEWKGDLWNTSGIPSPEGDHETNEAIVFGYLVAWFLGEYIAHESKRA
                     VIAHFHEWLAGVALPLAKKRHMDLTTIFTTHATLLGRYLCAGSVDFYNNLQHFDVDAE
                     AGKRGIYHRYCIERAAAHSADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFSAM
                     HEFQNLHSQAKEKIHDFVRGHFYGHMDFDLDNTLYCFTAGRYEYRNKGVDMFIEGLAR
                     LNHRLKNSGSKTTVVAFIIMPAQTSSLTVEALKGQAVVKSLRDTLEMVEKGIGRRLFE
                     RCLTWKDGDNMPDEKDLITSQDRVLLRRRLFALKRHTLPPIVTHNMVNDSEDPILNQI
                     RRVQLFNHPSDRVKVVFHPEFLNSANPVLPLDYDDFVRGTHMGIFPSYYEPWGYTPAE
                     CTVMGVPSITTNLSGFGCYMEELIENSSDYGIHIVDRRSKGVDDSVNQLADFMFDFAS
                     KSRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLALRRAYPNSFDSEEDFTDYIGGT
                     AQKISRPLSVPGSPRDRSGMMTPGDFASLQEGREGLSTEDYIAWKLPEEEDPDEYPFP
                     LTLRTKKPGDHAPSPLDSFSLNGK"
     gene            complement(<1404980..>1405531)
                     /locus_tag="TRUGW13939_10832"
                     /db_xref="GeneID:55998311"
     mRNA            complement(<1404980..>1405531)
                     /locus_tag="TRUGW13939_10832"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493942.1"
                     /db_xref="GeneID:55998311"
     CDS             complement(1404980..1405531)
                     /locus_tag="TRUGW13939_10832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349835.1"
                     /db_xref="GeneID:55998311"
                     /translation="MKLSFLSLPLFLTLGLAQPENSLFVRQTANSTECSSPQPNDCSF
                     YAECVEARYHCGSTGYPLDYGQKYCQKSLDNASLLSTAGQAWVTKVMLCLQEHLAPYD
                     QGGNQTFADCTALSDYAFSTHPTCYVQGGLCTLPVTDWETIVFKIVGVNTLFDSWDAI
                     KATVEAAAGCGEFYLWAIAHGVF"
     gene            <1406579..>1408342
                     /locus_tag="TRUGW13939_10833"
                     /db_xref="GeneID:55998312"
     mRNA            <1406579..>1408342
                     /locus_tag="TRUGW13939_10833"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493943.1"
                     /db_xref="GeneID:55998312"
     CDS             1406579..1408342
                     /locus_tag="TRUGW13939_10833"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349836.1"
                     /db_xref="GeneID:55998312"
                     /translation="MDFHPTPLAFSFQGFHRFSLKNFKPYSLKKSFEFYDPNGRQREK
                     RKGLYDSFRSNQSGVLRTVCLQNGEILYENDYRGLRNRIIQLNDTVLLEQYIARYPRA
                     ATGPGEVYYHDPFFIAAECGSTDALRLLLNVHNTDPTQRKAPDKRELLDLACQNAHIN
                     TVRFLVDSEPLLGDVRAGNQYGDTALLSAAASLERFRYEDWKDNDLSEEWIRDRFVRS
                     EDIIQLLLDRGASARDSNTSGFFREEYDVHKSQPRNTVLSLAVSRASPGLVKRLIDEG
                     ADVHRKDWYLRLPDSKFGGSDIDATDVSVLHLASSYWNVAAITVLLHNGGTELLSSPD
                     SIGRLPIHWAAAGCMFHNEHTIPDNELDSRIIETFKLILTGGLDMINVKDKEGMTALF
                     YMIGSHAGCGIGHLHLLTKFLLEKGANADLQNNKGQTVLHILASNSMTGEPINAAFID
                     LLLAHGADIHQTDMNGDTVLHLMAKNLRQVEVTRAVVSKGANVRAVNAKGNTPFHEVG
                     LGLLRSRVFRRQKTEIVTLEDKLKAQNEMVAVLQDGNGYNNALMDQPNVAGKAPRQLL
                     EERRALWQDIESKSSRSVRNQ"
     gene            complement(<1408792..>1410468)
                     /locus_tag="TRUGW13939_10834"
                     /db_xref="GeneID:55998313"
     mRNA            complement(<1408792..>1410468)
                     /locus_tag="TRUGW13939_10834"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493944.1"
                     /db_xref="GeneID:55998313"
     CDS             complement(1408792..1410468)
                     /locus_tag="TRUGW13939_10834"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349837.1"
                     /db_xref="GeneID:55998313"
                     /translation="MSTQTGEIPLISEYQRYRDFHEESYSVGVVDDDGAVLYEEPYGS
                     LLNTIVQHNDVTKLAQYLENDANATHGHVEVYYWDPLYVAANSGSTEALNMLLKHHEN
                     HLTDTNMIPLHLRQFRLLHVACLSARVETALFLLDTQPALATLHAKADFWNWDMGCGT
                     PLLSAAYSFTSLPSGSDEDDSTICAQHARSEDLMNQLLDRGASARDSLMSSLRKEQIS
                     DTVLSLAISRASYGLLKRLIIEGADVHTKTAHEAHFFLNQPDENIAKSITPLHLASFY
                     ANSNGIRALFDYLGDKFTVAQMVLSSDSAGRLPLHWAARGADNTAHHYMLPRNEIVPH
                     VTKTIKLLLSIDQETVHARDHQGFNALWYTVRGFRESINNHFAVLKTLFDYRPDGSIR
                     DQEGSNMLHLLAFTQNGEATDPAIIEALVAYGANVNDVDARGNTPLNQMAMNLRQVAA
                     VRALLDGGASVAVKNLRGDTPLHQSAQGRVFPYRQEPPNIEWHGVSLDDKIKAQDEMM
                     KVLEEASDGLNLMKERNVDGKTAQQLKEETRSKWRLEESERLSRMSSYQL"
     gene            <1410799..>1412445
                     /locus_tag="TRUGW13939_10835"
                     /db_xref="GeneID:55998314"
     mRNA            <1410799..>1412445
                     /locus_tag="TRUGW13939_10835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493945.1"
                     /db_xref="GeneID:55998314"
     CDS             1410799..1412445
                     /locus_tag="TRUGW13939_10835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349838.1"
                     /db_xref="GeneID:55998314"
                     /translation="MAYSEFHTADSFDCVPAAFNTDGTALYDGEYNGLLRTIIKRNDM
                     DKLKQYVLGFSRRFLSCPAELTWCDPFWMAASYGSTDALRFLLEQYNAVQADKTPLNQ
                     RGFSLLHAACRTANVDVARFFLDSQPPLGTISARDEENETPLLSAASSLINLGFGDAS
                     NGNADDGADVYKWNIDRISRAEEFINLLLDRGACAQDSRFPNNDDDMKSQPLETVLGM
                     AISRGSYALVKRLLDQGADPYIKHHFDYNIVMRFGHHHDSFKDVNVLHMAALYWNAEG
                     IKALIDHHTNSYTDLIFSRDSNGHLPLHYAAVTQSFSECTRPDISSRLVDTFRLLLGG
                     NPGAINAQNEQGLTPLYYTVKTHGTCNGTMHLELAVRVLLEHGADAAISDSDGRNTLH
                     LLAFSGAGPISIVLLDLLIAHGANTNYADKDGNTPLHIMAMNLRQAHAVRFLCSRGAD
                     ISVINTNGDTVFHKAAEGIFLPHRNLEGKYGGVTVAGKISAQDEMMAVLQTASGGDEM
                     MNQPNNAGKTPRDLQAETRSRWQAPKRGAFRGRGRGYTRG"
     gene            <1413655..>1414089
                     /locus_tag="TRUGW13939_10836"
                     /db_xref="GeneID:55998315"
     mRNA            <1413655..>1414089
                     /locus_tag="TRUGW13939_10836"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493946.1"
                     /db_xref="GeneID:55998315"
     CDS             1413655..1414089
                     /locus_tag="TRUGW13939_10836"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349839.1"
                     /db_xref="GeneID:55998315"
                     /translation="MSGAIGAQLPYITPGGTMQAVAAVGNFYVKAPSLQHNKGQTVLH
                     ILADCSLGGELIKPKLVDMFVAYGTQVNHANIDSTALHIMARNLRLVNAVRALLSQGE
                     DINCINMKENTPLHEAMEGNLLSRQTREGELERVTLADRISA"
     gene            <1416127..>1417122
                     /locus_tag="TRUGW13939_10837"
                     /db_xref="GeneID:55998316"
     mRNA            <1416127..>1417122
                     /locus_tag="TRUGW13939_10837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493947.1"
                     /db_xref="GeneID:55998316"
     CDS             1416127..1417122
                     /locus_tag="TRUGW13939_10837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349840.1"
                     /db_xref="GeneID:55998316"
                     /translation="MSTSTMKAVVLHAHGGPEVLKVEQRAIPKPEAGQVLIRVKAFGL
                     NRSEMFTRQGNGQFFSVNLPRILGIEATGIVEHAPGGEFEKGQIVMTAMGGMGRRFDG
                     GYAQYTVVPTNQVQVITTPTKLGWDVLGAIPEMIQTAYGSITKSLSVKKGDRVLIRGG
                     TTSVGLTAISIAKELGAHVAATSRKPERESLLREYGVDEFLVDDGAIGKQIKDESQKF
                     DKILELVGAVTLQDSFQCVAPGGTVSFTGIVGNSRHIDQFSPMEIMPRGTYLTVYGGW
                     APEFMDTPLNDIVQKVEAGKFKIKVGKVFNIDQIAEAHQCMEANAAEGKIVILTD"
     gene            complement(<1417529..>1418638)
                     /locus_tag="TRUGW13939_10838"
                     /db_xref="GeneID:55998317"
     mRNA            complement(join(<1417529..1418452,1418519..>1418638))
                     /locus_tag="TRUGW13939_10838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493948.1"
                     /db_xref="GeneID:55998317"
     CDS             complement(join(1417529..1418452,1418519..1418638))
                     /locus_tag="TRUGW13939_10838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349841.1"
                     /db_xref="GeneID:55998317"
                     /translation="MATRISRPEFEAHVDPLIQEILESTKAYNLPENAQKWFESSLKA
                     NIVGGKMNRGMSVPDTASILLGRSLTAEESKHLSLLGWFTELLQAFFLVSDDIMDSSI
                     TRRGQPCWYRQEGVGLIAINDAFLLEGSIYTILKKYFRSHPAYIDIVELFHDTTFQTE
                     LGQLCDLITAPEDKVDLDNFSMEKYTFIVKYKTAYYSFYLPVTLALHYLQLATPKNLK
                     QSEDILIPLGEYFQIQDDYLDGFGSPETIGKIGTDIQDNKCSWLINQALEIVTPEQRK
                     LLDEAYGRKDAALEAKVKVLYNDLKLEQRYKDFEEKRVGELREKISAVDESDGLKKEV
                     FSAFLDKIYKRSK"
     gene            <1419495..>1421675
                     /locus_tag="TRUGW13939_10839"
                     /db_xref="GeneID:55998318"
     mRNA            join(<1419495..1419598,1419654..1420371,1420424..1420607,
                     1420660..>1421675)
                     /locus_tag="TRUGW13939_10839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493949.1"
                     /db_xref="GeneID:55998318"
     CDS             join(1419495..1419598,1419654..1420371,1420424..1420607,
                     1420660..1421675)
                     /locus_tag="TRUGW13939_10839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349842.1"
                     /db_xref="GeneID:55998318"
                     /translation="MVMTLTKDDIEELRSRLEDSVIKCSERCLYQSAKWAAEMLDSLV
                     PSDEDDTDTRSSSMETDTTPTTNPFLPQLDPAEAALEARESHKYLLAKSYFDTREYDR
                     CAAVFLPPTIPPVPLSTVSPNVRSRTSLTPQKGKGKASGTPSSRGGHAPAQSPYPKLS
                     QKSLFLALYAKYLAGEKRRDEETEMVLGPADGGMTVNRELPDLARGLEGWFAERRELG
                     LESCGQGWLEYLYAVILLKGKNEEQAKTWLIRSVHLYPFNWGAWQELNDLLPNVDDLK
                     QVAGMLPQNIMSWVFQVHCNQELYQVNEDTHQTLNELENIFPNSAFLKTERALLYYHS
                     RDFEEASAIFADILVESPHRLDGLDHYSNILYVMTARPQLAFIAQLATATDKFRPETC
                     CVVGNYYSLKSEHEKAVMYFRRALTLDRSFLSAWTLMGHEYIEMKNTHAAIESYRRAV
                     DVNRKDYRAWYGLGQAYEVLDMSFYALFYYQRAAALRPYDSKMWLAVGTCYAKMDRLQ
                     HSIKAMKRSLVAGAYYEHAADSADANHPTGRKILDPDTLHQIATLYERLGDDEETAAY
                     MELTLQQETGEVERPDPGSDDDDDKNSDNGAGAARRRSDDGDVEVVGGTGVTATTSKA
                     RLWLARWALRHGDLTRADQLAGELCQDGIEVEEAKALIRDVRARKEGGR"
     gene            complement(<1422206..>1427643)
                     /locus_tag="TRUGW13939_10840"
                     /db_xref="GeneID:55998319"
     mRNA            complement(join(<1422206..1424426,1424482..1425641,
                     1426021..1427493,1427554..>1427643))
                     /locus_tag="TRUGW13939_10840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493950.1"
                     /db_xref="GeneID:55998319"
     CDS             complement(join(1422206..1424426,1424482..1425641,
                     1426021..1427493,1427554..1427643))
                     /locus_tag="TRUGW13939_10840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349843.1"
                     /db_xref="GeneID:55998319"
                     /translation="MLLEDQRFIHEDLERLEQGIADRVIDDPRNLRERLSRDHQVAGF
                     LDRIEEQSKRLLDIYKDAEGLRAQEIQSISTGDPFEEFYKRLDDIKDFHKRYPNEPVE
                     NLERAYKRKHPGEGEPFAFEAESIFTGEEAYGQFFDLTQLHEQYLNIPGVKRLTYIQY
                     IDQFDVFTPPQLPIKRSLKLSDRYFKYVGDLAGYLEGFMKRAHPLDNLEQLFVSFDEE
                     FEKQWSSNEVPGWGTEATIGPDGPKTQGTGEGIWCADCEKEFKNENVYKNHLTGKKHI
                     KAAEAKKANGPSDAPERNQNAIKDPSFNSLKERAVAEREHRVRSLSKTLDSERQATRV
                     NVERKQGMTERERQMEIEALMADAEPSFGGQPHDDESDEEGEDRIYNPLKLPLAWDGK
                     PIPYWLYKLHGLGVELPCEVCGNFVYMGRRAFEKHFSEARHIYGLKCLGITQQTNLFR
                     EIVRIEDAVRLWEKLEQDRKKDKDSRDNVVQMEDAEGNVMPERIYHEYAPFPLLPFSW
                     PLHTNFHAVSKSKEGRMGFNFTYLCDLLSGLERNRHLKAASVARTQNPDYHTISSWFI
                     NHSKRIHDKETNLLALLSCLFPEKRPDRVYWLQSTSLARVIARCLYLGSSRIKDLDQW
                     RLHGGGDLGQCVENVMNQAENQIIPGREVTVEEIEDALLEISSRCRFSGPAIRKRHAA
                     ADVDEVLGPLYRRLSSRDSKWLTRMILKSYSPVQLPVDVVLKHVHFLLPQLLLFQDSF
                     EGAVHLLRSTSLKHFPPRPQPDFAHLLNREALKHLVPRPGLKVGRPEFYKARSLKHCC
                     KMINRRRMSLERKYDGEYCQIHVDITDGVPSIQIFSKSGKDSTVDRAGIHETVKRSLI
                     IGERDCKISRRCILEGELLVWSDRDSKILEFHKLRKFLARSGTMIGTDYDSQPKPYEH
                     LMIMFFDILLLDDDVCLGKPHRLRRLLLKDTVKLIPGRADISEQEVIDFSRPDGPRRL
                     QTAFSKCISERWEGYILKGCDEPYFAILSSDTEKGFCRWIKLKKDYIPGLGDTADFSL
                     IGARYDPKDAQHLSEIGYLSWTQFFLGCLDNKDAVIQSGALPRFRIIDVIGRHSLCAS
                     DMRMLNLWGKFVACQVESNNTFKAYNLHNSLPEMEVAFKTPFIVELLGSGFDKPGNTQ
                     YYTLRFPRVLKVHWDRTFQDAISFSELQNLADKARLVPEQGLLEETSLWYEKIGETQG
                     KSEYIVETSQASSYSAVLTSTPPSRQGTLTSTGSTPPTSREIGDSSPGKSPVKKSNAP
                     LPPKPQPTSKRDTPPSLSSSDLDPSQASVKRRKILASSSTMATFAPEPRVPFQYLRDR
                     GSPVPKSSGLYDRAQTTSFSQFNENMDKMKSKTPLGENPNPSLRSKSVFIPQTPLSEP
                     VKATVDNCHTTNSATPTHSSDASPVRENLNGVHIDRGHDSLSPRGMVNSIPFPLPRRL
                     ESPLCTIPMYCGDFGFVETLFRQASRDFTFSMTHFVQSLGAPSTREKLRASNPSSADC
                     DMALGIILINKRDPGNTLATQLYNIGNLVASSLQSQLSTLPSQGKIFFLDRNILHAGS
                     GIHDETFLLNDWWAEYGVQYYYASISWGFGIDLGQVAQRVDEARQLGGPQAALYDQRK
                     MTSVVNVYEPSDVEILGEFVSIDPTVHLLGDYYYAPG"
     gene            <1427906..>1429236
                     /locus_tag="TRUGW13939_10841"
                     /db_xref="GeneID:55998320"
     mRNA            join(<1427906..1427936,1427990..1428244,1428299..>1429236)
                     /locus_tag="TRUGW13939_10841"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493951.1"
                     /db_xref="GeneID:55998320"
     CDS             join(1427906..1427936,1427990..1428244,1428299..1429236)
                     /locus_tag="TRUGW13939_10841"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349844.1"
                     /db_xref="GeneID:55998320"
                     /translation="MAEGIDRRNDERMEFTTSKEVTVAPTFEDMHLKENLLRGVYAYG
                     YESPSAVQSRAIVQICKGRDTIAQAQSGTGKTATFSISILQVIDTAVRESQALVLSPT
                     RELATQIQSVIMALGDYMNVQCHACIGGTNVGEDIRKLEYGQHVVSGTPGRVADMIRR
                     RHLRTRNIKMLVLDEADELLNRGFREQIYDVYRYLPPATQVVVVSATLPYDVLDMTTK
                     FMTDPVRILVKRDELTLEGLKQYFIAVEKEEWKFDTLCDLYDTLTITQAVIFCNTRRK
                     VDWLTDKMREANFTVSSMHGEMPQKERDSIMQDFRQGNSRVLISTDVWARGIDVQQVS
                     LVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTSEDVRILRDIELYYSTQIDEMPM
                     NGMQTVFQLLRLAKS"
     gene            complement(<1429799..>1431528)
                     /locus_tag="TRUGW13939_10842"
                     /db_xref="GeneID:55998321"
     mRNA            complement(join(<1429799..1430185,1430244..1430428,
                     1430505..1430810,1430877..1430966,1431044..1431184,
                     1431247..1431379,1431448..>1431528))
                     /locus_tag="TRUGW13939_10842"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493952.1"
                     /db_xref="GeneID:55998321"
     CDS             complement(join(1429799..1430185,1430244..1430428,
                     1430505..1430810,1430877..1430966,1431044..1431184,
                     1431247..1431379,1431448..1431528))
                     /locus_tag="TRUGW13939_10842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349845.1"
                     /db_xref="GeneID:55998321"
                     /translation="MINSISVAAALLLSFQGASAIERPNNVGRLPALGWNSWNAFGCD
                     IDETKIMTAANELVSSGLNKLGYEYVNLDDCWAVKDHRDATTGRIIPDPDKFPDGIDG
                     TAQKIHDLGLKIGIYSSAGTETCAGYPASIGNEAIDAQSFAEWGIDYLKYDNCYVPSK
                     WSDYSFCVADSDFPNVNPNGTCPGLDNQAPSGYDWSQSNTTKRYNVMRDALAAVEDQR
                     VILYSLCEWGYADVVSWGNQTASSWRMSGDINATWERITAIANLNAHELEFVDFWGHS
                     DPDMLEVGNGNLTIEENRAHFALWAIMKSPLIIGTALDSLPETHLDILKNSDLIAFNQ
                     DPTYGKPAVPYKAGYSNGTYDPEHPPEFWSGSTSYGWDLVLLFNSENATAARSAVWSE
                     IPQLSGGNSSSYQVQNIWSGDDLGCVTNQYTADLEAHDVAVLKITGSC"
     gene            complement(<1432462..>1434193)
                     /locus_tag="TRUGW13939_10843"
                     /db_xref="GeneID:55998322"
     mRNA            complement(join(<1432462..1433830,1433892..>1434193))
                     /locus_tag="TRUGW13939_10843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493953.1"
                     /db_xref="GeneID:55998322"
     CDS             complement(join(1432462..1433830,1433892..1434193))
                     /locus_tag="TRUGW13939_10843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349846.1"
                     /db_xref="GeneID:55998322"
                     /translation="MHFLKKLRSPPRVTTANAGNKTFAASSASNKSTSSIDSTRLVPD
                     TVISHILSYVCPHALDTSYKSSEESMTEDGCMLCDMRDLAHCVAACKRWKGPAQKLLY
                     QNIRLDAVHYCELEIELSSKRKRRSFVGTTGKAIDVVQMRLLLFMKTVRESSHLADLV
                     LSLRLPYMTREASKADLARTVSVLHHLRYVDLPAGFYSDDVSSYTLKQELMARCPEIR
                     HMTYAHGSEGSFSRIPGSGLWGSLEVLELSDLHIDESTLRLVLDSFKALKSLKMESLS
                     AVTDSVFASTHSLPPFPPLETMVLRNMPHLTATGLATYLTLPTNRDSLKNLTLTQTGI
                     LPEELHVLVSKASRLVSLTLEATVDRSFPVVDVPFLVSNSVHKLNYEISSANGSYGAQ
                     PVSGSYYKYLLASLMSRSLPKLRELYVLDPHFADKLLFAPFQQLSLRDETTSQPASQG
                     LSQPLSLFSKGIDEMDWNLTQIGPTSPQASQLSSPSTSSSGRGSSATRPVSFHAAQLS
                     PVWGGEARRSVAVGNGFGGFLAVPVDEERPRSSSGGGYKRQSKYDMWR"
     gene            <1434795..>1435538
                     /locus_tag="TRUGW13939_10844"
                     /db_xref="GeneID:55998323"
     mRNA            join(<1434795..1435035,1435090..1435342,1435406..>1435538)
                     /locus_tag="TRUGW13939_10844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493954.1"
                     /db_xref="GeneID:55998323"
     CDS             join(1434795..1435035,1435090..1435342,1435406..1435538)
                     /locus_tag="TRUGW13939_10844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349847.1"
                     /db_xref="GeneID:55998323"
                     /translation="MDNLKFVTDHLRSSVAPDPSQRQKSEAWRSRPPYQHVSDDEFGP
                     VKWQAMCHCTRVQYQLSREKPLAAKYCHCRACQVLHAAPFQWCAIYHKTDVRFTRGVD
                     SLMFYSSHEKTREYQVPTKVYCEHCSSPIMDEGRNMCLIFPELIDLGETEEEHLTRRK
                     VFEIDCHIFYSRRIVEVMDGKTKWSGIDKESDILDDNGHGLHQLSSAI"
     gene            complement(<1436984..>1437970)
                     /locus_tag="TRUGW13939_10845"
                     /db_xref="GeneID:55998324"
     mRNA            complement(join(<1436984..1437234,1437385..>1437970))
                     /locus_tag="TRUGW13939_10845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493955.1"
                     /db_xref="GeneID:55998324"
     CDS             complement(join(1436984..1437234,1437385..1437970))
                     /locus_tag="TRUGW13939_10845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349848.1"
                     /db_xref="GeneID:55998324"
                     /translation="MDHCLPANVSSSRPVRESILEIDDHSWIVGDRLIISLQPAVPSG
                     PFWSDGADAFYTISELASQQPQPQTRSLSPTSRIKLVHDAGDANAAWRIGEAFLKVQK
                     QSHQQRTREHTTLDFLHDPANGIELTSSIPRVLYHNEFNERYYLMTTRVAGETLEKAW
                     PAMGEAAKQACVTQVVDTCKALARKENDKICGIDGDLSNECKVGIIDWEMTGFVPKAW
                     IRTKFCVCGAMDFDFTAIDVKRSKEWRQRVQLQLAQEGFSEVAEAWERLFWENYQAIY
                     TK"
     gene            complement(<1438557..>1439105)
                     /locus_tag="TRUGW13939_10846"
                     /db_xref="GeneID:55998325"
     mRNA            complement(<1438557..>1439105)
                     /locus_tag="TRUGW13939_10846"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493956.1"
                     /db_xref="GeneID:55998325"
     CDS             complement(1438557..1439105)
                     /locus_tag="TRUGW13939_10846"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349849.1"
                     /db_xref="GeneID:55998325"
                     /translation="MPEKPDDYETLSDEGRLRADKLYDSALCHKYYEVLTAKRNPQHY
                     AAITHNDTWKAPLIQPIKSIGGAWSSGEVFGLRSSLMNVQDHWPELESAEHCPISFTE
                     NEKKLHNEEIENRDYIERLMEEFQDAGILPADGIVDPDDYEIVQKTNYTQKKNFMSLA
                     ENEEQREWMDKIWPYQDFPEEA"
     gene            complement(<1439155..>1443097)
                     /locus_tag="TRUGW13939_10847"
                     /db_xref="GeneID:55998326"
     mRNA            complement(join(<1439155..1439357,1439451..1439807,
                     1439871..1439892,1440045..1440175,1440225..1440311,
                     1440735..1440780,1441232..1441292,1441360..1441444,
                     1441617..1442666,1442737..1442911,1442978..>1443097))
                     /locus_tag="TRUGW13939_10847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493957.1"
                     /db_xref="GeneID:55998326"
     CDS             complement(join(1439155..1439357,1439451..1439807,
                     1439871..1439892,1440045..1440175,1440225..1440311,
                     1440735..1440780,1441232..1441292,1441360..1441444,
                     1441617..1442666,1442737..1442911,1442978..1443097))
                     /locus_tag="TRUGW13939_10847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349850.1"
                     /db_xref="GeneID:55998326"
                     /translation="MRSLLGITMNHLVNTLILFMSLGCTASSSHDPGMVYGFDNIDPS
                     ANLAWTPCFDNFTCSKLEVPLDYSKRSLGTTSIAFIKLAGKNATAESPSLVLIPGGPG
                     GSGVDLLLTYRTLTGQIFGEQYNIVSFDPRGVNNSGLRLDCFSGNIEARLAFSRLHST
                     GVTNISSTSLEDQYYSSSIYGEWCNHAVENESPNGYYVTTPAVAHDLLTFIESEAKVA
                     GQSPSDAKLWCYGISYGTVIGSTFASMFPNRVGRMILDGVLNAEQYYNNDWRDNVDQM
                     DEAMEKFSAFCHSAGPEKCSFWGPTPAKITARMDSIIHQLQTHPVPVNGVQSQDLPTL
                     VTYSDLKALFLNTISAPLAEFPAMANILHQFELGDVSALSGMFYGLNSTSDARLAIQC
                     ADSYRRNRLTTIEEFKSYVEYTISKSKYIGDIYPIYLETILCRSFRPQLPDSMVIQGP
                     IRGLDKPTSFPILFASNTIDPITPLESARKMSSRFAGSIILLQDAIGTEFHHPKKGTL
                     SGDSVTLLIIKFEILQLSRRKKKTSTGIPPSDDYQTTLKKPLSDIENLISTSFLTLLS
                     NPMALVRKDVLHPDPFQHMRSRNHGLCIPVPRVFTWNCDPSNPVGSEYIIMEKAKGTA
                     LGDVWYRLPNPSKHKFIKHLVELEAKLAAMPFPGHGCIYYKQDLQTPYPKYQISFGED
                     ESVKFCIGPVVDPVFWSDGRAEMTLDRGPCINERIWAMRSARPRINYYRSNTDHEMPS
                     EYIDLIEKYLLVVPHLTQCEPGSSELLKPKLWHTDLTS"
     gene            <1444290..>1445840
                     /locus_tag="TRUGW13939_10848"
                     /db_xref="GeneID:55998327"
     mRNA            <1444290..>1445840
                     /locus_tag="TRUGW13939_10848"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493958.1"
                     /db_xref="GeneID:55998327"
     CDS             1444290..1445840
                     /locus_tag="TRUGW13939_10848"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349851.1"
                     /db_xref="GeneID:55998327"
                     /translation="MPFAFKTEKTKIESSRYHNDKADRVESRDSYHPCTTISAYRSKQ
                     WHAEYHGLILQNPGPFMILPVTGSAQAEAMCFFEYISIKHLNEYHPWDSWRETLMFFS
                     QTVSSVRHAAIALALMHRNYLNRDSSDRVLQPHSLKDRQPCNAPLLHYNRAIQLLLTQ
                     ESGDSTEITAITLLVCYLFICFDHLAGNDVQAVKHLRGGVELSRNIDKAILNNSSTYE
                     DAKPLGVRTLICQVTKQIRRLDMQSVTFLVDWNPADIQEGFMSQLPPFDSPFRSLDQA
                     ADHLQILVARVMRLCNTEQQLSPMGEMLPLPCSLKDIVLGQLETWSTLFENILQQGNS
                     YEADSETYPLVSLLRLQYTIAWILLNSCGPGREMDYDDFLPEFQQCVALAGDVAAAHE
                     RYSGSLKPTFTPEVGIIPVLYIIGVKCRHPIVRREVLSILRRQQIREAVWDSISAARV
                     VERVIEIEEGGSGEGHMPQTMEQIAVWQRIKALSWIHVISGQSAARLDITYTFCAREG
                     IHTESLIM"
     gene            complement(<1446219..>1447118)
                     /locus_tag="TRUGW13939_10849"
                     /db_xref="GeneID:55998328"
     mRNA            complement(<1446219..>1447118)
                     /locus_tag="TRUGW13939_10849"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493959.1"
                     /db_xref="GeneID:55998328"
     CDS             complement(1446219..1447118)
                     /locus_tag="TRUGW13939_10849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349852.1"
                     /db_xref="GeneID:55998328"
                     /translation="MRVFITGASGFIGKAVTKELLGAGHTVVGLARSDRAAEELVAVG
                     ADVKRGSLTDLNILREGASASDGVIHLAFIHDFANYERTCQTDREAIQAMGDVLAGSS
                     RPLIITSGTMLLPHGRLGTEDDLFDSSSPTFAARGLSEELTKGLASRGIRTVIMRLAP
                     VNHGDGDNHMFISTLVATAREKGVSIYVGDGLNCWPAVHCLDTAVAYRLALEKATAGS
                     TFHVVAEEVKMKDIAQTIGNKLGVPVQSKSIRETQEHFGPFSLVVGADNPISNQKTRQ
                     ELDWNPQQRGLLADLQDGEYFQV"
     gene            <1447790..>1448730
                     /locus_tag="TRUGW13939_10850"
                     /db_xref="GeneID:55998329"
     mRNA            join(<1447790..1447981,1448049..1448323,1448412..>1448730)
                     /locus_tag="TRUGW13939_10850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493960.1"
                     /db_xref="GeneID:55998329"
     CDS             join(1447790..1447981,1448049..1448323,1448412..1448730)
                     /locus_tag="TRUGW13939_10850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349853.1"
                     /db_xref="GeneID:55998329"
                     /translation="MSAIKCTLYHNPYSVCSIMVRYTLALRNPAKDNVPALEVEEKSV
                     DIFNQEQLSENFLKTNPYGQVPVLLSSLQSPICDSLDITHFIANYSKSLIPENHKAEI
                     IELLAELHNLNYFSLSFPGRQQMAVTLSAPIEKRLQDPNITNGYRKALEFKLGVVKRN
                     KVDGLRPEVTSTMEHRTRDLMQKIEPLLGEAQDFAKERWLFNLQHPTALDAHLVVFIR
                     RMCDVGRDALIPETLRSYAERATLTPEWAKVMEGRRSTMVPKN"
     gene            <1449800..>1450522
                     /locus_tag="TRUGW13939_10851"
                     /db_xref="GeneID:55998330"
     mRNA            <1449800..>1450522
                     /locus_tag="TRUGW13939_10851"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493961.1"
                     /db_xref="GeneID:55998330"
     CDS             1449800..1450522
                     /locus_tag="TRUGW13939_10851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349854.1"
                     /db_xref="GeneID:55998330"
                     /translation="MITCSRRTTTEIHHFSQCVMLFNQKLSQHICPSDRDPLWATAAL
                     LGIMTIASFDAVTTEEAWPLRPSNPLDLEWFRLGDGKKIIWRLTDPLRPGGIFRAMAH
                     EYAQLPFEIPLAGTKGVPSELAEVCNMDSSCNENNNPYFVAVHVLVQLQKLPTDQTAS
                     IRMVSFMSQSQQPFRDLLQEKDPVALLLLALWYAQASRVLWWIAQRARIESRSIRLYL
                     EKFHRHNIKVHRLLPPPLLGTE"
     gene            <1451692..>1461868
                     /locus_tag="TRUGW13939_10852"
                     /db_xref="GeneID:55998331"
     mRNA            join(<1451692..1452131,1452186..1452516,1452568..1452697,
                     1453053..1453584,1453646..1453658,1453714..1454394,
                     1455493..1457256,1457310..1458009,1459139..1460164,
                     1460226..>1461868)
                     /locus_tag="TRUGW13939_10852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493962.1"
                     /db_xref="GeneID:55998331"
     CDS             join(1451692..1452131,1452186..1452516,1452568..1452697,
                     1453053..1453584,1453646..1453658,1453714..1454394,
                     1455493..1457256,1457310..1458009,1459139..1460164,
                     1460226..1461868)
                     /locus_tag="TRUGW13939_10852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349855.1"
                     /db_xref="GeneID:55998331"
                     /translation="MFVRSMAAMAAVASTAFAVASISDDEMTSYLNDGAVDLAVNYAP
                     LWFFGQAMDQPPCYPVWAFGGNVSTPDVYDSDHKTPPAAQCEYPDVGCGCRLPDVPIG
                     NAGPEFPIYYTFSQCNSSEVRVAYNLFYQKDGAKVVDLIDTGHDYDWERVVIIHTKDS
                     DNNSWAPSRALLSAHSGYHSIAWGDIQNTLTTDEINAGDAIDPNGVQNNDHPKVYVSW
                     SKHANFDTRNTGFNDPASQSLDDAFRSQDWWHFVDSKYYILSDNSTDAGQALGSADWG
                     SATSNPPSVQASLCTQNGPMRNATTRVISTWSSPAMATMTTTATAIELQPPAGNVART
                     TAASTGSQVPLRAAEEDDDVMQASFAADSEVPDGGYGWVVIFACAMLTFWFVGTTYCW
                     GVFQAVLVQQGVSSASTLAFVGSLTTACISFLAMLNARVIRKLGTRLSGILGISLFGL
                     GEILAGFTTKNVAGLFVAIGLVMGLGTSLLFMVVSVTPAQYFKSKRGIANGIVYAGGG
                     LGGAIISFVTNGLLEALGVAWTFRVLGFITLVTGLPAAYLIQERVPIRPSSFVEWRLF
                     RDYRFVLIFLGGGLATFPLFVPPFFLPLYTDSLNMTSSVGAGLVAAFNFSSAVGRLLC
                     GFSSDKIGPLNTVFSSLLLSALSMLVLWPVSNSLGPLVAFVIINGMANGGFFATMPTV
                     VGNVFGSARVSVAMGMVVTGWGGGYLLAAIQNYINHTLVTPACHSAKLPADMDAVRGK
                     YHELSSLILGYFMSWSKTAFRRLHKIHKKIPFVREVQFNFISLHYSYLILWAIIGSVV
                     VYAGSGIPYIDALFFAAGAATQSGLNTIDLNLVPTYAQIFLYIITMSTNPIVIHSFVV
                     FVRLYWFEKRFENIVKDARALRRTKSRTFTTGNDHHDTGMEEQGIRGQSIVVLRNEAG
                     EARDVVQDVPKVEAEASSEAGSSNEPGDTRRTSEASQEQTTDPPFTGVEALRLPTQRS
                     PEHHIAFLEHQRTDKGTLRIPSPREYDRGGVPQALDDVLEGPYSPKTQPVDDETQDTT
                     NEDTANDVGNHITINEPDIMRFRTRTGTFPRFDSRRTVPRDEGEEPANLTKTRTRRST
                     FTGLFRSLTQEQEKETMPYLSWNATIGRNSAFVALTEEQREELGGIEYRALKTLAIVL
                     VGFFFGFHILGIICLVPWIMHTEPYSSVVTAAGQGRPWWGVFTSMSSFNDLGFSLVPD
                     SMNSFSHAIFPLLLMGFLIAIGNTGFPCMLRFIIWIVSLFTTSGSPIWEELRFLLDHP
                     RRCFTLLFPRNATWWLFGILVILNAVDLIFFIILDINDPTITQIPAGIRVVDGLFQAI
                     STRTAGFGVVNIADLHPAIQVSYLIMMYISVFPIAISMRRTNVYEEKSLGIYGSQSDE
                     DEEAKEPSYIGAHLRRQLSFDLWYIFLGLFIIAIVEGTRLENNDASFSLFAVLFEIVS
                     AYGTVGLSLGYPNTNTSFSAQFHVISKLVIIAMQIRGRHRGLPYTLDRAILLPSESLH
                     EKEQADAERRLRRRASNTSNLSAVGGQASGMFRAETGTNINATDISGNTPLHWAIASG
                     FENVVLILIEKGANINATNGPGHTPLFSAVYRNLEAMVLILIEKGANINQTDKYGKTL
                     LHEAVKRRLEKFVPVLIEKGADINATDTHGNTPLHEAAITGSEMAVLVLIEKGADINA
                     TNQYGETSLHRAFEEGFYNVAVQLCDQGANVQVATIWGKTPLHIAAKNDPESVSLLID
                     RNAIVNAVDKYGRTPLHFAVGSKSPLAARELVRCGANITLRDKDGMTPVHDANSLKSK
                     RLDLLAALSDDRAGAISFFLWDPPEAFESSTNSKEALDTITNAIALVRQENRVVATTL
                     GAFVQNEFGSWGLWFLFYIACAFTGDNRTYENDDISIVAQPTYIHVRSSIFRDRIKEL
                     LKWICLSFRKPKDGSVSVSGGELYTNIFTLQTLQPFVVDTFNNSTCWHGLFESAVIGT
                     DSAISAEQPISGCRLDVSFDFMIQISAVEYPLMIERGIILMGYSTALVPVRMVDDTHV
                     LWHLEVAKHNSQLSISELAAIQSCWLQVDNLDQLRAKTALVGWCPEATVLLGTDKLRP
                     NATWSNGKVKKTSWHWSGANLQFLAQSAAPAQIGAQLGLAMSRTTNMLRFSPSNNYLK
                     CLNNSATEHVVLYDLAAERAWLVPLLSTFHHMLAIYWDTIPTESRSPTLPLATPSADG
                     ALASLNILKGRSEFIVERSADESSTIRDLIMGFSANFSRISVHSPFRSEVYGYELMDI
                     VVDSPMADLRQKKIKKEGLGWAPLLSQVRCLFCSGVGNAIIGAKAIDLDSPCNELPYG
                     SNLMAATIPSISALARRFGSDFQGPLCQLSTLHMWQLAGNPFTRCQHKVNSHETCWHT
                     MKFLQEIQSIKKTNHPIEGPQISTLSKDGAVVFGQQRRGSIVKDSKSISVLTYKF"
     gene            complement(<1462160..>1463092)
                     /locus_tag="TRUGW13939_10853"
                     /db_xref="GeneID:55998332"
     mRNA            complement(<1462160..>1463092)
                     /locus_tag="TRUGW13939_10853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493963.1"
                     /db_xref="GeneID:55998332"
     CDS             complement(1462160..1463092)
                     /locus_tag="TRUGW13939_10853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349856.1"
                     /db_xref="GeneID:55998332"
                     /translation="MVFYCATMAHQRRQEKAVWKDRKKNAPRQHPTTGNPIVSWATAL
                     LKRPKPTATQEDSPLFRLPKEIRLQIFAYVFMGDLHIVRLRKRLGYLRYMPLPPDTDP
                     TSEVDPARKKFIEHPVVRGLWRAAYPTSYSYGIWDPRWQQTISKPNSVTQQQQQQLPE
                     QADGRECLLSLLKTCKVLQDEATPLLYECINFEINSSWNAYYFMMTVPAEHLAHVREL
                     TISLSVDEVTNFNRLNIGEEPIMTSKVSSINQDGWRRLWDGVSSMPRLRRLNIAGKGF
                     PFSLDPQLREEIVASLKSILNTCRVIEIHIKTQH"
     gene            complement(<1463381..>1466283)
                     /locus_tag="TRUGW13939_10854"
                     /db_xref="GeneID:55998333"
     mRNA            complement(join(<1463381..1463927,1463982..1464262,
                     1464350..1464451,1464754..1464775,1464837..1465003,
                     1465072..1465324,1465385..1465522,1465579..1465616,
                     1465660..1465685,1465990..1466075,1466134..1466177,
                     1466239..>1466283))
                     /locus_tag="TRUGW13939_10854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493964.1"
                     /db_xref="GeneID:55998333"
     CDS             complement(join(1463381..1463927,1463982..1464262,
                     1464350..1464451,1464754..1464775,1464837..1465003,
                     1465072..1465324,1465385..1465522,1465579..1465616,
                     1465660..1465685,1465990..1466075,1466134..1466177,
                     1466239..1466283))
                     /locus_tag="TRUGW13939_10854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349857.1"
                     /db_xref="GeneID:55998333"
                     /translation="MADPERRQPLLLDEDLLAEDQDDETYSDELQSYRTSLSSTVTDY
                     KWTHGRRFHSYREGTDAFPSLEKVVGNDLSPIQPSWVPPNVEFEVDDVESEWPERPPF
                     DFIHSRYMCGSISDWPKFLRQAYSQTKVGGWAEFQDFHLVNYSEDGTLKEGNNVNKFY
                     ELLREACEKINRPVTVGVNLKKWAEDAGFENIEHKVFRLPLGTWPRDPRMKEIGAFNM
                     LQFLEGLEAFSIATFTQVLGWSYEEVQVFLALVRKDAKNRRVHMIHDFHVVYGQRENL
                     VKVTCIPPKIPAMANPKIPTIQLNDGTAFPIIGYGTGTAWFKRGDSPAVNRALVETVK
                     TAVKLGYNHLDGAEGYGTEPELGQAIEESGVSRDELFVTTKVGASVRDIPAAIDASLK
                     KLKLDYVDLFLIHNPFWANTEEELQEAWAAVEKVKASGKARSIGVSNFLKSHLETILK
                     TAKVIPSVNQIEFHPYLQHGDLVPFQESKGIKTVSYGGLIPITRATGGPLDALLSTLA
                     KKYGVNESEILLRWSLERKYVVITTSSKELRLASYLQALTFELTPKEVEEISHLGQQK
                     HYRAFWAGNFASDDRS"
     gene            <1466590..>1468035
                     /locus_tag="TRUGW13939_10855"
                     /db_xref="GeneID:55998334"
     mRNA            join(<1466590..1466826,1466892..1467404,1467470..1467819,
                     1467870..>1468035)
                     /locus_tag="TRUGW13939_10855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493965.1"
                     /db_xref="GeneID:55998334"
     CDS             join(1466590..1466826,1466892..1467404,1467470..1467819,
                     1467870..1468035)
                     /locus_tag="TRUGW13939_10855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349858.1"
                     /db_xref="GeneID:55998334"
                     /translation="MANPLIDLAAQITDTAKVINNFITANGYPQPSFDADAPHAFPSA
                     PKEILDARRQLLDASQAIRELVIGPAEYLRWFSCGSHDMSSLRWIYHFKIAEAVPLDH
                     GVTFTQIAKERSVDEDLLKRILRHAMTNRIFHEPEPGLVTHTSVSALLARSKSLNDWV
                     GYTCDETYPASAKLVEAHEKYGNSQKPNESAYSIAFDTDEPMFAHLTKYPDREQRFAN
                     TMVEMTSTEGYGVHHLVGGYNWEDIGKSTVVDVGGSTGHACIAIAEKKAPDATFIVQD
                     LSTVIEQGKKTLPHALESRIAFQEHDFFTPQKVSADIYLLRFILHDHPDAISQEIVKN
                     LIPAMKNGSRLIVNDGVLAEPNTLPTAEERISRIMDMEMMTTFNARERPLADWVKLCS
                     GADSRLKLHSVSRPEGSVLSILEFVFDDQ"
     gene            complement(<1468197..>1470517)
                     /locus_tag="TRUGW13939_10856"
                     /db_xref="GeneID:55998335"
     mRNA            complement(join(<1468197..1468496,1468551..1469004,
                     1469073..1469300,1469369..1469520,1469602..1469809,
                     1469860..1469968,1470017..1470142,1470220..>1470517))
                     /locus_tag="TRUGW13939_10856"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493966.1"
                     /db_xref="GeneID:55998335"
     CDS             complement(join(<1468197..1468496,1468551..1469004,
                     1469073..1469300,1469369..1469520,1469602..1469809,
                     1469860..1469968,1470017..1470142,1470220..1470517))
                     /locus_tag="TRUGW13939_10856"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349859.1"
                     /db_xref="GeneID:55998335"
                     /translation="MLVVAGLAILLVIAPTIFVASTFFPYGGNVPNIVVSGSDTGSDD
                     SQPNPGTVEESWRDAFTLQPNDHIFRKSQTIRATWNVTMEERAPDGVKKMVYLINGQF
                     PGPTIEARSGDELVIDVQNSIQDSDNDGIAIHWHGLSMKGANHMDGVVGLTQCAIGAS
                     ESFTYRFRIDESQSGTFWYHAHAGLQRADGLFGAIVVHKPADPSGSGSDMSTYEYDAE
                     KLLLVGDWYHRQADTVFDWYQDPGHYANEPAPDSMLMNGEGSFNCSMAVKSQPVVCET
                     VTTPSFRLPDRDRVRLRVINTGVSSGITLSISQGAMQLITVDGGSPVGNAPLATAMGV
                     LYPGERMDLVLDRSLQDTASDQTHSNSDKETKLTVALDREHMKIENLALTRIQSFPLV
                     WKERVTDKSLPERRESSNATSNFLLSEASGLPQWPGSDLTERSIEKAVLYTAMQIRSS
                     FNNRPVGIVNHSSWMIADSRAKPLLALDPKEWSKATKQPSSIQTLQVPWYEKTGEDRW
                     IELVLNNMDDTGHPFHLHGNEFYILSVETTTQLGGYNPFDPDAADLAKTMNMRNPLRK
                     DTVYVPPRGFVILQFPLNNDGLWLFHCHVLLHQAAGMGMVFHIGDIDPEARNSSSNLC
                     I"
     gene            <1471636..>1474534
                     /locus_tag="TRUGW13939_10857"
                     /db_xref="GeneID:55998336"
     mRNA            join(<1471636..1471752,1471829..1471911,1471972..1472360,
                     1472428..1472814,1472863..1472976,1473046..1473248,
                     1473305..>1474534)
                     /locus_tag="TRUGW13939_10857"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493967.1"
                     /db_xref="GeneID:55998336"
     CDS             join(1471636..1471752,1471829..1471911,1471972..1472360,
                     1472428..1472814,1472863..1472976,1473046..1473248,
                     1473305..1474534)
                     /locus_tag="TRUGW13939_10857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349860.1"
                     /db_xref="GeneID:55998336"
                     /translation="MRATGLVAASAVVAAVQAGSLQDIKHIVLFMQENRAFDHYFGTM
                     AGVRGFGDPNVQVNPDGNSVFEQHLSSTQNGADILKPWHINYLGSDWVNSTQCMTAGD
                     NGWATMHTVYNGGLGDGWAGADGAYSLGYFTRQDIPTHWDIAEGWTIFDMSMQSLLMA
                     TDPNRIMWMSGSVNIPGSPTNLDGKGGMIIDNSNTPGCESPGVNCFPFVWKTFPEYLE
                     EAGISWQVFQDLDNFEDNMLAYFEQYQKAPNSSALHIKGNSYPGLDAFYANASAGTLP
                     QVSWIIGPQEQAEHSPNMPKDGAWLQQQVVEAITSSPTYNETVLVISYDEQGGWADHV
                     VPVVPEKDTPGEWMTDPYDESLGDVPVGPGWRVPRYIISPWTRGGNVFTERTDHNSDM
                     MFIEKWAAANGYDGVHNEAITQWRRDHMSDLVNAFDFENPDYSIPTLTTAAEPPSKPE
                     DPSDYSGNLDLGSLTGPWVGPASCIADYPVKVPIPYGVNNANRDISLTVEDGYKRVRG
                     NLTEGRYLTFETEGQALTNVGNTSVSLSAAKESHDDINQRWIVHPVDGPGHGNRFYIQ
                     SAVDKSYITATGSLAADVGQAQAVTITYTPNGASYTLGATTSSTDTENHGTSQSKVPR
                     SNAASISWKDLEGKPFEVFSVSYKDGDNANTLLYNAGLSMFTFDYSTSDPNPSNWVGI
                     YDASGGGPDNQTQNQPSLVYSYAPQAMGSVVVVDPGLAPGDYKAYFLADDGYKWIADP
                     VTFTVKDYGGSISFQSGSDFIFTYSTGEANSKNWIGIYYALGGGPDDQQNNADSLAWV
                     YAPDSSGSVTVSDPGLASGSYKAYFLANDGYTWLANPITFNT"
     gene            <1475338..>1477758
                     /locus_tag="TRUGW13939_10858"
                     /db_xref="GeneID:55998337"
     mRNA            join(<1475338..1475675,1475728..1475773,1475986..1476338,
                     1476391..1476594,1476682..1476959,1477028..>1477758)
                     /locus_tag="TRUGW13939_10858"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493968.1"
                     /db_xref="GeneID:55998337"
     CDS             join(1475338..1475675,1475728..1475773,1475986..1476338,
                     1476391..1476594,1476682..1476959,1477028..1477758)
                     /locus_tag="TRUGW13939_10858"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349861.1"
                     /db_xref="GeneID:55998337"
                     /translation="MASSAQPLACDSSSFLPVSTSQHRTLRPHTLPPGSGIVDLLFYT
                     TNIAEILEDSWFLGFRAAKSASMAQIGSGSESSRQMDGKRSNTLVKTCNHCAKGKIRC
                     IRHGDTGPCDRCKRLGKDCQFREVRSSEGSVTDGTPGSPLRRPTDIIDKGLLTMEAAS
                     LLFDEYRANLVPFCPFLVIPSHTTPEALRREKPFLFLAILTAALYDNMPMQRVFENEI
                     KKAISHRLVFDGTISFEVLQGLLVHITWCQYHSRPRRFSQYLHLAISVINDLQLDRPP
                     ELRFWKTRVSFDHTDKEHLSWGRDEKRAIAGCFYLSSSTSHILQKQCPFPYQPFIGEY
                     CQSLAKDLEFPSDSSLLYIIQLQYLSEKMTSVSMQHFSENQTVSSTIQHRFQELHSEL
                     EAYRANLPFSLDENQILFMQFYTTELYLCQVSLFDYKPNTPSRKLDPSFHIEVLCVGL
                     RAAKHFLDFYVSLPLRAEMSFNNTGWVQIGFALTLACKLTITACEPSVYTHTGELCRT
                     LDLSSLLNKCILRIQALITSHMDASGDRDVFYHYEKRIKRVQWWFESRKLSISNNTNN
                     NYSPPQSRGAYETTLPLNNRENYFGASNLVHDYSRTTPAPDAVLQQEVFDIQWPAFFP
                     DAGFDQVFGDWVTHTTLSSDQEHLN"
     gene            complement(<1477889..>1478869)
                     /locus_tag="TRUGW13939_10859"
                     /db_xref="GeneID:55998338"
     mRNA            complement(<1477889..>1478869)
                     /locus_tag="TRUGW13939_10859"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493969.1"
                     /db_xref="GeneID:55998338"
     CDS             complement(1477889..1478869)
                     /locus_tag="TRUGW13939_10859"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349862.1"
                     /db_xref="GeneID:55998338"
                     /translation="MDGIRRSQLFFCIGLCSIFACLFVPFFFLDILSTLRINASSATH
                     VDAQNEESSQNPAPLLPAAFENLNSTGQSIPKIIHRLWSGEPGDVPVEWTNASNSCIE
                     QNPSFEQYDWTDETALEFIQAHFAWFAPSYTNRLKARQREDVLRYFLLWHYGGVYMDH
                     SIGCQASLDSLLLMDTTALAPEPTSSGASNDLIASTANHPFIIAIARNIHEDSMSRMS
                     KYKGLFSTRQISMNSALAMCLQPGTDCADAAVLPSTRYDKTENAIFTHYKAQGAYWGN
                     GLAYDRIFGNLFGWTTAGVAVIVMITLVFVVWIRPRRNSKYRLVVQDTHV"
     gene            <1479807..>1481009
                     /locus_tag="TRUGW13939_10860"
                     /db_xref="GeneID:55998339"
     mRNA            join(<1479807..1480087,1480204..1480592,1480675..>1481009)
                     /locus_tag="TRUGW13939_10860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493970.1"
                     /db_xref="GeneID:55998339"
     CDS             join(1479807..1480087,1480204..1480592,1480675..1481009)
                     /locus_tag="TRUGW13939_10860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349863.1"
                     /db_xref="GeneID:55998339"
                     /translation="MSNNQTSLDPSDYCTLDICPIDLAYIYYVPSLAGNAFYAGIFGF
                     FLLSQCILGIRFRTWGYLAGLLGGLVLEVIGYIGRIQLHNNPFKFTPYLEYLICLTIA
                     PAFFSASIYICLGRIVIIYGEQVSRLRPRTYTIVFVSCDLLSLILQAAGGAITSIADA
                     DQQDLAQTGVNIMIAGLASQVASLVLFMVLCLDFAWRVKKSPMSLNDGTRDLRNQLRW
                     KLFLGGLALATITIFVRSVFRMIELNGGFHSALANNEVDFMVLEGAMIVIAVLCLTAL
                     HPGVCFDGMWDQTKWSFKGTKNKNADNNNNTMMSLANLNNKDGNMSRDSQFTRDSRFT
                     "
     gene            complement(<1481358..>1482286)
                     /locus_tag="TRUGW13939_10861"
                     /db_xref="GeneID:55998340"
     mRNA            complement(join(<1481358..1481720,1481780..1482123,
                     1482187..>1482286))
                     /locus_tag="TRUGW13939_10861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493971.1"
                     /db_xref="GeneID:55998340"
     CDS             complement(join(1481358..1481720,1481780..1482123,
                     1482187..1482286))
                     /locus_tag="TRUGW13939_10861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349864.1"
                     /db_xref="GeneID:55998340"
                     /translation="MAQSPRLIDQVPQPQSPSKMEVLLLGMPRTGTISIRVAFEVLGY
                     KPFHGRMMDELPELYPLWLEALDAKWRGNGELFGREEYDKLFNGFNVSCNIPGTLVAE
                     DLIKAYPNAKVVVSTRDVDRWLRSMRESVDSAVEWKSFDWIAPWDSHVIGPWWKYHKY
                     QHGLRPLIAPKGERQAYLEHYARIRELVPADNLLEFNPADGWEPLCKFLGKPIPSTPF
                     PHVNNTNQFLAGRRRRWWRALGMAVVKISTPVVVVLAAAWWSRLRLWWRV"
     gene            <1482888..>1483781
                     /locus_tag="TRUGW13939_10862"
                     /db_xref="GeneID:55998341"
     mRNA            <1482888..>1483781
                     /locus_tag="TRUGW13939_10862"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493972.1"
                     /db_xref="GeneID:55998341"
     CDS             1482888..1483781
                     /locus_tag="TRUGW13939_10862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349865.1"
                     /db_xref="GeneID:55998341"
                     /translation="MAVIPQGKFTTGVVEMFDGTTDGGEAYLDTASGETNLKPKKVHH
                     VTVYDIRTQEPAPQINEDGYEVLAYPTALTEEEFMTYRTPEGKQMIKDRYWPELQELI
                     LQKTGATEAIPWHFSLRNQTPGYHPDQIFFMKTGISQPASTVHIDNDHTTAIDHMNRE
                     LGEEKAKELIAAHKRWAIINVWRPVGIPVQSWPLLVVDRRNVPNWNYPENTARVYRTN
                     DPKYYKAHDNFLKFHPDYIYRYADRLTPEEVIMFKDYDSRTDRVRGTPHGGFQDDNSA
                     ADAPPRRSIEVRLFVFFDDEE"
     gene            complement(<1485970..>1487515)
                     /locus_tag="TRUGW13939_10863"
                     /db_xref="GeneID:55998342"
     mRNA            complement(join(<1485970..1486111,1486174..1487130,
                     1487193..>1487515))
                     /locus_tag="TRUGW13939_10863"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493973.1"
                     /db_xref="GeneID:55998342"
     CDS             complement(join(1485970..1486111,1486174..1487130,
                     1487193..1487515))
                     /locus_tag="TRUGW13939_10863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349866.1"
                     /db_xref="GeneID:55998342"
                     /translation="MLLILLKIFLIWKKLLLSYAGAATLMYHRALGRTAIGPTNGSLT
                     ITDNRTRRSYQIPIVRNSVRATDFRQITAAQRGADVVDQVENGLLVVDKGYLNTACME
                     SSITLIDGKRGYIQYRDTSIDELFRQNDYEEVIHLLIFGNLPTPQEKKAFRRSLAAEM
                     KPHQTVVDVIRAFPREALSYTMVLAGLSAYASLDEGTRTTHEKGEPAFLGKPEAVDKA
                     VVRSLSMLATVIALVYCHKRGREFTPARLDESYIGNILLMMGIVEPGTKTPNKKIENC
                     FQRLWVLYADHEMTNSTAAFLHAASTLTDPVSCCVTGIVSAYGPLHGGAIDLAYHEFK
                     RLGSPENVPSLIDSVKAKKQRLFGYGHRIYKVVDPRTKFIREMMEEFKEDVQGNPLLR
                     VAMEIDRVAGEDPYFTSRNLKANADLYGCFLYTAMGFETDIILALTSLSRTAGVLAHW
                     KEAMGQTPGLWRPQQIYTGNVTN"
     gene            <1488758..>1493125
                     /locus_tag="TRUGW13939_10864"
                     /db_xref="GeneID:55998343"
     mRNA            <1488758..>1493125
                     /locus_tag="TRUGW13939_10864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493974.1"
                     /db_xref="GeneID:55998343"
     CDS             1488758..1493125
                     /locus_tag="TRUGW13939_10864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349867.1"
                     /db_xref="GeneID:55998343"
                     /translation="MKLSQSPEPESPPPSSDGSTLNESRFSTLTVAGTTHFVKNEEHV
                     VEPVVPKRCSLPPQPYDGSGITALPTSRYSTLKLPGSTHFVKNEERVVEPVAPNRYSL
                     SPNAAIKLPKEPWYRRMNPLKWGPVPPIPETREVSHEYNANFFSKATFQWMQGIMSVG
                     YRRPLEMNDIWLVSPERQIDVLAERFDAAFQNRIRQGATNPLLKALNETFKWEFGMAG
                     LCVLFASLCQVLTPYVLKYLIQSVTDSYVAGENGAHTGFSRQIGLVFTIMIMQLIQSS
                     GTNQFIYRGFMVGVQARAVLITVIFEKTLRISGRARAGAETDEKEAPTKKKKKNAKGD
                     TDEAGWSNGRVMNLMSTDTSRVEQAAGMFHLVWVSPITIFIALALLIVNITYSALAGF
                     ALLFFGIPVLTLTMKALIKRRKGVNSVTDSRISLTQEILRSVRFVKYYGWENAFLETL
                     RNLRKHEVALIQKLLALRNAMNAVSVSLPIFASMLSFIVYSLTGHELTPAIVFSSLSI
                     FNSLRVPFNLLPVVIGQLTDALASTRRIQDYLLTEDHQDQSIWNDRCPSAIDIRNASF
                     IWEQSASKSQGEKGENNEKTKKEKRDRKNGKSGDIEMESPSPAGSSPSQAPFGIDNLS
                     LSIGRNELVAVIGSVGSGKSSLLSALAGEMRQDGGQMTIGASRAFCPQYSWIQNTTVQ
                     NNILFGKEMDKAWYETVVQACALKQDLAMLPGGDQTEIGERGITLSGGQRQRLNIARA
                     IYFDSDIVIMDDPLSAVDAHVGRHIFENAICGVLRNKCRVLATHRHDILPRCDRIILL
                     DDGHIKANGTYENLMRNNRDFQALIASSSGAASEEQEQEPVAVPTEQKEAEPAANAAS
                     SKDPETLIQQEERSTTSVGWSVYSTYIRASGSIFYGLIPIVLLVVAQGSNILTSLWLS
                     YWTDDRFSLTKGQYIGIYIGLGILQAVLMFAFSVSVSMLATTASRTMTSRALDRVLKA
                     PMSFFDTTPLGRITNRFSKDVDTMDNTLSDAIRMFLYTVVMVLSVFILVIYYFHYFGI
                     ALGPLLIFFFYAAAYYRASARDLKRHEAVLRSVVFARFSEAISGTSCIRAYGQEKHFT
                     SIVRQAIDNMNSSYYLTFGSQRWLTTRLDVVSILLVATTGILIVTLRNVVSPSISGLV
                     FSYVLAIVQMTQLLIRQFAELETSMNSTERLDFYGTCLDQEEKEDPSSPPVQVDSSWP
                     QNGAIDFDNAQMRYREGLPLVLKGLDLKVAGGESIGIVGRTGAGKSSIMTALFRLTEL
                     AAGKIKIDGVDISKVPCHDLRSRLSIIPQDPTLFQGTIRSNLDPFNKHPDLTLWSALR
                     ETGLVRDDNKNSASRVQLDTTVEEEGLNFSLGQRQLVALARALVRGSKIVVFDEATSS
                     IDLETDDRIQETIRRNFKGRTVLCIAHRLRTIIRYDRVCVMDKGRIAELDTPFKLWRN
                     GGIFRGMCDQSGIVQDDFF"
     gene            complement(<1493898..>1495704)
                     /locus_tag="TRUGW13939_10865"
                     /db_xref="GeneID:55998344"
     mRNA            complement(join(<1493898..1494781,1494840..>1495704))
                     /locus_tag="TRUGW13939_10865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493975.1"
                     /db_xref="GeneID:55998344"
     CDS             complement(join(1493898..1494781,1494840..1495704))
                     /locus_tag="TRUGW13939_10865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349868.1"
                     /db_xref="GeneID:55998344"
                     /translation="MTSKQLTEISRWDLENGAAVASVTDVRHLSSYNWLEASEPTIAV
                     PGCPPLWSPPEAARMVSKDSGLIYIAQNAARHPEYPLEPLFRALYIDHPSFDLQSVDL
                     ITDRNNIRKLLSFINPTTSKNGLESFTINVEVLKNTVIFCRAETETKKFIQPHEFIGY
                     GHEFEKAFTTDRIGASTGHHRLISYQFSDLKIMVRYETDGYIDRPIRENLEIENDILA
                     CMIQSLSLGSVSTAPASSKLRVKRAGEAVGIDSTLEIKTRVSHKPIDLKEVLPQLWVS
                     QTPNLVGAYHKHESHQPDLKNLATLIKKIILVVKGYQGNAVIKYDQHIDKLVIWKNDG
                     PKMLPDDLYSKLDNHESTQDSTSAAASNKTKIRIGEVLYNIDISRIPYLSAFVRFPRT
                     AQPQTSEFVHGPIPLFDTALKGLESGYRTCFRSLPADLSQFHTLCDTYDFLKIDVLEG
                     QSIDDIIIRLKAGKTDYELEYKRYRAIRGDKSTARDAPFQLLFLILLFEFKNPTKDSN
                     KVFNAVLFVVSHSGTFKWRLRTVVRAAYEERFVVSSKQNAMLDRWIKPKPAEDISDDY
                     VTTEDDFSDYYFSDES"
     gene            <1496874..>1498066
                     /locus_tag="TRUGW13939_10866"
                     /db_xref="GeneID:55998345"
     mRNA            join(<1496874..1497068,1497122..>1498066)
                     /locus_tag="TRUGW13939_10866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493976.1"
                     /db_xref="GeneID:55998345"
     CDS             join(1496874..1497068,1497122..1498066)
                     /locus_tag="TRUGW13939_10866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349869.1"
                     /db_xref="GeneID:55998345"
                     /translation="MECQRFRIDEPVSHVKKASEIVDARVAGDTLSRLKDRVYTPSGV
                     IIEYLLKEAPEFRRLSELREKGWNNPEGDRFFEKQRQTADYADNKMAKQFYKMMKTIA
                     YDMHQATGAFHIKNPCQDGRSILDMCMAPGGFLAIALSYNPEARALAFSLPKINGGHV
                     VLLPKRPNVTLKFLDVTMLAEDMGTSSIPYEHPDARNFLPSQFNPREYFDLILCDGQV
                     LRNHGRADYRERTEASRLCLTQLTLALNHLKPGGTMIVLLHKIEALDTVQLLNTFDRF
                     ASVQLFKHTKFHAKRSSFYMLATNIRADSEDAKTAIERWKFQWKIATFGTDNDYCEAI
                     RPEIRDVQVMLKAFGPKLIELGREIWDIQANALENAPFMRQTSSS"
     gene            complement(<1500864..>1502904)
                     /locus_tag="TRUGW13939_10867"
                     /db_xref="GeneID:55998346"
     mRNA            complement(join(<1500864..1502322,1502417..>1502904))
                     /locus_tag="TRUGW13939_10867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493977.1"
                     /db_xref="GeneID:55998346"
     CDS             complement(join(1500864..1502322,1502417..1502904))
                     /locus_tag="TRUGW13939_10867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349870.1"
                     /db_xref="GeneID:55998346"
                     /translation="MAPALAGWHPGEARMHRELGFADAMRDRWASIASSMSDQHRIFH
                     TSNIPFIPITTIDEHGRPWGSLLAGANGSVGFVESPNNTTLVVDARIWDGDPILRTIQ
                     AISDNISCQAGDSPRFLIAGIGIEHSTRRRNKFAGYIRNVWPIKSSNGIHRLDLKVNQ
                     ALGNCPKYINVRKLIPHANTRPLIACQNSYMTISDKLPDEIINIITTADTVFLASYYQ
                     PTDLVRDPNVSHAGMNIRAGLPGFMRVDPSNNRTVIIPDYSGNRFMTSLGNISSTPMA
                     GLTIVDFHTGNVLYLTGRAQVLIGPSAMKTMPRQTCLTAIEITGYILVHDALPIRQEP
                     GTITERSPYSPKVKYLVSEPEGASIESRNGLRAQLSQAIQYAHDIAIFRFTVSSPRPG
                     PTGLRVLPGQAIVLDFMDWMGPPVYRHMANDTPGSINDDRVRTWTVSSGHEGQDVTWF
                     DLTMREVKQGAVTGGLFKILRQNSHGKTKEALNLFGTNVYADIVGITGDFNIRNNDLQ
                     MLWVAGGIGVTPFMAMLAAISQREKSTTAIITLAIATREPKVFLDLIKTSFPKALTNV
                     QIEVDVFSSRSGEIPNEPSNLSDPEWLDVTFHNYRIPNNYWSRARDCDEIFICGPGEF
                     GDVAQDRLKEAGIPDDRIHREGFY"
     gene            <1503649..>1505163
                     /locus_tag="TRUGW13939_10868"
                     /db_xref="GeneID:55998347"
     mRNA            join(<1503649..1503933,1503986..1504250,1504700..>1505163)
                     /locus_tag="TRUGW13939_10868"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493978.1"
                     /db_xref="GeneID:55998347"
     CDS             join(1503649..1503933,1503986..1504250,1504700..1505163)
                     /locus_tag="TRUGW13939_10868"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349871.1"
                     /db_xref="GeneID:55998347"
                     /translation="MTALADSSDEPTLILKNDTHGAQEMARAIVVKLEGPNDLSDSRN
                     WPTWKRVFCSENVGIIALVIGDAGAIDSSAIPQAATEFKVSHVVEALATGLFLCGIGA
                     GALIPGPLSETVGRNPVYFASLILFMFFFIFGAGISQSIEAQLVCRFFAGFCGESPLS
                     TIGGSVGDLWGPFDRLIAFPIFADNYGLSQGITGLLFLGIEIGTLLASVILTPFAYQK
                     AKKYLVTLKAAGLETTATNRLKPEFFLWYSILGAPAIPISLFWMGWTATPNISMWSPI
                     TASVLLGWGNPSIFVSAWLYMIDTYETYAASALTINLFVQYTTSGAMLQASIPMYENM
                     RVG"
     gene            complement(<1505809..>1506534)
                     /locus_tag="TRUGW13939_10869"
                     /db_xref="GeneID:55998348"
     mRNA            complement(join(<1505809..1505811,1505862..1506008,
                     1506086..1506196,1506257..1506410,1506473..>1506534))
                     /locus_tag="TRUGW13939_10869"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493979.1"
                     /db_xref="GeneID:55998348"
     CDS             complement(join(1505809..1505811,1505862..1506008,
                     1506086..1506196,1506257..1506410,1506473..1506534))
                     /locus_tag="TRUGW13939_10869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349872.1"
                     /db_xref="GeneID:55998348"
                     /translation="MSQPVYHYLDIGRLGRGEVVRLFMRDAGIQFQDIRYAFDDTWQT
                     TSKSLKEKGISPTGKLPVLEYEGKFLSQHVPILRYLSREIGSYDGKSSYEKYIVDAVS
                     DLYIDWRSQWVPALKKVTEQYKDVFVPNYYNLLSRYYSENGGPFLLGKEITYADFA"
     gene            <1508926..>1511389
                     /locus_tag="TRUGW13939_10870"
                     /db_xref="GeneID:55998349"
     mRNA            join(<1508926..1509154,1509214..1509275,1509342..1510114,
                     1510193..1510227,1510323..1510459,1510513..1510530,
                     1510587..1510913,1510981..1511002,1511065..1511224,
                     1511302..>1511389)
                     /locus_tag="TRUGW13939_10870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493980.1"
                     /db_xref="GeneID:55998349"
     CDS             join(1508926..1509154,1509214..1509275,1509342..1510114,
                     1510193..1510227,1510323..1510459,1510513..1510530,
                     1510587..1510913,1510981..1511002,1511065..1511224,
                     1511302..1511389)
                     /locus_tag="TRUGW13939_10870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349873.1"
                     /db_xref="GeneID:55998349"
                     /translation="MRCSLHHYIWLGIVAAASQAVADVLQFTNVTAGNPVKPGTELRI
                     LCVGDSITVGYRSDKDGGDGNGYRLRLFDDLYKDNVTFAGNQTSDGTMIGGYFGAWSG
                     KTIQYIADHIGPALEQRPNIVLIHAGTNDMNPNPSISTEGNDPTGASQRLGALVDQVI
                     QACPNAVILVAMIINTCDDTQEPQTRKYQGLIPNVVQQRSDNGSHVLAVDFTTFSTSN
                     LHSDDCIHPTNAGYRLFGDYWYDFITQISSDWIHTPVGPDPHRTDGIYANGGLDKNIP
                     APDIGTNLVQISPSENVTSAAIIAEKNGQVNRNPNPIRTATGGNFQNGLSRDDDWKYH
                     MNWTEPAKVADGLGLDRHYVSRLYDMDGDGKADYVWLDPMTGEVTCWLNKLPDPWTPA
                     GTNGGVIASGAGAENSVFIADMNGDGLADYMVVDPSDGAVSIWWNYGSDDSWDNGWKF
                     VGGGQIASGVPHANWVTLRFPDINGDGRADYVYIGEGGALKHYMNTGTAGGQDVVFID
                     QGGIFNGATSNITKIVFADINGDGRDDYLIWDEDGGLSGFLNQPTQNEGVPQFVSQGS
                     AKSLATGNSQNPTFLWLADMDGDGKGDYVYIDEDHGALFVSYNKGDVDTS"
     gene            <1513299..>1515242
                     /locus_tag="TRUGW13939_10871"
                     /db_xref="GeneID:55998350"
     mRNA            join(<1513299..1513537,1513594..1513864,1513916..1514258,
                     1514311..>1515242)
                     /locus_tag="TRUGW13939_10871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493981.1"
                     /db_xref="GeneID:55998350"
     CDS             join(1513299..1513537,1513594..1513864,1513916..1514258,
                     1514311..1515242)
                     /locus_tag="TRUGW13939_10871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349874.1"
                     /db_xref="GeneID:55998350"
                     /translation="MVVFARLRAMFRLSAGNNEPSVDPLENSPEEKKGSSASANKIDE
                     ESRAELPSQDLQRGIQDVEAVTLSWSKASLIAVFANIWMLYFVNAMQSSTLYNLTSFV
                     TSDFSAHSLLNVIPIVSSTMSAATYIPLAKVMDVWGRAEGFLIMATFSTLGLVLMATC
                     NNLATFCAANVFYTIGFGGITYCVDVITADASKLKNRGLAYAFTSSPYIITAFAGPKA
                     ADRFYYEVSWRWAFGCWAIVFPIVAAPLYVVLKYNLRKAKITGIARHETVPRTVLQAT
                     WHYISEFDIIGVILFSAGLTLFFLPFSIADNAPNGWASDYIIAMLVVGFVCLFLFALF
                     EKFLAPKPMFKFSFLTNRTVIGACLLDATYQLSYYCWNNYYTSFLQVVNDLTLAEAGY
                     VNNTFDVVSGVLLLFVGYLIRRTGYFKWLLYVAVPLYIFAQGLMIYFRRPNQSVGYLV
                     MCEIFISIGGSIFIIVEQLAILAAVDHQHVAAALALLNVVGTVGDAAGSTICAAIWTN
                     TFEKALIRYLPESAMANLDYIYERLDIQLEYPVKSLTREAIQNAYAYSQMRMLAVGTG
                     IMALAFIWVLMIRNIHLGKVDQVKGMVF"
     gene            complement(<1515906..>1517455)
                     /locus_tag="TRUGW13939_10872"
                     /db_xref="GeneID:55998351"
     mRNA            complement(join(<1515906..1516610,1516666..1517352,
                     1517411..>1517455))
                     /locus_tag="TRUGW13939_10872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493982.1"
                     /db_xref="GeneID:55998351"
     CDS             complement(join(1515906..1516610,1516666..1517352,
                     1517411..1517455))
                     /locus_tag="TRUGW13939_10872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349875.1"
                     /db_xref="GeneID:55998351"
                     /translation="MMDPPCLTCRMRKKACDRAKPQCKTCIKANRQCGGYASRENAVF
                     VNLNSRSIAKPLKPIIGKAITFAKNAEVTPVNKHDNDYTVSLRILDLPSGDFQNHFTM
                     LWRKFHVKYGRTPDVWSAGVAKLGLQNRALDMALISLATMRMSISECSNEYRVFSLSA
                     YSTSLQIFRRLLQDNKNGRSRSHLVVTSLIFTLFEGAQQAPTKIYDSGWAGHLKGTLA
                     LMQGQAPESFRGAGLLSVFRRIREMAVHFALSNRETTFLARPEWMSLPWGEFLKTPRD
                     QLHDIAVNLTAVYAFLPEDPSAGVLDGIKLTNFRLLCRQLYARLIEWQAAHLKMNILN
                     SWENGSGESLDKEIELFYPLQGFFPKEEFTFLAAEFIALSLLLTLAELKILRGIYLLS
                     LEGPMGIEANQLESLLNECGFLESKLREVLCLPCFGQAVAELPGLTEGRCRSLLPTWA
                     LAQCSPMAENGQIAWWDTLALRLIYGIG"
     gene            <1517846..>1518535
                     /locus_tag="TRUGW13939_10873"
                     /db_xref="GeneID:55998352"
     mRNA            <1517846..>1518535
                     /locus_tag="TRUGW13939_10873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493983.1"
                     /db_xref="GeneID:55998352"
     CDS             1517846..1518535
                     /locus_tag="TRUGW13939_10873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349876.1"
                     /db_xref="GeneID:55998352"
                     /translation="MSEETPIRSCVLVFDGMDLVDFVAPLETLNHAYKKDTKTFETLI
                     STVVAAPTEEVMTKQGVAIKRQISWEQAAASLADYDILVAPGSFLVETMAVCNDPDSP
                     FLKMLKDFSALPASTSKTGQRILLSICSGSFFLAAAGLLDGRRTTTHYTMIPQLEELA
                     AKFGKTEISRHIFVDAGLLDSGVRMISSGGLTSGFDATLYTLELVCGEECAAFAADVL
                     EHPCRKSQALF"
     gene            <1519014..1522806
                     /locus_tag="TRUGW13939_10874"
                     /db_xref="GeneID:55998353"
     mRNA            join(<1519014..1519793,1519932..1519950,1521432..1521605,
                     1521658..1522038,1522102..1522214,1522283..1522343,
                     1522418..1522806)
                     /locus_tag="TRUGW13939_10874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493984.1"
                     /db_xref="GeneID:55998353"
     CDS             join(1519014..1519793,1519932..1519950,1521432..1521605,
                     1521658..1522038,1522102..1522214,1522283..1522343,
                     1522418..1522626)
                     /locus_tag="TRUGW13939_10874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349877.1"
                     /db_xref="GeneID:55998353"
                     /translation="MQSLSLKTSPDTEIHFTISKPLSTPEDQVTSPLLVFLHYWGGSS
                     ATWHKLTSYESPSSLSNDYPCIAIDLRGWGQSSGPSSAPDHSITPTASDVISVLTHLN
                     TDPTTAHIFKNGIIIVGHSMGAKVALATLNRVPDASLGLVKGLVLVAPSPPTPLILPP
                     DMSEQQRQAYNSEESIRWTAENVLSSKESLTDDDFSIILRDSSKGNTFAKDGWLLHGM
                     QEDISLDVKNAGLRPAAKGLKIQVLAGELDIVEQKDRVEKDIFLLSEGLVSSTRLGSP
                     FRVNSSRFDLVKHEFIIIIMLPKLLISNAASVVVLGSVLVDATGALKQEVRYRRSNST
                     LTPNGKKAGSAGGNAVSFWEPHLGWWYDWNPEQSSSHDTEYVPMLWGDGDASDEDAQR
                     YQEFQNLDTTPTYLLGFNEPDCSPPDSSSIDEDKGAQVWNYLIAPWGQKGVLLGSPAM
                     CKQADEDWLAPFESQISTDWDFTAIHVYKNSIDGVNKDLDHYWSTYGKPIWVTEFGCV
                     DDQNGFTPCTDQSEINSFISGIVDLFESDDRIYAYAYTDGNGLGDVWPPTSNGELTES
                     GQTYLSAISKYS"
     gene            complement(<1523283..>1523741)
                     /locus_tag="TRUGW13939_10875"
                     /db_xref="GeneID:55998354"
     mRNA            complement(join(<1523283..1523330,1523391..1523461,
                     1523537..>1523741))
                     /locus_tag="TRUGW13939_10875"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493985.1"
                     /db_xref="GeneID:55998354"
     CDS             complement(join(1523283..1523330,1523391..1523461,
                     1523537..1523741))
                     /locus_tag="TRUGW13939_10875"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349878.1"
                     /db_xref="GeneID:55998354"
                     /translation="MKYIVSIALLASAAMAQVGSNSLSASQCDASHLQCCDTVGPTSS
                     NEVTQLLSLLNIPADGLTGEVGLECDPILSVTVPHCEAQPVCCSGTSNGGLVNVDCVP
                     VNLDL"
     gene            complement(<1525727..>1526755)
                     /locus_tag="TRUGW13939_10876"
                     /db_xref="GeneID:55998355"
     mRNA            complement(<1525727..>1526755)
                     /locus_tag="TRUGW13939_10876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493986.1"
                     /db_xref="GeneID:55998355"
     CDS             complement(1525727..1526755)
                     /locus_tag="TRUGW13939_10876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349879.1"
                     /db_xref="GeneID:55998355"
                     /translation="MRTFTALAGLSLLASSALAKPITLASRNSSSTAQNVVYWGQNGG
                     GTIENNDLAAYCNSTSGIDVLVIGFLYQYGNGNDVPGGLFGQSCTITSGKGQNCDSLA
                     AAIPTCQKAGIKVVLSLGGASGGYSLQSTAEAQQIGQYLWDSYGGGSGNSTSRPLGDV
                     VVDGFDFDIENPNGAEYYPDMISTLRSNFAKDTSKTYWITGAPQCPIPEPNMGAIIQN
                     AQFDKIWVQFYNNNNYTHPCALGINGDAAFNWDEWKSFTANSSSKDAQIYVGVPASEL
                     GANGTPTGSVYYATPSQLATIVSSVKDDERFGGVMMWSAGFSDANVIDGCTYAQQVSS
                     ILKTGSPC"
     gene            complement(<1529155..>1529643)
                     /locus_tag="TRUGW13939_10877"
                     /db_xref="GeneID:55998356"
     mRNA            complement(<1529155..>1529643)
                     /locus_tag="TRUGW13939_10877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493987.1"
                     /db_xref="GeneID:55998356"
     CDS             complement(1529155..1529643)
                     /locus_tag="TRUGW13939_10877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349880.1"
                     /db_xref="GeneID:55998356"
                     /translation="MSIIYNPNAQHQPPLPPLPIQLRVVINNPQFGEVPEPLVYFWAI
                     QPLHRCDTTMEQTVPFTPFNYDGSSFRVVLERLLSGRDDGELRILKRWDENFIKTVPD
                     DGHIIALRSTGDDGERLAIKVAGLYRITVSIRLTSRLPQFSDTLVEGRYELRVRRRRQ
                     WD"
     gene            complement(<1531034..>1532686)
                     /locus_tag="TRUGW13939_10878"
                     /db_xref="GeneID:55998357"
     mRNA            complement(join(<1531034..1531923,1532419..>1532686))
                     /locus_tag="TRUGW13939_10878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493988.1"
                     /db_xref="GeneID:55998357"
     CDS             complement(join(1531034..1531923,1532419..1532686))
                     /locus_tag="TRUGW13939_10878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349881.1"
                     /db_xref="GeneID:55998357"
                     /translation="MSSIRGGPEKSFLFHYRNISYWKDFAVGSEGTAQFSSKRLSCRA
                     MVEIFKSKSSATVNSNMTHSPTEIENDLVKSSMEYIQEEYQRSDCVAIRTSWPQGSPT
                     TTLRHPHPALPKPNRQFISSTSSTKKPLAHARTIFNGILPEDEGFADWKKNASALLIR
                     GSYLTAEDIASCPNLIAIGKHGVGIDKIDQKACGARGIRICNTPGANARDVAELVLAL
                     SVTVARDIRSITTRQMTRPIPKETCNGLTLYKKTLEIIGMGNIGRTVAEIFRGAFDAN
                     VVAYDVFMPDGAWPHISHRSFNDMEEVIKRADVVSIHVPLTEETRDMISYKEIRMMKP
                     DAILINAARGGIVNKADLTTALSEGHLWGAGLDCHEQEPPLVRSMVRCGII"
     gene            complement(<1537006..>1539078)
                     /locus_tag="TRUGW13939_10879"
                     /db_xref="GeneID:55998358"
     mRNA            complement(join(<1537006..1538690,1538760..>1539078))
                     /locus_tag="TRUGW13939_10879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493989.1"
                     /db_xref="GeneID:55998358"
     CDS             complement(join(1537006..1538690,1538760..1539078))
                     /locus_tag="TRUGW13939_10879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349882.1"
                     /db_xref="GeneID:55998358"
                     /translation="MAFLFSLLRLCLLYLICHTVACVPANQKDDKRLSRRMQLDAQDV
                     LPKRQLEWGQINFIHTTDLHGWYEGHMKERNYRADWGDFISFIQHMRDRARQLNVDLL
                     VVDIGDLHDGAGLSDVTKPDGLATDELFKMTDFDLLTVGNHELVDAGLPNATHMNLAK
                     HFGDKYITSNVYVNDTSINETDPVPIGSLFHKLTTPNGLRIMAFGVLFDMNPPAKDTQ
                     IHLAKDMVNEDWFKNAVDQSDIDLFVLIGHNPARLDITNHDNNSTLKFITETIQKSRP
                     DIPVQVFSSHSHIRDFMVYNENSTALQSGKYGDTVGWLAMTGIKSSTYKGVMNPAGVP
                     NPRRPAKPVSSMSMNETSETADTSSLKYARRYLDFNRQTFQFHTNTSGDDTAFDTTDG
                     LGVSKKITELRTKYHLTQYFGCAPRSYCISCRPHDDEGNIYNLVRKALEKIVVSPTGN
                     TTSRLIFANRNGIRYDLAQGPFMRDDSYIVCPFTDGFRVVHNVSSEHASKILGSLDIK
                     CPSGKGEMTSESLPVDDKDENGSWDDLSGSTDQKVLSRRGVQDPVGMLTPGYTTSDDF
                     GTDGDDTQHSTIPHYEPPAYVQGNVTILSGAGQVPEHYDVVYIKHMEPKVLAALKCLD
                     KTQEYKVDDYTDATINTNTLLQLYAQKYWNQPLQSCAVGGAIG"
     gene            <1540817..>1541795
                     /locus_tag="TRUGW13939_10880"
                     /db_xref="GeneID:55998359"
     mRNA            join(<1540817..1540943,1541001..1541377,1541415..1541476,
                     1541582..>1541795)
                     /locus_tag="TRUGW13939_10880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493990.1"
                     /db_xref="GeneID:55998359"
     CDS             join(1540817..1540943,1541001..1541377,1541415..1541476,
                     1541582..1541795)
                     /locus_tag="TRUGW13939_10880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349883.1"
                     /db_xref="GeneID:55998359"
                     /translation="MKEVPVFSTKPFLTTAICDGNLPVPQDNGILIRVMVASSKPKDY
                     KHLYATGVSINSGDDIAGYVHGLGKMAALGNEFKIGDRVAASHPMMAPGGTSAEYAVA
                     PTETTLLIPDGIDFESATKIPLTTLAAILALFRRQSLLPPWMKRSPNAPLMPLIIYGA
                     SSALRTYASLLVESTCYVKKLLDSKLGDASWITISQILSPGGTVSTENYDESKIPADI
                     NISYSFVGSAHFGAFKPSMPRQPQDAKNTAADIDFAYVMFR"
     gene            complement(<1542240..>1543529)
                     /locus_tag="TRUGW13939_10881"
                     /db_xref="GeneID:55998360"
     mRNA            complement(join(<1542240..1542329,1542384..>1543529))
                     /locus_tag="TRUGW13939_10881"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493991.1"
                     /db_xref="GeneID:55998360"
     CDS             complement(join(1542240..1542329,1542384..1543529))
                     /locus_tag="TRUGW13939_10881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349884.1"
                     /db_xref="GeneID:55998360"
                     /translation="MHFSNSLVTISLMAGTTLAAPHMLQSRAPGGEVAVYWGQNGGGT
                     IENNDLSTYCTSSSGIDIIILSFLYEYGNGNNIASGTIGQSCYISPQGEPQDCDALAT
                     AISTCKSNGVKVILSLGGASGAYSLQSQSEAETIGQNLWEAYGNTANGSVPRPFGTTF
                     VDGWDFDIESNSGNEYYQYMISKLRSNFASDSSNTYYITGAPQCPIPEPNMEEIITNA
                     TFDYLWVQFYNNPGCSNPNEINYDAWVDLVTGGPSADAKIFIGVPASTTAATGTSSGA
                     GYYFEPSALATLVSEHDTNAHWGGIMMWSAGFSDANVIDGCTYAQEAKSILDTGSPCS
                     GTGTGTSTPSPSATPTSTSSPTATPTTSATPTTSSTSTTGTPVAQWGQCGGQGYSGST
                     TCASPYTCVEESSWWSSCQ"
     gene            <1545547..>1546510
                     /locus_tag="TRUGW13939_10882"
                     /db_xref="GeneID:55998361"
     mRNA            join(<1545547..1545589,1545661..1546403,1546448..>1546510)
                     /locus_tag="TRUGW13939_10882"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493992.1"
                     /db_xref="GeneID:55998361"
     CDS             join(1545547..1545589,1545661..1546403,1546448..1546510)
                     /locus_tag="TRUGW13939_10882"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349885.1"
                     /db_xref="GeneID:55998361"
                     /translation="MAFARRVAILPGGLGGLGSVTGKKLMQNGAQLAIIYAPFEAKRH
                     DELMEKGYGGTPNSDKIRTYECDITSPESVQAAFDSIEKETVAPSSSAVSERAFPSIL
                     INTAGYVSLSDMELTPPEETMKHLTTNVLGPMLCSQTFARLYFAASKKAQSSTSPPPP
                     GRIISISSQAAHAALHRHGAYCASKAALLGLTRSMASEWADRGITSNTVSPTVAWTEL
                     GKKAWGEASVREAFLKSIPTGKFARPEEVADAVVFLAQASIALLDSSGMINGADIRID
                     GGFTIR"
     gene            complement(<1546827..>1547877)
                     /locus_tag="TRUGW13939_10883"
                     /db_xref="GeneID:55998362"
     mRNA            complement(join(<1546827..1547625,1547708..>1547877))
                     /locus_tag="TRUGW13939_10883"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493993.1"
                     /db_xref="GeneID:55998362"
     CDS             complement(join(1546827..1547625,1547708..1547877))
                     /locus_tag="TRUGW13939_10883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349886.1"
                     /db_xref="GeneID:55998362"
                     /translation="MAGFVQAIGVLSGLLGVVQFGINNFQTEPPPGSTIKFAIGLDSQ
                     SGLSNAGGDLPDVRIWNLYGEYVGMKADPGKVSDGDLGQVYVSHENQGVYSLMSANDD
                     AICIAWASTTWSAERGGNKYAVSGDFGRECGGTWYHSGMFPYDNSQYQPDCFWIDSNG
                     DQPNTGFQVRWPSFAGVKFNESNTDPKQFCNNIDFGLRTEKDPNSINFWTKRDSIPVA
                     PRRVAWAASRLVVSDSESHSAKKLCESSTSMGPDFVHTEEELFCDMGSKTLYPFCTST
                     KSNCFDLDSHTLYPKNGNTGTQRTRVSGTTESPYTAVVDWRKNGEA"
     gene            complement(<1551034..>1552463)
                     /locus_tag="TRUGW13939_10884"
                     /db_xref="GeneID:55998363"
     mRNA            complement(join(<1551034..1551476,1551532..1552324,
                     1552395..>1552463))
                     /locus_tag="TRUGW13939_10884"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493994.1"
                     /db_xref="GeneID:55998363"
     CDS             complement(join(1551034..1551476,1551532..1552324,
                     1552395..1552463))
                     /locus_tag="TRUGW13939_10884"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349887.1"
                     /db_xref="GeneID:55998363"
                     /translation="MEAERTGFHTIEEPHPTKLVEGGRLSEKDVTVDDLRRAVPDYCF
                     SPNLFLSFYYLARDLCYSAALTAALYQLLHTPAVVESTWLYYTVVNVYGFCQGVVWTG
                     LWVIAHDCGHSGFSRWSALNDTIGFVLHSWLLAPYFSWKSTHRRHHIYANHIEKDLNY
                     VPPRRSQYAEKIHAAVETLDEVGQDAPVVLFLRIILQQTIGWNWYILTNITCPPSAVP
                     KKNMSAWRHSHFDPWGALFYSSEWPAIIMSDLGCLATISILCYLCRAFGSFETLFWFY
                     IVPWTWVNHWIVMITYLHHTHPSVPKYTSESWTFLRGATATIDRDFSFIGTHFFHHIS
                     SDHVTHHLFSRIPHYYSPVASRAIIPLLGKHYHGRGDFNYDALAVAFGKCQWVEGDSE
                     KDSTFGLTREKSDKNGKANEALWYRPGPSPSPEFKMRGARIF"
     gene            complement(<1553175..>1553864)
                     /locus_tag="TRUGW13939_10885"
                     /db_xref="GeneID:55998364"
     mRNA            complement(join(<1553175..1553435,1553823..>1553864))
                     /locus_tag="TRUGW13939_10885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493995.1"
                     /db_xref="GeneID:55998364"
     CDS             complement(join(1553175..1553435,1553823..1553864))
                     /locus_tag="TRUGW13939_10885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349888.1"
                     /db_xref="GeneID:55998364"
                     /translation="MEDSTVLRLKRRRVLARIKGKGAADRPTSADAGPPSTSPARATQ
                     KVYAASQGVASAPGEWLEGWLSGLIGVPDPIARSQTLNNANSRVRKLEQASPDGKK"
     gene            complement(<1557849..>1559732)
                     /locus_tag="TRUGW13939_10886"
                     /db_xref="GeneID:55998365"
     mRNA            complement(<1557849..>1559732)
                     /locus_tag="TRUGW13939_10886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493996.1"
                     /db_xref="GeneID:55998365"
     CDS             complement(1557849..1559732)
                     /locus_tag="TRUGW13939_10886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349889.1"
                     /db_xref="GeneID:55998365"
                     /translation="MAVSRSLSLLLLAVLGLAQLCRAKTVTYDFNVTWVTANPDGLAE
                     RKVVGINGQWPLPVIEVDKGDQLVVNMHNALDRSATIHFHGMFQNGTNGMDGAAMVTQ
                     CPVPPGSDFTYNFTVNQNGTYWYHCHTDFCYPDGYRQALIVHDAESPFVNDYDEEMTL
                     TMSDWYHEMTEDISPQFLSVYNPTGAEPIPNAFLFNDTLNSSLPVKPNTTYLLRLINI
                     GAFVAQYFYIEDHTFRIVEIDGVYTEPVEADTLYIAVAQRYSILVTTKNTTDKNYPIV
                     TVADSVLLDTITPDLKLNQTNWLEYNADVDHPQAQMTVDVASDLVPFDDITLVPTDGM
                     PLLPEPDLDIQVTVQMLNLDNGDGYAFLDNISFTSPKVPSLYTVFSVGDLATNQAVYG
                     EFTHPMILEHNQVVQIVLNNNDTGSHPFHLHGHNFQLVDRQPPYGEHFYDYADGDPVP
                     YDPNNHTAFPATPARRDTFVAPPQGYFVIRFVADNPGVWIFHCHIDWHLSQGLAMIMV
                     EAPTKIQGANQEAVPQQHYDVCAAAGIPYQGNAAANTEDYLDLSGQNEQPGWLPAGFT
                     SRGIVAMVFSCISAVLGMAFIVVYGLSDMKFKPTTNDSQATGSSAPAATESSSETAQA
                     YRD"
     gene            <1560366..>1561484
                     /locus_tag="TRUGW13939_10887"
                     /db_xref="GeneID:55998366"
     mRNA            <1560366..>1561484
                     /locus_tag="TRUGW13939_10887"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493997.1"
                     /db_xref="GeneID:55998366"
     CDS             1560366..1561484
                     /locus_tag="TRUGW13939_10887"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349890.1"
                     /db_xref="GeneID:55998366"
                     /translation="MVSVFAVQVFFITFRECLEAVIIVSVLLSFLKKCLGQPGQDQDI
                     YKQLRRQVWVGSAAGIGICLVLGGAFIGVFYGLGHDIWSKSEDLWEGIFYLIAAIIIT
                     IMGLTLLRINKTQAKWQVKIARALAEHKEKKSFILGNWARRYSMFLLPFITCLREGLE
                     AVVFIGGVSLGYPATAFPLPVITGIIAGGLVGWLIYRGGNAMSIQLFLIASTCVLYLI
                     AAGMFSKSVWSLEFNTFGNKVGSDVAEAGDGPGSYNIFESVWHVNCCNPEIDNGWDVF
                     NAILGWQNSATYGSVLSYNLYWVFIMVTVSCMLYQERHGFFPLQKPALQLMSRVPGLR
                     GYALRKLNHSDADDEEIVRQVGNNMFTEVTTERVEPTK"
     gene            <1564271..>1566031
                     /locus_tag="TRUGW13939_10888"
                     /db_xref="GeneID:55998367"
     mRNA            join(<1564271..1564512,1564614..1564996,1565068..1565832,
                     1565892..>1566031)
                     /locus_tag="TRUGW13939_10888"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493998.1"
                     /db_xref="GeneID:55998367"
     CDS             join(1564271..1564512,1564614..1564996,1565068..1565832,
                     1565892..1566031)
                     /locus_tag="TRUGW13939_10888"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349891.1"
                     /db_xref="GeneID:55998367"
                     /translation="MDHAVSDDQLGMELELEQKPSTIDVDADIEKRSDQPLHTNVPLL
                     LSELDWDSPEDPDNPRNWGSSKKIYHLVCISLCAFTTTYLSSAWASGAVPAAKEYNVS
                     ETVSLLGVSLFCVGLSLGPVIGSPVSEQYGRLPVYRWSLPLGGLFIIGCAVSKNMASI
                     LVCRFFAGLFCSPCLSIGGGSITDMYLPSKMGRATSGFLVSPFLGPCIAPVIGGFVIE
                     HKSWRWLEWVGLIATAVTIVFSLGMQETYKTAVLKQRAQRRGLCVSDHKAPTLGSLRG
                     WMADTVVRPLILLTTEPIVTFLSLYIGFNFAVLYGFFASLQVVYSEIYGFNPHKSGLV
                     FLSLAIGLGLATTTSLLMDKFIYQKKHRELTAQGVKRIPPEHRLYPAMFGGFCIIISL
                     FWFAWTARSDISWASPTIALIPFNWGNLCVFTSAAIYLVDCYGPRYGASALAANGFTR
                     YMFAMAFPLFMVQMYNNLTPKWATSLLGFISIALAPIPWLLFWTGPKIRSWSRIASSL
                     A"
     gene            <1567439..>1569826
                     /locus_tag="TRUGW13939_10889"
                     /db_xref="GeneID:55998368"
     mRNA            <1567439..>1569826
                     /locus_tag="TRUGW13939_10889"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035493999.1"
                     /db_xref="GeneID:55998368"
     CDS             1567439..1569826
                     /locus_tag="TRUGW13939_10889"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349892.1"
                     /db_xref="GeneID:55998368"
                     /translation="MVIQAVIVTALATLLPSAVLAQNNQSYANYSSQSQPDLYPLTVA
                     TIDLSFPDCDNGPLKTNLVCNTSANYVERAEALISLFTLEELINNTQNTAPGVPRLGL
                     PPYQVWNEALHGLDRANFAESGDEWTWATSFPMPILSMAALNRTLIHQIASIIATQAR
                     AFNNAGRYGLDSYAPNINGFRSPIWGRGQETPGEDAFFLSSAYAYEYITGLQGGVDPD
                     HLKIVATAKHFAGYDLENWEDHSRLGFDAEITQQDLSEYYTPQFLASSRYAKSGSFMC
                     SYNSVNGVPSCANSFFLQTLLRDSWDFPEYGYVSSDCDAVYNVFNPHGYAANQSQAAA
                     DSLRAGTDIDCGETFPWHLNQSFIDGSVTRGEIERSVIRLYANLVRLGYFDGNSSEYR
                     QLGWSDVVESDAWDVAYEAAVEGITVLKNDGVLPLSKKVKKVALIGPWANATTQLQGN
                     YYGNPPYLITPLEAATKAGYEVSYVFGTNITSNSTAGFAKAISAAKKSDVVIYLGGID
                     NTIEAEGVDRLNVTWPGNQLDLVAKLAEVGKPLVVLQMGGGQVDSSSLKNNKNVNALV
                     WGGYPGQSGGTAIFDILSGKRAPAGRLVTTQYPAEYATSLPATNLNLRPDGDSNPGQT
                     YLWYTGKPVYEFGHGLYYTTFSESLPSTAKNTSLKIADIFAAPHPGYTYSELAPFTSF
                     NGTVKNVGKVASPYSAMLFARTSNAGPAPYPNKWLVGFDRLPTIDPGHSAELSIPIPI
                     GAIARVDESGSKLVYPGKYELALNVDRSVVVEFELTGEPVVVENWPLEEQQIKAA"
     gene            complement(<1570313..>1574197)
                     /locus_tag="TRUGW13939_10890"
                     /db_xref="GeneID:55998369"
     mRNA            complement(join(<1570313..1570484,1570551..1571080,
                     1571150..1571200,1571258..1571539,1571624..1571797,
                     1572796..1573199,1573272..1573336,1573387..1573760,
                     1573819..1573886,1573939..1573975,1574042..>1574197))
                     /locus_tag="TRUGW13939_10890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494000.1"
                     /db_xref="GeneID:55998369"
     CDS             complement(join(1570313..1570484,1570551..1571080,
                     1571150..1571200,1571258..1571539,1571624..1571797,
                     1572796..1573199,1573272..1573336,1573387..1573760,
                     1573819..1573886,1573939..1573975,1574042..1574197))
                     /locus_tag="TRUGW13939_10890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349893.1"
                     /db_xref="GeneID:55998369"
                     /translation="MAVNLKDNQQAEILQVTIALSIVADIAIVLRLISRKLKGSYALD
                     DILAVIGLVISWGCLGLGIYMVKIGVGKHTQLSSPKDQENFFKALMAYEIVYFATLSA
                     TKLSILTFYTRLFPTRSFKIAVKIMTAVVISWFIATTLVSIFSCKPVRAFWTHEPGST
                     CIVSEHFYIANAVPNIITDAIILALPIHMVWKLHTSKWERVALTFIFLLGSFVVVASI
                     IRLSQLHQVASADFMWGFNNTVIWSSVEPSVAVISSCLPTMRPVAEFILPRQWLSRSR
                     SYKGSSQLRSYTHGTAEFVPKSSQVDEIDRMDRMDAENRRLNSYWTADTYSSNAVPLN
                     AVGKSRYNSTTKGPSADSQDIHVETNINVSASSIIDSYLKANGFADISFDIDTPFESK
                     YPEEISALRTAVLDANTELSDLLLGPKEIFVEYQYNYFVCMRALYQYKIPNAFPVGQE
                     ATFAEIASKTNCGEVVVRRILRYAITNRIFKEVRKGVVAHTATSKALVEDEKFRDYVG
                     MRCEEMWQAELNTIPAMLKWPDSQDPAETGFSLANNSSDTMYRIMGQDPARAQRFSNA
                     MAFRLTGPSLQLKYLVEGGPWQSLPSGGTVIDIGGSHGHAMVAIAEKFPSLKFIVQDL
                     PATIAARRPIPEKYNEYISFVEHDFFTPQPIKNADVYLFRWIFHNWADIHCIRILKNL
                     VPALGPNSKVVVSEICLPEPNTMDARQERKLRAMDVAMMTLQNAQERDKDEWISLFKR
                     ADERFSFAGVTQPEGSDLAVIVFTWNETEN"
     gene            <1574776..>1576226
                     /locus_tag="TRUGW13939_10891"
                     /db_xref="GeneID:55998370"
     mRNA            join(<1574776..1574943,1574996..1575868,1575933..1576026,
                     1576081..>1576226)
                     /locus_tag="TRUGW13939_10891"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494001.1"
                     /db_xref="GeneID:55998370"
     CDS             join(1574776..1574943,1574996..1575868,1575933..1576026,
                     1576081..1576226)
                     /locus_tag="TRUGW13939_10891"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349894.1"
                     /db_xref="GeneID:55998370"
                     /translation="MSGHQRPDEKVAQPAVVLSSLPDSTSEEEPDQDSKYSWLCVACV
                     FLINMHTFGINGSYGVFLSYYLTSSYFPGATYIEYALVSGLSISQALLISPFVTYTTR
                     VYGTRTALFIGSFLEALALVGASFSKTIWQLFLSQGLCSGWGMGFLFLGTVGVVPQWF
                     TKRRSLAAGLASSGAGTGGFVYNLAVNAMIHNISLPWAYRILAIIAFTVNITCSFFIK
                     DRHRQIGTVQKTFDYRLLKSLDFWALSIWAIFNIIGYVVLSFSLPSYATSIGLSKQQG
                     ALVGALLNVAQAFGRPSVGFLSDHVGRVRMTAIASAACGLTCFVIWIFARSYGVLILF
                     AILAGLFVGNNWAATAPVSAEIFGMKYLPSILSTLWLILTPPGTFAELIALGLREKHG
                     SRIYLPTQIFTGALYFGAALSMWLIYARKSRKLW"
     gene            <1579971..>1581262
                     /locus_tag="TRUGW13939_10892"
                     /db_xref="GeneID:55998371"
     mRNA            join(<1579971..1580653,1580710..>1581262)
                     /locus_tag="TRUGW13939_10892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494002.1"
                     /db_xref="GeneID:55998371"
     CDS             join(1579971..1580653,1580710..1581262)
                     /locus_tag="TRUGW13939_10892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349895.1"
                     /db_xref="GeneID:55998371"
                     /translation="MAPSAAPIAHSEEQLYASSNSIDVTSNQDVYRGYDHTTWYVGNA
                     KQAASWYVTRMGFEVVAYQGLETGSRCTTSYVVSNNNVRFVLTSALQSISGVEDTASS
                     KERHLVKEIYDHLERHGDAVKDVAFEVDDVHSLFSSAISAGATGVQEPTSISDQSGFV
                     VTAVIKTFGETTHTFIDRRNYSGSFFPGFKAVEETDPIQQYLPVIDLGEIDHCVGNHD
                     WHDLESACNFYEECLGFRRFWTVDDRSLTTEYSTMNSIVMASPGNGVVKMPMNEPAIG
                     KKKSQIEEFVEFFNGAGVQHIALQTTDILETVTNLKKRGVPFISVPDTYYEDLRIRLN
                     KAGMEINESLEALQKLCVLVDFDEGGYLLQIFTKPLLDRPTIFLEIIQRNNFDGFGAG
                     NFKALFEAVEREQEKRGNL"
     gene            complement(<1581358..>1582095)
                     /locus_tag="TRUGW13939_10893"
                     /db_xref="GeneID:55998372"
     mRNA            complement(<1581358..>1582095)
                     /locus_tag="TRUGW13939_10893"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494003.1"
                     /db_xref="GeneID:55998372"
     CDS             complement(1581358..1582095)
                     /locus_tag="TRUGW13939_10893"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349896.1"
                     /db_xref="GeneID:55998372"
                     /translation="MKTLSQNDKNVLSRIFESHPSGSLATSPIDHTLPTSLPSIPPGA
                     LSELRELEFAAISPLDGERPSQESLRQSIAKLTDLVTSYPQYSSAYNNRAQALRLLHG
                     DDLYNEAIRDSTLWSDLCSAIAFASPGQSQQRVCELQGQILRSAYAQRGFLTWKAAKN
                     SAITLDSNNLPLELVGLEKEAIEDKARSDLEAAGRYGDQEAKKMAISANPYARLCGNI
                     VEEAMIAEMQKMRDSWNKGQSHTSKGN"
     gene            <1582535..>1584248
                     /locus_tag="TRUGW13939_10894"
                     /db_xref="GeneID:55998373"
     mRNA            join(<1582535..1582667,1582721..1583223,1583303..1583736,
                     1583797..1584032,1584091..>1584248)
                     /locus_tag="TRUGW13939_10894"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494004.1"
                     /db_xref="GeneID:55998373"
     CDS             join(1582535..1582667,1582721..1583223,1583303..1583736,
                     1583797..1584032,1584091..1584248)
                     /locus_tag="TRUGW13939_10894"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349897.1"
                     /db_xref="GeneID:55998373"
                     /translation="MDAEKGIKAAEVSIHSSRNDCWVVVNGQVWDVTNFMKTHPGGED
                     VIFKHAGNDASYTYNQAHSPKLLARTLPSTNLKGGLVGELPSSWLPIPETTQEKKETQ
                     SSIPPLSTILSLHDLEASAKDHLSKKAWAYYSSAATDLVSERANRALWEKIWFRPRIM
                     RNVKNVNTERIIHGVKSSTPFCVAPAAMAKLANEAGELAIAKSCAESGVIQCISINAS
                     YQVEEVVAAAPPGTPFFFQIYVNKDRSSSETLLRRVWDKGIRVLIVTVDAPVPGKREA
                     DEKVKTSGTVQTPMTGTLAANDTVGSGLTRTMGTYIDSELSWDDLDWLRSIWKGKLVL
                     KGIQTVEDAAMAAEARVDGIILSNHGGRNLDTSPPGLMVLLEIRKHCPQIFQKVEIHI
                     DGGIRRGTDILKALCLGATSVLIGRPFLYSVLYGEEGVAHVIRILKDELETAMRLAGI
                     TDLSQVHPGFVTTRELDHLVETTIHWNSREYMLKSKM"
     gene            <1585180..>1586951
                     /locus_tag="TRUGW13939_10895"
                     /db_xref="GeneID:55998374"
     mRNA            join(<1585180..1585290,1585352..1585447,1585513..1585637,
                     1585693..1585718,1585784..1585841,1585897..1586275,
                     1586337..>1586951)
                     /locus_tag="TRUGW13939_10895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494005.1"
                     /db_xref="GeneID:55998374"
     CDS             join(1585180..1585290,1585352..1585447,1585513..1585637,
                     1585693..1585718,1585784..1585841,1585897..1586275,
                     1586337..1586951)
                     /locus_tag="TRUGW13939_10895"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349898.1"
                     /db_xref="GeneID:55998374"
                     /translation="MAIDNVVSELRTSFESGKTRPIAWRKEQLRGLWSLVIDNRDRFA
                     EAIHKDVAKPKVQVEVLEVLCVANEIIHFLHNLDDWLKDEPVSTLPPFENWSPIIRRQ
                     PKGLCLILGTWNYPLTLTLLPFIGVIAAGNTGILRPSEFAPNTADLLSELFPKYLDSS
                     CFQCVTGGKEAAQSLLKHSFGHILFTGGQTVGKAVMQSAATTLSPLTLELGGRNAVIV
                     SDKANVHLAAKRTLWSKAASAGQTCFAPNVAIVHEAVYDQFLESLKQVHYDFYKGSPS
                     IDNVGRIVNTAQFSRVQSLLSSTKGKIVLGGKLDADSLYAEPTVVVDLEPEDSLLTSE
                     VFGPILPVVRATDIEHAISLAKSLAPESLGLYVFSEDPEEANTIANSVPNGSTAINDV
                     MAQIAPTSLPFGGFGASGFGSYRGKASIDTFSHQRSIVTVPTNADFEAMLEWRYPYAD
                     PDPTVAFIRANMTAPLPTA"
     gene            <1589682..>1591425
                     /locus_tag="TRUGW13939_10896"
                     /db_xref="GeneID:55998375"
     mRNA            join(<1589682..1589856,1589912..1590886,1590949..1591014,
                     1591073..1591191,1591252..>1591425)
                     /locus_tag="TRUGW13939_10896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494006.1"
                     /db_xref="GeneID:55998375"
     CDS             join(1589682..1589856,1589912..1590886,1590949..1591014,
                     1591073..1591191,1591252..1591425)
                     /locus_tag="TRUGW13939_10896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349899.1"
                     /db_xref="GeneID:55998375"
                     /translation="MKSSQALMPTLGALLSFIASPALALDLLPIEAPQAGLDARAADY
                     SALNLQSVETFLWGGSDTINTAIANLTVYMNGKEENILNLERFKDLVTSVKCAEKSTT
                     LTLESDDAFAHLMEAWDWTNQHENNTFVLIAGSGQCSSSSKRQPYIIESVEYDNTTNT
                     ATLNGAQSDWKTVAHTYDLHVGGTPSSKLAQRDYSGSYALNFTHTINFGKWAFDAVEG
                     VQITAVCNDCYTTGEFDFNFDIKTVLGIPDGASLTLNPKGVTAVVNPTIGLVGKLSGS
                     KSFEKKFLTIPIDGISVADIIELGPEIAFKGSLDIGPLKGTASVTTGVTLTINDDADF
                     TLDLLSPSDASANGWAPEVTGDDTTITAMISGGVSLGVVADVEFDISVLGKGLSAGIG
                     LNPLAGVLLSAIDSSAGACADDPEHHQYGVQLAPYAGVYLQASVSDVATVTITSETIS
                     LPSTCTGFGAALTSGVSTTVVPTTTAVPTPSGSVIPSSSAAINRRAPRPTSF"
     gene            complement(<1591918..>1593214)
                     /locus_tag="TRUGW13939_10897"
                     /db_xref="GeneID:55998376"
     mRNA            complement(join(<1591918..1591981,1592042..1592141,
                     1592211..1592475,1592533..1592701,1592760..>1593214))
                     /locus_tag="TRUGW13939_10897"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494007.1"
                     /db_xref="GeneID:55998376"
     CDS             complement(join(1591918..1591981,1592042..1592141,
                     1592211..1592475,1592533..1592701,1592760..1593214))
                     /locus_tag="TRUGW13939_10897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349900.1"
                     /db_xref="GeneID:55998376"
                     /translation="MAEPITAVVFGAGVIGLTTATELLRQYPTASITVVARHLPGDQS
                     TGDYCSSWAGANWISYDDNWGCQAAYEKASFQRFRDLDLRSGVKRVPLRLLYDDEDIK
                     IHGKEGLRQKWYRDLVGGLEEVNSGDLPAWASLGLDLTTFMINPNVYLPWLQSRLLHA
                     GVQFLRRSYEHIDEVFEDFPSATTVYNCSGLGARTLGGVQDEKVHSIKGQTILLAEPK
                     IPVPRMYMHKINKDEFTHVFPRPLGGGIIIGGIRLHHDYDEKPDMQLAERIKRRACDI
                     CPELGRPENLKVIRHNVGFRPSRQGGVRIEREKRGGKWLIHNYGAGGTGYQASWGMAE
                     HAVKLFTETTLEKAKL"
     gene            <1593744..>1595281
                     /locus_tag="TRUGW13939_10898"
                     /db_xref="GeneID:55998377"
     mRNA            join(<1593744..1594346,1594397..>1595281)
                     /locus_tag="TRUGW13939_10898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494008.1"
                     /db_xref="GeneID:55998377"
     CDS             join(<1593744..1594346,1594397..1595281)
                     /locus_tag="TRUGW13939_10898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349901.1"
                     /db_xref="GeneID:55998377"
                     /translation="PGWKDGGEREKLQIKHIKKEIQKNLTRRRGQSRSSPHNRHEDSQ
                     DNSDINHRRGSVAGMLNPVFFASAQIDENNSIDAGKGMPERISSYRKAELLMHYMDYV
                     FPLQFRFHTPDVNGRGWLLWLLVKTGPLYHAALSLSALHQSIYFPNVFGNAYAELAGY
                     HTKALRDLQEFLQHLRINDHRDEKSRLMEVMSCGVSLISFELFQGGVSDWQLHLDALI
                     SIITSRSSSAVIQLLTETRQKPDSRNTPLDWQHTALSFLIATIMWFDLLACASTGKAP
                     RMPYEFLLDENIVDMSNYMGVQNWVMRAIGDIAALDVWKNNVQDDDSSSHSDLVSRGR
                     VIEQQLERGLQDLDSSPLESYSTTMPGPFKRLNKVKNVTRSFATAALVYLRVVLLGLG
                     HDSDTIQDAVSRNVTSMKRITYQQDMRGMVWPICISGSMAETTHQPFYEAIVKEALGD
                     SPRDFGNCATILKILTRSWEIRRLDQSRSVGWRDVMTEIGICLLV"
     gene            complement(<1595397..>1597189)
                     /locus_tag="TRUGW13939_10899"
                     /db_xref="GeneID:55998378"
     mRNA            complement(join(<1595397..1595816,1595877..1596833,
                     1596908..>1597189))
                     /locus_tag="TRUGW13939_10899"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494009.1"
                     /db_xref="GeneID:55998378"
     CDS             complement(join(1595397..1595816,1595877..1596833,
                     1596908..1597189))
                     /locus_tag="TRUGW13939_10899"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349902.1"
                     /db_xref="GeneID:55998378"
                     /translation="MRRKIEPPAWQHVAATRRSLIESKIPPEWRVPAELLKSKDLVDL
                     PRRCRIMTEQELSITELSAVEIVSLIQAGKISAVDTTKAFCKRAAIAHQATNCLAEIH
                     FDEALLQAGQLDEYMRVHGRPKGMLHGLPISVKEHIKIKNTTATSGLIAWADHVSDED
                     ALIVRTFREQGAVFYVKTTNPQTLMAIETDSNLFGRTVNPHNTNLTCGGSTGGEGALL
                     AMRGSVLGIGTDIGGSIRVPSAFNGVYGFKPSIGRIPHSGLSGLSDGMQNIVGVVGPL
                     ALSLEDIELFCIAALKNNPWKYEPALLDIPWKEEVDVPKKLKIGVMWSDGVVQPHPPI
                     TRALKQVVVELQNQGHTVIDWDSQLHHSIFDVTNEAYFLDGGAEYHQTLEEGHEPPVP
                     IVKWLLDEKAKHRYTIEESWRVNRDLDNLRTKYALQWNNHDVDAIICPANASVASVHN
                     ENRYWGYTCVWNALDYPAVIFPVSTVQGTDIWKNFPPLAAPLNPMDAWSRNLYIDSEG
                     PLRYEGAPISLQVVGRRLQGERVLCITKRVVDILKSKECATPRD"
     gene            <1597639..>1598729
                     /locus_tag="TRUGW13939_10900"
                     /db_xref="GeneID:55998379"
     mRNA            join(<1597639..1597726,1597788..1598105,1598191..>1598729)
                     /locus_tag="TRUGW13939_10900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494010.1"
                     /db_xref="GeneID:55998379"
     CDS             join(1597639..1597726,1597788..1598105,1598191..1598729)
                     /locus_tag="TRUGW13939_10900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349903.1"
                     /db_xref="GeneID:55998379"
                     /translation="MAGTAQQPDTTSGGYPQGKLNTIRVYKQRGHYDYETVHSITDST
                     LLSHVAFIIKDNDNNGEDAPVNLPLTCVLGRYNPDIDYERLSDEQLDAEHKETIRSGP
                     VEAYVHGNAAAMLYKAIKASENGSVKVCITSTAVDGVVLFLTPNGHSLNYRSSVLHGT
                     ASLVPEHEVAKKRWSMRLLTNHMARGRWDVTYPVAQSAMKYVQVIEVQIRSASAKVRG
                     ANIGDFEPDTVLGESPGWQKKDVWSGVVPLYEVLGTPVSSGVMGTQGERDDAIRQVEH
                     WRGGRNEASKEYAERVAAVGPVEKDMKDQVEKWKSTHN"
     gene            complement(<1599167..>1601281)
                     /locus_tag="TRUGW13939_10901"
                     /db_xref="GeneID:55998380"
     mRNA            complement(join(<1599167..1599317,1599377..1599450,
                     1599503..1599533,1599608..1599820,1600024..1600310,
                     1600368..1600505,1600557..1600663,1600728..1600774,
                     1600828..1600909,1600965..1601017,1601070..>1601281))
                     /locus_tag="TRUGW13939_10901"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494011.1"
                     /db_xref="GeneID:55998380"
     CDS             complement(join(1599167..1599317,1599377..1599450,
                     1599503..1599533,1599608..1599820,1600024..1600310,
                     1600368..1600505,1600557..1600663,1600728..1600774,
                     1600828..1600909,1600965..1601017,1601070..1601281))
                     /locus_tag="TRUGW13939_10901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349904.1"
                     /db_xref="GeneID:55998380"
                     /translation="MAEVREGKAAIAQSTRADVHPADSSSANTELSSEPAQKKTFGKR
                     LKEVVWDTFDYPPAERKFVSKIDFFILTWAGFSYFSKNLNSNNVSNAYVSGMKEELNV
                     VGNEYQTFTTMWTIGYVISQIPSQMICTRVRLSLWCPSWELFWVIITFASAAVKTPHQ
                     LYICRFFVGLAEGTFYPAVHTVLGGWYTKRELAKRACIFFGSAFVGSMFSGYLQAALY
                     SGMNGVGGLSGWRWLFVFDGVITFPMAIWGYLALPDLPANTRAPWLKPHEREMAIERM
                     KRAGKQPNEPITWTGVKRVLSKWHFWVYTAYYTYPVTDINTYPTVMNAITILTTLIYG
                     WTSDSIGLRSPIVYFSLTVCFFAAMNLAIWDGVPFGLKWASYYLTGFAQGSGPVFLTM
                     VNEVCAGDSLERLIILGSTNSIAYAFNAWIPLLSYNTTYAPRFLVGNSITVALIVCAA
                     ATLTLALYLQRRDE"
     gene            <1601842..>1603182
                     /locus_tag="TRUGW13939_10902"
                     /db_xref="GeneID:55998381"
     mRNA            join(<1601842..1601908,1601959..1602060,1602130..1602410,
                     1602482..1603016,1603076..>1603182)
                     /locus_tag="TRUGW13939_10902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494012.1"
                     /db_xref="GeneID:55998381"
     CDS             join(1601842..1601908,1601959..1602060,1602130..1602410,
                     1602482..1603016,1603076..1603182)
                     /locus_tag="TRUGW13939_10902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349905.1"
                     /db_xref="GeneID:55998381"
                     /translation="MPSTTALPVLKPYVTPAQTKDNLDWAELEALDISLLKQPGGKQA
                     LANQVLNFINNNGFFYVKGHGLTDEQVNRQYAIAQAFFDLPLEEKEEYACNSAAGDFR
                     GYKGRSTGDLAARDNDERYNIPKFTPEHERPHPQLINQHYEEIKEFSLHIHNKILLPL
                     LRLFAYVLEIDEEYLVQVHRYEEKGLEYLRYMQYYPRSAEEDAKLGNLWSKGHTDYNT
                     LTFLFYQPVAGLQVQQQDNTWKYVKSEPGAIIVNIADALEYLSGGFLKSTVHRVVRPP
                     PDQADKPRLGLIYFARPEAAVKMKPVRSPLLERLGLQVPIDNLKALEGVTAEEWARAR
                     IAKDHRFRTGVVNQQETEILGGVHQKYYD"
     gene            <1603550..>1604287
                     /locus_tag="TRUGW13939_10903"
                     /db_xref="GeneID:55998382"
     mRNA            join(<1603550..1603999,1604051..1604113,1604165..>1604287)
                     /locus_tag="TRUGW13939_10903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494013.1"
                     /db_xref="GeneID:55998382"
     CDS             join(1603550..1603999,1604051..1604113,1604165..1604287)
                     /locus_tag="TRUGW13939_10903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349906.1"
                     /db_xref="GeneID:55998382"
                     /translation="MSLFARLHASIFGSSGPEAKIAIIGLAGVGKNTLLRLINEDQIQ
                     TICHPNSPYLYYKTGKNYHLRMNYVMTYVGYDEPGMSKIWLGEQFCDSDGIILVIDDD
                     HDSKAEAAEWMEAYVKGFRRERWPDHFPDVKIREGIPWLILANTKKSDNKLTIGEVQR
                     FMGLDELQIDYYVEVVNILTGEGVANALKWLRQRVDTPVENRLQMREVKSS"
     gene            <1604509..>1605600
                     /locus_tag="TRUGW13939_10904"
                     /db_xref="GeneID:55998383"
     mRNA            <1604509..>1605600
                     /locus_tag="TRUGW13939_10904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494014.1"
                     /db_xref="GeneID:55998383"
     CDS             1604509..1605600
                     /locus_tag="TRUGW13939_10904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349907.1"
                     /db_xref="GeneID:55998383"
                     /translation="MTDGIPKLYPGEQLDNAAGFPVLFNYFPADPKKALVVFIPGGGH
                     NARISYGGHQGSDEKNFLAHWMNQHGHGFLAVSYPLESSPPIMPATAPQFRIRDWGKQ
                     AAEVTHRVVKQYGLSGRVVLIGWSMGGRIVVPYSVAVRSLGLHVDLYVGLAATPGLHG
                     MRPPPPGIKSSESGYGAFTNMSNLFLAQIHEQQAMLNGGRTIVPDDVYVREYFGYTPV
                     SLAGWNLRYDPAGHGQAFVEEFWTSTKDAATDQAEHLPMIASLTGNSILDTRHVIMDQ
                     ATWTFMLTQRFTRIIETRNPKSGLTQARFEKLADMVHSPPRQLSRTIPGNHYFFLGER
                     GARQTSDAIVELLATAIEFESQFQEILSG"
     gene            complement(<1605980..>1610170)
                     /locus_tag="TRUGW13939_10905"
                     /db_xref="GeneID:55998384"
     mRNA            complement(join(<1605980..1606558,1606652..1607101,
                     1607182..1607485,1608990..1609799,1609875..>1610170))
                     /locus_tag="TRUGW13939_10905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494015.1"
                     /db_xref="GeneID:55998384"
     CDS             complement(join(1605980..1606558,1606652..1607101,
                     1607182..1607485,1608990..1609799,1609875..1610170))
                     /locus_tag="TRUGW13939_10905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349908.1"
                     /db_xref="GeneID:55998384"
                     /translation="MPTERYFKKVPPFPSDVPVAKLPRLSYAKLLARDEAESVALFNA
                     SRGSGFFLVDFTTCPEGQKFLEHAERMFEINEQVNALEQDELMKYAYRPPHHLFGYKH
                     VGNLKIEDGRPDRCEFYNIGQDDITGVSDPLPNPPLIENSRSEIKTYMEKAYEVLSLV
                     CSHLETQLRLPQGTLVALQPQTRPSGTALRMLRYLPQPEQDRQTSLLGHTDIGSLTLL
                     FNVLGGLQLLSPGADPKDNNSWVYAQPQPGCAIVNLGDAMVEWSAGILRSNMHRVTFA
                     PGEQSKSTRYSLAYLIRPFGQAPMKRLAGGESLIPPLEEGEEDNKMTASEWESHKAVA
                     IKAGRDNARSRGGREIKLDGKSDIVSGFTVGSVGASHTKKRNNCVLFADIYLLVESII
                     DAASSAAYGMMIHYTGNETGQIPGKIPNTWWEGGAMFMALIEYWYYTGDTTYNSEVST
                     GMQWQAGDGDYMPSNYSSYIGNDDQMFWGLAAMTAAELNFPEVSDGYSWLSLAQGVYN
                     TQIERWDSEDCGGGMRWQIWNYESGFTMKNSISNGGLFQLAARLARYTNNDTYADWAE
                     KIWDWSTTQLLVDTSTWAVADSVSISNNCSEPDHTRWTYNYGAYLMGAAYMYNYTNDS
                     STWLTPVNGLMNSTLSTFASATYNNTLTDIQCETSETCDNNEIIFKGLTAGWLAFTAL
                     IVPSTYTTIMPALKISAQSAAEACTGYSNNTCGVRWSIKSWDGWIGLEESMSTTNVFW
                     ANLIPYNMTSGPVTSTTGGNSTSNPTAGTDDSTGTSDTPRPITAGDRAGAGFITALFA
                     GSVISGVYWLITSE"
     gene            complement(<1612344..>1613508)
                     /locus_tag="TRUGW13939_10906"
                     /db_xref="GeneID:55998385"
     mRNA            complement(join(<1612344..1612660,1612722..1613280,
                     1613338..>1613508))
                     /locus_tag="TRUGW13939_10906"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494016.1"
                     /db_xref="GeneID:55998385"
     CDS             complement(join(1612344..1612660,1612722..1613280,
                     1613338..1613508))
                     /locus_tag="TRUGW13939_10906"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349909.1"
                     /db_xref="GeneID:55998385"
                     /translation="MSSSASFPSDHDNGPAVNGVTWSFLIIAVVSVILRCYVRIFMIK
                     SFGYDDILIVVTLGVLIAGDVVISNMVSAGMGRHLEYLPNPTYSALQILKWNSIYQIL
                     NVSGALLTKISIGLFLLRLKRTRKFTIAVWGVLTPLFITTVILCFVVGLQCIPLRALW
                     TPTIKGHCISNKTPLNVSYVQSAFAILADLFLTVSPIVILWKVQISLRKKLGICALMS
                     LGLMATIANALRNAFIPNLTASDETYTIVPIVLVADLEFSLGTIAACMPTLMPLFKGN
                     GNNSSYNKMSGMTPTVGSGRGRNTIPSRNQYSFTDATHTSRQSTESEIPLKSMNQGNQ
                     ITMSKSFAVEHSAA"
     gene            complement(<1614848..>1615941)
                     /locus_tag="TRUGW13939_10907"
                     /db_xref="GeneID:55998386"
     mRNA            complement(join(<1614848..1615795,1615852..>1615941))
                     /locus_tag="TRUGW13939_10907"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494017.1"
                     /db_xref="GeneID:55998386"
     CDS             complement(join(1614848..1615795,1615852..1615941))
                     /locus_tag="TRUGW13939_10907"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349910.1"
                     /db_xref="GeneID:55998386"
                     /translation="MEAIGSTPTLAASGHTEKSKTMGKSPFTEHKGALLHMFSFLKTI
                     YLFPRNDVPTMIIPVTCLGTCAALSVQGTLTTHGPGGLWWWETLCRVPKTFLWVWMNV
                     LLFSISNQRSEDAMVEDAINKPWRPLPAGRISPSQARRLLLAGIPLVVSLCYLHLGAT
                     QETIVCLLLTWMYNDLGGADEHFLVRNGVNSAAYFVYGCGAMRVASDLSLNDALQAGL
                     VQWLGIVSAIILSTMHVQDLKDQEGDRARARSTAPLALGDVMARWTITGGVLAWSILA
                     PLYWFSSISVPASSCGYGLIAATIPSLFAVLVSFRVLLWRDPRSDTITYKYWSIWLMS
                     LFALPLLPLAI"
     gene            <1617061..>1618422
                     /locus_tag="TRUGW13939_10908"
                     /db_xref="GeneID:55998387"
     mRNA            <1617061..>1618422
                     /locus_tag="TRUGW13939_10908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494018.1"
                     /db_xref="GeneID:55998387"
     CDS             1617061..1618422
                     /locus_tag="TRUGW13939_10908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349911.1"
                     /db_xref="GeneID:55998387"
                     /translation="MLVITPSITIAGFIFLFYILWVRQFRYHRARKHAQLLAQSQALD
                     TQEMPLPIAQEIYDSLMHAEFPFWFWKGIELALFRTYAIPTISSLLAKTSRLVSPEIL
                     PRRYVETEVLFLEFALRKWGTVPWLQATARTRAIHAGYRKSGAVREEDMLFTLAALAT
                     QPVTLVEQLEWRRLNEAELCAVGTLYRAMADAFDIDYSVYLAPYVDKKPSTGLLGLDF
                     YYALHDWQMAYEARVMTYTPQNRVLCDAAIGLLLWGVPGASVKQFVTTALTTVMDDSL
                     REAMGFPPTPVWIAKITTSLLDARRWFLRYLCPPRPDALKIQRWKDLDPSSIGCAFAP
                     ATATTNKESDTGSGLESNFQGERPKNSRVGIYKTPTTRMVSYVAAPYFVKPTIWNRWF
                     SLGTWWWWAVGRPIPGAEEIHEPEGYSILALGPPLGRTTAAQKREEEAVLAVGLSKGW
                     QHL"
     gene            complement(<1618568..>1620316)
                     /locus_tag="TRUGW13939_10909"
                     /db_xref="GeneID:55998388"
     mRNA            complement(join(<1618568..1618750,1618815..1619801,
                     1619861..>1620316))
                     /locus_tag="TRUGW13939_10909"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494019.1"
                     /db_xref="GeneID:55998388"
     CDS             complement(join(1618568..1618750,1618815..1619801,
                     1619861..1620316))
                     /locus_tag="TRUGW13939_10909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349912.1"
                     /db_xref="GeneID:55998388"
                     /translation="MADFSRLSVALSDASIYNVGLSLGIAVPIFLILRVLIDYAKVLS
                     LRRRMPPGPFPLPLFGNYFSIPGERPWLKFEEWSTKTYKSPLITIWNGTAPTILCNDA
                     WSISDLLDKRASIYSSRPRCVLMGDCTGATTTNQILQPYGDRWRLHRRLTHAIVGPQN
                     VRTFRPSQSDEANIMLRDMFETPDKMTDAIGRFACSQASIIGWGRRIDTVHDQLAALS
                     IPATEAANFAIPGFYIIETLPFLTRLPAWLFKMPTELAAGSKLFGKYLWALTEEGGEA
                     TFDKNFARLLLQEREKSDLSSNEIGSLIGNVVGGGLATMTSTTLSFILAMCVFPDVQK
                     KAQAEIDSIVGDGHRPPSWEDESSMPYVAAVISEVFRWRPVTVLGGMAHAPIQDDVYK
                     GYFIPKGTAITGNSWAIHRNSRDYPDPETFRPERFYDGLERPFPIKKGHYAFGWGRRA
                     CSGQNLAEQALWITIVRLLWAFNIQPGLDEKGDEIKPDVFAYTNTENSRPQPFEARFT
                     PRSAKHKQTLLNEAAKSRDALHIFDWESKAKMQ"
     gene            <1622312..>1623505
                     /locus_tag="TRUGW13939_10910"
                     /db_xref="GeneID:55998389"
     mRNA            <1622312..>1623505
                     /locus_tag="TRUGW13939_10910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494020.1"
                     /db_xref="GeneID:55998389"
     CDS             1622312..1623505
                     /locus_tag="TRUGW13939_10910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349913.1"
                     /db_xref="GeneID:55998389"
                     /translation="MSTSPNPSGIRALIPGLRLGRYTPGHLNSLTDVPGVLVHTESII
                     KKASETERGLAINTGVTVILPRRDWFDNASYAGYFRFNGSGEMTGSHWLDETGLLNSP
                     IVLTNSFSVGPCYSGIYQYAIREYSKNGKPADWFLLPVVAETCDLFLNDIAAMVVTPE
                     MVVNGIDNASSVKVPEGNTGGGTGMTCQGFKAGTGSASRIIEGVEFGEKKAYTVAALV
                     QANFGAKRDLRFGGVPVGRIMLEREEAKQASADNNTTTENTEEKDEERRLALKDGSII
                     VVLATDAPLHPVQLQRLAKRATVGVSRVGGWGSNSSGDLFLAFSTAQGIPRAPPFSWN
                     PTTEQKVSVVQDVTINALFEAAADSTEEAIYNALVAAKDMEGPLGAAEAIDHQELKAI
                     VEEYL"
     gene            <1624140..>1626267
                     /locus_tag="TRUGW13939_10911"
                     /db_xref="GeneID:55998390"
     mRNA            join(<1624140..1624568,1624631..1625092,1625152..>1626267)
                     /locus_tag="TRUGW13939_10911"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494021.1"
                     /db_xref="GeneID:55998390"
     CDS             join(1624140..1624568,1624631..1625092,1625152..1626267)
                     /locus_tag="TRUGW13939_10911"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349914.1"
                     /db_xref="GeneID:55998390"
                     /translation="MDQSVQAESSRRDAVLRRYNVERSCLKCHERKIRCDRRHPCTSC
                     MRLNIQCIYPGPERGKRRQHHKAAISDRLAQLERTITTLSQAHDEDVSHRKPESPLNE
                     STPNKPLPVQRAPSEASTNRGLLLPDRHYINDQLLSRLLTNESDLQAAMGGNAVDPSR
                     NQISSINFNTFLFGGGQPAVDLSLLNPSRSQVLRLWQVYLTNVNLMFKILHVPTIQSL
                     LFAAINDMKNIPHDLNALFFSIYFSVISSLDPESVVRILNQDRPSALRRFQKGIEISL
                     AQASFLELPTVTSLQAFVMFLMAMRVHNKCRLSWTLASLATRLAQSIGLHRDGKNFNL
                     SLLETETRRRLWWQIVNNENRAVEDHGIAVGLSCGFSDTEYPLHINDTDISASSTTPP
                     PPRKELCDMTTFLIATTTSKGFRNYLQPIIYGHRRNAADELYTKQMMESLINKVEKNY
                     MPLCDYNIPTQRSAYLLARVLLAKLEFLENQHSLALDAAEDTGPHHIDQRSVALARKV
                     LDPSNLILQDELLVHFHWNFLSYTQYSVLIYLLWNLCVNPTIADADSIWNEVNLHFGL
                     IESKKSIVDLGPKWPLMVRLREKALSIKEQHIAKTEACKEAQKQNSTLPTQLPAGQSH
                     LQSGSFTREAEFLGYINWDISSPSTSDWANFTLNLDKLSYEVGI"
     gene            <1628171..>1630297
                     /locus_tag="TRUGW13939_10912"
                     /db_xref="GeneID:55998391"
     mRNA            <1628171..>1630297
                     /locus_tag="TRUGW13939_10912"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494022.1"
                     /db_xref="GeneID:55998391"
     CDS             1628171..1630297
                     /locus_tag="TRUGW13939_10912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349915.1"
                     /db_xref="GeneID:55998391"
                     /translation="MPPPPAPPTAPNVASKPAFKRQKVRKGTFSCWECKARKVKCDLR
                     PGSGSVCSSCHRRGVQCVSQEFVEVGEKNYQHVGRRIDHIEDLVSQLVQQRFSASSAS
                     QKTSKNWEGSLVDAVETLDRSKGSFSPSVSTTGQQMLNECCSLSAYLHSLLPSQLVTM
                     IILRECKFFQLPFHLVRHKHEKLRSLKPTTERLHQVSKPPPPTAPPNVFAHRLIQIAI
                     CLQELDKIESQQLQSCLNGSAVDAASRFFNLASRHVTSKDELMESLEGLETLLLEAGF
                     YINIGKPRAAWSTIRRALGIAEIIGLHSLRKTMGSRAENVWFRLHSSDRHVSFMVSLP
                     YNSSDNGFADENVLLGKTPAERLERHHTALVGRIIVRNVHMQRRNTSHENYDDYVETQ
                     SIDYELKHLAKSMPPKWWVEPTLNSSTPDTDIMHNSAVLHAQTQHFYLLVLLHQPYLL
                     KRSYSYPIVSCGVIDQARSFDFTYSKLVALSASREMLSRFLVFRTFHRGPAYRGVDHK
                     GFTSAVTLLLAHLDGHRYDNANALEIHRPQDLGMIFSVMDLFNQDGPRGKKFAETLQR
                     LIEVEADAANGSIYYFVRSETSNDATQNNGLDLEIPYFGTMSVLKSSNTVFRPDRDCL
                     DLSLEYTQDSTPLDNFTSLDSSIQDTIFTMPGMTTSDNLVSTSNLQGINILASPNYSS
                     GFDYTFFSSWVHDDESISTNDCDLRP"
     gene            complement(<1630407..>1631077)
                     /locus_tag="TRUGW13939_10913"
                     /db_xref="GeneID:55998392"
     mRNA            complement(join(<1630407..1630640,1630718..1630945,
                     1630997..>1631077))
                     /locus_tag="TRUGW13939_10913"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494023.1"
                     /db_xref="GeneID:55998392"
     CDS             complement(join(1630407..1630640,1630718..1630945,
                     1630997..1631077))
                     /locus_tag="TRUGW13939_10913"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349916.1"
                     /db_xref="GeneID:55998392"
                     /translation="MAEKSELIPVNDIVDDDERLIEKVREKVSMDVVLDKNWSIGGNL
                     EEVDASIPALLIKKNGEWGAVRVDTSPVLNEVTGPTIASGFSLLVIKPGETCRFYREP
                     SNSSSSDGEICGMGRPSWVTFWARSRASSVGLRDDRMVFIRSNMTLLINVQASDHWLQ
                     QLARAAKCPPILSLSVSAVA"
     gene            complement(<1632670..>1633953)
                     /locus_tag="TRUGW13939_10914"
                     /db_xref="GeneID:55998393"
     mRNA            complement(<1632670..>1633953)
                     /locus_tag="TRUGW13939_10914"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494024.1"
                     /db_xref="GeneID:55998393"
     CDS             complement(1632670..1633953)
                     /locus_tag="TRUGW13939_10914"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349917.1"
                     /db_xref="GeneID:55998393"
                     /translation="MPSPSVDPKIAIIGAGLSGLTLALALHQRGLTNITIYEGRNESL
                     DIGGAIMLSPNALKVLDALDIYARLRPLGFEFESLDFRQSDNTPVDTFEFGSFIKYGY
                     KALRVYRYEIIDILHELVREKEGITIEYGKKFARVISEERGVTWEFSDGSEASASFLV
                     GADGIHSQVRKHIYPDLEPRFTGAIGVTAAVPTAQLNLPTNYSTPVTIMNREHGAFVI
                     SQQLRDGSECLIGKQRRFQTDLSKQGWVEMLENKDWCIDFLREGAENFPDLVKNAVSD
                     IPKDKINLWPFYVVPKLDTWVSRGSRVVILGDAAHAIPPTAGQGVNQAFEDVYTFAGV
                     VAALSKKGELHQTVLAEGLRNWQAGRQVRIDKVLELNGMIDKRRMPKAVSEGKEEEEI
                     GEFELTWLYDVDLEQMVVQWAAPKVKSWNPCSLFR"
     gene            complement(<1634612..>1636516)
                     /locus_tag="TRUGW13939_10915"
                     /db_xref="GeneID:55998394"
     mRNA            complement(join(<1634612..1635370,1635423..1635557,
                     1635606..1635968,1636021..1636314,1636406..>1636516))
                     /locus_tag="TRUGW13939_10915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494025.1"
                     /db_xref="GeneID:55998394"
     CDS             complement(join(1634612..1635370,1635423..1635557,
                     1635606..1635968,1636021..1636314,1636406..1636516))
                     /locus_tag="TRUGW13939_10915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349918.1"
                     /db_xref="GeneID:55998394"
                     /translation="MDESDSPQNETAPHLQPPSRKFRRTLSCLSCQKRKVKCDRVKPC
                     RACCTRGAPSECEFGVTKKDRHFMDQSDLIEQLQTKVRDLEQRLIKHPGTTPTAATTP
                     PLTEGSPDDNYDAPAEDEEPPEDEKKPVHSIAATRRPTLKDLLASSPSPGKLLMEVFV
                     GELINGFSPDPSNTHGRVFDLRSASERRIFSPLLTSGFSAAALTFVGQRDEHPKITAA
                     GNSQYNRLLRLLQWAVNNPEKSKSSEVLTVVVLLTIIEAFKQTSPGAVMKHQLGGLEL
                     LRIRTPYRHRSGFERSLFVDLRMFWVTSAIASRKKTFLANDDWKTVPWSGDGRQKDIL
                     HLLLDIAVDIPGFLGSYDALKFAVRHKTLSQDQVLSKQQRVQAAATELDHRLELWHSL
                     YAIDYEHGYMTEAPADSITGDEEFPHFQCCDLFTNETFVPTNFIYPDLMLAVSMCLYR
                     ALRLVVSGSSDDGLVAVLRPSERYQIAVDICRSMRYYLHTVPGFLVSRIMFVLRVAFD
                     TFTDGMVEKRFVQELFWYIGNKYRFPVFMNHCSESATAVRADDSA"
     gene            complement(<1638876..>1640699)
                     /locus_tag="TRUGW13939_10916"
                     /db_xref="GeneID:55998395"
     mRNA            complement(join(<1638876..1639319,1639375..1639758,
                     1639818..1640559,1640641..>1640699))
                     /locus_tag="TRUGW13939_10916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494026.1"
                     /db_xref="GeneID:55998395"
     CDS             complement(join(1638876..1639319,1639375..1639758,
                     1639818..1640559,1640641..1640699))
                     /locus_tag="TRUGW13939_10916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349919.1"
                     /db_xref="GeneID:55998395"
                     /translation="MDHSIDIELHEATMTQKACKKTTIQYETVEHIPTAPPTPKKKMA
                     HNNKGKGKAREEPEELIELEVRSHQLPGPAGSLSIRPSPRDQNTYENSTNMPITEITQ
                     TKSVRWASDDGEGSSGTGDGRKDYRDEEFLQEDMYGGIRRLLIDQTQPMVHNQLFTVK
                     MPYYDEVNDFRSTLDMLSNAGGHYYVRHWQHGFKAKLPLQKGFATKASMAAENEYLKR
                     NRLAKTKEQLWTEAAKREKMERESGLGFFESLNPALWRSHGKVLKVGEEPPEPSCKIQ
                     VETKCGDIVYRWYVKCHREKPFFRQVQNVTICGGDDDQCDEHSSWKHGDPPLKHKSSL
                     MQWVEVDPEEIEPRGKRQVPMNPNHCEEDIEEDKSQSAPQDCFPVWMLSWLEKGPPED
                     NISNCMKVTVMTKCGLVKARLLIICDQHMRCQEHCAGEREHLVIHDYACSLGKDKNRC
                     EVRTWCDSYIQYWKDLQQDSALMPEERKQIANLITLVTKEYTNEKEQRPFFRHSQSVP
                     VIKGKWVGWINNTLGYYEMLSQHGLKAINPLVRI"
     gene            <1642528..>1643058
                     /locus_tag="TRUGW13939_10917"
                     /db_xref="GeneID:55998396"
     mRNA            join(<1642528..1642585,1642637..>1643058)
                     /locus_tag="TRUGW13939_10917"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494027.1"
                     /db_xref="GeneID:55998396"
     CDS             join(1642528..1642585,1642637..1643058)
                     /locus_tag="TRUGW13939_10917"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349920.1"
                     /db_xref="GeneID:55998396"
                     /translation="MGLSFIKLLALGFVPFATAYDPREIFQVTVQSGDPQIDSLWFQK
                     GVQKNGLINLSFGDNNAAFVLDGNHLTLLNDDLSEFATGFIDNDDNGILKFGNSTKFP
                     PTNFYGYKEDLFAEDSSLLWFSCQIQDPPQITVVLATAAHSGCQQLGEVSFQYQPTG"
     gene            <1643951..>1644737
                     /locus_tag="TRUGW13939_10918"
                     /db_xref="GeneID:55998397"
     mRNA            join(<1643951..1644122,1644175..>1644737)
                     /locus_tag="TRUGW13939_10918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494028.1"
                     /db_xref="GeneID:55998397"
     CDS             join(1643951..1644122,1644175..1644737)
                     /locus_tag="TRUGW13939_10918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349921.1"
                     /db_xref="GeneID:55998397"
                     /translation="MRLILALAALTGAFAASANTVPPELAVIGEPSIVLNATYSVGST
                     SVSFKPGEFLNATTAQDAPQPQLHDSGLNSSASYLLLMVDPDWNATSPPSVIVHTVVT
                     NLTTSANSTSEAKVIASYIAPAPSSGTHNYTLFLFDQPSNFSIPSDYESYMETTARTP
                     YNRINLPLEKFIKQAGLGTPVAANYFRVTAASNSSGTSTTTGTPSGTATSTAATGTNT
                     SSAAAVRGNFYLATVLALFGAAVAIV"
     gene            <1645012..>1645871
                     /locus_tag="TRUGW13939_10919"
                     /db_xref="GeneID:55998398"
     mRNA            join(<1645012..1645245,1645311..1645502,1645657..1645707,
                     1645776..>1645871)
                     /locus_tag="TRUGW13939_10919"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494029.1"
                     /db_xref="GeneID:55998398"
     CDS             join(1645012..1645245,1645311..1645502,1645657..1645707,
                     1645776..1645871)
                     /locus_tag="TRUGW13939_10919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349922.1"
                     /db_xref="GeneID:55998398"
                     /translation="MASSRIDSLATTIAESAQELRTLLAQHGMAEPSFSADCPASTVL
                     PPAVDEARNVLLRTACEIQDLLLDPANLLRSYAVHANLVLLHFIQQFNIGQLVPVAGE
                     TKTITFAALAEQCGLPDADVHRLVRHAMAMRVFEQVGDNETIESLKRFPSSSDPSQSG
                     FALANNSLTLYDALAQSPARAATFAASKRG"
     gene            <1646674..>1647600
                     /locus_tag="TRUGW13939_10920"
                     /db_xref="GeneID:55998399"
     mRNA            join(<1646674..1646799,1646869..>1647600)
                     /locus_tag="TRUGW13939_10920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494030.1"
                     /db_xref="GeneID:55998399"
     CDS             join(1646674..1646799,1646869..1647600)
                     /locus_tag="TRUGW13939_10920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349923.1"
                     /db_xref="GeneID:55998399"
                     /translation="MATTTPGWYQPSVTSIDPAARSLLEEYSGLSPDEVLPHVVALRD
                     KAFQIFPYPCIGQMRFLTCHLARLPFYSRVLARLTLSEHAGFLDAGCCVGQELRHLVH
                     CAKIPARNLYGFDLEAGFFDLGYELFRDDATKFQASLIPADLGVEGPEWEVSPLVKTV
                     VGKIDVVWAGSLLHFWNYEGQLQGLLRLINLCSRNEGVMVCGRQMGSVLAGEYEMTGL
                     LDKKTYRHNVESLKGLWLDVQQRTKSRWQVEAALEVGETTANMQGMSFVDSNARVIWW
                     CATRLSSSL"
     gene            <1647802..>1648817
                     /locus_tag="TRUGW13939_10921"
                     /db_xref="GeneID:55998400"
     mRNA            join(<1647802..1648035,1648148..1648444,1648551..>1648817)
                     /locus_tag="TRUGW13939_10921"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494031.1"
                     /db_xref="GeneID:55998400"
     CDS             join(1647802..1648035,1648148..1648444,1648551..1648817)
                     /locus_tag="TRUGW13939_10921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349924.1"
                     /db_xref="GeneID:55998400"
                     /translation="MSEDTVALEPGMARKALLSERVRRPEFEQDPPAWNLSCLLRLLR
                     VRSHRTPDDSGTDTQPETIQSSTLYSRWLRIDRVMRVLRDTDGKEAAVNEEDMLQLHG
                     PAMFNKYYDGDPEATADGWFITGDSAYLDEQPALHHWAHHGHAARLQAHRQAQRQPPT
                     SDMEQTRKLLAPRSGFWVCRAHARNEGEAGRGGVECQLVVLGEADQQRFQVLGLERVE
                     LTHVTDVTHGSCKAAGAFMPSGQMNCVVDVFWRRAVVDGNGSEGGMA"
     gene            complement(<1650558..>1651218)
                     /locus_tag="TRUGW13939_10922"
                     /db_xref="GeneID:55998401"
     mRNA            complement(join(<1650558..1650997,1651068..>1651218))
                     /locus_tag="TRUGW13939_10922"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494032.1"
                     /db_xref="GeneID:55998401"
     CDS             complement(join(1650558..1650997,1651068..1651218))
                     /locus_tag="TRUGW13939_10922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349925.1"
                     /db_xref="GeneID:55998401"
                     /translation="MLRIVLLFLFFFHQVLAQTPPEFEPSTKERLGVSFGHNGRVHPG
                     AKIPKYEANHKPRLDLKSVAEIPPFGRHRARYLVLMIDLDVPRNDTTVPLLHWYQPDF
                     IIKDKKTRALSVQHFSKREKAKYIAPSPPPGDSAHRYVQILFEQPDRYIFPPEFDKYL
                     GKNPEARMGFEIKGFIRAAGLGEPVAGSWFLVQTLK"
     gene            complement(<1651909..>1654252)
                     /locus_tag="TRUGW13939_10923"
                     /db_xref="GeneID:55998402"
     mRNA            complement(join(<1651909..1651981,1652031..1652173,
                     1652240..1652773,1652834..1653140,1653190..1653930,
                     1653986..1653992,1654048..>1654252))
                     /locus_tag="TRUGW13939_10923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494033.1"
                     /db_xref="GeneID:55998402"
     CDS             complement(join(1651909..1651981,1652031..1652173,
                     1652240..1652773,1652834..1653140,1653190..1653930,
                     1653986..1653992,1654048..1654252))
                     /locus_tag="TRUGW13939_10923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349926.1"
                     /db_xref="GeneID:55998402"
                     /translation="MVVVHIAVLSALAALSNAAPSQPKHVVHEMREKPSADWIKSARI
                     EPSAILPVRIGLSQTNLEKGEEFLMDISNPESANYGKYWASDDVHDMFAPPEKHVDAV
                     REWLTTAGIEGHRVVRSDNKGWLAFDATTEEVERLLQAEYHEHEHAQSDKIRVGCDKY
                     HVPEHLAAHIDYITPGVKLTQVVKHKTHDYTKRASHAEAVRTSKYIEANLELPEGWAA
                     PQGLAADVQTCSFNMTPTCIKELYGIPKTLKNPHKDNSLGLYEQGDYFSKSDLDLYWK
                     NVNPAVPEGTYPTPALIDGANFSVPSYSSLNQGESNIDIEMAFSLIYPQTVTLYQVDD
                     QVYEPEEIATTNLFNTFLDALDGSYCTYAAYGEKGDDLSIDPIYPNPAAGGYKGKLQC
                     GVYKPTNVISASYGQAEADLPLKYTQRQCNEFLKLGLQGHSILFASGDYGVASFANDG
                     AENGCLGPEGKIFNPQYPSNCPYVTSVGGTMLYNGQSVQDTESVMHVDLGGTAANFSS
                     SGGFSNYFLRPWYQEFAVEKYFATADLSYPYYAELSVDVNTTSGLFNSIGRAYPDISA
                     NGAYFSSFLDGKFVHFFGASLASPLFASVLTLLNEERLSIGKGPIGFVNPVLYANPHV
                     LNDITNGTNVGCGSEGFSAIEGWDPATGLGTPNYPKMKELFLALP"
     gene            complement(<1655066..>1656390)
                     /locus_tag="TRUGW13939_10924"
                     /db_xref="GeneID:55998403"
     mRNA            complement(join(<1655066..1656259,1656319..>1656390))
                     /locus_tag="TRUGW13939_10924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494034.1"
                     /db_xref="GeneID:55998403"
     CDS             complement(join(1655066..1656259,1656319..1656390))
                     /locus_tag="TRUGW13939_10924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349927.1"
                     /db_xref="GeneID:55998403"
                     /translation="MGNSRRFHTKTRNGCTNCKKRRVKCNLQAPQCHHCKRRGEDCSF
                     QFKNDEENDDEECQDSDGKVAGESDSLSLAQNERGSSRRKSSELRWMEPSVWPALDIQ
                     QSELRWQYQQSTGSTLALLKEDPRRVQLIWKGEVPMQSEHNSWIDHCTMAISALHICY
                     LNPPNPKDYYTAAFKNYRSAVVAFPKAVQEMNPENCVTILSFSLMVLMFQLGISCVPG
                     AAPMTNGLPVADAYNAISALRGTWSLIDQLGPHLQQSKLKELFTHRKHLRFEALDENH
                     EIALSHLRQLNETSGFGVRREEDRQKCAQAITVLRFWYSILAAQLPTTWLLVLWWPAG
                     VAPEFLTLLRSKDPMALVIFCHWCAGMYRIPSPWFLDGWAKRMLSAMLNLLDADWLSA
                     VQWPIDEVFHSQGDQLAIESNVQTIEAST"
     gene            complement(<1657525..>1658207)
                     /locus_tag="TRUGW13939_10925"
                     /db_xref="GeneID:55998404"
     mRNA            complement(join(<1657525..1657609,1657675..1657897,
                     1657988..>1658207))
                     /locus_tag="TRUGW13939_10925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494035.1"
                     /db_xref="GeneID:55998404"
     CDS             complement(join(1657525..1657609,1657675..1657897,
                     1657988..1658207))
                     /locus_tag="TRUGW13939_10925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349928.1"
                     /db_xref="GeneID:55998404"
                     /translation="MKLLLTTALSLALFGSASLADPTVYLIRHGEKPDDGDPGLSSVG
                     AQRAQCLRSVFGASSQYNIGYILAQAYKSDGSRDRPYETVEPLAEDLGLTVDTSCDRD
                     DPKCVKDAVKDYDGEGNILICWEHKALTDIVDKLGYDDAPDYPDDSYNIIWTDPSPYD
                     NITAQTSENCAGLDN"
     gene            <1659184..>1661552
                     /locus_tag="TRUGW13939_10926"
                     /db_xref="GeneID:55998405"
     mRNA            join(<1659184..1659362,1659414..1659531,1659583..1660362,
                     1660418..1660549,1660602..1660722,1660771..>1661552)
                     /locus_tag="TRUGW13939_10926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494036.1"
                     /db_xref="GeneID:55998405"
     CDS             join(1659184..1659362,1659414..1659531,1659583..1660362,
                     1660418..1660549,1660602..1660722,1660771..1661552)
                     /locus_tag="TRUGW13939_10926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349929.1"
                     /db_xref="GeneID:55998405"
                     /translation="MDDSIHKLSQSLISDDLIIHPMGTTSLRNHILNKHSQDSAAQLT
                     RATANVKRTLTRANLAFGLLASLWAGFDAVLALNLNISTSGGNASSPILYGLLFEDVY
                     HSGDGGLYAEMIQNRAFQGTTINLDSNSHVIPPFQTLEYWHTRGSDTLNLDSEGPALS
                     DALPSHMRVDVDSGASGATGFWNEGFWGMNITTATRYAANFYLRGNYDGEILCAFWSN
                     TTNSMLGNTTFTVSQTEDDGWKLYQQTFTPFASAPDEKNTFHLTFDGASVAGNSLRFN
                     MISVFQQTWKDGNNGLRMDLAESLAAIGGKYLRMPGGNDLEGQSAPYRLKWNETIGAI
                     IDRPGFPGTWGYYNTNGLGLLEMMQWCVDMGLETILGVWDGYYLDHEVVAEADLQPYI
                     DDVLNELEFLLGPANSTYGSLRSSLGYPDPFTIKYVEIGNEDFFDTTNSYIDYRFWDF
                     YNAIKAAYPDMIMISSVWSGYFADPVLPNGTVQDIHDYLSASDMVSKFNAYDNSDRNY
                     PVLVGEYAAIYDDQHTNPNQLDNPTLQSATSEAIYLLGLERNSDVVVGCSHGALIKSL
                     HDEPDNVAMIKHSPTELVFSISYYVAKLLSSHTGSETVPVTSDTAYGPLYWSVTKNDS
                     ETYFVKIVNYDGAASTPVTVTIPGKKNDATLITVTAPGTYSTNTLGNTTSVWTETTVP
                     YSEIGYTFSLSGNYVSSVLVV"
     gene            complement(<1662953..>1663451)
                     /locus_tag="TRUGW13939_10927"
                     /db_xref="GeneID:55998406"
     mRNA            complement(join(<1662953..1663191,1663259..>1663451))
                     /locus_tag="TRUGW13939_10927"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494037.1"
                     /db_xref="GeneID:55998406"
     CDS             complement(join(1662953..1663191,1663259..1663451))
                     /locus_tag="TRUGW13939_10927"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349930.1"
                     /db_xref="GeneID:55998406"
                     /translation="MSRDTLLDDEKVLRAEDISTRRFNDRGNLRPALRLDENKYPAIL
                     GGSVIRTVLIEQGVSRKVTLSAIDAVLSERASNAFLAQRGFATGLAECVYKNRAQGNT
                     VFPGPMATTVQAIIGAVFKDSSENFTAVEGVMKALGISWPE"
     gene            <1666734..>1668790
                     /locus_tag="TRUGW13939_10928"
                     /db_xref="GeneID:55998407"
     mRNA            join(<1666734..1667012,1667129..>1668790)
                     /locus_tag="TRUGW13939_10928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494038.1"
                     /db_xref="GeneID:55998407"
     CDS             join(1666734..1667012,1667129..1668790)
                     /locus_tag="TRUGW13939_10928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349931.1"
                     /db_xref="GeneID:55998407"
                     /translation="MAVSTADDALFTRAVSGYRDVFWSKHKHLSEAERKRLWTRRLSQ
                     FITDNTLTSDGKMTTPTDSGPSDILGKRTRQDTPRTIPGISTPAKRRATTPESNPAVK
                     QTGPSVPLDPSTMTNSSFMMRRQSTSNQKAGHETYQLSARPASMVRSQSQQIPSRRQR
                     IPGDPEARRQSSGPISYIHNLNVNEYSPSEYAQQCLGDVPGQGTSDFTLSIPSDIDMS
                     MGTHENLVMQQHQLPQEQMQQTSPFAGLTSDQLTVATLQATEMSRSTTAESLCGGLGM
                     VRFDSKESNPEQLSDFSFSSDFLHLTSSKDVGFPSVSSIGHMDHVPISSSSSSSCSSA
                     PDPVSFPTSLSPSSAAQEMKVSFSAESNASDFSITQQSRTVRRTSEQVVQGARPIAPK
                     VSSNTDSMPNGTANGQHRMIRISSEDGTSKEVAAIPKASFQRPPRPKTYCHLCTDQPE
                     GFHGEHELRRHIERVHAMVRKVWVCVDISPDKAFLANCKACRNGKRYGANYNAAAHLR
                     RTHFNPCQRGRGGRGKDSEKRGGKGGGNLPPMEVLKHWMEQKEEVVLDNVQYLLGEEI
                     PSADMTSSVVAPTVVQPETSPEMSSEYDTMPLKWDTALGDGFEMVADSLPGMSLAPSL
                     DSHYYLSQPLTVDDPYLVQTAV"
     gene            <1669889..>1670440
                     /locus_tag="TRUGW13939_10929"
                     /db_xref="GeneID:55998408"
     mRNA            join(<1669889..1670043,1670100..1670278,1670334..>1670440)
                     /locus_tag="TRUGW13939_10929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494039.1"
                     /db_xref="GeneID:55998408"
     CDS             join(1669889..1670043,1670100..1670278,1670334..1670440)
                     /locus_tag="TRUGW13939_10929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349932.1"
                     /db_xref="GeneID:55998408"
                     /translation="MSNLSYYDRQQQPHQQQYGGPPDPGYGPGPGYAPGPGYAPGPGY
                     PPQQPPQAYQQGYAPPQQPGYQQVSFGPVDNRAHSLKSDADFTIISPLHNNTRNSSVA
                     ARTEGVSVLVSPPCAAASSARKAASAALNASSAVKAARRGIRVG"
     gene            complement(<1671224..>1674517)
                     /locus_tag="TRUGW13939_10930"
                     /db_xref="GeneID:55998409"
     mRNA            complement(<1671224..>1674517)
                     /locus_tag="TRUGW13939_10930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494040.1"
                     /db_xref="GeneID:55998409"
     CDS             complement(1671224..1674517)
                     /locus_tag="TRUGW13939_10930"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349933.1"
                     /db_xref="GeneID:55998409"
                     /translation="MVSLTHSHYTIAWICALPLEAAAARVMLDKTHTLLPKPSTDSNA
                     YELGELNGHYIVIACLPAGVYGKVSAATVVSRMRLTFPRLQYGLMVGIGGGVPGKNND
                     IRLGDVVVSKPAGKHSGVIQYDYGKAVQGSQFESIGTLNRPPQTLLTHIGQLEAKQMT
                     EGQSKMVREALEQNPNIEERFSPPEQHTDFLFHSSYHHVAGEDGCERCDKEQLIKRQP
                     RDAMAPYIHYGLIASGDQVMKDSETRDRLAQRHGILCFEMEAAGLMNELPTLVIRGIC
                     DYCDSHKQKQWQGYAALTAATYAKSLLMAIPSQTNIDLMKSKQMRHWMVSLARNPRFI
                     GRQDEITKLEELITMQDGPRRMAITGLGGVGKTQVALELAYRIRDREPECSVFWIPCI
                     SHAMIEQMFLHLSQILGLPDVSPAGAKEQVKIYLSSKQAGKWLLILDNADDTEMWFET
                     SHTTSPLDDILPTSEKGRILFTTRNRKLAMKLAPFNVISIPDADEKTAVNILERTLAD
                     KGLLQDPLASRALLKQLAFLPLAISQASAYIIENNISLSTYLALLQEQEQDAVELLSE
                     DFRDPARYKDTQSSVITTWLISFKQIQNQDQLAADHLSFMACINPRNIPQSLLIKPTS
                     KKQGIDALGLLNAYSFTNSQDMGINMHRLVHISTRNWLRKNELFSHWIQRVADHMQNV
                     FPDNKHANRELWREYLPHALVLVHESEFTVHEHNYLGLIEKVADCLVSDGRHQEAEIL
                     YQKLIRINQEKSGSEHPSTLFCMTNLASTYRNQGRWNEAMKLQMQVMETQKTVLGVEH
                     TDTLISTNNLALVYMYQYEWNKAEKLLVQVVESMKIVLGAKHSDTLISMGNLASAYTS
                     QGRLNEAEKLFVQTLEIQKTVRGAEHPDTLISMAKLALVYMNQGRYNESEKLLVQAIE
                     TQNTVLGGKHPVTLISMVHLASTYMSQGRWNESEKLLVQAMEIQKIILGAEHPDTLSS
                     MEKLALTYMNQSRWNESEKLLVQAIEAQNIVLGADHPSILVCRGHLASTYAHQGQLNE
                     AEKLQVQVVESTKAVWGDEHPSTLRSMDILTNIRNSQGMPLIAKRSDLRNKLSLYRKF
                     RQHLGSYGN"
     gene            <1675691..>1675990
                     /locus_tag="TRUGW13939_10931"
                     /db_xref="GeneID:55998410"
     mRNA            <1675691..>1675990
                     /locus_tag="TRUGW13939_10931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494041.1"
                     /db_xref="GeneID:55998410"
     CDS             1675691..1675990
                     /locus_tag="TRUGW13939_10931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349934.1"
                     /db_xref="GeneID:55998410"
                     /translation="MKSPHPGDFNQPSEAVFRNVERQSPSSKSRDDPHTQNQDERGRA
                     RLAHEQGGRPRRRPTASRSRSRSSGSASKRLANSRPRSKMRASSMGKPEYRYAYY"
     gene            <1676925..>1678268
                     /locus_tag="TRUGW13939_10932"
                     /db_xref="GeneID:55998411"
     mRNA            join(<1676925..1677140,1677207..>1678268)
                     /locus_tag="TRUGW13939_10932"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494042.1"
                     /db_xref="GeneID:55998411"
     CDS             join(1676925..1677140,1677207..1678268)
                     /locus_tag="TRUGW13939_10932"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349935.1"
                     /db_xref="GeneID:55998411"
                     /translation="MADNTLYLYTSLTAGSSHIITATSRLETILKANKIPFRAIDVAT
                     DDAARRLWGRYSKGRKLPGLVKYRTIIGDLEQIEEWNEFGELKMEIGAVNDPDGLSSE
                     TKPAAPFVETPKRAPVPPAAPKSGSPHIQIQNPPVTETKEDQRTLTLRLAGEEAAARA
                     KQNALQKLGTKLPTTEGDGKAAPTTEPSAKGTESAESTTEKADSASEAKPTSASQDEK
                     TEDSTSPPSGGRRTSVAPEIVPPLKRPSLADETAAVSTANFRAENADVLGLIDHHRSS
                     IVSVTNKDEQDQVRKEIRESVTEAPKDGDLQALRKEDAAKKQRDAIDEDEEEEETTDS
                     GESDTETSEAAKKKTEKKAESPVAAAKEGKKEEKDKEEKEKEEDEEDEEDEEDEEDEE
                     EEEEEEEEEEEEEKAPQKQDPKDASKAGVSVEY"
     gene            complement(<1678695..>1679833)
                     /locus_tag="TRUGW13939_10933"
                     /db_xref="GeneID:55998412"
     mRNA            complement(join(<1678695..1678955,1679023..1679274,
                     1679591..>1679833))
                     /locus_tag="TRUGW13939_10933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494043.1"
                     /db_xref="GeneID:55998412"
     CDS             complement(join(1678695..1678955,1679023..1679274,
                     1679591..1679833))
                     /locus_tag="TRUGW13939_10933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349936.1"
                     /db_xref="GeneID:55998412"
                     /translation="MSPPAIIAPSILSADFGKLGAECADTIGRGADWLHVDIMDGHFV
                     PNMTFGAPVVTKIRSHVAKPSTPGERGTFDCHMMIAEPQKWVAEFKAAGCDLYCFHYE
                     AAISSTAAKEPADAQTTRNTSPRELIRYIHEQGMKAGIAIKPDTSVDVLWDILENKEE
                     AERPDMVLVMTVHPGFGGQKFMASELPKVTALRKKYPNLNIEVDGGLGLGTIDQAADA
                     GANVIVAGSAVFGAQDPREIISKLREAVESRRH"
     gene            complement(<1680293..>1680871)
                     /locus_tag="TRUGW13939_10934"
                     /db_xref="GeneID:55998413"
     mRNA            complement(<1680293..>1680871)
                     /locus_tag="TRUGW13939_10934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494044.1"
                     /db_xref="GeneID:55998413"
     CDS             complement(1680293..1680871)
                     /locus_tag="TRUGW13939_10934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349937.1"
                     /db_xref="GeneID:55998413"
                     /translation="MQLASRRTLDIATPLHAAGSGKGPGLLKSAKFEPDSLYLLLSDI
                     GDSLQFHWGLYLAITASIGHIFHFICGPRTGFQWAFQTKKMRENAIPYSVTLLTGVKI
                     ADMDKCLQVPLANRLANIHNSEYLRSLPAERISCLEWIREALITLDQEGYIKMVGDVW
                     ELETEAWMQAAENKMCKRRTIINSQFCDLIGR"
     gene            <1682364..>1685249
                     /locus_tag="TRUGW13939_10935"
                     /db_xref="GeneID:55998414"
     mRNA            <1682364..>1685249
                     /locus_tag="TRUGW13939_10935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494045.1"
                     /db_xref="GeneID:55998414"
     CDS             1682364..1685249
                     /locus_tag="TRUGW13939_10935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349938.1"
                     /db_xref="GeneID:55998414"
                     /translation="MADYNRQAATLCSPLRLARKPTLNTIIEANEPSPDGQVRKNEIG
                     VRESLHSIKIAMAFSPETAKRLSTPISSHSTSSSCSDEEWQQGLESFDDLYDATDDES
                     CPSLTESRPSSLVSSSIRSSTYSTNSRNRYPTITIPVAALWPSLHNPHKSSPVPPTPP
                     PKIPVSPAALSMLPGHVPALHAPPSLDGSLSSDQISNLSAPATPDLRALPDADWDNGV
                     IRVCNGSDVPSSAGGSSTGLAAEEERAIEAPSEDWNPLLSRFPDIPSRSEEATVPQPL
                     TEGTVRSPSPDIDGVVLPPDALATLQHIPLGSSPEPWSETSETNDEMWQFSTTVPRPQ
                     RQEEATPDSELSGYSFTDLSIPSPGGFFSSLDPKSRHTWSLPSAMNPPTSAVAARFYD
                     LPWARDEGQIVEQVVEVPEEGFTDDQPTAVPVTAVRISNSNHGRSTSFDSKSPVQELD
                     RTGVVYEYDDAYDEELKRQAVSNLDRTSVWLAAQQAYLSALNESNPVNEANKEIVTLD
                     IEKRPASSSADSPPRKSVRFSEVVQQSTVSSTPPEPASMDSIYWRGFQFILRQYCRRD
                     TFLHSNMRFDAVQSVRLGLRDKHLDALTGKFELVKPERPEYKGPFSQAPRKSVAAGIL
                     ADQALFCKLEKEQTVLAQLWQSVWAIDAMRFLNGGSLLSSPAGRRLTKATVPLRNPGN
                     AGKRRLRVLDLGGQATCGWAWHLANDCPNVKVYTVVRKDQEVNSHIKGPANHRRVSVP
                     CLWRLPFRDNQFDVISARSLHALLKAQCPDGEEMDEFDLCLRECYRCLKPGGYLEFFV
                     IDSEIARAGSHGSAASVEFAFNLKTRGYDPAPTRTFLTRLKKYDFADMRRAWMFLPMG
                     VDPVPAEPVRETPNPRVKSQIDCEAVQGPVGSTVDIASMTGLLGGWMWEQWLLRLQIE
                     MGREHKDLLKGVGTVFDEGRKNSSGWTSLCGWAMKPKRRASAQPSQL"
     gene            <1685803..>1686249
                     /locus_tag="TRUGW13939_10936"
                     /db_xref="GeneID:55998415"
     mRNA            join(<1685803..1685816,1685897..1686147,1686218..>1686249)
                     /locus_tag="TRUGW13939_10936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494046.1"
                     /db_xref="GeneID:55998415"
     CDS             join(1685803..1685816,1685897..1686147,1686218..1686249)
                     /locus_tag="TRUGW13939_10936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349939.1"
                     /db_xref="GeneID:55998415"
                     /translation="MLFFSFFKTLTNHVVTVELKNDIRIRGTLKSVDQYLNIKLDDVD
                     VLDLDKYPHLSSVKNMFIRGSVVRYVVLPQAEVDRGLLEDATRREAANQASKAR"
     gene            <1687004..>1688968
                     /locus_tag="TRUGW13939_10937"
                     /db_xref="GeneID:55998416"
     mRNA            join(<1687004..1687273,1687460..1687795,1687868..>1688968)
                     /locus_tag="TRUGW13939_10937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494047.1"
                     /db_xref="GeneID:55998416"
     CDS             join(1687004..1687273,1687460..1687795,1687868..1688968)
                     /locus_tag="TRUGW13939_10937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349940.1"
                     /db_xref="GeneID:55998416"
                     /translation="MSPIIQTHNPKESYPKVTYSHVVTVDAPAKLVYTAGQVGRDSTG
                     YIPASYEEQVKLAYQNLGHCLAAVNASPKDIVKLTYYIVNYDPNRRDVDVIVVGGGIS
                     GLQAAYKVQEAGFSSIVLEARNRVGGKLLAVEIPEQVEGRGKKGGIDLGGAWINDSNQ
                     SRAYSLAQRLGLDLIEQATDGDCIVQQSNGAVLRFPYGETPKISSKYQKEVGEIRDNV
                     EDICHSVDDQNAVKYDGMNMEDFVQTQGLGTVALENVTLWTRAMLGCEPSEMSALYFL
                     EYCRLGGGLKQMRSDRKHGGQFLRARQGEKEHNPQSGLLSKIDYFSGMGRLAKGVESM
                     LRPGSVILNSPVSKVAQDSEKVVVTTDSGVQYRCKKLIFSLPTPLYKEVVFEPPLPSE
                     KLNFSSSTHLGYYTKVILIYEKPWWKDHGLCGLTHSFKGPSSLTRDSSSPADNQYSLT
                     CFVVGEPGRKWSTFSRPERHTQILEQVVSIYGPQLSEKAKMPLSILEQDWAQEQFSRG
                     CPCPVTPPGVLSRLGGSLQASFENIHFVGTETARHWKGYIEGALESGDRGAEEVIKLL
                     KD"
     gene            <1690323..>1692578
                     /locus_tag="TRUGW13939_10938"
                     /db_xref="GeneID:55998417"
     mRNA            join(<1690323..1690420,1690496..>1692578)
                     /locus_tag="TRUGW13939_10938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494048.1"
                     /db_xref="GeneID:55998417"
     CDS             join(1690323..1690420,1690496..1692578)
                     /locus_tag="TRUGW13939_10938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349941.1"
                     /db_xref="GeneID:55998417"
                     /translation="MAACDTCYRRKVRCDYETNSPCIACDRAGVACTFLLAERHKERR
                     RARRRSQPIPVQSGHEQRNLAATQKNTRPAVRRYSRRLAHGSEDQSSDTWLAGNISER
                     DLTGEEPVPNERPDRDTQRSSSVPVETCRENEKEDEEGLDKTALAQFHRHSINTSLWR
                     VFDDITNMRIAYIGTPVSNLSKLVEDEIEFTGPQAPSLHFPFPSIRPPLPWKPPQGLT
                     SIQCYSQSFIIDISSLPPEDLTVHLIDTFFKKIHPGFPIVDETQFRSAYGNPNTDNSP
                     PLLLLQAILLAGTHASDHPSVEKSRSLIKRSIFRRAKALFEAHYENDRMHLVQAALLF
                     TWHADGADDVSANAYYWVGVACRIAFGLGMHRNLGENSVSRMPLDDRRIYRRIWWTLV
                     QLDVLVSLHHGRPLMISAEDCDQPPLQIDDFIETGSSERNPNIDVDFCIQNSCLCEIL
                     RSILWLSSPGAAREHKANPSLFESKKSSIDFELSNWYLHLPNRLKDFNGPHATFWPLQ
                     LQMHYNMALLHLHRLPRPTTSSHEDLHTSETSHETCRSSAQSIANILETMVSSKHISQ
                     CWFTCLTSLLASAIQLCFEARSASRIWASTLEIQAQNRLARLLDSAFAISRHWSSAEA
                     IFHLYKNLLKQLAQSTRLNFESQRFMMLPTLDSVALSSSPNTDELALRPSEDPENNLR
                     QHRIQHFEEELTALFGAGQTYGFSSPHESGFEGNSSHLWELPNT"
     gene            <1692910..>1693867
                     /locus_tag="TRUGW13939_10939"
                     /db_xref="GeneID:55998418"
     mRNA            join(<1692910..1693056,1693113..1693555,1693611..1693785,
                     1693841..>1693867)
                     /locus_tag="TRUGW13939_10939"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494049.1"
                     /db_xref="GeneID:55998418"
     CDS             join(1692910..1693056,1693113..1693555,1693611..1693785,
                     1693841..1693867)
                     /locus_tag="TRUGW13939_10939"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349942.1"
                     /db_xref="GeneID:55998418"
                     /translation="MQMEIFNLDGRTALVTGGGRGIGRAMAVGLAEAGADIVLLLVAF
                     DSPNNRDLSQTETKEQIEKLGRKCFTYACNLELKDSVSRVIQEVLSSHEIHILLNAAG
                     IQRRLSAENYDQETYEEVMQVNLGAAFTLCREIGKYWIKNGIKGSLINTASLASFQGG
                     VRMSGYAVSKGGIAMLTKALSNEWATHGIRVNAIAPGYIATDMNVDTRTSPDKTYYKS
                     ITDRIPMGRWGDPEEFKGIVVFLASKASSYITGEIITVDGGWLAR"
     gene            complement(<1694431..>1696302)
                     /locus_tag="TRUGW13939_10940"
                     /db_xref="GeneID:55998419"
     mRNA            complement(join(<1694431..1695522,1695580..1696020,
                     1696090..1696117,1696187..>1696302))
                     /locus_tag="TRUGW13939_10940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494050.1"
                     /db_xref="GeneID:55998419"
     CDS             complement(join(1694431..1695522,1695580..1696020,
                     1696090..1696117,1696187..1696302))
                     /locus_tag="TRUGW13939_10940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349943.1"
                     /db_xref="GeneID:55998419"
                     /translation="MLVPAARNPSTEKSDINAVTDSRKSRSFIGAGIYAARRSPLWGD
                     LSKELPLESTLGQISEPETPYGTSSILWGLSDYRSLRSYHPGSSRILQLWQIFLDNVH
                     PLSKIIHSPSIQRQIIAATLNLDGVSRGLEALMFVIYLSAVNSLKPSECESILGERRD
                     ILHKRYLSATKQAFVNCECLKSCSFIVLQSLTLYLLCMRQYHDHKSSWLLTGLAVRSA
                     QRMGLHKDNMPSRIPSFESEMRLRLWWQILLLDSRAAQLSGLSMDSQTRTYFDSRRPL
                     NVNDSDLYPEMSVLPPDVESHATEMIFCLVIYEGARFTNSQALSECTDEKVMDEFILF
                     LRSKFLRFCEKAIPIHLLTHHVTQSVVAQTSIKGLQARKRNNKLDLTRSDREALLGWN
                     VDVIECMNSIYSTEILQPYLWFLHGTFPFEPFVSVLLELQRSVDGHLIDRGWNAIDGV
                     YNTFVGTDWLPCTHSNDSLYCAVGKLALKAWETQSTRREPMPSWVSQLREKQRGNNNV
                     NAQNEHSHAINADEVTQWSRFVGNDEDIIGDLDIDWAYWTQSLEGKQNFW"
     gene            <1696703..>1697827
                     /locus_tag="TRUGW13939_10941"
                     /db_xref="GeneID:55998420"
     mRNA            join(<1696703..1696876,1696953..1697006,1697071..1697349,
                     1697414..>1697827)
                     /locus_tag="TRUGW13939_10941"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035494051.1"
                     /db_xref="GeneID:55998420"
     CDS             join(1696703..1696876,1696953..1697006,1697071..1697349,
                     1697414..1697827)
                     /locus_tag="TRUGW13939_10941"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035349944.1"
                     /db_xref="GeneID:55998420"
                     /translation="MSKLFVVFGATGQQGGALVNYILNHPDFSKQFRLRGVTRNASSN
                     AAKELNEKGVEVVEADMDQPETLPAAVAGAYGYLVWKKASAAVEIAQGKAVAD