GenomeNet

Database: RefSeq
Entry: NC_050719
LinkDB: NC_050719
Original site: NC_050719 
LOCUS       NC_050719            1813878 bp    DNA     linear   CON 10-NOV-2020
DEFINITION  Zygotorulaspora mrakii chromosome 1, complete sequence.
ACCESSION   NC_050719
VERSION     NC_050719.1
DBLINK      BioProject: PRJNA670754
            BioSample: SAMN14605243
            Assembly: GCF_013402915.1
KEYWORDS    RefSeq.
SOURCE      Zygotorulaspora mrakii
  ORGANISM  Zygotorulaspora mrakii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Zygotorulaspora.
REFERENCE   1  (bases 1 to 1813878)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     The yeast mating-type switching endonuclease HO is a domesticated
            member of an unorthodox homing genetic element family
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1813878)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1813878)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUL-2020) Conway Institute, University College Dublin
            (UCD), Wolfe Lab, Belfield, Dublin Dulin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP058604.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: HGAP v. 3
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100.0x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1813878
                     /organism="Zygotorulaspora mrakii"
                     /mol_type="genomic DNA"
                     /strain="NRRL Y-6702"
                     /isolation_source="silage"
                     /db_xref="taxon:42260"
                     /chromosome="1"
                     /country="Italy"
     gene            <1..>4891
                     /locus_tag="HG535_0A00090"
                     /db_xref="GeneID:59233706"
     mRNA            <1..>4891
                     /locus_tag="HG535_0A00090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285903.1"
                     /db_xref="GeneID:59233706"
     CDS             <1..4891
                     /locus_tag="HG535_0A00090"
                     /codon_start=2
                     /product="uncharacterized protein"
                     /protein_id="XP_037141798.1"
                     /db_xref="GeneID:59233706"
                     /translation="LHRSPTPLPPPPTPLPYTAPLHRSPTPLPYTAPLHRSPPSSIFH
                     LLFLFYFIHPYTLTSLIHFTFFFSLFSFFTLHTLLSHLPPPFHFFFTSISHFTRLHIP
                     SFPLHSLLSLHHHYHLTFTPFPLSFLFSSHHSFPFPISSPSSTIHHISFTLFLDFPFH
                     FSFFPSFTPLHHSPTILLPYSTPLPLSPSLPISSTLFFTFPLSLPHSPTTTHSQTPFL
                     HPLLLHYYTTTQRHFTFSSSLSFFFLLPLLLSSPLHHPSPLTPLTHHFFHLFIPLPSL
                     IHTLSHPLHSSHIHRQTLLHLFTSFYLYHTPRFFFLFPFSLLFLPSAPLLQHSPPSPF
                     IHSYIHTFPFFTSLPSHPLIPLKPHFHSPSLSLNHSLNPQLLSLSTHHFIPLFFFFFL
                     SHFSLSFTLHFHNSSYLHLILFITLTSPHSLLSLSSSLLFNHHTSFSSFHLFFFLFHF
                     YSHFIPHSTQPLSLPTFPHSHTNIQTFHLFHATNHPFPFTHLLNFSTLLHYTLFLFTL
                     FISFIRTSFYLSTPISLHTHSFYSLFSLSLFVFTSTYTIHTTLLIHSSFLFHLFITSF
                     YTSTPFLLLNSRHLLFLLTPFSLSTTSFFFTLSFFHPFFSTLLHYTPHLSYIFTFTFH
                     FFFLFTYTLLYYILPSISLHSITLPYTFPLPNSFHPHFSIILLSFSLFHFFLILLLHL
                     SYQLHSPTPFPYRTHFIFTFLPYYSLPFPFIHSPTPFPYHSHFISTLFISALSSPPSH
                     TFIFTFSLFYHTTLILFLLFHFFPFAFYYSSLLHYTPHQTLFLFHSLQLLSPSIHFNS
                     HSLSIFSSLFIHTHISFLFTPTKLSSPSSSPSSSPSSSPSSSPLFSQPFTLLSHSLSS
                     FLLSHIHSFQLLFILSTLLSFLLPLLSFLYSTPLPSLSFFLYFYYSFLLSTPIHSISL
                     FTSTSNPFHLLIHFFFSFTTFLPLYSTTHSLSYFFSTFFSYLTTNSTGFFSISHTLLF
                     PLSTTHSYSFSLLYHSLTLSYSSPTLPFFHSTTHLFPHHSFHTYITLYPLLSSSPSFL
                     SPLLLKSSSLLEHTFSFHLFLFIPFHSTSYSHSIFFFSSLRPSFFLLHFFPSTQLLIT
                     SFTYLFPLHSFHHSIHPYSTSSLTPFSYFFSPFSLLLFSSFHPTIPFTFSFSLPLHTL
                     SSFNFTSSLFIISTTSHHFFFLLHLFITSLYSTTHPHSLFHSSSPTSLPTSHFLSFSL
                     LYSTTNSSISLYFHSLLQLQNSLILTIFSYFPFFTLSTSHFFPLFSLLFYFIHSHLFC
                     YFPFYVTLLLSSPYFHLTSFFFTSTITQTSTSFHLPLFFKLHIPLPFTFPLSSTFPLS
                     STFLLPSHYSPSLIFYAPTLNRFSFILPSYYSRRFSSTLYHPFSSYPPPLFFSFILHI
                     TPSFHSRSTSHSTSIFYIIFFSSLRSTIPLPLYFPFSFLHFTFTSHISFPLHLSPTAY
                     FHSTLNSFHLFYSITLYDSTSSSSFPHLSYHSLTALISISSAIQLPFTPYLLHLLHFS
                     PHLSYFPLLTHSFSSFLLSTTVYTLHLLHFFFFLFTSTSQLLHNTFPTSFHSYFYFFL
                     HSSLSNSFTLLLYIPPSFFPHLFFHFTTIFYSILLFPPLYSSTPFLSLKPLYYSLLLH
                     STFSFLLTSLFLHHSFSSL"
     gene            complement(<6814..>7779)
                     /locus_tag="HG535_0A00100"
                     /db_xref="GeneID:59233707"
     mRNA            complement(<6814..>7779)
                     /locus_tag="HG535_0A00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285904.1"
                     /db_xref="GeneID:59233707"
     CDS             complement(6814..7779)
                     /locus_tag="HG535_0A00100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141799.1"
                     /db_xref="GeneID:59233707"
                     /translation="MFHFILDNIQNKTTGLYASELRTLLFDSTSADLPRIKDLIYGVP
                     ADHILTAAEMNLPESVCRTCFMSNEYCQCETFGKHMGKIILEALALLRLVPARQNMRH
                     LFNFAQLGRGHNIVQHVLRQKAVWSRLYEEAMESEYTETIEGITCNDDVTSRVLLHWG
                     HFWHAVVRSKANVATLVFEGRLSKPFGIDMEWGNREPYSRYSRMLDKEIFLRSHRRML
                     EVVSGTLWEDGHGRGDCFDLDEFRLLVLLLYCVYEKGDIHNMVSRVLPGYRKFEVFGQ
                     WLGSVMCMRKCGYAQRVPVYRFILGTYVEECGLNKVLIEGEASDM"
     gene            complement(<7839..>11138)
                     /locus_tag="HG535_0A00110"
                     /db_xref="GeneID:59233708"
     mRNA            complement(<7839..>11138)
                     /locus_tag="HG535_0A00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285905.1"
                     /db_xref="GeneID:59233708"
     CDS             complement(7839..11138)
                     /locus_tag="HG535_0A00110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141800.1"
                     /db_xref="GeneID:59233708"
                     /translation="MKRGLKAESWECRKKFWKYSPLNYKYLHSSILELPVGMLDASVD
                     NSLPPQSIKVRDFNFSEEDYEVLREFREMKTAYVVFGQNYLNFAYLKAEHSASNYLNI
                     DMKDGITSMVKKFAPSTINQYGVTLAPYLFLLFNAWRLSCFAEHAFLPHRVIEMLTHD
                     PERQDTIVYKMKALGRCFDNCLRENIYREYLARWVRMCAFNFPAWDRTDVPCPENTVT
                     KARRIMDTIRCLIVFTCFATTENVSETAYWLASRNYLSVINYWGWFRRLYHTVAKEGI
                     EATVRVTVNPDERAVRVEGKLISFEYVAQMKSDLNRDLEAHVEELRRWLEFGSVSDVY
                     MTVMANRSICVVENLSGQDSVFNVIGAEAVSGYTMRFREQESAQNEQVRASILKLVNT
                     ITKLLMLAVWINPGLALRFPELSIISFGGSHRNLYFDSDDRVFIIRSRYNKNTKYDTR
                     LLFLDARVSAQLFWFIYILRPFTIVLLGDDISKINISAIMGALTPQEPLTDTHDTEEE
                     VEDINFNAELYYHQMELRNRLNNASPQTIGNAIFKSMVFLDVRKLVLVHRSTFSNMLL
                     KYPTATAMRESHRIRSMRHGLSALWKHFIAGQLYDQTLELGQAVARGFGHSVSVDAAV
                     YGFDNSRTVGPREVPFVSAKKLCQIFQKLTQKGPLITDKACTTSAASEPDEGTIGDYT
                     NLCEAGSGIISGFKFRSVEQERFTNMILTGDRNVLALQAPTAFGKTMTFVLPMLVLKR
                     TRPGKYVHFVAVPYVSLKIATMQRLEEVGLAVADLKLLGSAEWKSKLKNTDVLVGTFD
                     MFGTHATFSFINGWQEELMCVRQKGYFILDEAHALWLEQDFREELKEIHSLRWREFLK
                     IVFISATLPAWLMDELCKQLNLSRYMVRNAGWTNAVHQVPNQKVLKEVTLVPQKEFGG
                     AIEQRVNSYLLGTATGKAIFFFSNKARMRHCYARWKKVVAVAAVDSEMPDRVKLSVFR
                     EFESAASPVRVIIGTKLISNGLDCNAVDYVCLADCDVDMIDFLQMVGRIRGSGYLEVV
                     RIAGKKKEFRDAVAHEDLRNVNWSKCITETVASFYSVPAPDQITSCVATRGRSKVVRG
                     RLARCAELYTV"
     gene            <14913..>16052
                     /locus_tag="HG535_0A00120"
                     /db_xref="GeneID:59233709"
     mRNA            <14913..>16052
                     /locus_tag="HG535_0A00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285906.1"
                     /db_xref="GeneID:59233709"
     CDS             14913..16052
                     /locus_tag="HG535_0A00120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141801.1"
                     /db_xref="GeneID:59233709"
                     /translation="MSLPQLLPIAVQFNYNTLANGEWIPDFFQDLGVFGRGIACQSES
                     GSVISYYPDQHADALRTLEEFAVGFHMSYQVFAEQGVPTRETDMVIYDVPQSISEACQ
                     GIAAGSRMQCSLTDYCGPNAPNDAGLNPPSASASASAPASAPASAPASAPAPASASAS
                     APASAPASASAPASASASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPAS
                     APASAPASASAPAPAPASETWAGYSKNSTIITETKTSPLSTKLITVTSCSDNLCSESV
                     YTTGVTTVTNEFTTYTTYCPLTSSKVEIASNLEGSISSTLVPATVFPTESANSSTSPS
                     IQPQVSSVSSLATSSASLTAQTANAGGKLDYAFGSVIIGAAALLL"
     gene            complement(<18533..>19882)
                     /locus_tag="HG535_0A00130"
                     /db_xref="GeneID:59233710"
     mRNA            complement(<18533..>19882)
                     /locus_tag="HG535_0A00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285907.1"
                     /db_xref="GeneID:59233710"
     CDS             complement(18533..19882)
                     /locus_tag="HG535_0A00130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141802.1"
                     /db_xref="GeneID:59233710"
                     /translation="MTEVKLRTASQNILKASMAGSLSIVPGRLNETIIKTGLHFGCAS
                     KWGDEHHEFGMRRLAGTSVDGEIKDWFIMECKLLGCSIIIDRIGNIFAVFSGKKRGKP
                     TAIGSHLDTQPEAGKYDGILGVLAGLEVLRTFKENGYVPNFDVCVVCWFNEEGARFPR
                     YCMGSSVWANRYDIEDAYGMKSVTESTSETVYDSLKKIGYLGETPASYRENEIDAHFE
                     LHIEQGPVLEDEKKKIGVVTGVQACYWELFTVTDTGSHAGTTPRRLRKDALLMSARMI
                     LKAEEIAIRWGGLFTCGVIEAKPSSVNIVPGKVSFTLDFRHESDEILSSMLRETKSAY
                     DEMIKENESGELSWTSELLVNTPVVEFDEKCIKCVSKSARDQFPDTDIREIWSGAGHD
                     SCQINFRVPTSMIFIPSKNGLSHNYREYSSPEQIEDGFKVLLGSIINYDNMRLDRGF"
     gene            complement(<21100..>23151)
                     /locus_tag="HG535_0A00140"
                     /db_xref="GeneID:59233711"
     mRNA            complement(<21100..>23151)
                     /locus_tag="HG535_0A00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285908.1"
                     /db_xref="GeneID:59233711"
     CDS             complement(21100..23151)
                     /locus_tag="HG535_0A00140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141803.1"
                     /db_xref="GeneID:59233711"
                     /translation="MKFLCLLYFAIASSSALVLVDSTLASACVYYEKGFDWGCGTHSN
                     GMKAYTCRCGNVNWLGTITNCINSNSKSRHVVDHAFKHIAGRCLSRGNFHYSLDDMWK
                     FYENGTRYLRNPTKNDEESEVFTTLLVNQTDFDWYYSKFKGFTFEVERSQWFGWGLVF
                     YWASIIAIASLFNISNRYIGFKLFSKSFRKHLAIPPLVRIGNTTSRYADLLLPDAFRT
                     RLEVLIVGVFVCLSIISVGVGYELQTPHPYLTNRWFMNLVLVSYRVDLMSMSLFPVIY
                     FFGIRNNPFIKISGLSYSTFNYFHKWCAYVCAILAFIHSIIWTTYSIKEGGYKMWWND
                     AYWKWGIAAMTLLGLLVFHAAKLIRDIAYEVFLFLHRFMNIFFIICMYYHCISLGWLG
                     WIWSMAGILGFEYMMRIIRIMLSGGFQKAELTYCGDSVLKMTIRKPKFFKYGCGSFSF
                     IYFVDFHDPWYYPWQSHPFTLLSTPESVDEKLIVYFRAKKGMTNHLLKKIFSSGECTI
                     SHRIIIEGPYGNNVSVAHPNNKVVGIAAGLGVTAVYAYFSKIAKNKQSTIVNKFIWII
                     RNRDHISWFRKELEWLKSKDCEIAIVTTSQISIEDSFITFNDKESTEEFCFRDLGKRP
                     DLVQIISNEITAACEERNDLTFIACGPSSFNRELRAAISQKTCNSLSIAVDYKEESFT
                     W"
     gene            <24931..>26727
                     /locus_tag="HG535_0A00150"
                     /db_xref="GeneID:59233712"
     mRNA            <24931..>26727
                     /locus_tag="HG535_0A00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285909.1"
                     /db_xref="GeneID:59233712"
     CDS             24931..26727
                     /locus_tag="HG535_0A00150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141804.1"
                     /db_xref="GeneID:59233712"
                     /translation="MDKYTDRSHPEYIPGTFNIYASGVPGTPVNDAFKVLKKDKNDVV
                     LIPQPSDSPNDPLNWPKWRKLIHFGLLSFVTAFTAATSNDAGATQDSLNEIYGISYDS
                     MNTGAGVLFLGVGCATLLLAPLSSLYGRKITYLICTTLGLFGAMWFALARRTADTIWS
                     QLFVGISESCAEAQVQLSLNDIYFQHQIGSVLTVYILCTSIGTFLGPLIAGYIASLAT
                     FRWVGWVATIISGGLLIALIFGLEETYFDRNRYVTPLNPKLRSLNDDPNTSDNRSAYS
                     VSEKMKGLAAMQTRERNITEEDIVNDNEMHDNTSEGQIDDKANDVEGKFEDDLIDNLR
                     DGKSEGLLPYHKRIAIITKATNLKGWGLKQYFKYLFFNLRMLLFPPVWLSGLFWGIQD
                     VFLSFYLTTEDTYFYDPPWNYSDYGVAIMNVPTLIGAVIGCVYAGIFSDYFVLWMARR
                     NNGILEAEYRLYFSLAAALIGPAGLLMFGIGSDRSLPWQVIYVGLGFIGFSWGCSGDI
                     AMAYLMDCYPDMVLEGMVCTAIINNSISCIFTFVCSDWLDASGTENTYIALAVINFGI
                     ALLALPSFYYGKRIRKWTKEWYNQSVDLRDVL"
     gene            <28059..>29813
                     /locus_tag="HG535_0A00160"
                     /db_xref="GeneID:59233713"
     mRNA            <28059..>29813
                     /locus_tag="HG535_0A00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285910.1"
                     /db_xref="GeneID:59233713"
     CDS             28059..29813
                     /locus_tag="HG535_0A00160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141805.1"
                     /db_xref="GeneID:59233713"
                     /translation="MNMETESDKFTKTETTSTAVEARSDHSGSLINRIKDSFRPNELC
                     TVPEDAEISELTDQEKIQLNLASQPYQKVLSQRHLTMIAIGGTLGTGLFIGLGYSLAS
                     GPASLLIGFLLVGTSMFCVVQSAAELSCQFPVSGSYATHVSRFIDQSIGFTVATNYAL
                     SWLISFPSELIGCSLTISYWNSSVNPAVWVAIFYVFIMGLNLFGVKGFAETEFVLSIF
                     KILAIIIFIVIGIVLIAGGGPGTTGYIGTRYWHNPGSFAEPVFKNLCNTFVSAAFSFG
                     GSELVLLTSTESKNISAISRAAKGTFWRIAIFYITTVVIIGCLVPYTDPRLLSGSTSE
                     DITASPFVIALSNTGSMGGKVSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLP
                     SIFAYMDKKGRPLVGIGVSGIFGLLGFLVASNKQDEVFTWLFALCSISSFFTWFCICL
                     SQVRFRMALRAQRRSKDEIAYKSMLGIYGGLLGCILNVLLIAGEIYVSAAPIGESSSA
                     EGFFQYCLSIPIMIVVYFCHRFYRRDWKNWYIKTRNIDLDTACSVENKELFNAQRDAE
                     KDLISSKPFYYRFYRFWC"
     gene            <30241..>31218
                     /locus_tag="HG535_0A00170"
                     /db_xref="GeneID:59233714"
     mRNA            <30241..>31218
                     /locus_tag="HG535_0A00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285911.1"
                     /db_xref="GeneID:59233714"
     CDS             30241..31218
                     /locus_tag="HG535_0A00170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141806.1"
                     /db_xref="GeneID:59233714"
                     /translation="MVRIPLKQLLVENPQKVLVLDGGQGTELENRGIKVANPVWSTIP
                     FINESFWSDESSDHRRIVKEMYNDFMRSGAEILMTITYQTSFKSVSENTPIKTMEAYD
                     RLLSRIVDFSRQCIGDRNYLIGCIGPWGAHVCCEFTGNYGPRPENIDYYQYFKPQLDN
                     FNTNDNLDLIGFETIPNIHEIKAILSWDEAVLSKPFYIGLSVHEHGTLRDGTTMKEVA
                     QMIEDLGDKINPNFLLLGINCVSFNSSPDILSTLHEHLPDFPLLAYPNSGEIYDTEKK
                     IWLSNTDKLNSWDTVVRRYINSGARIIGGCCRTTPKDIEEVAAAVRRYT"
     gene            complement(<32064..>32768)
                     /locus_tag="HG535_0A00180"
                     /db_xref="GeneID:59233715"
     mRNA            complement(<32064..>32768)
                     /locus_tag="HG535_0A00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285912.1"
                     /db_xref="GeneID:59233715"
     CDS             complement(32064..32768)
                     /locus_tag="HG535_0A00180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141807.1"
                     /db_xref="GeneID:59233715"
                     /translation="MSLPIIKVHWLNESRAFRVLWLLDELNIDYEIIPYKRDKGFRAP
                     DELKNIHPLGRSPLIEIVDRESGKQKILAESGYIFQYILQHFDKDHKLNNADPDKAEE
                     IQYYLHYVEGSLQPPLMIEFILSKVEQAPIPFPLSYLARKITAKISEGYSRGELANQL
                     NFIEQELLKNDGYLVGGQLSAADILISFPLEMAFIRNFAKEEDYPNIRKFTKNMKSLE
                     SHKTAKGKASAVGGKF"
     misc_feature    38984..39276
                     /note="Z region"
     gene            complement(<39200..>39820)
                     /locus_tag="HG535_0A00190"
                     /db_xref="GeneID:59233716"
     mRNA            complement(<39200..>39820)
                     /locus_tag="HG535_0A00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285913.1"
                     /db_xref="GeneID:59233716"
     CDS             complement(39200..39820)
                     /locus_tag="HG535_0A00190"
                     /inference="similar to AA sequence:RefSeq:NP_009869.3"
                     /note="HMLalpha1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141808.1"
                     /db_xref="GeneID:59233716"
                     /translation="MNTMKSNRNGKNIYSQPAFKVKISKRKKLAASKFKKKCTNSSAE
                     VLRSKNRREPQSDGITNFLAKKSDIKIPSPPKSLLEEIKEEKIKLAGYGIDIGATHWS
                     FPFLWDNDEFLISLTNDLLNNLYKKPVSRAVSTRPLNSFMAFRVYNAQFGYGLRQNIL
                     SSLLASAWHSHPEQQNIWDTFAQQFNFVKPKCGFVEWVDQRYERES"
     gene            <40179..>40946
                     /locus_tag="HG535_0A00200"
                     /db_xref="GeneID:59233717"
     mRNA            join(<40179..40240,40301..40406,40470..>40946)
                     /locus_tag="HG535_0A00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285914.1"
                     /db_xref="GeneID:59233717"
     CDS             join(40179..40240,40301..40406,40470..40946)
                     /locus_tag="HG535_0A00200"
                     /inference="similar to AA sequence:RefSeq:NP_009868.3"
                     /note="HMLalpha2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141809.1"
                     /db_xref="GeneID:59233717"
                     /translation="MNKIPINILLNPVQYDDKKEKLRKINDRLLHICSEFPCDVKKVS
                     IGIFIELHGIFTTLSSFRDDGSFDSDEKCLLKVTAQLSKVIKLLIQEEIRLGSLREEF
                     NASKHIETGIGSNTKEDLKKPVFFDLNTPQTVQHKMSGKHPCRGRRLEKPQINMLEKW
                     FTNNIEKPYLNKKSLQLLTKETGLSNIQIKNWVSNRRRKEKVVTISPPLLDLLA"
     misc_feature    40990..42407
                     /note="X region"
     gene            <44611..>45879
                     /locus_tag="HG535_0A00220"
                     /db_xref="GeneID:59233718"
     mRNA            <44611..>45879
                     /locus_tag="HG535_0A00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285915.1"
                     /db_xref="GeneID:59233718"
     CDS             44611..45879
                     /locus_tag="HG535_0A00220"
                     /inference="similar to AA sequence:RefSeq:NP_009870.1"
                     /note="similar to Saccharomyces cerevisiae VAC17
                     (YCL063W); ancestral locus Anc_1.4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141810.1"
                     /db_xref="GeneID:59233718"
                     /translation="MVRMTTLENITEHLLNRAQEAVLQLELWISQEQNLQQPECYNRK
                     EDLKDTYSIYVAQLNSLCVRSEYVMSKLNQERTQRPSNYTNRRYIEDLVYEFQDVTTR
                     LNDLALLQKKDGTPSSKSSKCSWDSFQPKPLKITERHRSHMEATQLSPIRKDNKKKVV
                     IFSELQDSPMNCSKCVSLPGSPLKEANKNTVRLAKSYDTGLNGNSTSRSAHSNKNDVK
                     SFFKGKQRISISLFEDCEMDEDSMSDQDTVISINFRDDGKSVPLRRYNSHESILSVKK
                     QPSVSSRFQPSPFPSRINGPSMKSVRISSEPVFSRASKSVCSRQLLSEFVKRSQGITE
                     VKEITENSSFFTRWNPFSTKPAISKEVKTSHDAGQKITASQALKKTTLCDLRSELKFV
                     SQRREPAGPVLDSTIAYDDLREALNTDLIL"
     gene            complement(<45943..>48840)
                     /locus_tag="HG535_0A00230"
                     /db_xref="GeneID:59233719"
     mRNA            complement(<45943..>48840)
                     /locus_tag="HG535_0A00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285916.1"
                     /db_xref="GeneID:59233719"
     CDS             complement(45943..48840)
                     /locus_tag="HG535_0A00230"
                     /inference="similar to AA sequence:RefSeq:NP_009871.2"
                     /note="similar to Saccharomyces cerevisiae MRC1 (YCL061C);
                     ancestral locus Anc_1.5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141811.1"
                     /db_xref="GeneID:59233719"
                     /translation="MDEILSELSLLNGKRKTYKKRTESFSDDPPAFAPLVSGNGFLFE
                     NDTLNRVKNRLQRQEDTSSNDFVTELSQTQVISNFYSGGKDLEFDKNNHTAERTSAHL
                     SSTQRINSHRDLATQVKSLSGLKTQPIYSDHNLATQKDPYSELKTQHVKDANKDVLAT
                     QKILSPETNADSSAPAAKDSERNKDTSSTYKDGHGFSAEESLQCSPLKIHIIQAKLLE
                     NNEKSLDRATVSKDSKKAINNGPCIKVSKEEFLEDLDNSSESDQEKAMETELIQATAS
                     RVAISAEQKKIQIAAFSNSYGILKNYKHELKRESNIQECIILSSDDDTDDEQHLQVFR
                     SHLSKASLLDIKARLSKKNPSLKNAINGTSLKKLYTGLREASKKQIVEHQKKLMEKKG
                     LNIKEIEVQKQIVEDLLEQEIARNKRIRAREKQEQEQEQEQEQEQEQEQEQEQEQEQE
                     QDCSITAEFREEDMNYSGDESSNESIYHDEKSDGEDPHGPQPNSNLITGPLTEENSHS
                     DIEQSEKKTKETSIEKPHMIDDDEGIILGRLKAKAVPVIMDSDSNSDDERVNNGNPID
                     LGNYGKNLAEGTMHVHTRRENIVENYANERLEKDGQHRTAASLQVKEDLKEKKNRARR
                     LKMEESGVRSILEVEAEESEDEWHGLGGVDGELSEEYDSELEKMIDDYSQDIVNPDEI
                     RNLLAKENKELDLQMVNKILHDVKNGGFRKRRGAGMVLEISDEDDEDLENYRSKRREL
                     MKQKRLELTKEGDINLMKNGKVQAFFESMVEDIVDEKNAFQPDEKEEGESSQNEAALT
                     SKQKMTLSEEFVQQSLSFLRYNDDKQTSAIFNDNYPGKENSDLLSLKQHSHIKRLHAP
                     ISSVCHQVENHEDELHCMLTSEQTASSVSEKFGSHVGIDNKLKNGKKTVTVSRTYKTV
                     GGNRAAITYMGKMRKLVAPKRQNVSRMPSSFRTRKLNVNTIFDNDDTSFEV"
     gene            complement(<49074..>50030)
                     /locus_tag="HG535_0A00240"
                     /db_xref="GeneID:59233720"
     mRNA            complement(<49074..>50030)
                     /locus_tag="HG535_0A00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285917.1"
                     /db_xref="GeneID:59233720"
     CDS             complement(49074..50030)
                     /locus_tag="HG535_0A00240"
                     /inference="similar to AA sequence:RefSeq:NP_009872.1"
                     /note="similar to Saccharomyces cerevisiae KRR1 (YCL059C);
                     ancestral locus Anc_1.6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141812.1"
                     /db_xref="GeneID:59233720"
                     /translation="MVSTHNRDKPWDTEEINKWKIEEFKPDDNASGLPFAEESSFMTL
                     FPKYRETYLRTIWNDVTKALNSHNISCVLDLVEGSMTVKTTRKTYDPAIILRARDLIK
                     LLARSVPFPQAVKILQDDMACDVIKIGNTVANKERFVKRRQRLVGPNGNTLKALELLT
                     KCYILVQGNTVSVMGPYKGLKEIRRVVEDTMRNVHPIYHIKELMIKRELAKRPELAEE
                     DWSRFLPMFKKRNVARKKSKKPKKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKKEKE
                     IKKLHERREKQVEKQEERQKERNQDYIAPKENEYRGSAKIEE"
     gene            <50300..>50632
                     /locus_tag="HG535_0A00250"
                     /db_xref="GeneID:59233721"
     mRNA            <50300..>50632
                     /locus_tag="HG535_0A00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285918.1"
                     /db_xref="GeneID:59233721"
     CDS             50300..50632
                     /locus_tag="HG535_0A00250"
                     /inference="similar to AA sequence:RefSeq:NP_001018031.2"
                     /note="similar to Saccharomyces cerevisiae YCL058W-A;
                     ancestral locus Anc_1.7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141813.1"
                     /db_xref="GeneID:59233721"
                     /translation="MGRKSEKRIAKSKDYRKKNKKALSPKDVKKTKIQIHKMNRDDSL
                     TSDIFNVDKYNTRVRETPSNIKALNAKVLQKDQQKDKEVQDRIIAQRKDMSDNLTKQI
                     EELSVFSL"
     gene            complement(<50790..>51044)
                     /locus_tag="HG535_0A00260"
                     /db_xref="GeneID:59233722"
     mRNA            complement(<50790..>51044)
                     /locus_tag="HG535_0A00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285919.1"
                     /db_xref="GeneID:59233722"
     CDS             complement(50790..51044)
                     /locus_tag="HG535_0A00260"
                     /inference="similar to AA sequence:RefSeq:NP_065435.1"
                     /note="similar to Saccharomyces cerevisiae YCL057C-A;
                     ancestral locus Anc_1.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141814.1"
                     /db_xref="GeneID:59233722"
                     /translation="MSEKSKVQTLMPNKSILNDKWDVVLSNMLVKTGLGLGVGVVGSV
                     LFFKRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRTVKA"
     gene            <51686..>53338
                     /locus_tag="HG535_0A00270"
                     /db_xref="GeneID:59233723"
     mRNA            <51686..>53338
                     /locus_tag="HG535_0A00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285920.1"
                     /db_xref="GeneID:59233723"
     CDS             51686..53338
                     /locus_tag="HG535_0A00270"
                     /inference="similar to AA sequence:RefSeq:NP_009874.1"
                     /note="truncated, possible pseudogene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141815.1"
                     /db_xref="GeneID:59233723"
                     /translation="MLGNMNLTRIFSKGYVTNWFTADTIIPVVGLPILAYGIYRIVVR
                     RTMGSVRFVSPNSPPSWNWSSKDIIERANKIVEDAVKFYDSLAELEDPSINNLVRPFM
                     QHENRMQLETGQLTFFQHVSEDEGVRAASVEVTEVLQNLQIDLFLRHDLYVKFDTVWK
                     QIKDNKYEKGTEGFEVFRYVEKCIKDFLRAGLDLSKEKREEVKKLRKLISFKSLKFSE
                     NMGKQNEYIAFSKEELEGVSQSVLEQFETFWDERTKTEKYKVTFKYPDIFPVMKTAKR
                     TETRRKAFVADQNKTPENEEILLETLTLREKLAELLGYATYAGYNLDNKMAKKEEVVF
                     DFLKDLKDRLLPLAKKELKHLKAMKKKECEELSIPFDGEYYSWDHRYYDNTLMKEKYN
                     VDFEKISEYFPIESSISGMLNIYEKLFNLKFIEQTKTIVKNIWNDDVKLLAVYEMEDS
                     ASSKFLGWIYFDLHPREGKFGHAANFSLAPSFIDEEGRRSYPVTALVCNFSKPSSKKP
                     SLLKHDELNTFFHELGHGIHHLVGKNMAARMNGPSSVPWDFV"
     gene            complement(<53995..>54606)
                     /locus_tag="HG535_0A00280"
                     /db_xref="GeneID:59233724"
     mRNA            complement(<53995..>54606)
                     /locus_tag="HG535_0A00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285921.1"
                     /db_xref="GeneID:59233724"
     CDS             complement(53995..54606)
                     /locus_tag="HG535_0A00280"
                     /inference="similar to AA sequence:RefSeq:NP_009875.1"
                     /note="similar to Saccharomyces cerevisiae YCL056C;
                     ancestral locus Anc_1.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141816.1"
                     /db_xref="GeneID:59233724"
                     /translation="MERANLETAVNQTTNMQNSVIVSNTDPDCRNDSADENKGSSEPA
                     TFEDTVINILESACNVFDNIYFAKSLGIISDKNFLYRHLNNGEWGSKLWLITLILSAR
                     KLLRQLFKTMKARSALKSEIKITQLNSKSLINDVLTEKLRESLDKCSALIRDKLFDLF
                     QTFIYFIIASISLFKIAVPRKWKRVLEPLSNFVTLMRFFTVVR"
     gene            <55843..>56913
                     /locus_tag="HG535_0A00290"
                     /db_xref="GeneID:59233725"
     mRNA            <55843..>56913
                     /locus_tag="HG535_0A00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285922.1"
                     /db_xref="GeneID:59233725"
     CDS             55843..56913
                     /locus_tag="HG535_0A00290"
                     /note="ancestral locus Anc_1.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141817.1"
                     /db_xref="GeneID:59233725"
                     /translation="MEISSKRAYAALGNSDIHEGGLKRRALILDNSVPLQNFDAPRGP
                     FSGVSFQLKDGRSLNSFDSKNRSDSDLDAKSGFSSQEDHSYAHGFSSGLLNPKLVEAV
                     SRYSDSEVDKNNNYCNSSIRLGQDRCLEDNNQRRKSSARPDSFSSSYSRRSQVTKMDL
                     CARERCFDYIVQSIDEVWARYCDTTSCAEAKVYGNLPSQRAAKLQKCNQNNPTVAHFP
                     QSHKPLNITDRDTESDSDSEISIDGLNQNCEDDEEENSGYKSEATNITEYETDNGESR
                     TVSNLPDSVKLQSLKFRLKNAKNDMEQVYDSTEMQDSCSFWRRWDMIKYGAVEMMEED
                     DDDEIIENVIEELEQGRCYFTN"
     gene            <57568..>58533
                     /locus_tag="HG535_0A00300"
                     /db_xref="GeneID:59233726"
     mRNA            <57568..>58533
                     /locus_tag="HG535_0A00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285923.1"
                     /db_xref="GeneID:59233726"
     CDS             57568..58533
                     /locus_tag="HG535_0A00300"
                     /inference="similar to AA sequence:RefSeq:NP_009876.1"
                     /note="similar to Saccharomyces cerevisiae KAR4 (YCL055W);
                     ancestral locus Anc_1.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141818.1"
                     /db_xref="GeneID:59233726"
                     /translation="MAVSGQQDQDIVQINENKRVKHVRFKPTKEIQQNDYSNHYIHTG
                     VLPHQHITNTESPVVGYPKLQKLLALKEDQIKQYATNPFGCKVEIDQMVPTINHWIRD
                     EQLTFDVVMIGCLTDNQFIYPLLTQLALDRLVSKPGFLFIWASAQKINELNRLLNNET
                     WAKKFRRSEELVFVPIDKNSPFYPGLEQDDNSIVDKMQWHCWMCITGTVRRSTDGHLI
                     HCNIDTDLGFEKKDTRVGAVPSHLYRVVENFSTSTKRLHIIPARTGFEKPVRPRPGWV
                     VMSPDILLNNFSPKRYKQEISVIGCNVPLKNEIENLRPKSPIQKV"
     gene            <60531..>63032
                     /locus_tag="HG535_0A00310"
                     /db_xref="GeneID:59233727"
     mRNA            <60531..>63032
                     /locus_tag="HG535_0A00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285924.1"
                     /db_xref="GeneID:59233727"
     CDS             60531..63032
                     /locus_tag="HG535_0A00310"
                     /inference="similar to AA sequence:RefSeq:NP_009877.1"
                     /note="similar to Saccharomyces cerevisiae SPB1 (YCL054W);
                     ancestral locus Anc_1.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141819.1"
                     /db_xref="GeneID:59233727"
                     /translation="MGKTQKKNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFL
                     EKSKVVIDLCAAPGSWCQVASKLCPINSLIVGVDIVPMKPIPNVTLFQSDITTEDCRS
                     KLRGYMKTWKADTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKI
                     FRSKDYNKLMWVFQQLFDKVEATKPPASRNVSAEIFVVCKGFKAPKRLDPRLLDPKEV
                     FEELPDGPQNMESKVFNPEKKVRKRQGYEEGDTLLYHEMPIMDFVKTDDPITMLGKMN
                     RLTVDEGDHEWKIVKKLKQTTSEFLECIKDLKVLGRSDFKMLLKWKKAAAEILDYGKE
                     EVKTEIETTPLTEDEQIEKELQELQAKQRLNQKREKRKKNEVKQKELTRMQMNMLTPA
                     DIGIEAADIGRDSIFNLKTAEKTGILDKLAKGKKRMIFNEDATQNDDIHIDEDAPPQD
                     RDDAAEANDLEAELDAMYENYKTNKAERNARFRAKMARGGDQEDEWTGFAEKVDVQDQ
                     DEGNVHTYDDEDSEQESDGDEAITSLISKLKGKSGDSKLSNKARMLFNDPIFENVEPD
                     LLKVRPSAPAASDESSVPAKRKHVDLEEKEEESSDDEDNSSDSSDFELVANEESEQEG
                     FSSDYDSEEEKSHISKQKHSKEVDIATVEAMTLAHQLALGQKTKHDLVDEGFNRYSFR
                     DSENLPAWFTEEERNHSKINKPITKEAAMALKEKMKTLNARPIKKVAEAKARKKMRSL
                     ARLEKIKKKAGLIVDDNDKSEKDKSEEIAKLMRKVTKKPKTKPKVTLVYASGKNKGLS
                     GRPKGIKGKYKMVDGVMKNEQRALRRIAKKHHKKK"
     gene            complement(<63108..>64352)
                     /locus_tag="HG535_0A00320"
                     /db_xref="GeneID:59233728"
     mRNA            complement(<63108..>64352)
                     /locus_tag="HG535_0A00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285925.1"
                     /db_xref="GeneID:59233728"
     CDS             complement(63108..64352)
                     /locus_tag="HG535_0A00320"
                     /inference="similar to AA sequence:RefSeq:NP_009878.1"
                     /note="similar to Saccharomyces cerevisiae PBN1 (YCL052C);
                     ancestral locus Anc_1.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141820.1"
                     /db_xref="GeneID:59233728"
                     /translation="MRLISRHTVLFPNAEDVGSHLTYNDTHIEIRGDAGVIAQNRWAW
                     NTEALDNGASRSSTRITWRAPERVRGDSESSVAIEPVLCPGLNIYTNATEKHECLRMV
                     ENPVYQSVHKESFTQMADWLPSEYDTSFIKWDEVNCDYDITILNKTLEINEWCPIENE
                     KVIEFTKPIYVNQSEVGLFYVDFHDDKDINLGGLRCTWDSVGVIENCQKTMLMYMPAH
                     VVATTPMSIHLEKPVGLHPNLVINLENYTSCEIQCDYFAYLQLPVDLFIDRFQSGPVS
                     IFGQQDLEQPEYRLQNNSWGSESLFILEAGKINEINLHSRYVSPAPNSSYKSVAFNAM
                     IFKACDSNTEEVVRNPFYSKGLGYEAFFTPDTVFNHMRSTSIGVDIPVVDTSHYNTTR
                     FATLGCIIFSMIYLFLRVFTKR"
     gene            <64883..>66457
                     /locus_tag="HG535_0A00330"
                     /db_xref="GeneID:59233729"
     mRNA            <64883..>66457
                     /locus_tag="HG535_0A00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285926.1"
                     /db_xref="GeneID:59233729"
     CDS             64883..66457
                     /locus_tag="HG535_0A00330"
                     /inference="similar to AA sequence:RefSeq:NP_009879.2"
                     /note="similar to Saccharomyces cerevisiae LRE1 (YCL051W)
                     and HLR1 (YDR528W); ancestral locus Anc_1.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141821.1"
                     /db_xref="GeneID:59233729"
                     /translation="MTDTQHLLVADALPIENSTTPSKKGHRHKRSFAISGDFDFLKQP
                     GTVPPMICSSPGSATTNSYTHNIQTGQRQEDNYSCPSEAMPRSPFKLSNQASNLSPRF
                     FISEEPKFSSPFRGVPDAIINLDDALKAKPRSFKNHKRSESAPPDLAILLNSKNSTSG
                     TVMIEEEDDESPTNSDSSGSSNTEKDTVFPSLISPLRPQSPTPNPHNYDMNGSPVQSK
                     NTGYTSNSSKVNTLKINGQKQRYHYYTKKLSINAISNVEPQSLKEKGSFGSLSSGVNR
                     TPLSTACTPLMQISTPSTPVSLNNNNAIFNAYKYEGFEKGPISPVRVHRSSVYNNRNM
                     TQQNHNNNSKKNTNATFKYESISYDIPQEPNKCDSVSSRDDKTLMKKDIIFQDDGDVT
                     GSIKQDDAKLELSPYEEQRNENVLSKEILFGEPGDAVDLSTLPSSRRSSNENREPLSK
                     QEMAPIMQVTSFVKESRSRGFEASQDSRSVSDSILLTGGRPHRHKKTVKSKLNNFFAN
                     FFSKSSNESNLSEKKP"
     gene            complement(<66870..>67253)
                     /locus_tag="HG535_0A00340"
                     /db_xref="GeneID:59233730"
     mRNA            complement(<66870..>67253)
                     /locus_tag="HG535_0A00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285927.1"
                     /db_xref="GeneID:59233730"
     CDS             complement(66870..67253)
                     /locus_tag="HG535_0A00340"
                     /inference="similar to AA sequence:RefSeq:NP_010818.1"
                     /note="similar to Saccharomyces cerevisiae QCR7 (YDR529C);
                     ancestral locus Anc_1.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141822.1"
                     /db_xref="GeneID:59233730"
                     /translation="MPQSLTSIVKVGDYILNHAALSKIIVPVAQQFVKFGGYRKLGLR
                     FDDLLMEENPIAQTALRRLPADESYARNFRIIRAHQCELTHHLLPKNEWIKPEDDVPY
                     LLPYILEAEAAAKEKEELDNLEVAK"
     gene            complement(<67571..>68527)
                     /locus_tag="HG535_0A00350"
                     /db_xref="GeneID:59233731"
     mRNA            complement(<67571..>68527)
                     /locus_tag="HG535_0A00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285928.1"
                     /db_xref="GeneID:59233731"
     CDS             complement(67571..68527)
                     /locus_tag="HG535_0A00350"
                     /inference="similar to AA sequence:RefSeq:NP_009880.2"
                     /note="similar to Saccharomyces cerevisiae APA1 (YCL050C)
                     and APA2 (YDR530C); ancestral locus Anc_1.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141823.1"
                     /db_xref="GeneID:59233731"
                     /translation="MLPKDLSQRIADKYATAVDNGHVKFTQSSTKKVKDTVSGMPYVL
                     SYAPSLLDKPERGDDPERNPFGQPEPELTVLEDVADGEYRLLLNKFPVVAEHTLLVTK
                     EVKQQQSPLSPIDLMTAYRILDRLDDEDENVRHMAFYNCGPSSGSSQDHKHLQILRLP
                     QNFLTLQDKLCAGKSHFLPNFKTEPLQDNKVSFAHFVLPLPESKEEVDEELLTMSYVS
                     LLQRALTFFQDWLGERPALQNNMGYNFLLTKNWICVVPRSSTKASSIDIGFNATGFAG
                     LILVKKEDIYNKIQEDSNIINTALLECGFPNTAGVKSNEYNY"
     gene            <69131..>70222
                     /locus_tag="HG535_0A00360"
                     /db_xref="GeneID:59233732"
     mRNA            <69131..>70222
                     /locus_tag="HG535_0A00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285929.1"
                     /db_xref="GeneID:59233732"
     CDS             69131..70222
                     /locus_tag="HG535_0A00360"
                     /inference="similar to AA sequence:RefSeq:NP_010820.3"
                     /note="similar to Saccharomyces cerevisiae YDR531W;
                     ancestral locus Anc_1.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141824.1"
                     /db_xref="GeneID:59233732"
                     /translation="MTDQRAKEIHYPCNYSDGNFNIAIDIGGSLAKVVFSPYGSERLM
                     FHTIETEHIDKFIRLLHSIVENYHSGEYSTTRILATGGGAYKFHELLQEEFSAINAIV
                     RLDEMECLIKGLDAFIHEVPDEVFTYNDQDGAKNVTLPRDATDPASIYPYLLVNIGSG
                     VSILKVDEPGQFKRVGGSSLGGGTLWGLLSLITGAQTYDQMLDWAHVGDNTNVDMLVG
                     DIYGTDYNKIGLKSSNIASSFGKVFQKRRNSVTSNRPRSSSTASNNIALTTSQTDIAL
                     RNKKFKNPDVCKSLLFAISNNIGQIAYLQAKIHNVQNIYFGGSYIRGHLTTMNTLSFA
                     IDFWSQGNKQAFFLKHEGYLGAMGAFLSA"
     gene            complement(<70314..>71495)
                     /locus_tag="HG535_0A00370"
                     /db_xref="GeneID:59233733"
     mRNA            complement(<70314..>71495)
                     /locus_tag="HG535_0A00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285930.1"
                     /db_xref="GeneID:59233733"
     CDS             complement(70314..71495)
                     /locus_tag="HG535_0A00370"
                     /inference="similar to AA sequence:RefSeq:NP_010821.3"
                     /note="similar to Saccharomyces cerevisiae YDR532C;
                     ancestral locus Anc_1.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141825.1"
                     /db_xref="GeneID:59233733"
                     /translation="MTISGVCEFILILIRDIQRSVTKGIMSFESLHDYKTEIGNLENE
                     IAKVSDEVLIAQERRFSDAVNEITQSVVTMSRESELIRILDNSDENLSQIERQIVDFG
                     EIDKKIDAFNQLVDLLRVTYLEQETLDFFLRYTISSSELLHLDSIHDDKYVKLEEEVS
                     NLKDTELRKHHVKIEETKLKIAVAGDNLAKTEDKVNEILLETTEVLDSCDQMMEELEK
                     LREEYKIRNDRRENSDHDPLMETYHQWGQLKKTQGEYNILNDQLSEWEKVKKTYDFIG
                     NMKRSNSSISDTDPRLVELGSTLESLIKIWEAKFLPAKGWQNLEVYPQTRKFQFDVSA
                     IFTVVITLDDFSLIEDMKVYRKEEDIMRNDKNIENKLKKDHLGAKDIFNVMVHIINNL
                     K"
     gene            complement(<72414..>73718)
                     /locus_tag="HG535_0A00380"
                     /db_xref="GeneID:59233734"
     mRNA            complement(<72414..>73718)
                     /locus_tag="HG535_0A00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285931.1"
                     /db_xref="GeneID:59233734"
     CDS             complement(72414..73718)
                     /locus_tag="HG535_0A00380"
                     /inference="similar to AA sequence:RefSeq:NP_010816.4"
                     /note="similar to Saccharomyces cerevisiae RBA50
                     (YDR527W); ancestral locus Anc_1.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141826.1"
                     /db_xref="GeneID:59233734"
                     /translation="MSLLGDIVEHDAVPDAPNSPDPPCNVNGFPELYRPTKISSWKQR
                     LREKGAQARAKEKKDNGVSCSKEPPSGSRQRSEALSIHNENLQVLQNMSKEEILRERQ
                     ELLESFDPKLLQKLIKNINKKSKGDNAPLFADIDGAPGTWIGGTDSVNDLLPLDDDQV
                     DQALGISTNKKPTVEDFLQEKEASSENASIERLDEDDVAPLDFQMAQSIDHMSNEELL
                     NDVHFIKHENSQEIELEFQKLDLNDPDFNEKVHQKFFPDLPKDIEKLKWMEPLDDSDK
                     PQVINDVSQCRFDFKGNLVPPTREIHSTTHSALHHHSDDANLAGYTMPELQRLSRSSF
                     SAQRSIAIQTLGRILYKLGKQSYYQLVPEVDLETYQRDGGSKEVINKIYSMFWDLCKV
                     CRISECLNDAADEKKTKHISVRNYAVDALWLWKSGGGDFRDK"
     gene            complement(<73921..>74160)
                     /locus_tag="HG535_0A00390"
                     /db_xref="GeneID:59233735"
     mRNA            complement(<73921..>74160)
                     /locus_tag="HG535_0A00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285932.1"
                     /db_xref="GeneID:59233735"
     CDS             complement(73921..74160)
                     /locus_tag="HG535_0A00390"
                     /inference="similar to AA sequence:RefSeq:NP_010814.1"
                     /note="similar to Saccharomyces cerevisiae SNA2 (YDR525W-
                     A); ancestral locus Anc_1.21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141827.1"
                     /db_xref="GeneID:59233735"
                     /translation="MHARDWFLVFIAIFLPPVAVWIKRGFFTKDFLINVLLFLLGFLP
                     GLVHALWVISQHPFEKEGQAGLLEPANNNDYGATA"
     gene            complement(<74317..>75060)
                     /locus_tag="HG535_0A00400"
                     /db_xref="GeneID:59233736"
     mRNA            complement(<74317..>75060)
                     /locus_tag="HG535_0A00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285933.1"
                     /db_xref="GeneID:59233736"
     CDS             complement(74317..75060)
                     /locus_tag="HG535_0A00400"
                     /inference="similar to AA sequence:RefSeq:NP_012296.1"
                     /note="similar to Saccharomyces cerevisiae DCG1 (YIR030C)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141828.1"
                     /db_xref="GeneID:59233736"
                     /translation="MVKLLVVNPNSTQSMTDEIRTSVERCLGDAEETQPPVIAVTYMT
                     GPQGSPRQIDGLESSRESCEACLPLLQDPSSQYHYRSYDGILVACFSDHPLAAAIQAL
                     PAAPLVVGLLSCSVAFSSLALGRPFSIITSNAEWVAILDEQTQKFLTTDTISRSLWRG
                     TVSTNLQVLELHNSSNFNRIAQRIEDYNIARLGSEVVILGCAGFSGMQYKLTNMLGGK
                     ITFVDPIVLGFQTLVTNATFLATERRRCE"
     gene            <76086..>76298
                     /locus_tag="HG535_0A00405"
                     /db_xref="GeneID:59233737"
     mRNA            <76086..>76298
                     /locus_tag="HG535_0A00405"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285934.1"
                     /db_xref="GeneID:59233737"
     CDS             76086..76298
                     /locus_tag="HG535_0A00405"
                     /note="similar to Saccharomyces cerevisiae YDR524C-B and
                     YCL048W-A; ancestral locus Anc_1.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141829.1"
                     /db_xref="GeneID:59233737"
                     /translation="MQFKNFVATFAVATAVSAQAVNSSNVTNGTNGTNNSNGTTTSTS
                     TGAASSNVLNAGVFGAAVAAGVAFLF"
     gene            <76717..>79242
                     /locus_tag="HG535_0A00410"
                     /db_xref="GeneID:59233738"
     mRNA            <76717..>79242
                     /locus_tag="HG535_0A00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285935.1"
                     /db_xref="GeneID:59233738"
     CDS             76717..79242
                     /locus_tag="HG535_0A00410"
                     /inference="similar to AA sequence:RefSeq:NP_010812.3"
                     /note="similar to Saccharomyces cerevisiae AGE1 (YDR524C);
                     ancestral locus Anc_1.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141830.1"
                     /db_xref="GeneID:59233738"
                     /translation="MGQSASTSGDVSSYNLRRHREYFVQFNDTFVPLVTPAYVYDFNV
                     RVKRPSQLEVFTLQDKLVHRQSLSVSAGGSCVLVVASITVPSAAFYKVKIFDLSVVVF
                     FEDSSVKQITPPEFSNALPNWLPDSIDFRNIVASMETDLQHFQKSSVWKNLLDSLTKI
                     NDTLIQLSQLLGSVTKISFPSLSHRNILIELLSAGLFDRIRSFKTNQVDVFSKNLSHS
                     VINPLHEFNAFNSQNQKTVSKIQKNFNELTKSFYVNPSQTHSPLHSKRDFELARLDYY
                     DLLYQSLYNGLPLRKFASSICLFLYNKRISESEFNLSYMPRVNALRASIKRSKDFQEL
                     ATLHQGFKISSNFKEDIVLIRYLKQNGNSIDTLNSNESTTTSSSTSGHWHRQWIVLND
                     YILQLYSTSKKLQNNTSSRFHQINLSFACIKQINAKTLDVITTGSPLTISVPTHLQTQ
                     IPAAATNGTAPLSSTAYSTSTTTAVGTTPNDDLVSPVRFLLQFHNENEMKTWLSALRQ
                     QATQEIHSSSKSMLTNESTHSLKNESNSLLSIVKNQHESNSTCCDCGSTESVEWISIN
                     ILCVVCIKCSGVHRSMGSHISKMRSLTLDNFASPEILQLIQHNVSNSNVNSIYESSST
                     KRERISSTSTDAERSQYIIEKYQLKTFVDDGKQARKKSFKALIKAIHLNSIYLLQKCI
                     AQSSDSLKEIIEAEKGTTNSDQPQASIFQYSLKHHEMVNAHPIFFITEFLLINGVPID
                     KLPRDTQNWAPDVLDYWKSRIEIYGTYKPVTLNCQKEENISIKPSNSKSQLPALTIPS
                     DKSNKRWSLNPISASAQLKSPTNLLAMHKSLKLPKRGANTHKE"
     gene            <79720..>81150
                     /locus_tag="HG535_0A00420"
                     /db_xref="GeneID:59233739"
     mRNA            <79720..>81150
                     /locus_tag="HG535_0A00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285936.1"
                     /db_xref="GeneID:59233739"
     CDS             79720..81150
                     /locus_tag="HG535_0A00420"
                     /inference="similar to AA sequence:RefSeq:NP_010811.1"
                     /note="similar to Saccharomyces cerevisiae SPS1 (YDR523C);
                     ancestral locus Anc_1.24"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141831.1"
                     /db_xref="GeneID:59233739"
                     /translation="MTISKTFLRPSEIYEIKKCVGRGNFGDVYKALDKASGKIVAVKV
                     VNLEHTDEDIDLLAQEIFFLAELRCPFITNYITTMTEDVSMWIIMEYCGGGSCADLLK
                     NLYINGMPEDKVSYITREMLKGLAYLHQQKKIHRDIKAANILITDEGKIKLGDFGVSG
                     QIKATLKRGTFVGTPFWMAPEVVSKNSDGYTEKVDIWSLGITVYELLKGSPPLAKCDP
                     MKVMLNLPKRKPPALHGNYTNAAKGFIAACLVKDPNSRPSATQLLDLEFVKTSKIDDI
                     RNDVNYIKNKKSKENYQRNPKFSLQEKLYDGSGPHIIWDFESQREILKMNLQKMNLPF
                     TPLDVETPQSKSSTTGSPISSKIHSPVHQNNMTDTPITNPGGSSFRNYNKLEYDIGSP
                     MEIDFELQSDGDELKLRGFDYLKNLVSFSFHRMYERAHDDETRMYVKDMLERFAITES
                     KIPGFSEVFVEEMSLRLDSIKKYLAK"
     gene            <81377..>82951
                     /locus_tag="HG535_0A00430"
                     /db_xref="GeneID:59233740"
     mRNA            <81377..>82951
                     /locus_tag="HG535_0A00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285937.1"
                     /db_xref="GeneID:59233740"
     CDS             81377..82951
                     /locus_tag="HG535_0A00430"
                     /inference="similar to AA sequence:RefSeq:NP_009882.1"
                     /note="similar to Saccharomyces cerevisiae SPS22 (YCL048W)
                     and SPS2 (YDR522C); ancestral locus Anc_1.25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141832.1"
                     /db_xref="GeneID:59233740"
                     /translation="MKPHQTTMKYIVLFLPLLVAGMIIDPNLSFNCDAQNALMFRKLK
                     AFENNRAPLPHSATLSCDIEKKKREYSKSQQFEVHEKSLEMRAANPEKLDKTLDNTSG
                     KSFNNTTHKTTDKPPVIPPLMMEICKKDEHVIMNAADLHSLQVSCNDITGNIRFNAYR
                     DAIVDFGNLQTIGGSLYIENISNIVKIQGNRLQKIGGTFKLHSLTSLVVLDLPSLNNV
                     KEIEWKVVPILNSANLNKEMKGLKKIVISDSSLSIINDFNKIREVDIFDINNNRFLEI
                     IKANIETVRQKLSISANAKQLELEMPLLVSAQNITIRDISSISLPKLESVGSSLELIE
                     NDFVTIDLSTLKEVGASLGIIDNVNLDLIDFANVSDIQGGLIIENNPKLQKIDAFKTL
                     KQVGGGIYLDGKFSETNFPQLKLVKGSAYVKSDSDMFDCSRWTTPKYGRSFIRGGKVT
                     CISGKSEESESIDTDGNVVGRNEKSDNSNKSGPSSNRGKHGLFSKVSHSGSAINEIPK
                     IMVCTLAAVMAAAFII"
     gene            <83440..>85863
                     /locus_tag="HG535_0A00440"
                     /db_xref="GeneID:59233741"
     mRNA            <83440..>85863
                     /locus_tag="HG535_0A00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285938.1"
                     /db_xref="GeneID:59233741"
     CDS             83440..85863
                     /locus_tag="HG535_0A00440"
                     /inference="similar to AA sequence:RefSeq:NP_010808.3"
                     /note="similar to Saccharomyces cerevisiae YDR520C;
                     ancestral locus Anc_1.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141833.1"
                     /db_xref="GeneID:59233741"
                     /translation="MYFSIDTSDIKVDLSNCFKPTGQIIMVERIQVIPKNSVSETGDK
                     SISNGNLRQGDLGSENQSPLMASNSAKRDPITREINNERKPRKKRKTFSCSHCRRFKT
                     RCDFEPLVGKCHRCNILQIECSLTTERESEILAAIEQHSKSAMDLESVSGTSVQGRNV
                     FLSGEDSMAIRNPLTKTLNNRLTRLEDGFSSITSKIELMLVLLQGPSTSNDMLSASSF
                     HNASVRNKQFSQFAVDRFTEDDMEERKKADSSSEMASVANSIEPTFPIVDATEYRRKK
                     PLFLDNKFREPPLKLIRDLDERLFPRVALSAKDRLGKQQRPFVVARVNFLKFYRRHRT
                     LCQNLSREFLVRSHFWIVPGGIKEIDDEYAERHAFITSVFTIIAMSFDDNDKYAEEQE
                     VLYPLVERLLTNTLTMFEKLIAHDIEAIMYCCMFHISRKAKRHRQLQFNSLVLSDFAL
                     NSLLSIIDFSEIKERVLNNEEYDTTDLYHLRILNSLTACKLEYSVGYGSFCPLDDSIK
                     ELNNLTAKFPQSNFGDDIKVSEINLGDVVNIIFTNFRSFFESTKENFGKKTEGNGISE
                     NLIIFPQLNYWLKNWEELLARDGGGVLLFTFDFYHIMICRSFISHYIEELREQPEFLK
                     GILNTMKEHSFSLLRGFLRLPPSLFKGAPMFTTQQLIYACLTLCDFLHWFDPSERQIV
                     LNVCTRVYWQLNTIGEKLNEATDNVGKIIKSIIDTSKSRVNTGRLSNSFSSLGPQQTN
                     EIAKEIEITTPKSVTSHLSLGESGTGGSFSMPDVEQFNSFEDFFQDFFHNLKPTTQKM
                     FAAASSSQG"
     gene            complement(<85893..>86678)
                     /locus_tag="HG535_0A00450"
                     /db_xref="GeneID:59233742"
     mRNA            complement(<85893..>86678)
                     /locus_tag="HG535_0A00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285939.1"
                     /db_xref="GeneID:59233742"
     CDS             complement(85893..86678)
                     /locus_tag="HG535_0A00450"
                     /inference="similar to AA sequence:RefSeq:NP_009883.1"
                     /note="similar to Saccharomyces cerevisiae YCL047C;
                     ancestral locus Anc_1.27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141834.1"
                     /db_xref="GeneID:59233742"
                     /translation="MSTLETICLAVYKSFQACKTSSFQIVYGSKRIVDARVLLVLDSS
                     FNPPHWGHYTLIKKSLQFYSDRSSHVLLMLSVNNADKAPQPALFEKRIEMMCVMADML
                     KAESINASVGITTHGKYVDKYKTLRESYLPIGTLSFLVGFDTITRIFEPKYYTPHLLS
                     EALNDCMMFSEFCCLTRTGQQSVNDQIDYANRISKGDYEPTIPRSWGKKIHVLVNDKR
                     YENVSSSKIRRDIQNHSSLAILTKELPQPIIKYIQNQAEPIFM"
     gene            complement(<86866..>89079)
                     /locus_tag="HG535_0A00460"
                     /db_xref="GeneID:59233743"
     mRNA            complement(<86866..>89079)
                     /locus_tag="HG535_0A00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285940.1"
                     /db_xref="GeneID:59233743"
     CDS             complement(86866..89079)
                     /locus_tag="HG535_0A00460"
                     /inference="similar to AA sequence:RefSeq:NP_009884.1"
                     /note="similar to Saccharomyces cerevisiae YCL045C;
                     ancestral locus Anc_1.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141835.1"
                     /db_xref="GeneID:59233743"
                     /translation="MVQFLCLIYSLLLGALTVNAVFIEDAFISDWQLENIGRYECVME
                     DQGQQNLIILSDYESNTLMSFVNETSGTIIFRYPLDFKAIDAMLLEDRSAYVLKDLEG
                     NTYLFDASNGFLLDDKISVETFVSSCIPHSSSVIISNNTLKFMDQDSQLEISQVPLRE
                     NFESLKFLYHDNLGSVKFLYSTDDYQYIFESFENGVPKNQWHRDEVVSDVCSYTFVDV
                     PNEALLSKKSELLTEQEFTNVWDAYTYRVSQNWGRFKGFLKENNYSPGKIIMRLMKMD
                     SHSLNYSSDVEFGLAKYLIVASKKGQLSAIDVRNGSKVWQRQTSLEDTIFMDNLSKKS
                     QIISFDKNGSYEIYDISNVTEPVLARKDRVEISSINLISKLSENKYLLQSGNDIKKIF
                     CLGGCVDEPITTVLATHDKKGVHGTIVKSDYQMQDTWEITMSESEEIVAFAKKGDEPI
                     SNIGVTLGNRTVLYKYLYPNLASYVVANKKTGNIYVHLVDTVTGELLFSQFHDEKVDI
                     YSPVNMVFGDSWFIYSFFSNEPIPEQRLVVVELYESLHADERVTTASEHYDPFRAVNK
                     PFTISNAYYFPEVIKRMVVSRTKYQITLSAIILELTNGQITYLSKALLNARRQPEVKM
                     TDSDKKEVMAMPYISTLPLNDQFIITHSRALLMGETAELISVATNLESTSIVCDIGHD
                     IFCTKLHPSGQFDTMSPSFEKGKLLATILGLFVLSYFLRPMVESAQLKTQWLVRS"
     gene            complement(<89251..>90669)
                     /locus_tag="HG535_0A00470"
                     /db_xref="GeneID:59233744"
     mRNA            complement(<89251..>90669)
                     /locus_tag="HG535_0A00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285941.1"
                     /db_xref="GeneID:59233744"
     CDS             complement(89251..90669)
                     /locus_tag="HG535_0A00470"
                     /inference="similar to AA sequence:RefSeq:NP_009886.1"
                     /note="similar to Saccharomyces cerevisiae MGR1 (YCL044C);
                     ancestral locus Anc_1.30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141836.1"
                     /db_xref="GeneID:59233744"
                     /translation="MISRLFAYTTVFRFHFQPKWAHEKWRNIEEGSQNIKLLELNKAF
                     RTKIIRVMALYTPPGKPSSRPSAGESINDSRDDPKDDSKKFYVRPSLGLRIWGPLVPA
                     SDNKMGLWSLVGAQTIVGLFCMYRLRGLRGPTKSLRRDIADIPSLNRFSTTHGEILAS
                     PVPAAMGHVRVGNTASVVNGGKVLGTTFGGASSFFKSKAQGTGQGFFKSAGVIAFRKV
                     LYLLTGTLLLSQSLLETCRLTILKYDPWVEEAKSVREKQFYNDIIQFYHEGIDPTKIR
                     VKDAKSGDVMSTNIPEVRQSVALVRAQSEAQNPIIRWYGPLEYQPMSFTEYLDRLEYH
                     LDMADFLQDKRNVKESTIQVMKKLTHTQGESEQIIKINEKNRRELLNITSNVDKGTMP
                     LSSNVQQYPSRGIVMDVNQDSPEKVDLEETWNLYDPWMNLAFDTSLSIKFLPTLMTPN
                     DIMDGKSKERNDSNDDKEPKAE"
     gene            complement(<90871..>92445)
                     /locus_tag="HG535_0A00480"
                     /db_xref="GeneID:59233745"
     mRNA            complement(<90871..>92445)
                     /locus_tag="HG535_0A00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285942.1"
                     /db_xref="GeneID:59233745"
     CDS             complement(90871..92445)
                     /locus_tag="HG535_0A00480"
                     /inference="similar to AA sequence:RefSeq:NP_009887.1"
                     /note="similar to Saccharomyces cerevisiae PDI1 (YCL043C)
                     and EUG1 (YDR518W); ancestral locus Anc_1.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141837.1"
                     /db_xref="GeneID:59233745"
                     /translation="MLVNKKTLFQAFAILASALSAKAQEASAPDDSAVVKLTSETFED
                     FIKENPVVLAEFFAPWCGHCKTLAPHYVEAAAALESEDIALAQIDCTVEQDLCMKQGI
                     RGYPSLKLFKNHDLENPKDYAGGRTANAIITYMKKQILPTVQVVDSQKDLEAILTKAT
                     QPVIFSNGDAALNETFFSIADKFSEEYTFVSFPGSKVKLAVQLPSEAEAIEYNGDITE
                     VEKNPEILESWLKVEALPYFGEITGESFGSYVESDVPLAYFFYTDDDEFEEYTEFFTD
                     LAKEHRGKINFVGLDSRKFGKHAENLNMDEQFPLFAIHNMSSNLKYGLPQLAKEEFEK
                     LTEAVKLETKDISKLVNEFLSGKSEAIIKSEEVPEVQESNVIKIVGKSHDGIAYDEEK
                     DVLVKYYAPWCGHCKRLAPIYEELADILASDEDSKDKFVIAEVDSTLNDIQDVEIEGF
                     PTIVLYPAGKNTEPVVFSSQRELTNFITFLEENAGNKVDFQIIHDSYKSALEAQKVAD
                     DLDEVEEDEDFEHDEL"
     gene            complement(<92688..>93863)
                     /locus_tag="HG535_0A00490"
                     /db_xref="GeneID:59233746"
     mRNA            complement(<92688..>93863)
                     /locus_tag="HG535_0A00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285943.1"
                     /db_xref="GeneID:59233746"
     CDS             complement(92688..93863)
                     /locus_tag="HG535_0A00490"
                     /inference="similar to AA sequence:RefSeq:NP_010805.1"
                     /note="similar to Saccharomyces cerevisiae GRH1 (YDR517W);
                     ancestral locus Anc_1.32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141838.1"
                     /db_xref="GeneID:59233746"
                     /translation="MFRIAKNLVKTLEQSVLTLSQDTNQLDLFFQSIPPNLLLPQRHS
                     QIQLEEGTDQQSQIAFDHRFNNVVSGLRVLCVDETQLQLQSFFDYIIGINDDVVPLIS
                     NQHGYFYPDYNKISQIFNAHCNQHLKLNVWSAKGGSFRDEYISVIAKDASQLDDVSLS
                     LSKESEHIFQPLGFKVQWTSLVASTFTYHVLNINIPNGPAAQSGLIPDEDYIIGCQDG
                     LLATGGEALLQDIVRSRANQDLILYVYNRVHDCVRPLTVQIGGDGRLGCNVGSGFLHR
                     IPAVSTSHQQFDEHQAHLTEELYSPSPLDLQPATDSVFVPGNVITPVSHSTTAGASPP
                     KKQAHRKKHVDPAVAATPMMNEYFSEGKDTSARAHSSTPDSTKLSQPPPPPTTTRRS"
     gene            <94676..>96184
                     /locus_tag="HG535_0A00500"
                     /db_xref="GeneID:59233747"
     mRNA            <94676..>96184
                     /locus_tag="HG535_0A00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285944.1"
                     /db_xref="GeneID:59233747"
     CDS             94676..96184
                     /locus_tag="HG535_0A00500"
                     /inference="similar to AA sequence:RefSeq:NP_009890.1"
                     /note="similar to Saccharomyces cerevisiae GLK1 (YCL040W)
                     and EMI2 (YDR516C); ancestral locus Anc_1.33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141839.1"
                     /db_xref="GeneID:59233747"
                     /translation="MSFDDLHKATARALTSAVDEICEEFKIDGDDLKTLTEYFIESME
                     QGLKPLEDGESEETSKGLPMIPSFVTGKPNGTEKGTLLAADLGGTNFRVCSVNLKGDH
                     TFSMEQTKSRIPDELLEDDSVTSSELFGYLARRTVLFMKKFHPEFFKEPGAESQKPLK
                     MGFTFSYPIDQKSLASGSLIRWTKGFKIKDTIGKDVVKLYQEELNSHGLGMINVVALT
                     NDTVGTFLSHCYSSGTADSLSSGEISEPVIGCIFGTGTNGCYMEKIENITKLPQEARE
                     GLLNEGKTHMVINTEWGSFDNELKYLPTSKYDVDIDQKLSSNPGFHLFEKRVSGMFLG
                     ELLRNMLVDLHERGLMLNQYRTYNQLPHRLRTPFELSSEVLSHIEIDDSTGLRETELS
                     LLQSLRLPTTPTERIEIQKMVRAISRRSAYLAAVPIAAILIKTNALNKRYHGEVEIGC
                     DGSVVEYYPGFRSMVRHALSLSPIGSDGERKVHLRIAKDGSGAGAALCALVA"
     gene            97644..97717
                     /locus_tag="HG535_0Atrna1V"
                     /db_xref="GeneID:59234620"
     tRNA            97644..97717
                     /locus_tag="HG535_0Atrna1V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59234620"
     gene            <98501..>100807
                     /locus_tag="HG535_0A00510"
                     /db_xref="GeneID:59233748"
     mRNA            <98501..>100807
                     /locus_tag="HG535_0A00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285945.1"
                     /db_xref="GeneID:59233748"
     CDS             98501..100807
                     /locus_tag="HG535_0A00510"
                     /inference="similar to AA sequence:RefSeq:NP_009891.1"
                     /note="similar to Saccharomyces cerevisiae GID7 (YCL039W);
                     ancestral locus Anc_1.34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141840.1"
                     /db_xref="GeneID:59233748"
                     /translation="MPLSYDRNSDRPDVFVPSYTSKRKKSMIVSSNEVQMNQNSNTAN
                     GQNDLRLFDKEQLAKLLIHALKELGYNQSSNALQEETGGIQVESAVVQKLFNIIRSGN
                     YENITVSLLCQLPLKYGSLNSEHIAGHLSQGQPPFNQSGYLGTSSEDNSMKIENIIVQ
                     GTDWQRVIAQMQQELKNFESILPVSGKSFDSQIAVQLISLVEIMVLINREIFLELVFD
                     QQNPPIAVLFLRNILRKYIQLWDSLLSLENHFLDKDTTFTPDNLLREMTTILTSPFDS
                     NQRNTMWHGSLARSRETLIEEISDYINPNDLVPKGRLLTLLKQAITYQQTQEAFSAVA
                     ENEELATIENGEQSTSFKQCNKKFNLLQDNISTFQQIKFVEEKTLIQNVDEIWYLQFS
                     PDGKYLASASADSLTDRKIMIYDVENDFQVYKVLAGNDQCVLYLSFSPDSRYVVSCPF
                     NEMANVYDIHSKGESTNINPNSENGLIAEVIAPINTFQIPSTPGSPEAASNNCGGPPR
                     IWCCDWFHTSDHKGRFVVGSPDREVAIYDMNRNAIILRLSNSICPPLNGTNDLGSAPL
                     EPFPRVHDLKITADDNYLILMTHQGNIDVYDLTQLPSNEKVEAKEANLDKVLLPRISR
                     LTVQKRMTCISLPNIVDPKSPLASLLLVSLQSNELQLWDFKEQILVQKFFGQRQEQFI
                     IRSCFGYNNELIASGSEDGKIYIWDRINGNIVGVLTAHVTQRPVPSGSNKKFGKNCNV
                     VAWSPTNKALCASGGDDGYIKIWRVGTE"
     gene            complement(<100898..>102460)
                     /locus_tag="HG535_0A00520"
                     /db_xref="GeneID:59233749"
     mRNA            complement(<100898..>102460)
                     /locus_tag="HG535_0A00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285946.1"
                     /db_xref="GeneID:59233749"
     CDS             complement(100898..102460)
                     /locus_tag="HG535_0A00520"
                     /inference="similar to AA sequence:RefSeq:NP_009892.1"
                     /note="similar to Saccharomyces cerevisiae ATG22
                     (YCL038C); ancestral locus Anc_1.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141841.1"
                     /db_xref="GeneID:59233749"
                     /translation="MSYGASNTGANTGIDPLRASLCAQKTKNNIRGWYFYSFSSEPFA
                     VSAVATYIPLLLEQFARMNGVLVDDHSISCSESHEKCVLGLFDNRVFIDTSSFALYTF
                     SASVLFQTILVITVSGLADIWKSVRFKSKVLIFFGVFGSLSLILISQLNSNQYYSLAL
                     LCITANTCYGVVNVVGNSLLPSFVSDLIKYDSSQMNKDVDSLTSIISGCGASIGYSSA
                     LFVQVATMWLIKRSKSQDNIQLGAMFVGLWWVAWQTPIFWLLADVETPSLIVEASSDV
                     DDFSQSLFKWEYMRYGWTSIFEAIKHARLLKDVVIFLIGWFIISDSLTTINSTAILFS
                     KTELKMSTLQLIVISILTMVNAIIGAYFIPHFIAQRFNWSAKNTLLYIICWASVIPLY
                     GMLGFFFNSFGLKHQFEMYIMAFWYGISLGGLSAVSRSLFSLIIPKGRESTFFSLFSI
                     TDKGSSIVGPVLVGFLTDRTHNIRYSFYLLFFLLVLSLPVLNTLNISRAKVEAQELSR
                     VETDVQILQNSH"
     gene            complement(<103107..>104651)
                     /locus_tag="HG535_0A00530"
                     /db_xref="GeneID:59233750"
     mRNA            complement(<103107..>104651)
                     /locus_tag="HG535_0A00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285947.1"
                     /db_xref="GeneID:59233750"
     CDS             complement(103107..104651)
                     /locus_tag="HG535_0A00530"
                     /inference="similar to AA sequence:RefSeq:NP_009893.2"
                     /note="similar to Saccharomyces cerevisiae SRO9 (YCL037C)
                     and SLF1 (YDR515W); ancestral locus Anc_1.36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141842.1"
                     /db_xref="GeneID:59233750"
                     /translation="MSSVMEKRPAPIVVKETMDDQPAEATPSEMAPKSQSEAEHESSG
                     TKKKEPILTPAPMPTKSPWKSLSSDVSVANITIESLEANKKKKSRPTASVSSGTKWVP
                     IKASIVVSGSKRSGSGGKKNPSKANGNAKSNNTGFRKKKHQHQQDGQQGQRQPQHLKK
                     QQHKVSGIRGRSNDNDGKIANDDDSTGSQGGVDESSSNDQRLQDGGASRPQDSQSLDS
                     DNQESLHSSSFEKTSNFTQYNESLSHNQPQNRRNNQTDQNQHYPYQQNNSQRKKYYNN
                     YNNNEAFQQPNFVPFQQQRNSFEPYHGRVPRSFKNGFHPRYHQIDASQMYQPYYSVQP
                     MMLAINNIAKQIEYYFSAENLDRDNYLRSKLSKEGYAPLPLISKFYRIVNMSFGGDSN
                     LIHAALKQIISNENATVEIAVGSIKGEEDFDDDLLLSQYFIRSKNWASLLPETFSTFV
                     EIKEILTPESIHEIATNLPTQPMNAPIYDESFNPNGHKDVGEQKSSNAPSTSNFEDSQ
                     GNEAKQ"
     gene            <105085..>106557
                     /locus_tag="HG535_0A00540"
                     /db_xref="GeneID:59233751"
     mRNA            <105085..>106557
                     /locus_tag="HG535_0A00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285948.1"
                     /db_xref="GeneID:59233751"
     CDS             105085..106557
                     /locus_tag="HG535_0A00540"
                     /inference="similar to AA sequence:RefSeq:NP_009894.1"
                     /note="similar to Saccharomyces cerevisiae GFD2 (YCL036W)
                     and YDR514C; ancestral locus Anc_1.37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141843.1"
                     /db_xref="GeneID:59233751"
                     /translation="MKRSFGKFISQSQIRERARHKVNRISTDNFSMAQKKISVRGLPD
                     NNISSSSRYWRARGLIENESGHGQPSWIEEQEQFAKLHKIPYNGKGEVATELADNIEK
                     YLDKVRARFKKEEDISDMKLAQKLAVYKKQWMRLYDGVDPDSLVLNGTETVEVRELKK
                     AYDKAIKALKREHSPIIHPSPRSSNFDYFCNGIRLLASKKTICFCLDAEAFEFDNDMV
                     TEIGISIYDPRENFFSFVPITRNYHIIISEALTVRNSKFVIDSKDCYQLGESLVLSLG
                     ECVEFVQALIDFYLEPRTVEDESWSRALVGHNVQGDISWLKQMGIKIPKVAKNHSDNL
                     DYQLSHVNAPNEPIFVLDTEKLYRFTYGNKGGSLGKLLRLLKIPHSFLHNAGNDAYYT
                     LQLLLRMCDINYRKQNGLDDLIEMNRRIEQWLQREREEPKVVPMSYLETVKTFHDSSR
                     IKKDSNPSGKKKGKTLVHQTEFGGSQWYPTAREAFLSTLR"
     gene            complement(<106580..>107032)
                     /locus_tag="HG535_0A00550"
                     /db_xref="GeneID:59233752"
     mRNA            complement(<106580..>107032)
                     /locus_tag="HG535_0A00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285949.1"
                     /db_xref="GeneID:59233752"
     CDS             complement(106580..107032)
                     /locus_tag="HG535_0A00550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141844.1"
                     /db_xref="GeneID:59233752"
                     /translation="MNIQRCKLRSLFFFFSPAGQRSKRKTNSSISYDCLALFSLSFFV
                     FTRRGLLFKNGRHHSIMHACSYRFRTVGTHGSGAEPHVSGFARSVAMQGQMGRNLKTC
                     PCVHEALIYHVSCFRHHCLSNLPLGTASPKGNVMYFLSIGCWFLCFLC"
     gene            <107258..>108652
                     /locus_tag="HG535_0A00560"
                     /db_xref="GeneID:59233753"
     mRNA            <107258..>108652
                     /locus_tag="HG535_0A00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285950.1"
                     /db_xref="GeneID:59233753"
     CDS             107258..108652
                     /locus_tag="HG535_0A00560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141845.1"
                     /db_xref="GeneID:59233753"
                     /translation="MVPTTWFGFLLLGVVSLVQAATTFTVPIDYNDELTVSYYFRNGN
                     SEVSVAASGQGLEITINADASEVCDILYSGMIVYAADGAAENTLISWNQYDVFYMVDN
                     NGNTVTWTSTNAQVCPVADSPSGSITSSAFATSGIESTTTLSGSISSSMMQTSDIASL
                     ITFTGEISGLGTSLVTLSSTAVPVAPSVTLSTVTSTVNGEVTEYTTFCPYTTIVPAEK
                     IVTYASAVTRTINGQESIYTTYFPVSTQFIATSTATGKQAPTVAPLTTVTTTQNGVVS
                     VYTTICPETSKMTSVETAQTVVTSIVNGSPTVYTTWYPYATVEQTASVVTTSVNGVAT
                     VYTTWCPVSTSATTALSDALAANNDTASQTATSISSTSVQTVTTSPAPTSTIIGGTSI
                     ITNGQSIEASSPSSRSSPASPASPSINTVQGQTTAASETTASVSAYQGLAATFKTNSI
                     LGYAAVLVGSFFLA"
     gene            complement(<108780..>109208)
                     /locus_tag="HG535_0A00570"
                     /db_xref="GeneID:59233754"
     mRNA            complement(<108780..>109208)
                     /locus_tag="HG535_0A00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285951.1"
                     /db_xref="GeneID:59233754"
     CDS             complement(108780..109208)
                     /locus_tag="HG535_0A00570"
                     /inference="similar to AA sequence:RefSeq:NP_009895.1"
                     /note="similar to Saccharomyces cerevisiae GRX1 (YCL035C)
                     and GRX2 (YDR513W); ancestral locus Anc_1.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141846.1"
                     /db_xref="GeneID:59233754"
                     /translation="MGFDISSFVPLVIILLVTNFLTRRYLNSGFQKKMVSQDTIKKVK
                     DLIAEKKVFVASKTYCPYCQATLRTLFEEYKVPKEKSVVLQLDTIDDGADIQEALKEI
                     NGQKTVPNIYIDGKHVGGNSDLEELKSSGKLDALLKDVLN"
     gene            <109506..>110528
                     /locus_tag="HG535_0A00580"
                     /db_xref="GeneID:59233755"
     mRNA            <109506..>110528
                     /locus_tag="HG535_0A00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285952.1"
                     /db_xref="GeneID:59233755"
     CDS             109506..110528
                     /locus_tag="HG535_0A00580"
                     /inference="similar to AA sequence:RefSeq:NP_009896.2"
                     /note="similar to Saccharomyces cerevisiae LSB5 (YCL034W);
                     ancestral locus Anc_1.39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141847.1"
                     /db_xref="GeneID:59233755"
                     /translation="MGFLTDHPHTSITDTIDRVVSARDYTLEVDLGTLVGLIRDNRNE
                     YQYTTNQEEAGRALRKKLKYGNKIQQSRSLDLMDLFISQGLKFTVLYNDDKLIDRIEG
                     IALGNVSDSRGNKYSSKIITKCANYVLGWYSYIRSTGLESSRCYASLNVVGEKVKRHY
                     SHRRRADERSNFMDDGADESIYATSAANPDQMYRIPQLDMKKAAPSIRLVISDGLASA
                     IALQNALMVLPSNQRSVDDEEATAKFIQARALRRKVLRYLQLVTEGEFLGSLIHANDE
                     LVSALTSYDEKSGVSEDTDGSSGDYDYSEDENQDSDEEESLDDRSLSSVQPSTSSNPF
                     GDHNRI"
     gene            complement(<110640..>111134)
                     /locus_tag="HG535_0A00590"
                     /db_xref="GeneID:59233756"
     mRNA            complement(<110640..>111134)
                     /locus_tag="HG535_0A00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285953.1"
                     /db_xref="GeneID:59233756"
     CDS             complement(110640..111134)
                     /locus_tag="HG535_0A00590"
                     /inference="similar to AA sequence:RefSeq:NP_009897.1"
                     /note="similar to Saccharomyces cerevisiae YCL033C;
                     ancestral locus Anc_1.40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141848.1"
                     /db_xref="GeneID:59233756"
                     /translation="MLRRFAFRHLPITVKRRSFVTLRSIHYTSARMSDNEQKWNPELT
                     GEQLRILRDKQTERANTGKYIHNKETGVYSCANCNTPLYSSGAKFESGCGWPAFYEEI
                     SKDALTYHTDISYGMKRIEICCGKCGGHLGHVFEGEGWKELLNLPSDVRHCVNSASLK
                     FSKS"
     gene            <111313..>111570
                     /locus_tag="HG535_0A00600"
                     /db_xref="GeneID:59233757"
     mRNA            <111313..>111570
                     /locus_tag="HG535_0A00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285954.1"
                     /db_xref="GeneID:59233757"
     CDS             111313..111570
                     /locus_tag="HG535_0A00600"
                     /inference="similar to AA sequence:RefSeq:NP_010800.3"
                     /note="similar to Saccharomyces cerevisiae EMI1 (YDR512C);
                     ancestral locus Anc_1.41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141849.1"
                     /db_xref="GeneID:59233757"
                     /translation="MSTKYPSTMRCMEAFDQLTICYSIGGQFRNYYRHGEFNQCQKPL
                     EKLKFCVVNGKDPVKVQEWYKNQIEYNKTHRGTSDDIWQER"
     gene            <111859..>112791
                     /locus_tag="HG535_0A00610"
                     /db_xref="GeneID:59233758"
     mRNA            <111859..>112791
                     /locus_tag="HG535_0A00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285955.1"
                     /db_xref="GeneID:59233758"
     CDS             111859..112791
                     /locus_tag="HG535_0A00610"
                     /inference="similar to AA sequence:RefSeq:NP_009898.1"
                     /note="similar to Saccharomyces cerevisiae STE50
                     (YCL032W); ancestral locus Anc_1.42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141850.1"
                     /db_xref="GeneID:59233758"
                     /translation="MSLNHEEGSAVGQASIVDDNFKKWSSNEVVTWCVASLGLSESDP
                     LAERLQKNDVSGELLTELSLDDLKELCEPDLDKAIRFKVLLNKLQYDAGVDSKLQKQQ
                     ENMIITLKNLHSTLTQKLQDFQTQYSKLRLDVLEIVKNPSISPRIPLQQQHSSQQLQQ
                     LPQQPSDYFDGPHHPGDYPSGSSKTPAFAPKLPISRSTSSQLNTADTPGLLSSGSNEP
                     LKQLRASKEDSCQRILKNAMKRHHLNDQEWKQYVLVICYGDQERLLDLEEKPVVIFKN
                     LKQQGLHPAIMLRRRGDFEELNMASEDVTPGGRL"
     gene            complement(<112863..>113747)
                     /locus_tag="HG535_0A00620"
                     /db_xref="GeneID:59233759"
     mRNA            complement(<112863..>113747)
                     /locus_tag="HG535_0A00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285956.1"
                     /db_xref="GeneID:59233759"
     CDS             complement(112863..113747)
                     /locus_tag="HG535_0A00620"
                     /inference="similar to AA sequence:RefSeq:NP_009899.1"
                     /note="similar to Saccharomyces cerevisiae RRP7 (YCL031C);
                     ancestral locus Anc_1.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141851.1"
                     /db_xref="GeneID:59233759"
                     /translation="MARKSVSPDCMKKGFLVIPFKLPTHRTLKNDDAFHFMFVKKHQS
                     QYENEQNCLFLVNIPLLTHLDNLKIAFNEICSRFDTVSHIEELLYNDEFGLEEVDLSA
                     LTSDLMSVKDAESKRYTPRNTALLKFVDEASLTNCFDALKKYSKLDSSSLIEWQYKSP
                     TIATFLNFYRPLDVDYLKWDIHMHMELFEQREQEAQDAIQTSIVDEDGFTLVVGKNTK
                     SLNSIRKKILKKNPLSKHENKVIPPSTVDKKAKKDFYRFQIRERKKQEINQLLKKFKE
                     DQEKIKIMKANRRFNPYT"
     gene            complement(<114009..>114425)
                     /locus_tag="HG535_0A00630"
                     /db_xref="GeneID:59233760"
     mRNA            complement(<114009..>114425)
                     /locus_tag="HG535_0A00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285957.1"
                     /db_xref="GeneID:59233760"
     CDS             complement(114009..114425)
                     /locus_tag="HG535_0A00630"
                     /inference="similar to AA sequence:RefSeq:NP_010799.3"
                     /note="similar to Saccharomyces cerevisiae ACN9 (YDR511W);
                     ancestral locus Anc_1.44"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141852.1"
                     /db_xref="GeneID:59233760"
                     /translation="MRTTGAVLHRVTSTLLKARRIITKGSQPILPPLQLYRRILREHK
                     NLPQLQRELGDQYLKSEFRLHKNTDNPLHIVGFLTSWQDYLGLISKGDWSEATLTSDV
                     LEKLSPDQVVQLYELMKETEQIRTGEINEAASKSME"
     gene            complement(<114706..>117123)
                     /locus_tag="HG535_0A00640"
                     /db_xref="GeneID:59233761"
     mRNA            complement(<114706..>117123)
                     /locus_tag="HG535_0A00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285958.1"
                     /db_xref="GeneID:59233761"
     CDS             complement(114706..117123)
                     /locus_tag="HG535_0A00640"
                     /inference="similar to AA sequence:RefSeq:NP_009900.2"
                     /note="similar to Saccharomyces cerevisiae HIS4 (YCL030C);
                     ancestral locus Anc_1.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141853.1"
                     /db_xref="GeneID:59233761"
                     /translation="MVFPILPIYGNDAATLIKDKPFLTIAGQALLDSSELSQVEIKTF
                     AEEFGSSIKIISVLVKETSRFTDDEIVDLLNNGIFTLFLSDKSYADHLSQEVGVPKER
                     LTILKGSCYKNHFIVVDDFKIDSLIPANQLTVEIFVKSLISAIKTDREDKLLTTLVVD
                     THDRCLGLVYSSVESIKIAIEKKAGVYFSRSRNEIWIKGLTSGNTQQLKCIQLDCDGD
                     ALKFVVEQGGENSSFCHLETESCFGQFDHGLIGLERLLQQRLKNAPEGSYTHRLFNDP
                     ELLTAKIKEEAEELTEAKTKSEIAWEAADLFYFALAKLVSEGVSLSDVETNLQTKHLK
                     ITRRRGDAKAKFLNTNDKPTEPQADSGLIHLKILKSKENVALKEALTRPIQNTNQIMK
                     LVNPIVESVRNNGDKSLMEFTQKFDGVKLKTPVLEAPFPKEYFDGLTDEMKESLDLSI
                     ENVRKFHAAQLQETVLKVETKPGVLCSRFPRPIEKVGLYIPGGTAVLPSTALMLGVPA
                     QVAGCKEIIFASPPRKSDGKVSPEVVYVASKVGASMIVLAGGAQAVAAMAYGTESVPK
                     VDKIAGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVICDEDADADFVASDLLSQ
                     AEHGIDSQVILLGVDLSSKKVEEIQAAVHSQATNLSRVDIIRKCISHSSIVLCESYEE
                     AFQISNQYAPEHLILQISNAEDYVKDVDNAGSIFVGAYTPESCGDYSSGTNHTLPTYG
                     YARQYSGLNTSAFQKFITSQSITPEGLDKIGKAVMCIAKVEGLDGHRNAVKIRMSKLG
                     LLPENFK"
     gene            complement(<117706..>118605)
                     /locus_tag="HG535_0A00650"
                     /db_xref="GeneID:59233762"
     mRNA            complement(<117706..>118605)
                     /locus_tag="HG535_0A00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285959.1"
                     /db_xref="GeneID:59233762"
     CDS             complement(117706..118605)
                     /locus_tag="HG535_0A00650"
                     /inference="similar to AA sequence:RefSeq:NP_009901.1"
                     /note="similar to Saccharomyces cerevisiae BIK1 (YCL029C);
                     ancestral locus Anc_1.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141854.1"
                     /db_xref="GeneID:59233762"
                     /translation="MERYKEKIGCLVHIPNVGRGKLKYLGPVEGKPGIYAGVDLLANI
                     GKNNGSFGERQYFESEYPHSGLFVQLEKLIPLIESTYDSKKDPLAIESSPQNEKENVQ
                     NKERNLWSSETTIQKTSTGNNQQSPTLVNNLLTSSDGKSPKHDDFKTTPSSGKHESKS
                     SLGYSDVDGDVCMSALSSKDAVPYSEYYSSKSYRDQQLRIEKHEKEIMQYKKLLNEQR
                     VLLEELQPAIEEYEKNMLLVEKENQELRYQLIKQQEQQEKQKQFFEGEHEQLLTVVEE
                     LHEQMKSNERYFKNSSGTCLPKD"
     gene            complement(<119013..>120473)
                     /locus_tag="HG535_0A00660"
                     /db_xref="GeneID:59233763"
     mRNA            complement(<119013..>120473)
                     /locus_tag="HG535_0A00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285960.1"
                     /db_xref="GeneID:59233763"
     CDS             complement(119013..120473)
                     /locus_tag="HG535_0A00660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141855.1"
                     /db_xref="GeneID:59233763"
                     /translation="MRTSTVAMSLLTGALLVGAQNTVYEDFTATVTPVILTKPGFSGS
                     SSGATSTSSTDFEPSSTASSAPVSSASSSSFSDSVPASSVVSSMFSSASSVSSEVVPS
                     TPISSSIGSSFIYSNSSSTISSATSSYSPISSSSFMSMASLSPSNSDATSAILTTLPA
                     LSVGSTPSSSPSVSVSESGSNSASTSSASPSSEIISTLPSGSSDSSSSGTSSTLLSIP
                     SITSTSTTPSTTSTTSATPSTTSTSNTPSTTSTSTATSTTSTTSATPSTTSTSSTSST
                     TSTTSSISTTSIATATFSSSSVTTTSSTTSSPTSTVVPAPQSSLTLSNALASQLLAEH
                     NSKRNLHQNTPPLTWSDSLSAWAFTYANSLRGTEYDPCSGRLLHSSNRGFQGENIAFA
                     TQSNPTALVDLWYDEIQYYDYNDITGITHNNQDVGHFTQVVWVDTTEVGCAVIDCPAN
                     DGTYLLCEYTPAGNVYNGNADADEFSYFRTNVRPLK"
     gene            <122145..>123587
                     /locus_tag="HG535_0A00670"
                     /db_xref="GeneID:59233764"
     mRNA            <122145..>123587
                     /locus_tag="HG535_0A00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285961.1"
                     /db_xref="GeneID:59233764"
     CDS             122145..123587
                     /locus_tag="HG535_0A00670"
                     /inference="similar to AA sequence:RefSeq:NP_009903.2"
                     /note="similar to Saccharomyces cerevisiae FUS1 (YCL027W);
                     ancestral locus Anc_1.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141856.1"
                     /db_xref="GeneID:59233764"
                     /translation="MTTTSTTTLNPLLVSLEHLSSFLSPARSDVIITSTQQVTAGVNS
                     LIYPTREIQPPAKPQESKSASSLTIGLSIGLPVGLFCLVLIILLFIFYLGVWKKQNKS
                     YTEGEKYANYLGEPLGSADDFMSSRIQYKMSKPTDQHILTPKASVYKNYSITTSSVDI
                     KKDVDTFLYSKPPNIYHIDSRRTSSNNLSKLANNSNIVCQTLEENEVCNNANNYTKGR
                     WTYQSPLSKWFLRNSTYLDEGLTFPIFVKTPALHLKQLKILSRIQKDYVDIGCSLKDE
                     RSPILERIDDSPCSNSKSEHEESASSSQHAAHTPMPILYGSLDAKLRATPKEDPDVPA
                     YPGDIKALDANPKESFTKRKRKKNRKLRKHLRLITNVKPLPLTPKNNNVPTDLIVGEV
                     YAVTEQYEAKLVDEISILKGNYVKILATHTDGWCLAEKCDKKGRIQDILDCENDGAAS
                     LNDTNYLNSYRGIIPGNCLGSVKGNAYFAF"
     gene            complement(<124167..>126122)
                     /locus_tag="HG535_0A00680"
                     /db_xref="GeneID:59233765"
     mRNA            complement(<124167..>126122)
                     /locus_tag="HG535_0A00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285962.1"
                     /db_xref="GeneID:59233765"
     CDS             complement(124167..126122)
                     /locus_tag="HG535_0A00680"
                     /inference="similar to AA sequence:RefSeq:NP_009905.3"
                     /note="similar to Saccharomyces cerevisiae AGP1 (YCL025C)
                     and GNP1 (YDR508C); ancestral locus Anc_1.50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141857.1"
                     /db_xref="GeneID:59233765"
                     /translation="MTAQDLDGSSDSDIISPTYEMENIKKNSENSKHQQLEQEHEVEY
                     FDKSGQPSQSPECDNTMTSESEYNYKNTKSSFFRRFVDSFRAAEVASTAEEDLENDLT
                     TCISPGTLSDYKRSGTTTLKHGPTAKDGSEGLKKTIKPRHVVMISLGTGIGTGLLVGN
                     AKSLNQAGPAGLLLGYGIMGTCIYCIIQAAGEMAVVYSNLGGGFNAYPSILVSPSFGF
                     SVAWVYCLQWLCVCPLELVTASMTIQYWTTTVNSDVFVVIFYVLIIVINVFGARGYAE
                     AEFFFNCCKILMMIGFFILGIIITAGGAGNDGYIGAEYWINPGAFRGEKAIDRFKGVM
                     AVFVTAAFAFGGTEFIALTASEQSNPRKAIPSAAKKVLYRIICIFLGSIALLGFLVPY
                     NSSELMGTGGSNTKASPYVIAIASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLL
                     SLAQQGYAPKIFKFIDRKGRPGKAMLVSSLFGVIAFCAASSKEEQVFTWLLAISGLSQ
                     IFTWFAICISHTRFRRALKVQGRSLGELGYKAQFGVWGSYYAAFMMFAVLIAQFWVAI
                     APIGKSGLDAQNFFENYLAMLCLIALYIGYCIWKRSLIFFIRAKDIDLDSHRQVFDEE
                     LLKQEDEEYREKLKNGPVWRRIYAFWC"
     gene            <127325..>127630
                     /locus_tag="HG535_0A00690"
                     /db_xref="GeneID:59233766"
     mRNA            <127325..>127630
                     /locus_tag="HG535_0A00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285963.1"
                     /db_xref="GeneID:59233766"
     CDS             127325..127630
                     /locus_tag="HG535_0A00690"
                     /inference="similar to AA sequence:RefSeq:NP_010798.1"
                     /note="similar to Saccharomyces cerevisiae SMT3 (YDR510W);
                     ancestral locus Anc_1.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141858.1"
                     /db_xref="GeneID:59233766"
                     /translation="MSETPPESKPEAKPEVKPETHINLKVSDGSSEIFFKIKRTTPLR
                     RLMEAFAKRQGKEMDSLRFLYDGIRLQADQTPDDLDMEDNDIIEAHREQIGGNSVAA"
     gene            <128137..>131595
                     /locus_tag="HG535_0A00700"
                     /db_xref="GeneID:59233767"
     mRNA            <128137..>131595
                     /locus_tag="HG535_0A00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285964.1"
                     /db_xref="GeneID:59233767"
     CDS             128137..131595
                     /locus_tag="HG535_0A00700"
                     /inference="similar to AA sequence:RefSeq:NP_009907.2"
                     /note="similar to Saccharomyces cerevisiae KCC4 (YCL024W)
                     and GIN4 (YDR507C); ancestral locus Anc_1.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141859.1"
                     /db_xref="GeneID:59233767"
                     /translation="MSTMNKKSFSTIKGDSIGPWKLGETLGLGSTGKVQLAYSESTNQ
                     QAAIKVISKAIFNGKVNGNGSIAANSTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWE
                     TDSNLYMVLEYAQKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKP
                     ENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSC
                     GVILFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDEDEISLDAMDLIQKILTVDPE
                     VRIKTRDILKHPLLQKYPSISDSKSIRNLPREDTYLHPLSEGSSSDIDPTILQNLVVL
                     WHGRDPNHISAKLREPGANAEKTLYALLDRFKNDTEKEAARQKQIKKIQSQSVPVPDP
                     SNIKKSISKSNVAISPKKRTRTSVISVSSAHKRPVSFNKISSITYSSGYSSSNSTTPS
                     KKVPLNFSSNKRLSNILTHSNNSSPTPASRNKRVSIIDLEKTNRPPPVPLNVLKDYNT
                     GTKTRRMSRASMRLSFKPSMKRGSITTKLISTYAKLSEDDDWEYIQKETKRTSSDFAT
                     LCDEIFEHEKFEQIRKEKEELEKKVRETKEREERDRREAEAEKLRNAREKAEMVRRQV
                     EAQRQMDEEVAKLRNELQGQQFDDSEKNSETLEVNTRSISAPMERNNKRDSVANIQSN
                     IEDILRQRTFSLQTRPVSKLDPGILYSENNEVDSESSPILEDKRLQNEKMILETIRRS
                     KFLGSSFDIKKELDAAEREQARKYKQKSMNQERITSTTNEPFETQTLPKNAVSSAPLK
                     ESDAANEPRKLSEIKVPQFTRKSRYFSESNKRMSVLSMYSTRQSFQNLKYMLNDHDAN
                     IDNIPDSPRTYSAQEPEFLFEAVNDEAERTGDSSNDGRIYEVPDELGLTKDGMKLNFA
                     DRFKEKGNKKDSERNEDGNVKLPSLPPLEGKNASGLGIYQSSSTESVTELQPPIIKSM
                     IPSDNIEKTKNHSTSKSEIHKTSPKVPDEPPLNTIMKKRENEGDAQRKPLRDITEKKS
                     NMSFFRKFSKSSNEKESKSFEAELYAKVSAKQLFNGLQTLLRGWTKYGLKDVKSYPEK
                     FTLTGKLSNENILSLRSTLFEIVIWERGNASIVGFRKKSGSSKTLKRLVNEIEKVLVK
                     EGVLNN"
     gene            <133448..>135304
                     /locus_tag="HG535_0A00710"
                     /db_xref="GeneID:59233768"
     mRNA            <133448..>135304
                     /locus_tag="HG535_0A00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285965.1"
                     /db_xref="GeneID:59233768"
     CDS             133448..135304
                     /locus_tag="HG535_0A00710"
                     /inference="similar to AA sequence:RefSeq:NP_010794.3"
                     /note="similar to Saccharomyces cerevisiae YDR506C;
                     ancestral locus Anc_1.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141860.1"
                     /db_xref="GeneID:59233768"
                     /translation="MIVSCAVTWLLVQCSLFLRTLSTPIYDDVKDRTHLIDLEVRSAY
                     NGNDRRVLSVNGHLDSYGPTIRVNSGDNIRLHLRNSICSQNEVNKGKTYSIWREYCET
                     ALHFHGLTPIGNQNDGVPGFTQPPILSGESFWYNFTIPEETCGTFWYHSHSAVQYGDG
                     FRGIFIVDCTRYNHQVNKVIHTLQQSGEIQNGVMLLPEENFDVTNLYEEQVITLSDWY
                     YSWNLDVVKDRVLSYDSTTDPHIDQSLINGISDDNLQFKLQDATEGILIRIINTGMSG
                     TQIFHVEGHKLVIVEADGILVNPYVLDTLSLAVGQRYTLLVKLADDINYRGVKVVNGC
                     SKMMGYIEKTAWFVKEAVDKVTLDSPSNIKALPGLDKNELYKSLEPTYEIFEDRKGLW
                     VEPDIKTIELNYEYFSDSHTKEKYGTGMYKMNGKTLNEYLESPVEFNTGQVVQIIINA
                     NDHMRHPWHLHGHPFQLVSIGSGHEGALNINDLNNNAGRKYKDDIKYWQETGKTPMTR
                     DSINIQGRSYAVIRIIANSPGFWLMHCHIDWHVQKGLGVAFHELEPRSLPDSVDSAQP
                     PSHTEEMQQEESHGNETIDDTGTQSFPHRHKVLAIYFLIMVFINCIVYQVIM"
     gene            <135784..>138198
                     /locus_tag="HG535_0A00720"
                     /db_xref="GeneID:59233769"
     mRNA            <135784..>138198
                     /locus_tag="HG535_0A00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285966.1"
                     /db_xref="GeneID:59233769"
     CDS             135784..138198
                     /locus_tag="HG535_0A00720"
                     /inference="similar to AA sequence:RefSeq:NP_010793.2"
                     /note="similar to Saccharomyces cerevisiae PSP1 (YDR505C)
                     and YLR177W; ancestral locus Anc_1.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141861.1"
                     /db_xref="GeneID:59233769"
                     /translation="MNTSDRKTNYGKTAMAAELPSISSATSISDNVGLRDYYDKLLFK
                     NNNGKSLTDLTQRATQGTAVVNNGVYVANNGNNGTVTGSESTEGKEELSASTGHSSRV
                     GGDGQKMDFINGFNGTNGMRNGFRLPFSSFQMTPSNSEPTPPSASLSMTQPQSMLQQQ
                     QHQPIFNFDEEATMGYQQNSASISTPAFSFDFGPNNRHPVNYYSGSLRSEQNPIESSM
                     KNLSLEDPNSQQYPSARRSSYISDTLIHGQVGSAPNTYANSIFNMPGDNVAPKTMNYL
                     PVSGTTQMGHPQPPPTAPPITYGNAVPNYNQQRRHTQPVNSLSAPSTANANYGHAQIG
                     QGVSRNRYLNYSKQQQQRQQVSDSSNGEMLLENGLVLLASQKLVSSRDLQALYKDCGT
                     KYFSSKLVFEFTDHIKSLLGSKVSTINDSRKQPSVPRFLAFLKSCNLNYNPQSDAFVS
                     DPQVSPKNHTTNVTASSGNNNISNIPAHGNVRERRSNSTSSYLHYKPLVLVALKNGKL
                     ELLSTPQNTNISMQRGDLIIIDGDRGKDLALVVEPVVSLDLALFVNFLKKKIHFDSLI
                     TSKSQHHPNHTFIQALIESTKGQSDKLNSKLYDVIELTQLIVPSKQVLRFATTWEVAT
                     NLHNKFQDELKALHIAQLKLQSLNSGFTHHHNANSVTYNAPASKSDGNPAPPGLSIRP
                     QLNIKILNAEFQFDRKKLTFYYVCEERNDFRELIKELFKFYKTRIWLCAIPNNLGIDS
                     KYYDSQRKELQMYQEMMQHYAAEDLTDANAQQGGGFIVAPPLSKIELDNFQIGVYKEL
                     VLELFG"
     gene            complement(<138403..>139044)
                     /locus_tag="HG535_0A00730"
                     /db_xref="GeneID:59233770"
     mRNA            complement(<138403..>139044)
                     /locus_tag="HG535_0A00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285967.1"
                     /db_xref="GeneID:59233770"
     CDS             complement(138403..139044)
                     /locus_tag="HG535_0A00730"
                     /inference="similar to AA sequence:RefSeq:NP_013279.1"
                     /note="similar to Saccharomyces cerevisiae TFS1 (YLR178C);
                     ancestral locus Anc_1.56"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141862.1"
                     /db_xref="GeneID:59233770"
                     /translation="MMHAFDFTKTTNEALLKHGILEDVIQEADFKPWGVLAGEFSSDS
                     PIAMGNTLSAKDAQSRPTVQFNLNPEEGAPRVSDKDLFTLVITDPDAPSRSDHKWSEF
                     CHYIEADIKILDQTATATSGKVSEPQFVCSKLNSGTELVSYHGPAPPKGTGKHRYVLL
                     LYKQPAGVVSSKFTEVKDRPNWGYGTPATGVKKWASENNLKPIAANFFLVENK"
     gene            <139439..>140284
                     /locus_tag="HG535_0A00740"
                     /db_xref="GeneID:59233771"
     mRNA            <139439..>140284
                     /locus_tag="HG535_0A00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285968.1"
                     /db_xref="GeneID:59233771"
     CDS             139439..140284
                     /locus_tag="HG535_0A00740"
                     /inference="similar to AA sequence:RefSeq:NP_010791.3"
                     /note="similar to Saccharomyces cerevisiae LPP1 (YDR503C);
                     ancestral locus Anc_1.57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141863.1"
                     /db_xref="GeneID:59233771"
                     /translation="MPGAAANAQEKTAQKMQWNALLEYSSSFAMHYLLCLLCGVAFAV
                     MEFCVKPKTDDIEFSTLDPTIAKTFKPHELVGNGSCLFIAAGVPLLVITGYCVYGRKM
                     LKKHKKTDAEKVHPIFSLWHTSLLALCAALTLNGALTCFLKLVIANPRPDFISRCQPV
                     VTRQDDRFSLSDCTQTDIYTLYDGLRSTPSGHSSFALAGLGYLYMWQTRFICGNKSRH
                     LWSPLLIVLVMLSRVVDHKHRWSDLVYGGLVGLASLGFAWTQIVRPQLTLADSWQLPR
                     PVTQA"
     gene            <141253..>142401
                     /locus_tag="HG535_0A00750"
                     /db_xref="GeneID:59233772"
     mRNA            <141253..>142401
                     /locus_tag="HG535_0A00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285969.1"
                     /db_xref="GeneID:59233772"
     CDS             141253..142401
                     /locus_tag="HG535_0A00750"
                     /inference="similar to AA sequence:RefSeq:NP_010790.3"
                     /note="similar to Saccharomyces cerevisiae SAM2 (YDR502C)
                     and SAM1 (YLR180W); ancestral locus Anc_1.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141864.1"
                     /db_xref="GeneID:59233772"
                     /translation="MAGTFLFTSESVGEGHPDKICDQVSDAILDACLAEDPLSKVACE
                     TAAKTGMIMVFGEITTRAKLDYQKIVRDTIKQIGYDSSDKGFDYKTCNVLVAIEQQSP
                     DIAQGLHYEKAIEDLGAGDQGIMFGYATDETPENLPLTILLAHKLNMAMADARRDGSL
                     DWIRPDTKTQVTVEYADDHGRWVPKRVDTVVVSLQHAEEISTEELRSKVKTEIVQKVI
                     PSDLLDENTKYHIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGASAVGGGAFSGKDYSK
                     VDRSAAYAARWVAKSLVNAGLCKRVQVQFSYAIGIAEPLSLHVDTYGTATKSDDEIIA
                     IIKKNFDLRPGVLVKELDLARPIYLPTASYGHFTNQEYPWEKPKTLNF"
     gene            complement(<142823..>143932)
                     /locus_tag="HG535_0A00760"
                     /db_xref="GeneID:59233773"
     mRNA            complement(<142823..>143932)
                     /locus_tag="HG535_0A00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285970.1"
                     /db_xref="GeneID:59233773"
     CDS             complement(142823..143932)
                     /locus_tag="HG535_0A00760"
                     /inference="similar to AA sequence:RefSeq:NP_013282.1"
                     /note="similar to Saccharomyces cerevisiae VTA1 (YLR181C);
                     ancestral locus Anc_1.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141865.1"
                     /db_xref="GeneID:59233773"
                     /translation="MGAKSLVDRLVATALDFDTSGLPIVSYYLRLYAVEEILNEENRS
                     GDLTQLASDLLGSVERFKNSADLDEDDTQRNAIRSLIHDQEKAKVYVSNFAMSLYNGK
                     LQQIQHGPWDLNLRRGLWCCIDIFSCIIHLWDDPDGSYRKRIKYCKLYLSKLSKGELG
                     GISGNTNNFNSGAGKQNVIGPDLNTLDEDETYKAAKKVPSFEGVEEPEAPPSQLDYGD
                     FVSDADDVNTSEDKLNEMLERLKAKEEDDEVSTQSASETKEEESSPLFLPHVPKDVPK
                     DVPSGNSVGNRQQETDTIPTFLDSEDECDIQNTIKEEPKTYTRGELNNMMEKSSKIEK
                     IQRMAKYAISALNYEDLSTAESELSGALEILKSLK"
     gene            <144126..>146468
                     /locus_tag="HG535_0A00770"
                     /db_xref="GeneID:59233774"
     mRNA            <144126..>146468
                     /locus_tag="HG535_0A00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285971.1"
                     /db_xref="GeneID:59233774"
     CDS             144126..146468
                     /locus_tag="HG535_0A00770"
                     /inference="similar to AA sequence:RefSeq:NP_013283.1"
                     /note="similar to Saccharomyces cerevisiae SWI6 (YLR182W);
                     ancestral locus Anc_1.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141866.1"
                     /db_xref="GeneID:59233774"
                     /translation="MSVLEVTKLIGEQDFQLPLTLKRNNSTGYFLLRPFLPLLQSFNR
                     KNDGNEDSSDAKGDEELNNEQEDEILSQFGILVDTDDQGKKWITSEKAVELLKKLNLF
                     HLFEAELGSNLEVNEGSSRFDSLDKSQPEVNSDGKKSQNSIIGEEDIKMDANDHRSLL
                     GNSTSSSIVNHPVEVIKRHNDEINGKNANELASPLKKSKIDNFSPKEMNSNAPHESLD
                     SNVSSKKIRTFNHDLNSEMLKQPLRLQKTQKAPQVSNNNQRVKLETFLQRLLFPAIQD
                     ISSSNNSSQPLSFELALQEVENSYPDIPLNLNIPVDERGNTPLHWLSSIANLELVKYL
                     VEHGTNRLLGDNLGESALVKAVKSVNNYDSGTFEKLLDHLYPCLILEDSMNRSILHHI
                     VITSGMPGCSSAAKYYLDILMGWIVKKQSRVIEGAGSDIILETLDLKWVISNMLNAPD
                     SNGDTCLNIASRLGNVSIVDALLDYGADPYVANKSGLRPADFGAGTSKLYTNGTSNAE
                     KQSDKLSPHETSTDVNVPDTISLVEGMQSLLATVSKDYATEVKEHQDKLNKLHKELNS
                     HREVLAASRDRLAHAKQLQDEHAILKEQLGNIRQGVVEEEQKFKEESRLLGLSSEDTA
                     GADWDSSEFDADEPFRVDFVYEILENKLANDYNGSVDKLLESETIDSMFNEVRSAYYF
                     HHQDNEKLDSMLPPSVLLSARINAYKRNDAQLNSTLEEIRRKQKVLESKFRRVLCLCL
                     KIDEDKVDGMLDGLLQAISSEDPQDVDTDEMQEFLNKHNT"
     gene            complement(<146575..>148254)
                     /locus_tag="HG535_0A00780"
                     /db_xref="GeneID:59233775"
     mRNA            complement(<146575..>148254)
                     /locus_tag="HG535_0A00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285972.1"
                     /db_xref="GeneID:59233775"
     CDS             complement(146575..148254)
                     /locus_tag="HG535_0A00780"
                     /inference="similar to AA sequence:RefSeq:NP_010789.1"
                     /note="similar to Saccharomyces cerevisiae PLM2 (YDR501W)
                     and TOS4 (YLR183C); ancestral locus Anc_1.61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141867.1"
                     /db_xref="GeneID:59233775"
                     /translation="MVGSFPPSSPVAASGSAFGQHLHRESSTDDISIEPLNNNYMTKF
                     SVNKPALYKVQSTCDDRSQYGLKGSKIQFPTPQASSSTGRSSSPIRAGAVESRPSSSP
                     SFSPALSPSSPHVISQEISSTVGTDWINIELDSRNCSRLAIGRKKSVCDIVLPSKKNI
                     SRQHAFITYFPVENLLKLECNGTNGLVIELPCGINCKLMKKDSTKGSYQLSAADAGNE
                     ESFAQNGNLEKRRNALSFVLLKGEKVVMPFIAGTLIDFRQAEAILTLKQDDCPVDADD
                     NSTETEDEREALFTKSDDFHEGSNTPERFITVATSPSTLKLSEEMIPKNPPSSPSYNA
                     ASNTTPITSNPPQLFTKFQATPLKLFDIQTPATPKKIKQLNTRINESYEAQDTPISKN
                     RKVESLSKPLLLHRPRNDLSVEKPDEQKRKQRKKITNKDAKTKDPFEALEERGIDCSE
                     LQNVLANHLAFANVQQTPLFQLLQVNSKTSTTSRQELRALLAREPCIGVIYREGKDAA
                     GKPLDEEYFYDVENDSNEERRNLVTSLKGGRSGLRSCRRTHKQYFWKKPAK"
     gene            <149065..>149665
                     /locus_tag="HG535_0A00790"
                     /db_xref="GeneID:59233776"
     mRNA            join(<149065..149071,149406..>149665)
                     /locus_tag="HG535_0A00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285973.1"
                     /db_xref="GeneID:59233776"
     CDS             join(149065..149071,149406..149665)
                     /locus_tag="HG535_0A00790"
                     /inference="similar to AA sequence:RefSeq:NP_010788.1"
                     /note="similar to Saccharomyces cerevisiae RPL37B
                     (YDR500C) and RPL37A (YLR185W); ancestral locus Anc_1.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141868.1"
                     /db_xref="GeneID:59233776"
                     /translation="MGKGTPSFGKRHNKSHTLCNRCGRRSFHIQKKTCSACGYPAAKT
                     RSFNWGAKAKRRKTTGTGRMRYLKTVSKKFKNGFQTGTPKAASA"
     gene            complement(<149789..>151978)
                     /locus_tag="HG535_0A00800"
                     /db_xref="GeneID:59233777"
     mRNA            complement(<149789..>151978)
                     /locus_tag="HG535_0A00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285974.1"
                     /db_xref="GeneID:59233777"
     CDS             complement(149789..151978)
                     /locus_tag="HG535_0A00800"
                     /inference="similar to AA sequence:RefSeq:NP_010787.3"
                     /note="similar to Saccharomyces cerevisiae LCD1 (YDR499W);
                     ancestral locus Anc_1.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141869.1"
                     /db_xref="GeneID:59233777"
                     /translation="MVQSKDGLSSDEDDDLILQLELRSAKTATQLPAKSAQTLQQPPL
                     ASSAKNFKDEMIVAQGEASMLRDKIFFLQKQIKRENELQSLKAEELNSVHHEELKKVK
                     LALQNLEDEKKFLLLEVKKANSSTRSRGNSSFPYSNADRSTSGSADEVTATENTRNRV
                     IAPINKKRKIDNESLLKHYVTLNPGKIPRDETSDFVDYLLLHKLVGSELSTIEILHSL
                     ELRYIANFNFNGFKISRGDSIGKSLVTLLLKCKKCLTLDKFINTLLESVAILIKEISL
                     HKHESDLAIPFLVVIMYQTISFRPSAVHPMALKDLLHFISDLIKAYQHVLKQSMFEND
                     PGTSAEPQIFQYELIDFLTTLYSFDTLETSLRILRYLPSAVHEEVLDSDLLESLKQIC
                     KCALTISYTPIMNIVFNAIAILNALCNMMVSGKSSLTIIESQWWKNCIPRLYHILSRG
                     VKSVNILSENDGNDFSLSRFHDCFGLIRNLGTNFIGKFISKLIFNDRLQSLPRVISKD
                     DIPERNEEPFNVDLKLERWFLQLKDDSLNLVENLMILYPKESGIIDGEMLIQLTKLMS
                     KEQENLIERYVGQDSDNLYFRCHLIEHLLTIIFWLCTEYEKQLSIDHIKEIESELIMS
                     LWRVIVTEENNSFENSELADHSQLVDRLHQLELQDEISYYNDALEDMPGFIKQELKEE
                     VHDRAAKIMQIKYDECHQHMARTILESKFESMISMEDIDSLYFAMGL"
     gene            <152926..>153684
                     /locus_tag="HG535_0A00810"
                     /db_xref="GeneID:59233778"
     mRNA            <152926..>153684
                     /locus_tag="HG535_0A00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285975.1"
                     /db_xref="GeneID:59233778"
     CDS             152926..153684
                     /locus_tag="HG535_0A00810"
                     /inference="similar to AA sequence:RefSeq:NP_013287.1"
                     /note="similar to Saccharomyces cerevisiae EMG1 (YLR186W);
                     ancestral locus Anc_1.64"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141870.1"
                     /db_xref="GeneID:59233778"
                     /translation="MVEDSRVRDAIKSGEQKALPASLVPEAPAVLSSKDKTTQRLIIV
                     LSMASLETHKISSSGPGGDKYVLLNCDDHQGLLKKMGRDISEARPDITHQCLLTLLDS
                     PINKAGKLQVYIQTSRGVLIEVNPTVRIPRTFKRFSGLMVQLLHKLSIRSVNSEEKLL
                     KVIKNPITDHLPTKCRKITLSFDAEVIRVQNYVEKIDKDESICVFVGAMARGKDNFAD
                     EYVDEKVGLSNYPLSASVACSKFCHGAEDAWGII"
     gene            <153981..>155975
                     /locus_tag="HG535_0A00820"
                     /db_xref="GeneID:59233779"
     mRNA            <153981..>155975
                     /locus_tag="HG535_0A00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285976.1"
                     /db_xref="GeneID:59233779"
     CDS             153981..155975
                     /locus_tag="HG535_0A00820"
                     /inference="similar to AA sequence:RefSeq:NP_014120.1"
                     /note="similar to Saccharomyces cerevisiae PRM1 (YNL279W);
                     ancestral locus Anc_1.65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141871.1"
                     /db_xref="GeneID:59233779"
                     /translation="MPYFTSYLRLNDRLSQVWINTYTLMLLIVMLKLVFFTKSIKDSI
                     NLAKNYTMSHCDDIDSLYSDALNGTPHYLGKMGNFLIEKTMIESVEATLKVISLLLYA
                     SEELLAFIVDLYIGTYVCLIVSAIDGTVDVATNTTEALIGMVNSSVISLSSELEGGLT
                     DISDFLNKVISAASKVESFFKDDDNDSNNASDKISKLNLTISSLRDMKIPSSINNKLQ
                     ELSNKTPDFADVKNMTKNLISLPFEKVRNEIASINSTGIVGDSDLFYVPPLTMNNGTT
                     SGICRSNEAQIEKIYDAFGKTLQTVTVILIVLIMVGALAAMVPSAWKEYRQWKKLSAL
                     RDEYLEVHEKRNHLDPFDSFESEKSYDVIASYHRCFNVWSGRISNIIMRMFTSMSSEE
                     LNNSTKVKIQWVVSYMTTERALLLLGVGFLALMTCICQFIMIAVCRSFLNSKDITSLA
                     GSSNSSFSTSLQNDMVQWSGNTNLYIGSTEDRMNSRVFGWINETTLSINTTANKMMDE
                     IDTTIQNAFENTILYPPMSTIVKCTIGNKLTAIESAMTWIHNKAHFNLPRIDPLEIQA
                     LLLPEQNSTGSMNSTSSVNPQSDSVGKTKKPAVAVATAVQSLAENIRTGLLAVLESFY
                     KTTMWELIVAFILIALWVIQLPIALSTIFCRTHRSTAPDA"
     gene            <156465..>159431
                     /locus_tag="HG535_0A00830"
                     /db_xref="GeneID:59233780"
     mRNA            <156465..>159431
                     /locus_tag="HG535_0A00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285977.1"
                     /db_xref="GeneID:59233780"
     CDS             156465..159431
                     /locus_tag="HG535_0A00830"
                     /inference="similar to AA sequence:RefSeq:NP_013288.1"
                     /note="similar to Saccharomyces cerevisiae SKG3 (YLR187W)
                     and CAF120 (YNL278W); ancestral locus Anc_1.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141872.1"
                     /db_xref="GeneID:59233780"
                     /translation="MKRIFSGAKTPEFPAPPRFFSGGNSPGSSSPKNTGRSRSSSLSK
                     IFSGSNSPKSPVLLPQESSTTGHLSPELVPIVTLISAQTHRRYHEGTFLILQDLKNDG
                     SPASRKWQQVYGVLIGTQLALWDAKELAGNNPDLENTNLKEIASKPYYINFTDASLRT
                     INGSDAVFTESKKKLENALVVSTTLKNRYFLQFANKESFNHWNAAIRLSLFELTSLQE
                     AYTGAFLSSRGAKLGDIKIILSNSKFDYEDWVSVRFGTGMPWKRCFAVISQSTSKKHP
                     FGKVKFYENNKKNKKTSAMATIVSSKALYAVYPSSPLLIDTSTIIKLEGEITFDKKDS
                     PQETNIFIMPEKHHAVPGYDTIIRFLIPAMNAFRLYGRPEKLIANKVDQNSLLFALPT
                     LPHIHYLKVDDLLALANSLSCLQWSTHDWKGHIKDILTKKIGHNYTGCGSSASLSVAL
                     SSPVIGAAELFETPNSISSPSFLPKQRPTNGSTLTFSSTNTGSHSTLSGSPLHKQTFT
                     LSPASTNADKQSNDQRTYQTSPTERLMSSPTKKAVEQQGLLKVNIKESNYDRLAVDTM
                     RGNKINYIDKYSNASELSALYDKYSAAPFGRSPVSETTPVSQTINVNDSNPTASPYAQ
                     YVGSSDARTFEISNIRDSTSTSHSNEIPGDADNDALNDDIDPLQEFSDLAKTISEIGL
                     ESVSSISKYNKANDYTLDEDLKFNSSPADIANEEDNVFDPDYTEHNHMLETESILDAS
                     EASSVYTTKNDGRSRSDYYSTPQTSAVQQSGVTSSANRLPHSVAMSDMTRMNQSIPLS
                     KQRERPVQSSYTNNYNQPNLTQNVNQYSSRNAMANPVQKLSRPSPSNSPQYQQFPQSY
                     NQSPSRPFHAQQNHYQAPPFKQYSPKQNPAPQPQYEPFQMYSPQHSQLPQQTHQMQYA
                     QKQPYPQSGVPQNRFPDGNQPGPQVRQPLPHGAIQSGPYGAAPKKPVSTNKPRPPPNA
                     GFSQFMPSANVNPYSR"
     gene            <159691..>161910
                     /locus_tag="HG535_0A00840"
                     /db_xref="GeneID:59233781"
     mRNA            <159691..>161910
                     /locus_tag="HG535_0A00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285978.1"
                     /db_xref="GeneID:59233781"
     CDS             159691..161910
                     /locus_tag="HG535_0A00840"
                     /inference="similar to AA sequence:RefSeq:NP_013289.1"
                     /note="similar to Saccharomyces cerevisiae MDL1 (YLR188W);
                     ancestral locus Anc_1.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141873.1"
                     /db_xref="GeneID:59233781"
                     /translation="MISLLRHHLHSSAKLNTQLNVCVRRLHVPYKYRTSSLNFVGNNL
                     RQSHITIEILILSQLRSQSTHLRAATKSAPIENANLNLPRLSSSNLTGSGMKDIKRLF
                     RLAKPETMYIALALLLILISSSVSMVLPSVIGKLLDYAKDGFETSDVEETEGSQEETE
                     GSQEETEGSQEKTARKIYGLSPNQFIAAMGCVFVVGAIANMGRVIILKVTGERLVARL
                     RTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRATIQGIVGFG
                     MMGYISWQLTCVMGLMIPPIAIMALVYGRKVRNLSRQLQTSVGELTKVAEEELNATRT
                     IQSYVGEKKEIHRYAKEVRNVFNIGLKEAMVSGMFFGSTGLVGNVALLSLLMVGTNMI
                     QAGLMTVGDLSSFMMYAIYTGTSMFGLSNFYSEIMKGAGAAARVFELKDRKPLISPTI
                     GKDPKTLLGKSIEFNHVSFTYPTRPGQQIFNDISISIESGEHVCFVGPSGSGKSTIAS
                     LLLRNYDVTSGCIKIGTDDIRSFNLRKYRRLLGVVQQEPVLFNGTIFDNILYTVPPKV
                     AQDKNRVAKAIGQANCAKFLSNLQDGLQTNVGPRGALLSGGQKQRVALARSFLLQAPL
                     LILDEATSALDVQSEEVIARTLKERVQKGLTTISIAHRLSTIKHSTRVVVLSKHGSVI
                     ETGPFEQLIANPKSELNVLLSQQQQVDNKEQEREQEDINAHVMKSIPWTEDATSNAI"
     gene            <162323..>163774
                     /locus_tag="HG535_0A00850"
                     /db_xref="GeneID:59233782"
     mRNA            <162323..>163774
                     /locus_tag="HG535_0A00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285979.1"
                     /db_xref="GeneID:59233782"
     CDS             162323..163774
                     /locus_tag="HG535_0A00850"
                     /inference="similar to AA sequence:RefSeq:NP_014122.1"
                     /note="similar to Saccharomyces cerevisiae MET2 (YNL277W);
                     ancestral locus Anc_1.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141874.1"
                     /db_xref="GeneID:59233782"
                     /translation="MSQTLRSKTLAEVDIDQVACTNPFVKLVNDQRIVEVPELTLESG
                     ITIRNFPIAYKSWGSLNEKGDNCLVICHALTGSSDVADWWGPLLGNGQAFDTSRFFII
                     CLNSMGSPYGSFSPLTVDEETGRPYGPEFPLCTVRDDVRAHKIVLDSLGVKSIACVIG
                     GSMGGMLVLEWAAMFDRQYVRNIVALATSARHSAWCISWSEAQRQTIYSDPKYEDGYY
                     LLEDPPTAGLSAARMSALLTYRSRNSFEKKFARRSPSLEHQRKVAQQELPLPSTVSEQ
                     SLQIHNDGHNHKRENSYQKCNSVVSSNSSESVRSVSSVTSSSSVTGSTKEVKPPQTYF
                     SAQSYLRYHGTKFVNRFDANCYIAITRKLDTHDLARGREEHEEDITRVLHSIDQPSLI
                     IGITSDGLFTYSEQEFLAENIPNSTLTEIQSPEGHDAFLLEFKYINELIIKFLKQNAE
                     EIMSSPPRLWKENDSSVVITDSLFGEAEEVTNW"
     gene            complement(<163976..>167644)
                     /locus_tag="HG535_0A00860"
                     /db_xref="GeneID:59233783"
     mRNA            complement(<163976..>167644)
                     /locus_tag="HG535_0A00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285980.1"
                     /db_xref="GeneID:59233783"
     CDS             complement(163976..167644)
                     /locus_tag="HG535_0A00860"
                     /inference="similar to AA sequence:RefSeq:NP_013290.1"
                     /note="similar to Saccharomyces cerevisiae ATG26
                     (YLR189C); ancestral locus Anc_1.69"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141875.1"
                     /db_xref="GeneID:59233783"
                     /translation="MALPRRHSKQSRSNSVHLIDEAASDKRKSVLLPQNMLSKSISGL
                     TFRKHTHDKADSLNSSLRDVSEQRVSEDEESDIGRSRYMMKSIVGLLTTASVYAGMQD
                     AQEASKFGQDLPGSQQTKSKDEKGAEDDDEKKIESLEPPLKTAKEGDRKNEVNTVKAH
                     CLETRQPTLFDFSVVANSQVPQLCQDSSIPKHQGQNILVNKLLKHFNLYHSDSVLKEF
                     SAWILKDVLLQGKVFLTSRHLLFFAYLPRVSGTVKINGNLTIKTNLRGSTRYWCVLKD
                     YTLSVYNSPSEVYFPVLTIDLRNALNIKVAKKGLNEELKHFKITTSEKSYTFMADSEH
                     SAKAWANALKKQLFAAKNSENNSVSLKIPLANIVDLDDQLIMKQTFTLRIKVLESPST
                     FAVDDFFFVFLDGSGSILKTSVIKQIAVLERAGVQNVYNSGQLNKKSESIEAQSIDES
                     ETPALSRQANSYDFSLGKTSTTSSKKDDLIKKNKGNRPWRRGLKKHNDDTKSKEKSLK
                     DKPSEELSDVTESSLHITEEDVEKNGESKENESGSRKARIAGWTAKPFKHMAEMWSSN
                     PIHYRNNRINFSDDDPYLIDDNSNVQANHRFREHFKMEGNELLIGAYFTYLTRNIPLY
                     GKLYVAEGFLCFRTLVPRIHTKMILPLTDIETCYKEKGFRFGYFGLVIVIRGHEELFF
                     EFSTEVSRGDLEFILLKRLDSMKSEKKNIRSPTTSLVETDTNRARLKFFEDKINSEGF
                     DVPILIDENPFFQTNIVPNRSYKIGMLTIGSRGDVQPYVALGKGLLKEGHQVTIITHG
                     EFREFVERHGIRFEEIAGNPAELMSLMVEHESMNVSLLRDASSHFREWITELLNSSWK
                     VCSQLGLDLLIESPSAMAGIHIAEALEIPYFRAFTMPWTRTRAYPHAFIVPDQKRGGN
                     YNYLTHVLFENIFWKGISGQVNKWRIESLGLQRTNLDLLQQGKVPFFYNVSPTIFPPS
                     VDFSEWIKVTGYWFLDEKIDYNPPEELVDFIAKARSLGRKLVYIGFGSIVVSNAKEMT
                     QAISDAAVEAGVYCVLNKGWSERLNDKNANEIEVELPECIYNAGNVPHDWLFPQMDAA
                     VHHGGSGTTGASLRAGLPTVIKPFFGDQFFYALRVEDIGAGLALKHLNSSSLSTALKE
                     VTTNKRMRDRASLIKEQISNENGVKTAINCLYGELVYAKSLVLSKRKKFHDADHSCPG
                     KPASKVEHPQIDEAWTLL"
     gene            complement(<168028..>169464)
                     /locus_tag="HG535_0A00870"
                     /db_xref="GeneID:59233784"
     mRNA            complement(<168028..>169464)
                     /locus_tag="HG535_0A00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285981.1"
                     /db_xref="GeneID:59233784"
     CDS             complement(168028..169464)
                     /locus_tag="HG535_0A00870"
                     /inference="similar to AA sequence:RefSeq:NP_010935.1"
                     /note="similar to Saccharomyces cerevisiae ISC1 (YER019W);
                     ancestral locus Anc_1.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141876.1"
                     /db_xref="GeneID:59233784"
                     /translation="MSAANLRSSVSGAAQDAATVTSDTVTSAADSATGHSIKLLTFNT
                     WGLKMVSKHRKARLRAIADELAGYSAAIPIPGYESLMINETPEQGKQYDVVALQEIWC
                     KEDWDYIVSRCSQAYPYSRIFYSGIIAGPGLAILSKIPIESTFLYRFPINGRPSAIHR
                     GDWYVGKSIAITLLEPISEDTAPIAIMNSHMHAPYALKGDAAYACHRACQAWDFSKMV
                     NLYKKAGYAVVVVGDLNSRPGSLPHKFLTVETGLVDSWEQLKGKQDLQALSKMEPLEQ
                     LRYGCTTCDSFLNTWRSYLPTESACRLDYALIDPSRLKTTDAGPRFTKRLPGIGSFSD
                     HFAYACNLNLLSNRRTTDVETGDETPSKRDIQLQKYASYEEMIQCISSYRVVAKRQKF
                     LRGVHFVISILLLIGALVVTTFTSNRAAWSSIFWVFFAVVVSVTGTIDGLISFLFGRK
                     EIRALHEVEEEVSCAQKHLQGLLDVKKR"
     gene            <169664..>170362
                     /locus_tag="HG535_0A00880"
                     /db_xref="GeneID:59233785"
     mRNA            <169664..>170362
                     /locus_tag="HG535_0A00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285982.1"
                     /db_xref="GeneID:59233785"
     CDS             169664..170362
                     /locus_tag="HG535_0A00880"
                     /inference="similar to AA sequence:RefSeq:NP_010934.3"
                     /note="similar to Saccharomyces cerevisiae SPC25
                     (YER018C); ancestral locus Anc_1.71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141877.1"
                     /db_xref="GeneID:59233785"
                     /translation="MDQTLGSFQELKSQMGTFEAQLRQSLKSKVHLASSVTLTYKEQF
                     EELKANQQNLIRKLDQLEQKERELKDEIETFRKDTDYVKTDLETKQIKKQQLESQRDA
                     LLEESRELDGMLAKKEQEVKQHRERLMRQRQRDSPEVRLYEQLLGLQIDASQPDTLHF
                     KFQNFDDKMISRSCELTLDVSENTFSILSTTPVLNSTEDLSELVDILNDSYDIAQFLA
                     ASRAKLISKTIRSE"
     gene            <170513..>171577
                     /locus_tag="HG535_0A00890"
                     /db_xref="GeneID:59233786"
     mRNA            <170513..>171577
                     /locus_tag="HG535_0A00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285983.1"
                     /db_xref="GeneID:59233786"
     CDS             170513..171577
                     /locus_tag="HG535_0A00890"
                     /inference="similar to AA sequence:RefSeq:NP_009973.1"
                     /note="similar to Saccharomyces cerevisiae PER1 (YCR044C);
                     ancestral locus Anc_1.72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141878.1"
                     /db_xref="GeneID:59233786"
                     /translation="MRLSFALLLLLADYVLGSPGDRLSEFQDCNDACEHRRTYSQSQA
                     TGLDISENEFSHIAFKQTPILLQWLLFWDYRADCDYQCQQIVTRDRIVNNKEIHQFHG
                     KWPFIRLFGMQEFFSVIFSVGNFLPHYYGYQKLLKRLNMLQYRGKAETSPSKLLKSYM
                     LVAVAGMLAWSASSIFHLRDLLITEKLDYFFAGGTVLSGFHAIFTRIARLDRHPFLSR
                     LFTWSVILIFGLHILRLYIDWSYTYNMRFNVLFGLLQYILLLLLAFNNYKLLQKQPKS
                     KIRPNIPSSKNIKQLCLMPVILVLTTASGMSFELFDFFNYRWQIDSHALWHLCTIWPS
                     WELYEFFIADFNFVTREVSN"
     gene            <171851..>173542
                     /locus_tag="HG535_0A00900"
                     /db_xref="GeneID:59233787"
     mRNA            <171851..>173542
                     /locus_tag="HG535_0A00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285984.1"
                     /db_xref="GeneID:59233787"
     CDS             171851..173542
                     /locus_tag="HG535_0A00900"
                     /inference="similar to AA sequence:RefSeq:NP_014124.1"
                     /note="similar to Saccharomyces cerevisiae BOR1 (YNL275W);
                     ancestral locus Anc_1.73"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141879.1"
                     /db_xref="GeneID:59233787"
                     /translation="MKRFGLPFCNFRNCEEVDTQSESTNAPGVGSEVTITSTNEKRKL
                     PKPGAGILLDLREQIPTYWKGWKDSWDYRVIPSVVETFFSNLLPALAFAQDMFDRTEN
                     AYGVNEVLLSSGLAGIVFGALSGQPLCIVGVTGPISIFNYTVYEIIKPLNTNFFGFMF
                     WVCIWSMILHFLLALSNLVCLLQFVTSFPCDIFGLFINIIYIEKGIQILIRQFNPENQ
                     LEDISAGFASIVVALVMTIFGLMFKNITRTTLLNYKLRTFISDYSTALSVLFWSSFIH
                     FGGYLSDIDFQRLPITRSFYPTSTNHRGSSTWLAYAHISTKHIFIALPFGIILTILFY
                     FDHNVSSLMAQRAEYKLKKPASFHYDFALLGATTGISGVLGIPAPNGLIPQAPLHTES
                     LLVRDPDGNVLRCVEQRFTNTIQGLMCIATMARPFLVCLGEIPQAVLSGLFFIMGIQG
                     LLGNEIISRIMWLFTEQRSKTADNALYYVSNKYLITFLCFSLAGFVGEFAITNTVAAI
                     GFPLILLLTVIASFLFPKCFPKRQLNILDTKVAEEFTLKNLLLFNTDEVTSKDDT"
     gene            <173739..>174128
                     /locus_tag="HG535_0A00910"
                     /db_xref="GeneID:59233788"
     mRNA            <173739..>174128
                     /locus_tag="HG535_0A00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285985.1"
                     /db_xref="GeneID:59233788"
     CDS             173739..174128
                     /locus_tag="HG535_0A00910"
                     /inference="similar to AA sequence:RefSeq:NP_009972.1"
                     /note="similar to Saccharomyces cerevisiae YCR043C;
                     ancestral locus Anc_1.74"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141880.1"
                     /db_xref="GeneID:59233788"
                     /translation="MIPPPVDPALLHEHAYQGTGDLSYALNIETFTDEGGYKPLLKYG
                     LGFFNYYLALDDEVYGRSWLEIFRFHLYEHFAIYFLIFLVAFLAWSSMVVAHIGSTSD
                     IIFHKSKGSHKKRSEDGDSLDYHHLKV"
     gene            complement(<174287..>175339)
                     /locus_tag="HG535_0A00920"
                     /db_xref="GeneID:59233789"
     mRNA            complement(<174287..>175339)
                     /locus_tag="HG535_0A00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285986.1"
                     /db_xref="GeneID:59233789"
     CDS             complement(174287..175339)
                     /locus_tag="HG535_0A00920"
                     /inference="similar to AA sequence:RefSeq:NP_014125.1"
                     /note="similar to Saccharomyces cerevisiae GOR1 (YNL274C);
                     ancestral locus Anc_1.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141881.1"
                     /db_xref="GeneID:59233789"
                     /translation="MSVKPTVLRLGNVNYAQEAWKKLAQIANVVSIEPSMNREAFLKA
                     LKDPKSDISKAQIITRTFQSVQQTGRFDKELCDSLPSSVVAVCHLGAGYDQIDTEFFK
                     IRKIQVTNVPELVNDATADTHVFLLLGALRNFSYGSRVLINGGWPKAGPAGGAPVGND
                     PEGKVVGVLGLGGIGRTVAKRLQPFGFQRFIYHNRSRLSAELENGCEYVSFDELLKQS
                     DVISINIPLNPKTKHMLDEEAFGKMKDGVVIVNTARGAVIDEAALIKALKSGKVRSAG
                     LDVFEHEPQVPQELLDMPQVTGLPHMGTNTFETIKHMEEFIVENVENIIKTGKGLTIV
                     PELKGESWIDSAKMLC"
     gene            <176207..>180466
                     /locus_tag="HG535_0A00930"
                     /db_xref="GeneID:59233790"
     mRNA            <176207..>180466
                     /locus_tag="HG535_0A00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285987.1"
                     /db_xref="GeneID:59233790"
     CDS             176207..180466
                     /locus_tag="HG535_0A00930"
                     /inference="similar to AA sequence:RefSeq:NP_009971.1"
                     /note="similar to Saccharomyces cerevisiae TAF2 (YCR042C);
                     ancestral locus Anc_1.76"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141882.1"
                     /db_xref="GeneID:59233790"
                     /translation="MSFSKGATPKGVQNGPAILDASAIRTFKIAHQRISLDVDLSTHS
                     IRGTADIILIPLIQNLAFITLDCKAMKIKDVLVENRRCENYIHDDAVRTYSQKYTQNA
                     RDPLFEFNSIEQSHFFREKFADLNEFPEEKTKSQLTIKIPPSIKITLQDANSLTNFTP
                     ITPSIRGTPAQDTVFTPISIRIEYEVNNPSTGVRFDTISETQQHLWNVYTTNSELCCT
                     ASYWMPCVNMLDEKCTWEVEISVPRKVKDIGTSKIIGQQENISRRLRPHKQSEMDLNR
                     NYNDISDNAYTTPNDVKQENEKKVHDQEDEEEDDEYEMLDEEDENNTLNKDIQVCCCE
                     FSTAKETSHPTDLTKKLFSFQIFNPVAPHHVGWAIGAFDIWVLPPLQQHEETSDDEQD
                     ENDESKKLSQKFSNEMVDDTENNDIIPIQVYTLPQGDIDEKTVLNTTIVSQKIMDFYS
                     KEFGSYPFASYSIVFLPTLVDPTMDFAGMTLSNTRLLYPPEMIDSMFTTTNHLAWALA
                     TQWSGVNITPLEMNNIWCCLGIAGYMVFQLTKKLFGSNELRYRLKMAAEKIVDQDWEK
                     PPIGSAFTNSSRPISYTSKDLDFIKLKAPMVMFILDRRMIKTERSFGMSRVLPKIFLQ
                     AMSGDLTNNSLSASHFQYVCERVNRSKLEAFFQQWVYGSGVPIFRVTQRFNKKRMMVE
                     MGIRQCQAQELGQDKVLGAEGFCSSALNYKDVPSLNRTPFFTGSMTIRIHEADGTPYE
                     HIVELKDVFTKLDIQYNTKYRKLRNKRIQATKSSNKSSTPDLMHEALSAFSDKSENGP
                     VHKLGNVLSSSDELDVWNLVDVSVSTDGNESQRQNEAFEWIRIDSDFEWICKIYVNQA
                     DYMFTSQLQQDSDVEAQVESLRYFEDVIVHASDNSQIYSSILTRTAMDKRYFYGVRLE
                     ACRALARFIVRDHEPKNFSGGPRHLIHIFRALFCYKDSNVPLSNDFTNFQNYFIQKGI
                     LKYLKLIKNERNETPEFVKHFLLDILTYNENSENAYDDSHYLCALIDAVVDCAIRNPT
                     DENYLTKVIEQLRRYQNLEKWTPTYQFLVKKEVISAKLRLTMSGLYELNELNEIIGDT
                     LEEETQPTNLNVPRLREGSQDITLCAFKLLLVVGGMKNKEALKYFFETLCFTPNVYLR
                     DKMVDVLFDAIDFIAVNKLSDRLDDDIDYLVNKINPEDLSLDNLNGDSAIVEEDTNRE
                     LKKRQEEKLKTTIRGLMQLLTRQFKSYDPLKTILWGVLRVPGLSLYQKKRLFDLSRIL
                     YPLLDSFEVVLPMPRDKKLVASYDENNKVVIKREGLLKVHIPSNIKINVKSNENVNQK
                     PNFTTVTVPSNKVKITLNKPTTAKPKKVVKPPSKLKQAKGTVNRVGVLPLRFVKLSIA
                     EKKKVDISSTPFSKNVQIIKANSRSFTLKILLPKKNNQIGQ"
     gene            <180685..>182451
                     /locus_tag="HG535_0A00940"
                     /db_xref="GeneID:59233791"
     mRNA            <180685..>182451
                     /locus_tag="HG535_0A00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285988.1"
                     /db_xref="GeneID:59233791"
     CDS             180685..182451
                     /locus_tag="HG535_0A00940"
                     /inference="similar to AA sequence:RefSeq:NP_014797.1"
                     /note="similar to Saccharomyces cerevisiae SLP1 (YOR154W);
                     ancestral locus Anc_1.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141883.1"
                     /db_xref="GeneID:59233791"
                     /translation="MKVSICILLAHLYLVLSSADSAELEKSANVGENTAFIDEFSSIL
                     RVKLYKTFLPHASYVHRSASPSLFNGEASTSVISTSSAKRKSSKAGVLQGTSTPLVDN
                     DGINENSKKSNSTFVPFDEWKMNNLDDKPLKKQTRVRSSSRMDQTEGDTIGDDLEIDI
                     GFLSSSDVEKVHEDQNEEPEGKVYKHKFNFASLDCAATIVKTNSEASGASSILIENKD
                     KYLLNPCSAASQFITVELCQDILVEEIVLANFEYFSSTFKKLRFSVSDQYPVGKNGWR
                     MIGEFEAEDSRNLQIFYIDNPQIWARYLQVEVLSHHDEEYYCPISILRVHGKTMMDDF
                     KMENSKSNPPVVVTVEEELKKEILDECMETVVEQCDLWPSINPANITLVPHFPDYFKT
                     CSSKLKTLKFDEFLRELNESSCLPSYSKDSVNNEGSSSSSASQTNSFSTEESIFKNIM
                     KRLSSLESNTSLTVQYIEEQGRLLSNSFEQLERAQTIKFENMIGLFNQTIMDNLNALR
                     VFAKQLKDQSVRILEEQKLNTDQFTTKNMNRLEILEEQLKVQKIFAYALLISVLLIFA
                     YLFVNKEDSFSMNHLERTMPSV"
     gene            complement(<182632..>184242)
                     /locus_tag="HG535_0A00950"
                     /db_xref="GeneID:59233792"
     mRNA            complement(<182632..>184242)
                     /locus_tag="HG535_0A00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285989.1"
                     /db_xref="GeneID:59233792"
     CDS             complement(182632..184242)
                     /locus_tag="HG535_0A00950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141884.1"
                     /db_xref="GeneID:59233792"
                     /translation="MARKYVKVDQRLTILEKASCEGSIECFKNDIIEYLLGLDGNRIQ
                     IDPIMIDNQPEITWVMRPFIIDYLVELHNFFKLDDETLFLACSISDKYCSKRIVYKKH
                     YQLLIITSLWIAAKFKDVKTRIPTLKELCFVCHRTYEPNVFLQMERHILKTLEWSIGN
                     IVTTSDMLQLMISSSSDDLIPKDFNFLNLASFFCDVSLYRRSYLSYSSLTKAIAALLI
                     TSRILGHDDFPDFLVQLMTFSLEKNDFCLNDPEFYKQACDDIHENEYRYNDDIKRLHQ
                     LNELSSIICSQNINDIRNCFYLFLKDVFHENSQNNGERISNLLLRKHSVGSLLESYKS
                     QNCAAYNNLCFMKDALEHSDLDSDVFQSHFKDSVFTYIDRLAGFKTTEEKLKRLSLPF
                     IYENMLLTSPLTPLSSLPVSRENDISKINVPNTMPLAQFNPSMLCSTTNCDATFTPLA
                     SYYPTQFNSYPPTPLSANSCFSARPKLGSIGSSSSSVSFSANSMVSPAGLLKKSYRSN
                     SRNSPSHFRPVLSRKSSTQSDIYELISK"
     gene            <186260..>187381
                     /locus_tag="HG535_0A00960"
                     /db_xref="GeneID:59233793"
     mRNA            <186260..>187381
                     /locus_tag="HG535_0A00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285990.1"
                     /db_xref="GeneID:59233793"
     CDS             186260..187381
                     /locus_tag="HG535_0A00960"
                     /note="ancestral locus Anc_1.78"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141885.1"
                     /db_xref="GeneID:59233793"
                     /translation="MVRFGDIIILLTLVRSVFGTKFVIQLANEISLEAVFQHHRFEGP
                     LEVFKIGTGFKAFSGDFDDAILQKLLNDPKVESISIDQRLQTQEYVFQQNAPAHLKKI
                     ASSSPTPRQPYLYHSNAGIGVDIYIFDTGIDSKNPNLQQINVMKLIDLTQDIAPAGVD
                     ANGHGTAMAGVVASETFGVLKKCNLIDMRIVEKDGTSKLSSLLRALDIAEKHVKTTER
                     PSVFTIPLIMQERNAILNSAIENLNKELAIVVPAGNQNSDACNFSPASCSKNANLLVL
                     GSLNQDDNLAEFTNFGGCVDLFTSGTDVITLSPTDLSQSSLIREVNGTSISCAIGSGV
                     VGYYMSLGFSSLQAIEQTKTAAYNPTSMGIEYKVLQLKP"
     gene            <187549..>191238
                     /locus_tag="HG535_0A00970"
                     /db_xref="GeneID:59233794"
     mRNA            <187549..>191238
                     /locus_tag="HG535_0A00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285991.1"
                     /db_xref="GeneID:59233794"
     CDS             187549..191238
                     /locus_tag="HG535_0A00970"
                     /inference="similar to AA sequence:RefSeq:NP_014126.1"
                     /note="similar to Saccharomyces cerevisiae TOF1 (YNL273W);
                     ancestral locus Anc_1.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141886.1"
                     /db_xref="GeneID:59233794"
                     /translation="MVELHTAFNTNLSDADGSLTVLRARIALLATAIGGPDYTSKLDP
                     PPYKLGDDCLACLKDLKRWFKLVDDQQNRWDVAMAAAEYRILIDDLLPIMIDWENKTA
                     LANKLSKQDTSTDESIKTVGGREYHDNIALNSLQLLVILTWPLTLNEQSTADQIRVYS
                     DLKKHQVVYKKKVLSLDRGKTLKAVTRLASKVVRINKSNRSPKDNMVLRLTLNFLRNI
                     LSIGPAELNIARNKNMTNRGINITDTLPPDVTLDDISLSSVISAFQRNKVFKLLLLLS
                     GSSTEFDNDFIDVPLMEILFQITKEINQESLFSCGTEQNNENEKLVAKDLSPTCSQLT
                     DLLQKEKILRKNVLQNTSTRHSRFGALLSIETANKNRLTVSGGSNLRNDSIALKNIDS
                     RKKWNKRGTKKRDDMAVEGLPNTLLKSRHRSYNFSSSTSNFLKKFIDDFIDSGFNFLL
                     QRLTSHFTTEQDQMMTSEQVEYLMFFAWFTKFQRIRPKSALLGDVSYITGAIDETSFI
                     LLSSILRKSYEEKNWVVVHAGMIAFDELLQLVGYAKEICYDENIEFILSRLFSDERIK
                     LLSDIPKHAYKHTVQYMKSCVDLTHTAMKLFEQYDEEKSLIITKKTKKKQHNISEAEI
                     ENLVQSQGIDRDEALEILQPSFREHEVSFAKIQRQYFCESTIETYINCLQRFQELEDS
                     DIKKGISFLHRVITRESEEALLFRIDFIVLLRNMLSTGGISRRSRVRKHVESFSNFFL
                     YRLKKKLKDSSSWFIALLFPLLHNSDIGYFQKYGERKDQEKYGLYAVPPSEFRHIEDE
                     EQLPDSILADIQHGLLTSALIDSGKIDLLTTLIEHMSNSLKNFRVFLSLNVKKGNESL
                     NPPNELLTWVESDEPSPLLVDGDFRALLQLVGYHIPESANDSCYLVGSVDVPVLEQSL
                     QTIQKYLSTPFETRNGFPSSSYLIRPRVQNIDSFKEDGTYEEDNSQSYEGPGIVSDND
                     VNEWGEDSYFNDLGNEMIEKIEGRTLEKGLAKAKKSRKSRKIERKTTSKRRKIRSNIP
                     LFDTNEPEKVHSGKARQFVPSKEYISDSDDGEDYVNPIFFENEMYMRFLLDRYSGQLT
                     EDKYSLFGKFAAERMNNGGQIISDFTNLFNGEVPTVDFLAQRTQSSSGPDRSLISLSS
                     LISKEIGNSRGNNTSVEIQGASVGYDFQEDQEEYSSPTSSSKNIEKNPTENFNMEESM
                     REEEEFNEPLISRKRQKIIIQDDDD"
     gene            complement(<191291..>192766)
                     /locus_tag="HG535_0A00980"
                     /db_xref="GeneID:59233795"
     mRNA            complement(<191291..>192766)
                     /locus_tag="HG535_0A00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285992.1"
                     /db_xref="GeneID:59233795"
     CDS             complement(191291..192766)
                     /locus_tag="HG535_0A00980"
                     /inference="similar to AA sequence:RefSeq:NP_010850.1"
                     /note="similar to Saccharomyces cerevisiae AVT2 (YEL064C);
                     ancestral locus Anc_1.80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141887.1"
                     /db_xref="GeneID:59233795"
                     /translation="MAPKDYAALDDEGDDGDGKDDMNIPDVQFEMSNFTNKTKLIEDS
                     IENGVFDLDNTIGIPDYDVNVVLSEDPLVRDVLRENENKSTMRWAFMNMANSILGAGV
                     ISQPFALKNCGIIGGLVAYFLLGFLVDWTLRLIAINLVLTGTQTYQDTIQSVMGRKGK
                     ILILVTNGLFAFGGCIGFCIIIGDTVPHVLRSLFHSNSFFLRRNVIISLVTFFISYPL
                     SLQRNIAALSKASFLALVSMVVIVFSVIIRGPMLNSALKSEGLSIENIFVTPRFFRGV
                     SVISFALVCHHNTSFIFLSMKNRSIQKFSKLTHISSVVSVIFCMLMGYSGFGVFGMKT
                     KGNILNNFPVNDKTINIARLCFGFNMLTTFPLEIFVLRDVISTCFQKQISTNCEPAIL
                     STKLHFIITTVLVFGTMSVSLTTCNLGALFELIGATTASIMAYILPPLTNLLLRREKS
                     SFKSKSPHILSIIFGATMMIVSSAQTIFEAIHGEDQNHCEI"
     gene            complement(<192948..>195074)
                     /locus_tag="HG535_0A00990"
                     /db_xref="GeneID:59233796"
     mRNA            complement(<192948..>195074)
                     /locus_tag="HG535_0A00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285993.1"
                     /db_xref="GeneID:59233796"
     CDS             complement(192948..195074)
                     /locus_tag="HG535_0A00990"
                     /inference="similar to AA sequence:RefSeq:NP_014127.1"
                     /note="similar to Saccharomyces cerevisiae SEC2 (YNL272C);
                     ancestral locus Anc_1.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141888.1"
                     /db_xref="GeneID:59233796"
                     /translation="MAESEESKRISGQIASLSTQLIESIDKQSQLEEKLNQARRTIQL
                     QNASAQQSSKVSEELESLKSSVIEKDFLIKELQKQVDGERELRLTAEKAVDELNKEVE
                     DLTASLFDEANNMVATARRESHATEIKNNKLIEQLKEKDSILDTLTLQLKNLKKVLQN
                     LEDANPPHTKNYRGSVIINDNSMPSSTSVKDHTERKSDWPSEYHIDPIYSPNVSSIRY
                     DLSLFQEFLKFIAVLPHCQGIKDSASESHLLRRIVHDEIQPILRIDNASGLGWIVRRT
                     LMSLMMDGLVSVEPLSGLNETYQFGNASPHLKSNAFASPGGTINKDLHLFNFPADSPP
                     IAVYEKCSFCGESRRDVIEHARMHVLKTMTKADDGSLIVTNSFPLCNYCVLKLRQTCE
                     IFAFLRSLKIGAWNLEKISLSSIANGESDKYSKITQSFKPVRKEDKAAHADSESASDS
                     KLPTALANSTTNIQQAWLQLCKLRAMLHWTYIGIWSVNDSIASRFGPVSPQESDTDTS
                     SVKTHDTYALKEVTTEDSFTLRKEYDDEDDDGVECDEEENEKERQVHDDIENAKKTEI
                     SKEAVTDANDQIGLGNYANEIESEFDNGETTLSEVDSVSMIPLTDSENNSNLPDVNNP
                     NSTEQLNIGRKKNDLKTEGEGDISFHATNQIMPEANLASKNGVTNEDLRRLTEAGNDE
                     LNSSSSNLSNKEDQFDDAREEQSLTR"
     gene            complement(<195289..>201063)
                     /locus_tag="HG535_0A01000"
                     /db_xref="GeneID:59233797"
     mRNA            complement(<195289..>201063)
                     /locus_tag="HG535_0A01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285994.1"
                     /db_xref="GeneID:59233797"
     CDS             complement(195289..201063)
                     /locus_tag="HG535_0A01000"
                     /inference="similar to AA sequence:RefSeq:NP_014128.2"
                     /note="similar to Saccharomyces cerevisiae BNI1 (YNL271C);
                     ancestral locus Anc_1.82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141889.1"
                     /db_xref="GeneID:59233797"
                     /translation="MKRGTSTKGSSGSNNSGNDNSSSNTSNTGSGILSNLKRLTNTST
                     SSNGAQQRIEPSDISSPKKVVVPSRVTNANDLRPLNKKNTLNTQNISQYINSKASNEP
                     SDYRSRSPSVPPNAKHTHSRRSSNQTSILTGHSGLSRQPTNQSFSSSSIISQPSTSNL
                     ARFMTSDGVIKLDMPKDTHEIESLFEDIMYKRNIFQSLSPQKQHELMSYDIDKKWLIV
                     KQDLQSELKKMLAKNGGSHPSVPKTSIDLTASSGNLNITSSRSSVVFDNSNVPLAKPS
                     KKNNFASNQISTSNSNSFYELAEKNSTSSTLLSDKINRPPIHYVKKLIADKLSKDEMN
                     DLWVTLRTEQLDWVAIFLEHQGHIAMANVLMTSIYKTAPNSSLNSDTLDKENSFFKCF
                     RVLSMLAQGLQEFSHHSIMADTVANALFSVRLATRKMATEIFVCMLESKNKARFEAVL
                     NALDKKFKVGENLHMVQYMKNLPQHFSHFTSESMFKVVQAWMFSVEKTLEGRGKMGSL
                     VGASDDFKSSGGENAILEYAQWTMVFINHLCNGTDVLNQRILLRTRLENAGFIRIMNK
                     LKVFDYDKLTEQINYYENAKLDDLNLALEAENDTHDINMQDSVQILQKLSDHCKGTEN
                     ERLLNTLVKHLFLSSARLIENKEDPTKLSKQLKLMDSLVTNISASSTDDNSGMNMAIQ
                     RLYDSMQTDEVARRAILESRTLTKKLEEAQAERDILSQKLSAAGNGLVGQLEVELQER
                     DNILAKTQRVTRQLQSELEELKKKHLLEKHEHEVELRKMLTLFNSRTGETESSKDRQV
                     RSNVPGTLDPERQTSIQRVLQEGLQKTKKDISTDSKRFGITLQPNKRLEQLRSRMEDI
                     ESQARELEMTNFADHKAKVLQAPVEIQKGTQFKVHKEQSVHKLNELRKALGDIQRETN
                     DVSKFNVEERVNELFNEKKNQALKRLKELETQYKNYGLELNLDDFSDINSRSDKSCSD
                     NIHSTLDPKAFQRKLDEMNRIADELAELKSHIVEGNVQDYSSSSSEEDGLEESRTIAD
                     QSSTYSGQSGNSFLETLSQRYGTGQNEFSSPVSSLNNLKPHQKSFAARMKRSSVSAPF
                     LDELSKRVSKAEPLEDNEKEPKSSSTEKSHLQNAVAATIDSADGKKPFSNKSTTSSEN
                     EKRSPLSSESVNEKLDSAHAQAPPPPPPPPPPPLPSLLTTDNKEEKDPVGATIPPPPP
                     PPPPPPLLFSKGPNGDALPPPPLPPSLTPRLQSPSPPPPPPFPMMGQKSSSRTAIPSP
                     LLPQSPSLFSSYPRPQKRLKQLHWEKLDATDNSIWSSGEAEKFAGDLYEKGVLADLEK
                     AFVAREIKSLKSRKKDDLQKISFLSHDISQQFGINLHMFSQLTVDDLISKILKCDREL
                     LNTPSVIDFLSKSEIIEVSTNLAKNYAPYSIDWEGVKSAKDVKPPEKDPTDLQRADQL
                     YLQLMFNLQPYWGSRMRALKLVTSFEREYSDLISKLRKVDKAVAAVEKSNGLKNVFNV
                     ILAVGNYMNDTNKQAQGFKLSTLQRLTFIKDTNNNMTFLNYVEKIVRENYPSFNDFLT
                     ELQPVIEVTKVSIDQLVSDCMEFCQSIINVERSIEIGNLSDSSKFHPSDRVLSKVLPA
                     LPEARKKSDLLDEEVRLSIMEFEGLMQRYGEDSGDKFAKNSFFKKFADFIAEYKRAQT
                     QNIKAEEEERIYERHKKMIEEQQKRLKEQEAVQNETNSDSGDSKGSEDRRAMMDKLLD
                     QLKNAGPTKSDPSSARKRAMIRKKLTADKDATDHLMQDIDNGDDTMIYSPENTMKTPN
                     AVLDQSPTPGVADAPIEEQDSYSPSKSQRESDSAQEVIGDRAKALLNELRGSEFSPEK
                     RDSSSAEHRERLRARRRKTNTELPSGNKLRFFGDEEDEDNNVTADTRSDLLKVADTES
                     LAGPERLAKPKLDQHNGGVITETD"
     gene            complement(<201473..>203275)
                     /locus_tag="HG535_0A01010"
                     /db_xref="GeneID:59233798"
     mRNA            complement(<201473..>203275)
                     /locus_tag="HG535_0A01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285995.1"
                     /db_xref="GeneID:59233798"
     CDS             complement(201473..203275)
                     /locus_tag="HG535_0A01010"
                     /inference="similar to AA sequence:RefSeq:NP_014129.1"
                     /note="similar to Saccharomyces cerevisiae ALP1 (YNL270C)
                     and CAN1 (YEL063C); ancestral locus Anc_1.83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141890.1"
                     /db_xref="GeneID:59233798"
                     /translation="MSGTDKMGETVYELQDYNGAIEEGDLSSNNSSSQGKAYRRKHSF
                     VTGKADSSSNGASKIDLYGSPEPENGSVSPLSELEGDDGNLEEGKVTNAEVKRELKQR
                     HIGMIALGGTIGTGLFIGISAPLENAGPVGSLIAYMFMGTIAYSVVQSLGEMATFIPV
                     TSSFTVFSYRFLSPAFGAANGYMYWFSWAITFALELSVVGQIIDFWTSAVPMAAWISI
                     FWVLLTFMNMFPVKYYGEFEFWIAFIKVIAIVGFIIFGLCIVCGAGVTGPIGFRYWRN
                     PGPWGPGIISSEKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKK
                     VIFRILFFYILSLFFVGLLVPFNDPKLDSDQYASASPFIIAIQNSGTPVLPHIFNAVI
                     LSTIISAGNSNIYIGSRIMLGLAKNGLAPKIFNRVNRHGVPYVAVVFTALFGALAYME
                     TTTGGENAFNWLLNITAIAGFFAWLFISFCHVRFMQALKFQGISRDDLPYKAHFMPYL
                     AYYAIFFMVIIIIIQGFTSFAPVFSGVDFVAAYISVFLFIFVWVLFQIIYRCRFIRRI
                     EDVDIDTDRRDIEAVIWDEPGPKTFWDKFWNVVA"
     gene            <204481..>206208
                     /locus_tag="HG535_0A01020"
                     /db_xref="GeneID:59233799"
     mRNA            <204481..>206208
                     /locus_tag="HG535_0A01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285996.1"
                     /db_xref="GeneID:59233799"
     CDS             204481..206208
                     /locus_tag="HG535_0A01020"
                     /inference="similar to AA sequence:RefSeq:NP_014131.1"
                     /note="similar to Saccharomyces cerevisiae LYP1 (YNL268W);
                     ancestral locus Anc_1.84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141891.1"
                     /db_xref="GeneID:59233799"
                     /translation="MATDEEIYRIKSMQDEKKSLGEKVSSKEEKFATVALSRSSAINS
                     QNTDIEEAGGEDVDPEEGHYRDTKVKRALKQRHLGMIALGGTIGTGLFVGIATPLHNA
                     GPVGTLIAYLFMGTVVYFVTQSLGEMATFIPVTSSITVFSRNFLSPAFGVANGYMYWF
                     NWAITFAVEISVVGQVIQYWTMSVPLGAWIAIFWVFVSLLNFFPVKVYGEIEFWVAFV
                     KVVAIVGYLIYALVIVCGGSSEGPIGFRYWRNPGPWGPGIITSKTGEGRFLGWVSSLI
                     NAAFTYQGTELVGITAGEADNPRKSVPKAINNVVLRIALFYILSIFFVGLLVPYNDPR
                     LSDSSAIIAASPFVISIENAGTRALPDIFNAVVMITIISAANSNVYVGSRVLYALAQS
                     GNAPKQFSYVTKQGVPYLGVIATMLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWL
                     FISFAHIRFMQALKYRGISRDDLPFKAKFMPWGAYYAAFFVTIIIFIQGFTAFSPHFD
                     VSEFFTAYISLILLVVLFLGCQLYYRCRFIWKVEDIDIDSDRREVEAIVWEDEEPKKF
                     WQKLWAVIG"
     gene            <206719..>209826
                     /locus_tag="HG535_0A01030"
                     /db_xref="GeneID:59233800"
     mRNA            <206719..>209826
                     /locus_tag="HG535_0A01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285997.1"
                     /db_xref="GeneID:59233800"
     CDS             206719..209826
                     /locus_tag="HG535_0A01030"
                     /inference="similar to AA sequence:RefSeq:NP_014132.1"
                     /note="similar to Saccharomyces cerevisiae PIK1 (YNL267W);
                     ancestral locus Anc_1.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141892.1"
                     /db_xref="GeneID:59233800"
                     /translation="MSSGPNDNAKDLNDLVTNRMNQVLLKHCSSPNFSIYNCIELLCK
                     HADNIGIHFYLCQKLLTFPHSELQFYIPQLVQVLLTVETESMALEELILELKNENPHF
                     ALLTFWQLQALLADLSTDPKSYGFQVARRVLNNLHSSLFNTATADDENKIKRINENVG
                     PGLLLASMVMSSIALPQLGGMTRPLVDSQGKRQKAFVFKLAKNAMKDLRKNITLKNTI
                     LNTKNTHVPSRNKDLELPESPVDLIDSTKTREDALFKKPKHLETDLNFDIVDDVGEQL
                     FQDRISNSIKLPKRRSKYLDDSYVHRTYESVSLSSSPRQSISSMIQRPTYGSAVYEES
                     LLNVDQFTSSMPDLHDVQPSRSRTSLSFSEKKSDDTRSNSQPPSLADGFVKLSAVTSD
                     LDRIQDMDVSQMTTKMKIKILKANYFRCETQFAIALESISQRLAQVPTEARFSALRAE
                     LSLLNSDLPAEVDIPTLLPPNRKGKLHRLVLITANEAQVLNSAEKVPYLLLIEYLRDD
                     FDFDPTSEENQEILRRKPNAKSFIFDLNDISRIKNRGSEFELESTILTSTSESNTVAS
                     RPASPLINNFTFQEPAKKGGKEMDLGDMSMIRVKNQTDAEAYRESLVLQSATKIPVIP
                     RDSEQRAPELSFVATLEDAIVPRAETRNFQDKTVELANEMRISAVMLAQLDKSPQEIS
                     DTANQIRAKIIASMKEVQDKFGYRDLEAIHGTAGERKLENDLKTGGIDTSYLGEDWIT
                     KKERIRKTSEYGHLENWDLCSVIAKCGDDLRQEAFACQIIQAMAQIWTKEKVDVWVKK
                     MKILITSANTGLVETITNAISVHSIKKSLTKKMIEDGNLDEKGVIASLNDHFIRAFGD
                     TKSFKYKRAQDNFASSLAAYSVICYLLQIKDRHNGNIMVDNEGHLVHIDFGFMLSNSP
                     GSVGFEAAPFKLTYEYAELLGGLQGEPYRKFVMLVKDAYKALRKHAEQIVSMCEIMQK
                     DNMQPCFNAGGETSVQLKQRFHLELSDTECDEFVENYLVGKSLGSIYTRLYDQFQLTT
                     QGIYS"
     gene            <210195..>211370
                     /locus_tag="HG535_0A01040"
                     /db_xref="GeneID:59233801"
     mRNA            <210195..>211370
                     /locus_tag="HG535_0A01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285998.1"
                     /db_xref="GeneID:59233801"
     CDS             210195..211370
                     /locus_tag="HG535_0A01040"
                     /inference="similar to AA sequence:RefSeq:NP_011560.3"
                     /note="similar to Saccharomyces cerevisiae TAM41
                     (YGR046W); ancestral locus Anc_1.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141893.1"
                     /db_xref="GeneID:59233801"
                     /translation="MLGLKYSASTAGNAGTMLRLLKKSTSLGCLSSVRRHGTSAEPDI
                     SREEAIIHGVKVGDFKRVAGKKSTENLDLLLLEEGIKKTDELTSSFTDYMYRFNRLPA
                     DFGSNQLIAVDAELQKELEGILASFEAPVKFAFGYGSGVFQQTGYVQGVDKPQIDLIL
                     GVSHATHFHSLNMRQNPQQYSSLRYFGSSFVSRFQEVGAGVYFNPFAEINGHEVKYGV
                     ISMEKILKDLATWDTFYIAGRLQKPVKILKNDLRVQYWNQLNLKGAASLAKYFTLKKN
                     NGVFDEFEFYNEIAGLSYLGDIRYQIGGEHPNKVKNIVTKNFEKFQYYYKPIYKDVVL
                     NNSLYLPQGFTLENAGHLLHDRISSSSALQTLKGIFTAGIAKSVKYAWAKKLKTFKN"
     gene            complement(<211887..>212771)
                     /locus_tag="HG535_0A01050"
                     /db_xref="GeneID:59233802"
     mRNA            complement(join(<211887..212690,212748..>212771))
                     /locus_tag="HG535_0A01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285999.1"
                     /db_xref="GeneID:59233802"
     CDS             complement(join(211887..212690,212748..212771))
                     /locus_tag="HG535_0A01050"
                     /inference="similar to AA sequence:RefSeq:NP_014134.1"
                     /note="similar to Saccharomyces cerevisiae IST1 (YNL265C);
                     ancestral locus Anc_1.87"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141894.1"
                     /db_xref="GeneID:59233802"
                     /translation="MAQQIPFNIKLKTCLKMCIQRLRYVQEKQQALAKQDRREVAQFL
                     NDGKEQKAHYRVETLINDDVHIELLEILELYCELLHARVSILMSITDEANLISEHMND
                     GINEAVRALVYATIHAPEVKELAQIRDLLTLKFGPDFVKVILDGGIGVPEKVVKKCSP
                     NLPGEELVVMYLKEIARTYAAPYSQLTDTEDEELEDKEELEELKPIVAVDNDDQFTED
                     AKHPISVRKPRKNSETLERDLKIPKDIKKDVKVMRRKESGGSDDLEQLKKRFAALRR"
     gene            complement(<212943..>216032)
                     /locus_tag="HG535_0A01060"
                     /db_xref="GeneID:59233803"
     mRNA            complement(<212943..>216032)
                     /locus_tag="HG535_0A01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286000.1"
                     /db_xref="GeneID:59233803"
     CDS             complement(212943..216032)
                     /locus_tag="HG535_0A01060"
                     /inference="similar to AA sequence:RefSeq:NP_011561.3"
                     /note="similar to Saccharomyces cerevisiae TFC4 (YGR047C);
                     ancestral locus Anc_1.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141895.1"
                     /db_xref="GeneID:59233803"
                     /translation="MVDAREKEDSGGGSVRPYEEDAEQFFDNLDDYRKMISDDEDMDV
                     QENEAGMLDVSDHENYASGADSLLAEFSDYGEMSEDDEEDFMDAIREVHNFKVKRKRK
                     DGRPKPGAGRARRPRVLDPEVSQLLSEANEAFVRNDLQVAERLYNEVIKKDARNFAAY
                     ETLGDIYQLQGRLNDCCNSWFLAAHLNSSDWEFWKIVAILSADLDHIRQAIYCYSRVI
                     HINNEEWECIYRRALLYKEIGQIGRALEGFQKLYAHNPFDSNILRELAVLYVDYNRIN
                     DAIDIYMKIFDSNVTRRNAIIAASESALESSDEDSNGDDDDEENKQSESPNEQDLEEM
                     RLYPNINWKKISARYRCILFDWSSLNILAELFLKLPAGGASGIKIIKKCARWIERREN
                     QTFWEDVADDSEFDDRRLKNSRFDVLTETEKEKSYTLPIDIRIRLGLLRLNNENFVEA
                     ISHFQFLYDENFPDISDLYFEVALALSKADKYKEAIDFFSPLLSVEEYCTLELYKPLA
                     KCFKETEEYETAKKYYEQIVELEEDNLEEKLVLAEINYHLGNSDIFQGLLMEVVEQRK
                     KQASESNTPDRQKDTDGTDVVQKDASGKPLLEDSLFRRAGPKKKRTPQDTERERSERE
                     KRISAKVLDKYNKLALYKIGVNDGKKEQKLLWIDTASDLVDVFSSVKNFFIKSRSKKF
                     VGIIRRTRKFNKVIDYKIERLSKLSKGDNLLDGLPLMEERVTLTSATELRGLTYDQWF
                     ELFMELALTMTKYQSIEDGLSIIETAQEVNVFFQDPTRAKTMKFVKMAIVLQTENETE
                     LTENLRGLLNQFQFNRKVLQLFMYSLVRGQTALSIVSSTVHQKFFLRQLKAYDSIRYG
                     KHVNGQASITNKKVSNPQKLNSPYLYYIYAVLLYSSRGFLSALQYLIRLEQDAPNDPM
                     VNLLMGLSHLHRSMQRLTANRHFQILHGLRYLFKYYKIRISSYTDLESQEADYNIGRA
                     FHLLGLLSLAVQYYNKVLNDYEDEKLKKHAAYNSIIIYQESGNTRLANHLMEKYLSI"
     gene            <216398..>217474
                     /locus_tag="HG535_0A01070"
                     /db_xref="GeneID:59233804"
     mRNA            <216398..>217474
                     /locus_tag="HG535_0A01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286001.1"
                     /db_xref="GeneID:59233804"
     CDS             216398..217474
                     /locus_tag="HG535_0A01070"
                     /inference="similar to AA sequence:RefSeq:NP_011562.1"
                     /note="similar to Saccharomyces cerevisiae UFD1 (YGR048W);
                     ancestral locus Anc_1.89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141896.1"
                     /db_xref="GeneID:59233804"
                     /translation="MFSGFNSFGSGYVNIPQKYEDFFRCYPIAMMNDRIRKDDANFGG
                     KIFLPSSALNKLSMLNVRYPMLFELTASENGRVTHGGVLEFTAEEGRAYLPQWMLATL
                     GVQPGSLLKIGSVDLPLGKFVKIEPQSVDFLDISDPKAVLEHVLRKFSTLTENDVIEI
                     SYNEKIYKIKILETKPETDAKGICVIETDLVTDFAPPVGYVEPDYKALQQKQQDELAD
                     RKKHQQIDPAAHGEGTMSKRIRYKGLLKEPNDAGSKFVGEGQKLSGKSSKKNDDKGLD
                     TSKIDLSLDGEPAPLNLPDGQLFFGFPIVLPNANDASKESDVQNTFHGKGQSLRKSNK
                     RRDKGDHASIKSKAPRSPEVIEID"
     gene            complement(<217592..>221194)
                     /locus_tag="HG535_0A01080"
                     /db_xref="GeneID:59233805"
     mRNA            complement(<217592..>221194)
                     /locus_tag="HG535_0A01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286002.1"
                     /db_xref="GeneID:59233805"
     CDS             complement(217592..221194)
                     /locus_tag="HG535_0A01080"
                     /inference="similar to AA sequence:RefSeq:NP_011375.1"
                     /note="similar to Saccharomyces cerevisiae YGL140C;
                     ancestral locus Anc_1.90"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141897.1"
                     /db_xref="GeneID:59233805"
                     /translation="MTGSSVTSSKKPSVLRRGFELWQHYFPCDKILARRIAKSTINST
                     VAFIFCLIPKVRERIGTEPAMLPLISVMVHPGRRVSGTIQGAIYCLTGLVFGLAYSLL
                     GRFLAQRCLGSTWHTLTELQQYAVHYRGYEAGLAIMAVFETLMLFFHGWMRSVSHHYF
                     GIVFPLFLVVHFTFMAPLTESAAVIADSFSTPFYLGIAMSIFWNLTLFPEFGSTFLGN
                     QTVGTFNDIHKAIDDSINFFISLNCTGNDSLYSEPPVSLSKLLKMKTAIDKKIGNCLI
                     VLEECIYEISYSYLSPTQLKPIIKLLEPLGMYINGLVNACQLEFVLLGKQQYMEGDIM
                     AIHTDKEIVYADADNLVKILDRLRAPIYGLHKSLSECIYLVKLIISYAYDVDLDKVKL
                     PIIFPDGDFVAYEHKKDLPKDFDLEDRIIKLTEALIEFDLNFREEMIGLDIDVTSTSD
                     EMFLLSSFLMNFKECTNSVIEIMKDVNDVYKIRKTRESKGWLRGKSFWLIFLKNYGSF
                     KTWFKGSHYRTNVITENESLKGTIDGDQYGKLGVLAVRRPSQEEDELLSQKMETNLDA
                     DGKQGIGGLPITKQHAESSTYLSNQKNAGFAERSSLYLTRTLLWWDQFCKKNSSHFRF
                     GFQVAIALMLASFPMFIPKTRHWYVQYRGTWIGFVCILCLEPSVGGTFWVFFLRAVGV
                     IIGAAWGYLSYVAGVHQTNPYLETVITIFGAVPGFYFLLGTPYVKAAIIQIISIYIVM
                     LAAILPSPIAGGILSSFAKRCLAVGYGGGVALIVQVCFFPIKAREQLNQEIAFVCGCI
                     SEMELLYATGLEGETVKVSLSEEKYSQFARISRSAKAALARADAYKGLTRQEPRLKGE
                     YTQLESVFTQIIFVQRQIVDRMDNAALLRKQYGSGVIEEMNDVVFPYRRQMVASFSCL
                     MRAMQEAFLNKTPLPQFLPSARIAQRRLINIVSRVLRNRYKSRLDSLRPKPVSDVFRD
                     DEDSDIDEGILLKSRRDSSRVILRPHEYTLKEKFLSWSASSSAAEEIIEYIEELLDLT
                     KILIGINEFKYGFLSRPLYEDWAAEAARGFDEFIKGKKPDKATKDHRSFDLNPAISEG
                     EESMTGSSISTAGYEQPVEYNSEAAGDNTVNLARIASHKAGQNNDGLPEKFRKRAFSI
                     GSIMRDGLYKSKTLGDADSSYYNEDDDTSDEDLPLALKRIVSQKSHSSKKNPSQ"
     gene            complement(<221560..>222609)
                     /locus_tag="HG535_0A01090"
                     /db_xref="GeneID:59233806"
     mRNA            complement(<221560..>222609)
                     /locus_tag="HG535_0A01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286003.1"
                     /db_xref="GeneID:59233806"
     CDS             complement(221560..222609)
                     /locus_tag="HG535_0A01090"
                     /inference="similar to AA sequence:RefSeq:NP_014135.1"
                     /note="similar to Saccharomyces cerevisiae PDR17
                     (YNL264C); ancestral locus Anc_1.91"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141898.1"
                     /db_xref="GeneID:59233806"
                     /translation="MGLFSKRVKEQSPPVNKKDLIPCDKAFVGPPKHYGKPQLPPKVT
                     KEHSQLYKSMLEYFQNDKLQLPIDTTHTETLKPLTSKEKCWLSRECLLRYLRASKWDL
                     DAAIKSLKSTLVWRREVGLSLIDGITAQPLTSNLVSVENETGKQNILGFDINRRPLLY
                     MKNGRQNTEPSFRQVQHLIYMMESVTTFTPQGVENITVLIDFKHYKEPGIITDKMPPL
                     SIAKLCLNVMQNHYPERLGKCVLVNIPWFAWAFLKMMHPFLDPNTRQKTIFDEPFENH
                     IDAAQLQSLYNGKLDFSYNHEVYWADLSEKVESLKKYSYERFLKFGGLVGLSEFDLKG
                     DHQDLLYPVDYENLS"
     gene            complement(<222809..>223669)
                     /locus_tag="HG535_0A01100"
                     /db_xref="GeneID:59233807"
     mRNA            complement(<222809..>223669)
                     /locus_tag="HG535_0A01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286004.1"
                     /db_xref="GeneID:59233807"
     CDS             complement(222809..223669)
                     /locus_tag="HG535_0A01100"
                     /inference="similar to AA sequence:RefSeq:NP_011387.2"
                     /note="similar to Saccharomyces cerevisiae CWC23
                     (YGL128C); ancestral locus Anc_1.92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141899.1"
                     /db_xref="GeneID:59233807"
                     /translation="MSFDLQKVFDENLDLYEILEFGNDVPREQLTPSAIKKQYRTLAL
                     LYHPDKQPDNPQSLHKFHLISLATHVLGDSSLRDAYNGWLRNRESHETNDKVRTAHIN
                     KLHKREADASRISNDENAPNVQQIQKYGETLRKLKHFKMSYGDWKNLRESTNSSENSQ
                     PVHKFYDSSTLRIELINDDPTVADKLTLKTFLSRLFEVQELYDLYYSSRNDFQNDETI
                     VAYAVLMSPQEAQQLFQRWTERRNTEGWKSIIDIAPRIPLHYYAGFTDRVDLNPKIAA
                     MVNNDTIVIE"
     gene            complement(<225533..>226537)
                     /locus_tag="HG535_0A01110"
                     /db_xref="GeneID:59233808"
     mRNA            complement(<225533..>226537)
                     /locus_tag="HG535_0A01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286005.1"
                     /db_xref="GeneID:59233808"
     CDS             complement(225533..226537)
                     /locus_tag="HG535_0A01110"
                     /inference="similar to AA sequence:RefSeq:NP_014136.1"
                     /note="similar to Saccharomyces cerevisiae YIF1 (YNL263C);
                     ancestral locus Anc_1.93"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141900.1"
                     /db_xref="GeneID:59233808"
                     /translation="MSYNPYAYASEEGAVNDRFDQGIPGRDMHPVVEQQQQQGKGPIT
                     GYPSRAPFQAGSQGIQGMHGNQGMAAGLPGPSSSSGAGNGPFQSGSTSMAYQLGQSAF
                     SNFIGQENFSQFQATVSKATSGSSGLSHYFQVTTAYVLRKLQIILMPFLNKSNWQRLP
                     DPQVQGAFLPPKDDVNSPDLYIPVMGLVTYILIWNMQKGLQGDFNPENLYYKLSSTLA
                     FVGLDLVILKLGLYLLVSTNSPTASFIELICYVGYKFVPLTLVLFSPSKPFYASMLAK
                     VYLFIAFGVFLLRAVKFNLFFDANNDMGSIKKSTVKKCNYFLFVYGFFWQSVLMWLMA
                     "
     gene            <227022..>233660
                     /locus_tag="HG535_0A01120"
                     /db_xref="GeneID:59233809"
     mRNA            <227022..>233660
                     /locus_tag="HG535_0A01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286006.1"
                     /db_xref="GeneID:59233809"
     CDS             227022..233660
                     /locus_tag="HG535_0A01120"
                     /inference="similar to AA sequence:RefSeq:NP_014137.1"
                     /note="similar to Saccharomyces cerevisiae POL2 (YNL262W);
                     ancestral locus Anc_1.94"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141901.1"
                     /db_xref="GeneID:59233809"
                     /translation="MMSNNFKGSASARFAKKGRTNYAGSSSSNNYALTTKQLMQAAKV
                     DSIDEMMGFEKYVPPQHSGKTDAGNLDQVAGRVGWLTNMHPTVISQESLTGKGNGESS
                     GIAGVDFYFLDEEGGSFKSTLNYDPYFFVKCNDDSRIQEVEELLKKYLEPCLKHLEVV
                     EKEDLSLDNHLIGLKRTLIKLSFVNSNQLFEARKLLKPILSYNESNKSEQRIYKSSVQ
                     NSSKNSVRDVKSLIEDIREYDVPYHVRISIDKNIRVGKWYKITSDGFFECSEKVAFAD
                     PVILAFDIETTKAPLKFPDSAIDQIMMISYMIDGDGFLITNREIISEDIEDFEYSPKP
                     EYLGQFTIFNEEDEAALLQRFFEHIRDVRPTVMSTFNGDFFDWPFVENRAKIHGLDMF
                     EEIGFASDADGEYKSSYCSHMDCFRWVKRDSYLPQGSQGLKAVTQAKLGYNPIELDPE
                     LMTPYAFEKPQQLSEYSVSDAVATYYLYMKYVHPFIFSLCTIIPLNPDEVLRKGTGTL
                     CEMLLMVQAYNGNIMLPNKYTDPIERFYDGHLLESETYVGGHVESLEAGVFRSDITND
                     FNIDPTVIDELLQDLPNALKFSIEVENDTALEKVTNFEEVKKEITDKLLDLKHNNKRN
                     EYPLIYHVDVASMYPNIMTTNRLQPDSMKSERDCASCDFNRPGKLCDRRLKWSWRGEF
                     FPAKMDEYNMVKRALQNETFPNKNKFSKKQYLSFDELSYADQVAHIKKRLTDYSRKVY
                     HRVKVSEVVERESIVCQRENPFYADTVRSFRDRRYEFKGLAKVWKQKLSKKDNSDRHG
                     KDEARKMIVLYDSLQLAHKVILNSFYGYVMRKGSRWYSMEMAGITCLTGATIIQMARA
                     LVERLGRPLELDTDGIWCIIPKSFPENFTFTLENGKKLFLSYPCSMLNYKVHEKFTNT
                     QYQQLVDPVKHKYKTIRENSIFFEVDGPYRAMILPSSKEEGKGIKKRYAVFNDDGSLA
                     ELKGFELKRRGELQLIKNFQSDLFKVFLEGDTLSNCYSAVANVANRWLDILDTKGSLL
                     EDEDLIELICENRSMSKTLKEYEGQKSTSITTAKRLGEFLGEEMVKDKGLQCKYIISS
                     LPPNAPVTERAIPVAIFSAELAVKKSFLRRWTMDMSLENFDPRGIIDWGYYRERVASV
                     VQKIITIPAALQNISNPVPRVEHPMWLQKRLATKQDKFKQVSLNKFFTNTQRPPSSGS
                     IKDIEDLFQENEGDSGTIGRIAKVSTRKGSKKRNRSNIVEEEPLVLPSHKPSMEEDYV
                     AWLQYQKIKWKIQSRDRMRRSHLFGNGSSTTGSTALGNMIRKQAESYANSTWEILQYK
                     ASAQSDVVDVFVSINGKIQVLKFNIPKTVFVKFKAPPLGSIDHCTMEASSYSLPNNSK
                     LKDLSSSNLYKLTLTERTFLDELENPNSILNSDKVIGIFESSIPSNERAIMELGSSVT
                     FTSKAMGDLGKGLRDGFHMKNLSMSESQRYLSRFSIASAYILHLVTDVGYEFLCIFKS
                     WSHSTTVLCLKPSFQAAELSSTTLSQTFSEVFQKKKEHLAKYSKFVSYAENMTFDTHS
                     FTDKLKFQRKFSREVHKLKDDKGLQFLILLQSPYHSDLLDTAKVLSQVPVIPCAINET
                     KVPQLNWQGAVGKKMINHILSCSSWLSHLLSISQFSNVPICNLKLDNLGYVIDILYAR
                     QLKHEGHVLWWDESIPLPDHGGVQRDFDLNLFSLMGDMSFPELNNSGAYDHVVLEVEM
                     ENLTVNTVLASALLNTEEGSEISEVDIPLNSDDGTKNFKSTFIQDAFSGGSLAVLRSL
                     LKSWWDSAMKNNLTADLLVNAFVSWVHNSNSKLFDPLLRYHIHNLTKRSLFQLIAEFH
                     SLGSTVIYACRNKLLINTSKLSPELCYAYGQYITKAVRTNPIFTYIDLRIEKYWDLLI
                     WMDKYNFSGLACTEIHDKEIQDIRAFSQWHIREFLPVIYQPEFDDWMMIILDSMMKAK
                     KEYMSAVDGTQRITQIVSKKSDDSNTKEASALATFTHIFAKPLIKRVRKLYRNQQEFI
                     LDPKYAADYSFPSLPGSHLVLNNPLLELVKFLCQVMLFSQKTVIEVRELRKQLLNIFE
                     IREFDAISEFKDPSTALVVSGFQCENCSSLNDIDLCNEDPSTVFKCNKCHRDFNLTLL
                     QDHLIRMFYAEREAYLIQDIRCSRCKKVKTDNMSKYCACSGSWKADVSLESVMSRVSV
                     YLRVAKFYQFELLKSCISSLRI"
     gene            <234365..>235780
                     /locus_tag="HG535_0A01130"
                     /db_xref="GeneID:59233810"
     mRNA            <234365..>235780
                     /locus_tag="HG535_0A01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286007.1"
                     /db_xref="GeneID:59233810"
     CDS             234365..235780
                     /locus_tag="HG535_0A01130"
                     /inference="similar to AA sequence:RefSeq:NP_014138.1"
                     /note="similar to Saccharomyces cerevisiae ORC5 (YNL261W);
                     ancestral locus Anc_1.95"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141902.1"
                     /db_xref="GeneID:59233810"
                     /translation="MISYPEDVLFRDYQLKSVAAFVHGDPTIACPNLIIQGNSSSGKT
                     YVLQKFFEANPSLINAWLEPIELVSWKPLLQAVVRSVQNKLKILFCDLAHKECDPLEV
                     EEPFLLVKALWNIFSQYDSLPTDINFFLVLDGFDRLQDLDAALFNKFIKFHELINTKS
                     KIHLKLIYMIQDIAFVERYSSHCLPMIVFPSYSIEQIIEILIFTRVEQLVMSNTLRER
                     IIKQGVEECTDEQFVSVAANYIKLIVQAFHSYTGNNINALNDFIDFKWHSYVQKITKE
                     NIFDPLALYRSSINLFLTTDDSFVEDEDNRDNYNEPSQTYELSAISKYLLIAAYICSY
                     LGPRYDSNVFSRRSYLKSGRSSYGRRKKMETNPRYLQPSLFHLERLFAIFQAIFPVER
                     TTESGSLASLREEALIRANVEVFQNLAELHVLKMVSTTVTKNIDFLSHKTKWKVNVPW
                     EIVLEVAKSVNFDISQYFSGL"
     gene            <236022..>237155
                     /locus_tag="HG535_0A01140"
                     /db_xref="GeneID:59233811"
     mRNA            <236022..>237155
                     /locus_tag="HG535_0A01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286008.1"
                     /db_xref="GeneID:59233811"
     CDS             236022..237155
                     /locus_tag="HG535_0A01140"
                     /inference="similar to AA sequence:RefSeq:NP_012026.1"
                     /note="similar to Saccharomyces cerevisiae LIN1 (YHR156C);
                     ancestral locus Anc_1.96"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141903.1"
                     /db_xref="GeneID:59233811"
                     /translation="MSSYEFSSSDPLKVRKKAVESDEDDESLEDLVEENGFLSKSVSQ
                     RIKRHKYLASYNSDSSEDDESDSDGPVRQREGTGAITEGQDSEDKNDMFSLEDEEEVG
                     NEGNEERKARRLKALDINKFNEENLKNLGSETDDVGFNEEEGSIRIEAFNIEEESKRG
                     MFDEDGNYMEAEEHEDDVFQDQDMWIRDFKDVSKTAEAQKKLAKSQVQQQRESQKRKK
                     IYMLDEALIRLQYLLSKDDTVLDTLGKYNKLREKQARQKVLDSSGRNVKEYVVNAINL
                     LADLVAILESKGVSNVYELNRPHIETLIKEESLTAETTDNYKTGLWHFKWMSKMDDIH
                     GLYTNYQMQYWKQTYFNHKVVVKYRDEQDEKSNWLDIDCVTFM"
     gene            complement(<237174..>237695)
                     /locus_tag="HG535_0A01150"
                     /db_xref="GeneID:59233812"
     mRNA            complement(<237174..>237695)
                     /locus_tag="HG535_0A01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286009.1"
                     /db_xref="GeneID:59233812"
     CDS             complement(237174..237695)
                     /locus_tag="HG535_0A01150"
                     /inference="similar to AA sequence:RefSeq:NP_014139.1"
                     /note="similar to Saccharomyces cerevisiae YNL260C;
                     ancestral locus Anc_1.97"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141904.1"
                     /db_xref="GeneID:59233812"
                     /translation="MSPRTSNGDLNDAMDELLNLEEKFYKEGYEEGLAVKAKDNFRQG
                     KQYGLQVGLQRFLLLGEIEGYIDVIAAQNIDNTSLSKNIEIVRSLLRGLRFDNSDETV
                     ADFDSRVLKIKNKFRTILLVLNRKQNYGFKDSIIFDMLDKTSSSLGGTLKAYVEDGIG
                     TDDVSFNGKQQDW"
     gene            complement(<237885..>238106)
                     /locus_tag="HG535_0A01160"
                     /db_xref="GeneID:59233813"
     mRNA            complement(<237885..>238106)
                     /locus_tag="HG535_0A01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286010.1"
                     /db_xref="GeneID:59233813"
     CDS             complement(237885..238106)
                     /locus_tag="HG535_0A01160"
                     /inference="similar to AA sequence:RefSeq:NP_014140.1"
                     /note="similar to Saccharomyces cerevisiae ATX1 (YNL259C);
                     ancestral locus Anc_1.98"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141905.1"
                     /db_xref="GeneID:59233813"
                     /translation="MSEQSHYQYNVSMSCSGCSNSVSKVLKRLEPAVSKVDISLEDQT
                     VDVFTSLPYETILEKIKKTGKTVNSGKKL"
     gene            complement(<238380..>240656)
                     /locus_tag="HG535_0A01170"
                     /db_xref="GeneID:59233814"
     mRNA            complement(<238380..>240656)
                     /locus_tag="HG535_0A01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286011.1"
                     /db_xref="GeneID:59233814"
     CDS             complement(238380..240656)
                     /locus_tag="HG535_0A01170"
                     /inference="similar to AA sequence:RefSeq:NP_014141.1"
                     /note="similar to Saccharomyces cerevisiae DSL1 (YNL258C);
                     ancestral locus Anc_1.99"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141906.1"
                     /db_xref="GeneID:59233814"
                     /translation="MEGVVQIIRDPVRNLLGDNDKLLRELKNDKLLEEYLNSNRENGH
                     NSSDILSREQELSKELHELSRLRSIPGLVLEIETNLELQEFENCYQSLKTLRKKLYEN
                     EFILNKSFGLQQSVSRFVDGLHVKFVHQVHEVCKAFWKVQDDSIALHKRIKWGKDDVE
                     IEYSAFIESVATLFFPEGLVDSKHWIIDDMLLADLQENVRATLKSIFNDHIHLDVIVE
                     KMKSLIFVGKKEIAFSDDKDFLILKGVYIGNEETTAGTLSNFESILLFLDHTSPPGAK
                     SVLVRRLCPVLANDLLKVIKKNASGVFGPQESSVKKKALRVNCLLEKLLNSQEDMSKA
                     IASEIERLLTSEELYVHLQLEKIFQEQLQELRMLFEDENKNLVRVEPKLVTYQTGSSR
                     NSMAADGMTNKNLKDDETEDWGWEADDGWDDQIDVSVEGDNVSRISKKSRNTEKTDDL
                     GAVEDNADTEGVEDGWDDAWNVDFDVEDERKSMKSVETKSSFKVTSLSKKYMASIRVF
                     SQRWKEKCGGSFDEPYYRYKLNVLQTAYMGMCIPYFGDDWCQLSRDLSYIHSADRSFS
                     RLYELALNYLDFNIRTREKICDTYVSQQLEEFEQNESNPSWDTTITELLPFIHNEVIG
                     PFSQLNNGVAQECITKFLKFLYQNCIAGKILTWNIISEKNSENLSEFISLIFAKTEVT
                     ILPHSKEMSELREKFSFIGTFLPLHLKDIMELFYHGDFYLFTTDEIIQWIVLLFAETP
                     LRRNAIDDIREIRNVELE"
     gene            complement(<241731..>245450)
                     /locus_tag="HG535_0A01180"
                     /db_xref="GeneID:59233815"
     mRNA            complement(<241731..>245450)
                     /locus_tag="HG535_0A01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286012.1"
                     /db_xref="GeneID:59233815"
     CDS             complement(241731..245450)
                     /locus_tag="HG535_0A01180"
                     /inference="similar to AA sequence:RefSeq:NP_012025.1"
                     /note="similar to Saccharomyces cerevisiae YSP1 (YHR155W)
                     and SIP3 (YNL257C); ancestral locus Anc_1.100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141907.1"
                     /db_xref="GeneID:59233815"
                     /translation="MVKQKLQPKEPNGKVSEWKKMKLVSIAFKEASLDTPSFRASVNH
                     FQTRTEIFQEWMEKVVDFIYNKYSSSMEDFQRAHNTFISLLLPSPMILSNGFVANQAN
                     TPSLVGSFNQTFYELSSKVFKVVCEKDYGSPNSLLELMNTAIEPYKDRRANFDYYQSK
                     YDNMLGKYQAIKISNTNLEPATIKEDAFQIFEIRKEYLKSSLELVCAISTMKLAIDKF
                     LLEVMETIQTRASQSMKEIGQFIDLAPALSASLKDYAHWIENSIASTKILASDMQKAK
                     QQVMEYSLSKIAPAQEVNDYNVKSINFSSLLSKKTEAIKNPPEKSGWLYMKTTVGSPS
                     RTVWVRRWCFLKNSVFGLFLLSSSKTSVEETDKFGVLLTSIRYDPDEDRKFCFEVKIM
                     TRSSKARTNSIKDIHLVLQAESLQELKSWLNTFDASKRYAYNLSHDSAEYDMAFKRYF
                     PEFLEFASSTTTTTDQLITTCDENTMSIMSMTDSELASLYMESSAGHKYFQFQLAGTP
                     ISTKLTPVAVMANLYKKSHHLPNAILANIWGSANWSDYAIYDDEEEEPAVSTKKLGRG
                     MTTSTLVYPNFYPNQMKVEDVQFKSLFFTINQKLNQFPDELLLFNFSSFWFPNKRQKF
                     SANCYVTVDHIYCYMNSMGFICLTHRSLGDLVSVEVDTSADNLLRIYDVNGIQLKMFV
                     YFVDRQLIANKLQYLLENKALKQPKKEEEIFKRLNVMDSEFQERHRRSTLAGSKIFQN
                     HADTDNSFGTKLCESFWPNDEESSDLSRRRKSIQREYSVMYRHAYEVSSKCLIHILYG
                     DQSIAFPRSLLLATKDTNSNISSNWMQENSADGQGQLVRTLEFNLNLTDSFLGNVRRG
                     QTCELKLKQRMVRVIENKYYEIEQDPIIIKIPFCRPLRVKAKHVIMEANESRFSLNSP
                     SSSSACLLYIFYKLQFLDPITGKCVNNLTFAERAVMPWARHFTSFEYASIRKMIRYYL
                     EKIGKHGKTIKAIKICGMIGVAKSRAEQNDESKGLNNSAKSVLSNEKLQEDLNIDVVY
                     SLSIIFKVILKLIGYKITNFAFLFLRYIFRWLLLMVSNVTHINRTLLLGLLLSITVNI
                     FLSGKSSVAYWSVKRAETAFHDYAKENSEVSMHHAITIKDLDLLKFTLAYENDNLPYK
                     KFNHTHSAEIYKYKATREEISAKRNEALIELKILQNMERELVQDQYKKFLVKELENCH
                     IVEQEVSQIWSNDTQLQKYCQSCSTELYRVGTLLL"
     gene            complement(<245662..>246849)
                     /locus_tag="HG535_0A01190"
                     /db_xref="GeneID:59233816"
     mRNA            complement(<245662..>246849)
                     /locus_tag="HG535_0A01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286013.1"
                     /db_xref="GeneID:59233816"
     CDS             complement(245662..246849)
                     /locus_tag="HG535_0A01190"
                     /inference="similar to AA sequence:RefSeq:NP_010343.1"
                     /note="similar to Saccharomyces cerevisiae TGL2 (YDR058C);
                     ancestral locus Anc_1.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141908.1"
                     /db_xref="GeneID:59233816"
                     /translation="MLKNGSEEREYKSEAPSLSSLSSKYNDPTVLSFNQSYRSFCSSY
                     SNTTALLISSVPLREKFRAPKNPIVLCHGLSGFDKLILIPSLTQLTKLLYNHLQGLNR
                     ESFIVDHSNSEELGNRGILEVEYWIGVKERLEQKGCTVITASVPSFGSIEERATILNA
                     FLETETQKLKQTASKGQVYNTSEESTDETFEKDDRIRLNLIAHSMGGLDCRYLISKIP
                     DKSYQVLSLTTISTAHRGSEMADYVVNLSEDLRKLIAFEAPVILLPPCFYELTTEYMK
                     YFNERVLNEPAVSYYSYGSFFKPKWHNAFYTSWKIIDNSSNGNPNDGLVSVQSSKWGQ
                     YQGTLANVDHLDLINWRNKIRRDIGKLLENTNHSLEQKVKPDIDILNFYLAIADNLAS
                     KGF"
     gene            complement(<247045..>248034)
                     /locus_tag="HG535_0A01200"
                     /db_xref="GeneID:59233817"
     mRNA            complement(<247045..>248034)
                     /locus_tag="HG535_0A01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286014.1"
                     /db_xref="GeneID:59233817"
     CDS             complement(247045..248034)
                     /locus_tag="HG535_0A01200"
                     /note="ancestral locus Anc_1.102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141909.1"
                     /db_xref="GeneID:59233817"
                     /translation="MSVLIETTLGDLVIDLAYENYKIESYNFLKLCEMGFYDRQCFYD
                     LQKGRSVMFGDALVGFEDRKELRTHNMSIKGLEDQESSNGSQLIRATDLLSTSQRTRK
                     GQFGFKAVNKDDSTPQLIGSQVVLVLNDLEEPMQNMIFYGEVTVESQKLLKIMNSLEV
                     DDMKRPLNDIRIKKTYLVFDPFPPLENVHRLSISLPLRDVRISKEWLEEHRDLWDTRD
                     EILDDIKRKELVFEIASDVPTMGIKPSECVLFICKLNPLTRAKDIATIFHRFGEINSV
                     EIIRDKLSGRSLGYGFIEFKDRRSCEESYKQMDGVLIDDKRIHVNFSQSFKRI"
     gene            complement(<248219..>249652)
                     /locus_tag="HG535_0A01210"
                     /db_xref="GeneID:59233818"
     mRNA            complement(<248219..>249652)
                     /locus_tag="HG535_0A01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286015.1"
                     /db_xref="GeneID:59233818"
     CDS             complement(248219..249652)
                     /locus_tag="HG535_0A01210"
                     /inference="similar to AA sequence:RefSeq:NP_011771.1"
                     /note="similar to Saccharomyces cerevisiae COQ6 (YGR255C);
                     ancestral locus Anc_1.103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141910.1"
                     /db_xref="GeneID:59233818"
                     /translation="MFGKVSAPHKLIRLISSATHAVPKLADVLIVGGGPAGLTLAAAI
                     KSSPKLNQLSTVLVDASDLKGKVASFYNSPPDNYTNRVISLTPPSRRFLEERAGVSLM
                     NDRIQVYDGLYVTEGCSDATLDMEKDSMACMIEILNVQSSLLKRLDQLSPDPNTFKII
                     DNTKVSGIELNDPYDAKSWPLVTLDNGEVYKTRLLVGADGFNSPVRKFSRIPSRGWSY
                     NAFGVVATMKLEYPPYKIRGWQRFLPTGPIAHLPLPGENATLVWSCTERLSKLLTSIT
                     PEQFTALINAAFVLEDADMKFYYKQLEDKTISTKELSEDINFRIEQVFSSSEDENMID
                     EKYPPKVQGILPDTRARFPLKLSHADTYCSERIALVGDAAHTTHPLAGQGLNMGQGDV
                     EALVDALEIAVSRGSDIGSLLSLQSFWADRYPINNLLLGMVDKLNKIYGTDYAPIVAL
                     RSFGINVINNVPPLKNLIRDTLGESGR"
     gene            <250188..>252737
                     /locus_tag="HG535_0A01220"
                     /db_xref="GeneID:59233819"
     mRNA            <250188..>252737
                     /locus_tag="HG535_0A01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286016.1"
                     /db_xref="GeneID:59233819"
     CDS             250188..252737
                     /locus_tag="HG535_0A01220"
                     /inference="similar to AA sequence:RefSeq:NP_014143.2"
                     /note="similar to Saccharomyces cerevisiae FOL1 (YNL256W);
                     ancestral locus Anc_1.104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141911.1"
                     /db_xref="GeneID:59233819"
                     /translation="MRTLYSNRLALRVFRPSYRGAFTRTSDYSRGVITHINRPFSITS
                     KTYNTASSNLMNDKVHIEKLDVNAVIGADSWNQLNAQQCFVTMNMLTDFSKAAVGDDL
                     NYSLNYAVISRDIAEFVQSKRNWRSLGNLSRSVSNYALQKYSGIESLQLLIETKTGHI
                     RSDSISCLVNQMNSRAPTRQKDVYDVIQISNIKMLTLIGVFTFERLQKQYVTLDIRLP
                     WPKDLVNHASYKSIIESAVSHVENSNFLTVEALVESTAKVIASNPYFRKNNKLPIELK
                     VIKLNAITNTTGVGVSIIKTPQELDSIPLPHVLETKTTSSALFAGNQENDIISNTYPK
                     AWSTAFIAFGSNMGNKVENIQKALDYLNASENVEIRKVSSLFESEPMYFEDQDVFMNG
                     CVEIVTKLTPHELLKLCKDIEYKELGRIKHFDNCPRVVDLDIIMFYDKDGSQVILNTK
                     DLIIPHPKLLERSFVLEPLCELLPPDITHPLTTEPLTDHLNQIYDQGNEADVLWKIIP
                     LQPRSSNFRALKFMNVKMTDEILRSKVITKSPALLMGILNVTPDSFSDGNKQYLNLQK
                     QIETVKIMCSDALRLQDKIIIDVGGCSTRPNSSQVSEMEELERTIPVIKSIRTCKDLP
                     QENIIISIDTYRAKVAQEAIIAGADIVNDISGGTFDSDMFGVIASHPNVAYVLSHTRG
                     NISSMIDLNKYEQPNSNVKEYMNGEKISGRSAILLRSIAHELSERYAQAIGEGIRRWQ
                     LILDPGLGFAKNGKQNLEIIRQLDLLKNYACILESGEFVNFKNIPILVGPSRKAFIGK
                     ITKDDDPKDRDFATASVISSCIGFGADIVRVHNVVDCSKTIKIANTLYRDA"
     gene            complement(<252933..>253415)
                     /locus_tag="HG535_0A01230"
                     /db_xref="GeneID:59233820"
     mRNA            complement(<252933..>253415)
                     /locus_tag="HG535_0A01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286017.1"
                     /db_xref="GeneID:59233820"
     CDS             complement(252933..253415)
                     /locus_tag="HG535_0A01230"
                     /inference="similar to AA sequence:RefSeq:NP_014144.1"
                     /note="similar to Saccharomyces cerevisiae GIS2 (YNL255C);
                     ancestral locus Anc_1.105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141912.1"
                     /db_xref="GeneID:59233820"
                     /translation="MSQKACYVCGKIGHLAEECDSDRLCYNCNKPGHVQSECTLPRTV
                     EHKQCYNCGETGHVRTECTIQRCYNCNQTGHISRECSEPKKSRFPTASSAQASNKVSC
                     YRCGGPNHMAKDCLQTGSKCYSCGKFGHLSKDCPSGPGEKICYNCNESGHISRDCTYE
                     "
     gene            complement(<253663..>254748)
                     /locus_tag="HG535_0A01240"
                     /db_xref="GeneID:59233821"
     mRNA            complement(<253663..>254748)
                     /locus_tag="HG535_0A01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286018.1"
                     /db_xref="GeneID:59233821"
     CDS             complement(253663..254748)
                     /locus_tag="HG535_0A01240"
                     /inference="similar to AA sequence:RefSeq:NP_014145.1"
                     /note="similar to Saccharomyces cerevisiae YNL254C;
                     ancestral locus Anc_1.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141913.1"
                     /db_xref="GeneID:59233821"
                     /translation="MDGSQLKRKRVYGSIVKSPGNSKRSKSFHALREIKSDEKRNNSS
                     DSSDLSDIEGEALRLNSDIMGEVDDEDTDSISSESEREILEELKNISSPEKGICLKQS
                     VDVEDIELTRKECTVHGRHDGWKILKEAETSLVNDDSMLALNARSRIRKDMPEPHVQY
                     LEKQKVRNLHIERYNLPQVLTSSDLINKIQPLLPIIRDMYNGVVDSYYKYEATAVSKY
                     SQNGILSSKEFRSLDINRFQAGFYGFRRQLRVGEEILRHFKSFLLKRQGKTMRWWGVA
                     DFANYVLAPEVLASLCILEMNLGKELYDKETRERAYELFDKTIEFGNKVADSEPLEEW
                     EIQAENQRIAEIELSFETGSESLAQRD"
     gene            <255580..>256899
                     /locus_tag="HG535_0A01250"
                     /db_xref="GeneID:59233822"
     mRNA            <255580..>256899
                     /locus_tag="HG535_0A01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286019.1"
                     /db_xref="GeneID:59233822"
     CDS             255580..256899
                     /locus_tag="HG535_0A01250"
                     /inference="similar to AA sequence:RefSeq:NP_014146.1"
                     /note="similar to Saccharomyces cerevisiae TEX1 (YNL253W);
                     ancestral locus Anc_1.107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141914.1"
                     /db_xref="GeneID:59233822"
                     /translation="MDTPKVKNMKLLGQEVMSPELSNLLTEKLLSSIMDKPQIEDLED
                     ERYIHVNTRSQSRFAVPVNPNEVMSIEFHPSGKFLAYGRIDGSLTIWILDSSSYAKAR
                     KIYLADAIDIDKMVYSLSWNANETSQFATVANTSEIFIWGIDEGKRSLTKLRTLTVGS
                     KVKLFKCFYDPMGNWLLAVTKSEELYLFNVRSDHEMHSTFDVKAIVPDDSIYCVSWNN
                     SGSHIFLGLKSGKLVVLELDETEGISVKSILSSHRASLNCVKMDPWGRYVVTGSTDGT
                     CCIWDLKTLCCELCIDEFDCSVSQVDIDALGKILAICTTDGVVRFYDINSGHLFLQQK
                     IKNSNSDVILLFKPDSTDLIISGKQDILQSHFTPNHYHDVLSLWKTVHEKSRSTSRNK
                     NNISSTINNPDNTRRPNKRVRDHDRITNNSKRERVSQRTSRFTDKRQ"
     gene            complement(<257008..>257814)
                     /locus_tag="HG535_0A01260"
                     /db_xref="GeneID:59233823"
     mRNA            complement(<257008..>257814)
                     /locus_tag="HG535_0A01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286020.1"
                     /db_xref="GeneID:59233823"
     CDS             complement(257008..257814)
                     /locus_tag="HG535_0A01260"
                     /inference="similar to AA sequence:RefSeq:NP_014147.1"
                     /note="similar to Saccharomyces cerevisiae MRPL17
                     (YNL252C); ancestral locus Anc_1.108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141915.1"
                     /db_xref="GeneID:59233823"
                     /translation="MLPFRRKIATAAQSAVGNPISAGLLLSRIPVVTPELNKIESQYY
                     DYQSELKKRLMWTFPHYFYFRRGTLAERRFLMAQKGPISKQPGVWFPKGTPDVKHNRE
                     RSQKQEIALPRESNEGSEVTQKGSDISRPVVPNARITEADKTGDETSLERKLDRTLYL
                     MVKAQDGSWNFPSFPAYDKPLHISAEEGLRSLGGGSIKTWTVSNTPAAALEIENGGHQ
                     FIIKSHILAGEFKLQNKQDFVEYAWLTKEEIQDRVEATYFKSTGFLLADN"
     gene            complement(<258018..>259718)
                     /locus_tag="HG535_0A01270"
                     /db_xref="GeneID:59233824"
     mRNA            complement(<258018..>259718)
                     /locus_tag="HG535_0A01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286021.1"
                     /db_xref="GeneID:59233824"
     CDS             complement(258018..259718)
                     /locus_tag="HG535_0A01270"
                     /inference="similar to AA sequence:RefSeq:NP_014148.1"
                     /note="similar to Saccharomyces cerevisiae NRD1 (YNL251C);
                     ancestral locus Anc_1.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141916.1"
                     /db_xref="GeneID:59233824"
                     /translation="MSENNQEFVATLESFRDLKSGISGSRIKKLTTYALDHAEDEETL
                     ISLIINYSRTCSASHRLGSLYIIDSIGRAFLDEARANDDVIQSTAKIGSCAHAVYTLG
                     ESIKDLLADGISNSNEDHREKIRTLVDIWDRAGLFPKSYLNAIRSKYFSMNAEEESSH
                     TSGSSQDQLSDDPNERCVQILNNLKPLKFVPRVHLPTTLESNDLAEQQAALFQVLVSV
                     QQQFQEQDELQHQRNFTSLPQREPAHQSHVTTEYGSRRERERERERYSSRRNRSRSPR
                     RETGTRNSSGAHTNSNGPLGTNNHHLYPDEQNVPSNSHSRSKPVSFEANLPPDHIKVF
                     SRTLFVGGVPMNMKEWDIATVLRPYAEVQSVILNNARKHAFVKVYSRSEAENVLLNFN
                     KDGSSPLRTRWGVGFGPRDCCDYQHGYSIIPLHRLTDADKKWCVHAQWGGTGGQRLQG
                     GVVFEEPDIIVGEGVSSKAISQKMPTDSGRNGPRSGKADKNSGSTPPMPTYRTNQASN
                     TNEMYPQVPQQPYQQQIPYPQQPQPQTAGYSQPQAAQTSFDATAQLNSLMSMLNQQQN
                     "
     gene            <260345..>264262
                     /locus_tag="HG535_0A01280"
                     /db_xref="GeneID:59233825"
     mRNA            <260345..>264262
                     /locus_tag="HG535_0A01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286022.1"
                     /db_xref="GeneID:59233825"
     CDS             260345..264262
                     /locus_tag="HG535_0A01280"
                     /inference="similar to AA sequence:RefSeq:NP_014149.1"
                     /note="similar to Saccharomyces cerevisiae RAD50
                     (YNL250W); ancestral locus Anc_1.110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141917.1"
                     /db_xref="GeneID:59233825"
                     /translation="MSAIYKLSIQGIRSFDSNDRETIEFGKPLTLIVGSNGSGKTTII
                     ECLKYATSGDLPPNSKGGAFVHDPKITGEKDVRAQVKLAFTSANALNMIVTRNIQLLV
                     KKTAATFKTLEGQLVIVNSNGGRNTLSTRSIELDTQVPLYMGVPKAILEYVIFCHQED
                     SLWPLSEPSNLKKKFDEIFQAMKFTKALDNLKGIKKDMSVDIKLLKQSVEHLKVDKDR
                     SETVKLEMRQLETKVEKYKSEVKEIEKRILIVNEQSDKLFKSNQDFQRVLSKAENLKH
                     NRESMRDQISRLSSAIDILDIPRAELLSRIKNFSFTLEEKEVNTEAVRADITSAKSKS
                     LELHNKCNFLIRRQGELTAAKNTHEKNLKALNELHQYLSLKYPSCGKDNTNLRIFLLD
                     LEKIKNSLNANFQKLSNEGKLELSYLEKQLSELRHSKIIQKERLEYSKQDEEKLIKEV
                     DRLDTELQLSGFTFEDLEKEKTSLEKFQQKLHEWERKDDISKFNSDIKSKNDQMLILE
                     SEVEDIQIKISKTNQRADLFAKLSVIKRLMKEKEEELSTLKDKILDDENCIKWNISAE
                     SNVDVDFKKLSSKLTQETSLKEKKFRDKDREFTEASLNYGNIKQELKDLAEKRSNVGK
                     ILERNLPEDCPIEEYEEVVAETELSYRTALENLKMHQTTLAFNRRAIEVAQEESVCYL
                     CSRKFEDKPFKSSLLKKLAAKIDVGFEKGLKETVENEKTYLQTLRSMEKNVVELRSCS
                     EKVKSLVAYEVTSQERVRTLESERNSLSNEYLNLKHDLDFVEKDVRSLVDSVIRCKNE
                     LKDLKNDVKTLSDELALYGALREDIQTVDELQAQQKEKNDHLRMLRKDINQLQEKKEE
                     KSREYSKLLTVVKERNLKVTEIEKELSMNRNIENDIEQKKKEIVYMKKSTEKGEKELE
                     ALTIKLVECEKIEHLKRKELESNMLSLSTNLKETEEDLEKFSGLKQALDGYASTGLEK
                     LEECSNELDSCQKSFDQINKYIEKRNAELSNEIQKIRDSTNEKRSLEQNLQLCDLRAN
                     LERLEIDINEIDISNAENERDRYQEESLKLRNEYEGLSSDNAGKLGEIRQLQNQIESL
                     SRQLRTEYEDVNNHYHKKWVELQTRTFVNDDIETYSKALDSAIMKYHGLKMQDINRIV
                     DELWKRTYSGTDVDSIQIKSDEVKSGIKGKSYNYRVVMYKQDAELDMRGRCSAGQKVL
                     ASIIIRLALSETFGVNCGVIALDEPTTNLDEENIESLAKALNNIIHIRRHQKNFQLIV
                     ITHDEKFLNNMNASEFTDHFFRVKRDDRQKSQIERVDISRVTE"
     gene            complement(<264873..>266108)
                     /locus_tag="HG535_0A01290"
                     /db_xref="GeneID:59233826"
     mRNA            complement(<264873..>266108)
                     /locus_tag="HG535_0A01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286023.1"
                     /db_xref="GeneID:59233826"
     CDS             complement(264873..266108)
                     /locus_tag="HG535_0A01290"
                     /inference="similar to AA sequence:RefSeq:NP_014151.1"
                     /note="similar to Saccharomyces cerevisiae RPA49
                     (YNL248C); ancestral locus Anc_1.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141918.1"
                     /db_xref="GeneID:59233826"
                     /translation="MSAKRSIAEVHISEYQDHPSVAIGSFFKGFQAPEGTTFDLYKKK
                     TSKDQFILHGENDKLEYNGETDPESVTSNQYLVGIFNPEKKSVQLYKAPLIASKIFSK
                     HTKNLSGPTIKSNDVRSSALRNALGEAFGTKKAKKAIADLERNRVDSDKLVDSAVDIV
                     DSVRTAAKDLPSRQQLEEQVTHDRPTPLANIDATDVEQIYPVENIIPKRELQVIRVGP
                     LLKETDHEKRLELLPYNKSQYISKKLPALTQATQMTKLQLLFYLSLLLGVYDNRRVNN
                     KVKLLERLSSPSEILLDGVLERFTVLRAGQIGKSKDRSFVIDPQNEDKLLCYILVVIL
                     HLNNFIVEISPLAKELGLKPSKLVNLFRVIGAQVKGATVAQAEAFNIPKSSASTYKIA
                     TLKVPFKLPQMTRRGRAPR"
     gene            <266635..>267111
                     /locus_tag="HG535_0A01300"
                     /db_xref="GeneID:59233827"
     mRNA            <266635..>267111
                     /locus_tag="HG535_0A01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286024.1"
                     /db_xref="GeneID:59233827"
     CDS             266635..267111
                     /locus_tag="HG535_0A01300"
                     /inference="similar to AA sequence:RefSeq:NP_012631.3"
                     /note="similar to Saccharomyces cerevisiae JJJ3 (YJR097W);
                     ancestral locus Anc_1.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141919.1"
                     /db_xref="GeneID:59233827"
                     /translation="MNKTYYEILGLKSDCSIAEIKKAYREKIVSTHPDKSRDLIQNVD
                     GQLTVDDIQEAYKTLGNEQLRLQYDKQILEGHKKRGYHNSGDGLDEYSLDKFFFSAAT
                     MEYSMDCPRCHSKDGFHFSEEALEEHAEEKPCGFQVLSQCSACSLWLKVNFDVAEE"
     gene            complement(<267137..>269269)
                     /locus_tag="HG535_0A01310"
                     /db_xref="GeneID:59233828"
     mRNA            complement(<267137..>269269)
                     /locus_tag="HG535_0A01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286025.1"
                     /db_xref="GeneID:59233828"
     CDS             complement(267137..269269)
                     /locus_tag="HG535_0A01310"
                     /inference="similar to AA sequence:RefSeq:NP_012632.2"
                     /note="similar to Saccharomyces cerevisiae YJR098C;
                     ancestral locus Anc_1.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141920.1"
                     /db_xref="GeneID:59233828"
                     /translation="MYTLSNEVSSDRTVLKSPSIEKNCQDKNNLKKTSTPNDTNTDTL
                     IGGTKVVHTNDGQSSLKKNISIFEDDNEESPLSTLDSEENASNSSYSSKNQKKLESQS
                     EPSRDTSHKIFTFSLPFGGKSLLSSHPITNLVSSILPNDPDPKSNEYPNLNRERIKEK
                     LKRSDSITSLEEMALFNDEKGIDNVRTRAFKKTFEMETLKQTLKNIIASPGECTHDGY
                     EYTRLESIWDEMEGDLLLMGGYRGSILRDAQTGRRLWIPMKAGLNLRKVNLLIGPDDR
                     DEVETQKKIIPDKMLSHIGPVDISRRLMKKLRSNPNITTHDFGYDWRLSLHISAKHLA
                     QKLQSIYDNQEEKKGTTIIAHSMGGLVAHKVLQEHTHLIRALIYVGSPSECSNILGPL
                     KFGDEVFMNKTILSKEANFFMRSSFYFLPTDGTCFVNKKTLEKCEIDFFNPDVWVELG
                     LSPVVDEERKVQAETQEDNQRACHSKKEEELARTESKKKQPEPGIPTDVKDLWGIFNP
                     IPMLKSISSPGNDSSSGTGGTSSTLKSLTPASIITKITTTATDAIGLTESKDCQEEEE
                     EMAFQTSFEDSFKYLRKTLKRAKEYQTSLDRIAHKEYPPLAIVFGNTVPTVRGVKISS
                     WKDIKEGHYDDFYYGPGDGVVHHKWLLPEQRGFQVDAKIASSCGHVSLLSDLESMAKA
                     FISVVDKEKANQQKHQRQAPTTDTTTCK"
     gene            271158..271246
                     /locus_tag="HG535_0Atrna1K"
                     /db_xref="GeneID:59234614"
     tRNA            join(271158..271195,271210..271246)
                     /locus_tag="HG535_0Atrna1K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:59234614"
     gene            <271490..>273760
                     /locus_tag="HG535_0A01320"
                     /db_xref="GeneID:59233829"
     mRNA            <271490..>273760
                     /locus_tag="HG535_0A01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286026.1"
                     /db_xref="GeneID:59233829"
     CDS             271490..273760
                     /locus_tag="HG535_0A01320"
                     /inference="similar to AA sequence:RefSeq:NP_014152.1"
                     /note="similar to Saccharomyces cerevisiae YNL247W;
                     ancestral locus Anc_1.115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141921.1"
                     /db_xref="GeneID:59233829"
                     /translation="MKLLKRYISSVMSSNKIVQPKWYSPERNDNKPVLKLYNSLTRQK
                     DVFLPKSGTKAVSWYSCGPTVYDASHMGHARNYVSIDINRRIMSDYFGYNVKFVQNVT
                     DIDDKIIIGARQNYLFETYVDKTRKEDSLSDVETALEEYLMKNLRSTNGEVRTCEQFN
                     NWIKSVDFEDEKLNSPKFPMYVTAIKKTIDGLKDVEGEKYYQNVRDVLMPYLDKKKGS
                     SINDPEIFRKLPAYWEGRFDDDMRRLNVLPPSLTTRVSEYVPEIVEFVAKIIANGYAY
                     ATEDGSVYFDTLKFDKSDRHYYAKNQPWNKGHLDLISEGEGSLSVSLGGKRSASDFAL
                     WKASKPGEPRWESPWGLGRPGWHIECSVMASDILGESMDIHSGGIDLAFPHHDNELAQ
                     SEACFDCKQWVNYFLHTGHLHIEGQKMSKSLKNFITIEEALNKSSPRQLRLAFASAQW
                     NNQLDFKESLLSEVKNLESSFTNFFNNVRALKRDAQQQYHASKKIGELERQLIMNLEE
                     CEEKVEIAFCDNLSTPQAIKALSELVSVTNSYIFKAGVDIRIEVLVDVTKFVSKILGV
                     IGIPMRSDGLGWENEDSSDVANKEDVIAPFVKCLSGFRDEVRKLAISKADFKKYLELT
                     DNVRDNELLKLNVSLDDRNGQSALVKFITDEEKTKLIEVQKEEVANRKKKESEYLARK
                     LEQEAKEKERIEKVSISPLLMFKDSSLYSEWDIEGIPTKDVDGNQITKSMTKRLKKLW
                     IQQEKLYSSLNKNNSK"
     gene            complement(<273789..>274199)
                     /locus_tag="HG535_0A01330"
                     /db_xref="GeneID:59233830"
     mRNA            complement(<273789..>274199)
                     /locus_tag="HG535_0A01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286027.1"
                     /db_xref="GeneID:59233830"
     CDS             complement(273789..274199)
                     /locus_tag="HG535_0A01330"
                     /inference="similar to AA sequence:RefSeq:NP_014154.1"
                     /note="similar to Saccharomyces cerevisiae CWC25
                     (YNL245C); ancestral locus Anc_1.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141922.1"
                     /db_xref="GeneID:59233830"
                     /translation="MAGGNDLNLLKSWNPKLSKNRAKVKHKEDELLLEEKKIQEQIRE
                     RKLQDLATTKSKSGLEWMYHSIDGKFKNEETTQLKKNRQINESETLIPNTNDPVPHPN
                     PDHNSTRRSNPQKYEKDDPMSKFKVAKKKRITKR"
     gene            complement(<274346..>274672)
                     /locus_tag="HG535_0A01340"
                     /db_xref="GeneID:59233831"
     mRNA            complement(<274346..>274672)
                     /locus_tag="HG535_0A01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286028.1"
                     /db_xref="GeneID:59233831"
     CDS             complement(274346..274672)
                     /locus_tag="HG535_0A01340"
                     /inference="similar to AA sequence:RefSeq:NP_014155.1"
                     /note="similar to Saccharomyces cerevisiae SUI1 (YNL244C);
                     ancestral locus Anc_1.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141923.1"
                     /db_xref="GeneID:59233831"
                     /translation="MSIENLKSFDPFADTGDDEGTTANYIHIRIQQRNGRKTLTTVQG
                     VPGEYDQKRILKVLKKDFACNGNIVKDSEMGEIIQLQGDQRAKVSEFLTTQLGMQKKN
                     IKIHGF"
     gene            <274936..>276114
                     /locus_tag="HG535_0A01350"
                     /db_xref="GeneID:59233832"
     mRNA            <274936..>276114
                     /locus_tag="HG535_0A01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286029.1"
                     /db_xref="GeneID:59233832"
     CDS             274936..276114
                     /locus_tag="HG535_0A01350"
                     /inference="similar to AA sequence:RefSeq:NP_014156.2"
                     /note="similar to Saccharomyces cerevisiae SLA2 (YNL243W);
                     ancestral locus Anc_1.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141924.1"
                     /db_xref="GeneID:59233832"
                     /translation="MVNYELVKSIRKACSAEETAPKRKHVRACIVYTWDHGASYEFFE
                     ALKSMPILNNETQVYKALILVHKVIQEGHPTALKEGLKNRDWIGTVGRSQRVESVGTY
                     GYLIEQYSKFLICKLDFHAYHKGFTSGIFEYKEYVALMNVSDPDAGYEVILDLMGLQD
                     NATNYSVHVLASIGSENRESECKISALVPMIAETYAIQKFTTAMLRGMVEQLGDTGGL
                     EQLIDKHNIQYARVFEFFADCSSIKYLISLINLPKLPSQPPIFVTGTVVDRKPLQSAK
                     PREIPSPDIHLTIHLALQTIKHFQDPVSAVSITQLANEVATQPRIPSIIQLTHQITTL
                     LQRNPSPLLAQASQLYFQALLSPNQQDIINANTNLQNLLINSPAHIFDPPTPQTHTSA
                     "
     misc_feature    275840..276132
                     /note="Z region"
     gene            complement(<276056..>276676)
                     /locus_tag="HG535_0A01352"
                     /db_xref="GeneID:59233833"
     mRNA            complement(<276056..>276676)
                     /locus_tag="HG535_0A01352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286030.1"
                     /db_xref="GeneID:59233833"
     CDS             complement(276056..276676)
                     /locus_tag="HG535_0A01352"
                     /note="MATalpha1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141925.1"
                     /db_xref="GeneID:59233833"
                     /translation="MNTMKSNRNGKNIYSQPAFKVKISKRKKLAASKFKKKCTNSSAE
                     VLRSKNRREPQSDGITNFLAKKSDIKIPSPPKSLLEEIKEEKIKLAGYGIDIGATHWS
                     FPFLWDNDEFLISLTNDLLNNLYKKPVSRAVSTRPLNSFMAFRVYNAQFGYGLRQNIL
                     SSLLASAWHSHPEQQNIWDTFAQQFNFVKPKCGFVEWVDQRYERES"
     gene            <277035..>277802
                     /locus_tag="HG535_0A01355"
                     /db_xref="GeneID:59233834"
     mRNA            join(<277035..277096,277157..277262,277326..>277802)
                     /locus_tag="HG535_0A01355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286031.1"
                     /db_xref="GeneID:59233834"
     CDS             join(277035..277096,277157..277262,277326..277802)
                     /locus_tag="HG535_0A01355"
                     /note="MATalpha2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141926.1"
                     /db_xref="GeneID:59233834"
                     /translation="MNKIPINILLNPVQYDDKKEKLRKINDRLLHICSEFPCDVKKVS
                     IGIFIELHGIFTTLSSFRDDGSFDSDEKCLLKVTAQLSKVIKLLIQEEIRLGSLREEF
                     NASKHIETGIGSNTKEDLKKPVFFDLNTPQTVQHKMSGKHPCRGRRLEKPQINMLEKW
                     FTNNIEKPYLNKKSLQLLTKETGLSNIQIKNWVSNRRRKEKVVTISPPLLDLLA"
     misc_feature    277846..279263
                     /note="X region"
     gene            <279156..>280037
                     /locus_tag="HG535_0A01370"
                     /db_xref="GeneID:59233835"
     mRNA            <279156..>280037
                     /locus_tag="HG535_0A01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286032.1"
                     /db_xref="GeneID:59233835"
     CDS             279156..280037
                     /locus_tag="HG535_0A01370"
                     /inference="similar to AA sequence:RefSeq:NP_013452.1"
                     /note="similar to Saccharomyces cerevisiae DIC1 (YLR348C);
                     ancestral locus Anc_1.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141927.1"
                     /db_xref="GeneID:59233835"
                     /translation="MQPNTPQQSAPIYPWWYGGAGGVFACIITHPLDLAKVRLQTASL
                     PKPSLLLMLKNILQTEGIFGLYSGLSASILRQCTYTTARFGCYDYIKEAWIPKSEINN
                     TFYLLPCSMLSGAVGGLVGNPADIVNIRMQNDTQLDVSRRRNYKHALDGIYKITKNEG
                     IKKLFTGLTPNLVRGVLMTASQVVTYDVFKNSLVTNFNFDPVKKTTHFTASLFAGLVA
                     TTICSPADVIKTRIMNAHQHHESAVKVLIDSVKNEGPAFLFRGWLPSFVRLGPNTILI
                     FLAVEQLREWKLGMPTQ"
     gene            complement(<280098..>282170)
                     /locus_tag="HG535_0A01380"
                     /db_xref="GeneID:59233836"
     mRNA            complement(<280098..>282170)
                     /locus_tag="HG535_0A01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286033.1"
                     /db_xref="GeneID:59233836"
     CDS             complement(280098..282170)
                     /locus_tag="HG535_0A01380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141928.1"
                     /db_xref="GeneID:59233836"
                     /translation="MVGQGKGGGMNKESGKKITQRGGTGSGEHGCVKKALRSCTRCRR
                     NKIKCDSMATRPHACTNCARKGAECHIDYVTPPQRSKEMKYLFENVRYVEKKIGGLED
                     MYVDILGKNGLEMACDDEIRCPTRILKLNGGFVVFCVDIEKDVFSVNNMKMSAMQVEK
                     SFMNFRNMLTFLLEIYFKWENVDQMTFDRAVMYVRELTVENLMERNELLLLLCVLNFY
                     FDIPNINYLDNFNYVIESYCRNASCGAEGDLNVDEDVLSKDLLAKLIVGNVSNGSVQF
                     HSELFIKNFTMYLFVHIVLYGPEFFMDCFMEKYIGTLESVRKKINFDKNWEVKWVNFY
                     IRLFNLIECKVCPETEEIEDILSQIEKEKESYGSLECAISLIKLDQYIVGMKIIETKD
                     RIFKGLLFVFEKLAKDLDFLIGRNDSEVEGERICFIQMFFHQLFSLNEILCVNSCKID
                     LKCPFVFNGFNYENSNLYEIQRKSNYVGKVLVSEKGIFSMMEYLGLGISKHSSNIDEE
                     TSIVNIVEQDLKNYGLGHNSSLNILKSSCRLIWDLYEKVVFWDMFDKVFVHCPFAWNA
                     KVLLRYNGLSCECEDDRSKGRSVIRGKEMKGKDFEHSNVKSRSCKNGVVKYKVENDCS
                     FVEESGSEGGENFTYFKEARNFVNVPGIPEKIEDQLRGGINQILKDVDWVKESADDVL
                     RKIHGVIN"
     gene            <283029..>283844
                     /locus_tag="HG535_0A01390"
                     /db_xref="GeneID:59233837"
     mRNA            <283029..>283844
                     /locus_tag="HG535_0A01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286034.1"
                     /db_xref="GeneID:59233837"
     CDS             283029..283844
                     /locus_tag="HG535_0A01390"
                     /inference="similar to AA sequence:RefSeq:NP_012325.1"
                     /note="similar to Saccharomyces cerevisiae PEX2 (YJL210W);
                     ancestral locus Anc_1.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141929.1"
                     /db_xref="GeneID:59233837"
                     /translation="MLRVAQLDSAALDDEVRSIFWRDFQTNLPITRNKEEYQLLLESL
                     VFLFSSKLLAGSFTNTYGSRLSGVSYTCKRRTLYLITTLSGYLESKLSHFVFSSSNRI
                     VTNNSDKLRKAFSYLTTVYSFFDVFLFAKFLSNLSSTYLSPLHRLLGVSFSGSDSSAS
                     TFHDNTVYSQIEFQNRQLLWNAILELFNVTLLSNAKWFHRHYSSSSSTDQKHSVASSD
                     DAHCPYCNQFPTNPYVISCCNSTFCYLCVVKVLEWSHCPRCDATANIKASPLY"
     gene            <284084..>286018
                     /locus_tag="HG535_0A01400"
                     /db_xref="GeneID:59233838"
     mRNA            <284084..>286018
                     /locus_tag="HG535_0A01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286035.1"
                     /db_xref="GeneID:59233838"
     CDS             284084..286018
                     /locus_tag="HG535_0A01400"
                     /inference="similar to AA sequence:RefSeq:NP_012326.1"
                     /note="similar to Saccharomyces cerevisiae CBP1 (YJL209W);
                     ancestral locus Anc_1.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141930.1"
                     /db_xref="GeneID:59233838"
                     /translation="MSLRYHSITKSFLFTSSIRTYSNLPTGYTKPHALLLKLITEDLP
                     LTSESKKYFREYWRKIIPENQILPENTLLNTIPIKTFATFIQNYKKKSSTVRAAYRKE
                     LLLNYIKNPENVRSLLTNLGFTFKENFTSDEILSISIMDSLRTGDVNIAADLYLLYYK
                     LFPNAPLNKKLCSYVISALAFENPKFDHIHLLKFLLLYKLFKSYNTHLLLSEIQIVTL
                     CNKALSLENSPILIKEVLSKLMDIELISTDPLRKSKLISAYHLIETDYKINNAAGVLL
                     TWANIKNEYNSITKHDPRILHIIMKIFTHNKAYRKNFKELFDHLTPEYYCNNPLILPS
                     IIDFATKTNDLIMAKKVMNNANKYVFQKNSQVVLFSKRCLSSLLRMHLKFKDSQGVDR
                     VLKQILEIFGKHSEENLFAIISHLLSIKTLENFNKAIKLVNSIPQERALLSYGAIINK
                     MVEWQIASNGKFDQKSMPLMNELLSKAHTLDPYHKNSLWTIVASLFIKKIVHRKNLQK
                     KVNPKEPSKMIFNTTCLDLARLIYKRSNSTTLSASKTDHNPFTNSSPQRILLKLTNNN
                     KVVILRNIASSAIKGKRKDIFLWCCSELYENGIPITELVLGWNMMLKHRFRFTQFPNK
                     SMIEEDLSINGLPIISKALK"
     gene            complement(<286119..>287114)
                     /locus_tag="HG535_0A01410"
                     /db_xref="GeneID:59233839"
     mRNA            complement(<286119..>287114)
                     /locus_tag="HG535_0A01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286036.1"
                     /db_xref="GeneID:59233839"
     CDS             complement(286119..287114)
                     /locus_tag="HG535_0A01410"
                     /inference="similar to AA sequence:RefSeq:NP_012327.1"
                     /note="similar to Saccharomyces cerevisiae NUC1 (YJL208C);
                     ancestral locus Anc_1.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141931.1"
                     /db_xref="GeneID:59233839"
                     /translation="MSLRNVAFGLSGIGIGTGFASFFFGKSSPSSSQVQTPSSSQTVG
                     FPKGPNGTINAVGSDINPSEFFRYGFPGPVADVESREEFISCYNRQTRNPHWVVEHIT
                     KESLAAKNGDRKNSYFIEDEKIPEIFRGRLRDYFRSGYDRGHQAPAANAKFSQNAMNE
                     TFYLTNMCPQVGEGFNRDYWAHLEYFCRQLTESYNSVRIVTGPLYLPKVDPVDGKTKV
                     CYEVIGTPPNIAVPTHFFKLIVGEKPVKNPSSESISIAAFVLPNKPISNETKLTDFEI
                     PVDALERSAGLQFFQKVPENRKKPLCKEVRCQITVREFQKALPPPKSLPSLPAPK"
     gene            complement(<287288..>293311)
                     /locus_tag="HG535_0A01420"
                     /db_xref="GeneID:59233840"
     mRNA            complement(<287288..>293311)
                     /locus_tag="HG535_0A01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286037.1"
                     /db_xref="GeneID:59233840"
     CDS             complement(287288..293311)
                     /locus_tag="HG535_0A01420"
                     /inference="similar to AA sequence:RefSeq:NP_012328.1"
                     /note="similar to Saccharomyces cerevisiae LAA1 (YJL207C);
                     ancestral locus Anc_1.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141932.1"
                     /db_xref="GeneID:59233840"
                     /translation="MSLIEIVNSSTTKRHDLLNWVTLKIQIAVQFESTDDGSAQMKIA
                     ADIADQICLFIRYLSDLEDLSVIESHFIWMRLSQLHLICLKHLEKEQSEKIFDSAELM
                     IKVLSEDDVSIDNENKENGEDRKKRKKPSKKKMYRYSAAKEVACIVLIQLFEVFGNQF
                     SSLVPLLFGTIFKNLKKVLEKSKYMHATFMTSLIQLVNVMVRNGNQAEFFTNYFSKFS
                     KISKNMFEGFYSDKLDFPVNFVSAVMELWSMHFREESFIKSHVTDLSAAIYMRYSEGE
                     LGSYGFTNDRTRPSTAKSLAEILFDYYYVKKIISLKEIWTLYARIFKNCASRDIQVGT
                     FESIIHFYGLCSTTDCTFLDGSSYLVAFRTLALEVFDTDEIKNEGMHILYRILRYFDL
                     MHDILLPRIGDSSRTQMLFNIMGSENEEKTSECAGNVLFVNSKPDSQWFNIAQLGLAK
                     RLLLELSSSFGNEQHHISQIKRKLTELSTCDVFCIRIHANEALKVFLTNFPELISETI
                     ESSLDSLQQSFKQLEKYPFAVNHGHALIIASMIEKSDKDYVSYELVMRITIFATSFIK
                     NHTTSTSSILYYKGLICWILLIGLVNYNDEQYLAMQSSQLFLFWKVLLTHTFGYREED
                     ELYRNLEIRNHALTCLLTYLGNSKMDKEVAKQISYLLIKCSNFNHSINLKSTNIDKAL
                     LINEHRILQIYLRLHEFIKRDFNSSLLILIVKNFSDPNLYIEASQSMLDNIIGVTEKN
                     TSLKEASREESFLENTVETVLHLNDGFAFGISSKIALSEIQELSIKIPQRCDRETSGA
                     LPSKKDSWYHPLEREITKPITPILSLDYLIMLYGRGHYTAKDEYSPKITTSLVDSSME
                     IFSLTFPYINGKIQYSVIESLNVSLFSKLTTPLRNVAVAANVCVAINSALNIIVEKEL
                     GIDVSVGQLLIDSLKKIEYYKDSYLTRIKADCVGLICMAVSCGEAGSERMEFVSTQIR
                     ILVKNVVDIEEPYKRVLYALSLVSIYRYNAQNSSFSAIYEVIFALIQDPHPVVHVWSL
                     KAMHILLERHFSIDTSTAARLLGTVESVTSDPSYGIYCSSILQHNYNNQFNSHIVVGQ
                     ITETLTEILGPNIIELDESSLCSYRNLVIAGLTSNDLTAQNISLSIFEMLATFKLKGI
                     VADEVFMACAKSMIDDAIVTVFGSSYVNCRFTGSTEIFSNDSSLSSSVHCFGLFTELI
                     RLQRESLITRDIDIASWRYLDLYPTSEAVIGFLFTWIEQSCELNERWFDKLYLFFNMG
                     ERKLFSSLYKEFSSILQRKGIRKTAEKEIRGEEEKAIADSDTNISSVHVDFSSDSIHW
                     GAKKAVLAFIKLLCIKSQKKRSLFNLLSKRLPELIKISFQASVSKVVSMQLLGLEILS
                     LLLKQWAKVSDPENPNNSILGIEEAQITSALMPAFDAESAPDVVVSAINVCAEFLSSN
                     IAPLERANRVSHIMVNFLEVYNNKSSSIKIGDTHILTQKAKRKIELAVLDGWSKLVQN
                     ALVQQNEKLIEFTRRYWEILVPLWIISLREYVMVKYEKIEIEMGLHEDCKSSLYESRS
                     TKIELYDGIWLNFAIALGSILENDSFLISSCLNEEEADSFMFVLLTQCFEDIAKHLDD
                     HEIKMKVLPAMHNILKCHISFDNIFEDDANAEIVGILDRLIVMGDNEEKYELVNIIND
                     LIGGYTKKYNTHETFLPGIDKLYELLRLLLIPISDLIPSIKYNFEDPEDMPMVKLDDT
                     DLRLLRHTFTVLENNVSKFDEMFKEDLYACMLYIMGRIYEDKNRDIVVPLVLPFLKSI
                     TADLKTMKHCMNMMKVFYEAVKAPLFDKINGENELTTLLILLTNGFVDFSSQDLERIV
                     NVCVVGIFTLKTNAIATEGLRNVVMNINKNPICGFLFKKVLKNVEGRINADTTIEICR
                     SIMSVVMTFAKKVKAENPDKSKQAFALCLNLSLLCCDISSSDADQLVVDSAIELISID
                     SNVFKEVLQNFVPESRKTKIGHIMENSSQISTFNGKGYEEEHLTLKSFK"
     gene            complement(293632..293702)
                     /locus_tag="HG535_0Atrna1G"
                     /db_xref="GeneID:59234613"
     tRNA            complement(293632..293702)
                     /locus_tag="HG535_0Atrna1G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59234613"
     gene            complement(<294668..>296587)
                     /locus_tag="HG535_0A01430"
                     /db_xref="GeneID:59233841"
     mRNA            complement(<294668..>296587)
                     /locus_tag="HG535_0A01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286038.1"
                     /db_xref="GeneID:59233841"
     CDS             complement(294668..296587)
                     /locus_tag="HG535_0A01430"
                     /inference="similar to AA sequence:RefSeq:NP_012329.1"
                     /note="similar to Saccharomyces cerevisiae YJL206C;
                     ancestral locus Anc_1.128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141933.1"
                     /db_xref="GeneID:59233841"
                     /translation="MARARFNRPKLIVLSVDSSTKRLRAQNGRVSKACDLCRMKKKKC
                     DGLQPCSQCKPHKVACTYSGKCNRGSAASLSSGARETGRTRSPMIKNLVDERSGPLSP
                     ALVKRFTRGGSTDEDNSVTIALPEKEVALKLIQKTWDNVCVLFRFLYRPSIFATVDEL
                     YDSWDLLQLSTVQEKELSLIYSVMAVGALFTRRDLDKTDVAKRDFYEDEGYNYFVTAQ
                     SLINITSINDIYSIQTMFMLTMFLQCSGNLKKCYSYIGIALRAVITEGLHRKNSLVGP
                     TPIEDETKKRLFWSVYKVDVYMSCVLGLPRSISDSAINQAFPNDVDDERITEEGIMIQ
                     EFGKISSCGMNNEHTKLMLIMARIHESLYPVLKWDEKTYMKIINFQEQLDQWLLKLPV
                     QLHPSYGFYDEKTKDYYYKPNRLLYLDYLLTKIILHKPFIHYISIDAGKSSIYEFQHS
                     MAKNCIRVAHEVIDLSNQMIENNLLSGSYWFSIHTIFFSVTCLMFYQHQINLGLIAKK
                     DSIVEKNCDLGIRNLLKLKDSTSAGQRSFIALNSIFKEFNKKTTDAYLRVMANLNAQN
                     AHDQEREMISIRQIQPPIKEHVPVSSSTSDPPGITDELLDQLLMDFDIPISNILPDFE
                     LTSFFPKPNDDYSLS"
     gene            complement(<297122..>297289)
                     /locus_tag="HG535_0A01440"
                     /db_xref="GeneID:59233842"
     mRNA            complement(<297122..>297289)
                     /locus_tag="HG535_0A01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286039.1"
                     /db_xref="GeneID:59233842"
     CDS             complement(297122..297289)
                     /locus_tag="HG535_0A01440"
                     /inference="similar to AA sequence:RefSeq:NP_012330.1"
                     /note="similar to Saccharomyces cerevisiae NCE101
                     (YJL205C); ancestral locus Anc_1.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141934.1"
                     /db_xref="GeneID:59233842"
                     /translation="MVQQAPYLLGKYWDPVFAIVVGTLSYYSYERKVGRPEGHRLNDL
                     IRKRLAGKEAQ"
     gene            <297460..>297876
                     /locus_tag="HG535_0A01450"
                     /db_xref="GeneID:59233843"
     mRNA            <297460..>297876
                     /locus_tag="HG535_0A01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286040.1"
                     /db_xref="GeneID:59233843"
     CDS             297460..297876
                     /locus_tag="HG535_0A01450"
                     /inference="similar to AA sequence:RefSeq:NP_013255.1"
                     /note="similar to Saccharomyces cerevisiae RNH203
                     (YLR154C); ancestral locus Anc_1.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141935.1"
                     /db_xref="GeneID:59233843"
                     /translation="MTEYTAHFIPCKVRYNGATEEFVDNFHCDNEDDLTLKRKEDDSL
                     NGEKLCVRHIRGRKIVGKKFLGSDGYQTFLVKTGTREGEDGETGQISLDTTSKIEPIA
                     KISSMINYERDGNEERLLEELEKFQQFLDVSDVIHS"
     gene            <298136..>299122
                     /locus_tag="HG535_0A01460"
                     /db_xref="GeneID:59233844"
     mRNA            <298136..>299122
                     /locus_tag="HG535_0A01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286041.1"
                     /db_xref="GeneID:59233844"
     CDS             298136..299122
                     /locus_tag="HG535_0A01460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141936.1"
                     /db_xref="GeneID:59233844"
                     /translation="MKRSTFDRHAYSQSPASTRKIQKFYVSLVLFELLPHELILHILR
                     YISRTDLIILASTSKRIRSVLQPYLFANTKVSWRDLMNNWELCKMPVIARDPYVIERL
                     RLVDSCSKNEWTFPFAELFSSSRLPNLKSLTLETAGSSSFFKYSAVGSRLEKLSIHTV
                     RPGSIFNLEHVSPFAALKHLTLTNFEIETFEENDSWCPNLSTLSLENCTWCYPFQLEN
                     FGREKITSLFLKYSNAFIISERFKMFLNNPNFTKLHHISITNNETNLKLTLSVHIMNL
                     IESIPTLKTVELIGNIYNETIHNFTTYDLDNCTNYLALNNVKIFYSSFLQGS"
     gene            complement(<299298..>301643)
                     /locus_tag="HG535_0A01470"
                     /db_xref="GeneID:59233845"
     mRNA            complement(<299298..>301643)
                     /locus_tag="HG535_0A01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286042.1"
                     /db_xref="GeneID:59233845"
     CDS             complement(299298..301643)
                     /locus_tag="HG535_0A01470"
                     /inference="similar to AA sequence:RefSeq:NP_012331.1"
                     /note="similar to Saccharomyces cerevisiae RCY1 (YJL204C);
                     ancestral locus Anc_1.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141937.1"
                     /db_xref="GeneID:59233845"
                     /translation="MEDLLRVRNIVINIASNLNTRDYVNFRQVNKKVHDIHLSDDTDN
                     EIWSQKLLLMGIKKEQTQIAENQEVIHELEFDNEKELDCVTIFKDIKSFREKDAKRIY
                     IKFYRCFQPYCNKLKSNSLAHFFPQKYDDDPLIQVKIFSYISRYNKGNKNEFDEYQKI
                     DQNLNMLKEIFINSVLQEMDANFAKENYSQVGKFIQVLLLSHEERNAVEFFRSKADPT
                     FEMNLPGSVFYDDETLNEKSLDEALEKVKDFLNSKIELVDTLFADTYPVILEFTESFI
                     QENFLDYMNEQFGKEESRLQYMPEMYSKTMANVCGKLKASKNGGEFFGKVVKEFFDMY
                     LEPKIVTYLEFQPRIFQKSISNKLDQYKDEAEAREKEQNEQIYNSLRDQSVEKNNITD
                     DKNDFLSSFTKIFKLTNSERQKNAEQLQLAYNLNLLNNNLQNIKSLVSLDLCYNIVQQ
                     AQTLTDQMYTFHQIEKIVGTMRSRCQEIFKILINELGWNHIKPGFEKATVLLQKYDSN
                     EIQRVELKLEGVETQVEPLVQFTELINIGDIILQMISIFYRNELIQKCIIDKNRDFLN
                     DVVQAKKNFETMLDDFVAEGLNIGINKLMDEVDFVFNTIQLPDDYNPNTKQGEASSKE
                     IKPTQCALKNIELLNNHAFLLTGATDKGTIDVYKQEIGERFFNELVKHIKKSLISPDG
                     AIFLICDLNLYYDFIATKLKQKRIVPLFAALKNVAQLYIISGKDSKELGKMISDVGRF
                     QGIFSQEEVYEFVERRSDWVRVKRDVEKVMYGLGVKDCTIM"
     gene            <301851..>302981
                     /locus_tag="HG535_0A01480"
                     /db_xref="GeneID:59233846"
     mRNA            <301851..>302981
                     /locus_tag="HG535_0A01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286043.1"
                     /db_xref="GeneID:59233846"
     CDS             301851..302981
                     /locus_tag="HG535_0A01480"
                     /inference="similar to AA sequence:RefSeq:NP_012332.1"
                     /note="similar to Saccharomyces cerevisiae PRP21
                     (YJL203W); ancestral locus Anc_1.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141938.1"
                     /db_xref="GeneID:59233846"
                     /translation="MSYPDGLKVPLGQGSEQIREDIIQTVSYVKKNGPILEEVKRNDP
                     KYSFVNPDNEYHEFYQYLLREQNTARSTNVAKGDLEPLENMKPKVPQEPYAFSFMSYD
                     KNVARRDLEAIKLAAGFCIANEKADYLEKMKNRFKDDPKFGFLCPGHALNSTFVQFLN
                     QYKQVKANILAPPMFQLKKKEDFKNIILKRSFQRGEYREYEKEVRAAKDETLKLHKIQ
                     FAAIDWSNFKVLTNVTLPTSQEPELMLPKPLNFSKLSIKRIDQGNELELFETSEKDVS
                     NKDIEPSGRKRKIRAAGETRLKRRNTASPNANNSHKHLIKCPLTQKMIPEENFDKHLR
                     VLLGDPHYKLEREKYEAKHKLTNLTSNEVYENIKKIAKKSTN"
     gene            <304062..>305261
                     /locus_tag="HG535_0A01490"
                     /db_xref="GeneID:59233847"
     mRNA            <304062..>305261
                     /locus_tag="HG535_0A01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286044.1"
                     /db_xref="GeneID:59233847"
     CDS             304062..305261
                     /locus_tag="HG535_0A01490"
                     /inference="similar to AA sequence:RefSeq:NP_015431.1"
                     /note="similar to Saccharomyces cerevisiae ISR1 (YPR106W);
                     ancestral locus Anc_3.421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141939.1"
                     /db_xref="GeneID:59233847"
                     /translation="MTMIRTPPPSPNLPTGFGARSDSNGRAAQKAEAEVETVSSSLRI
                     NTPSRSAIRTESCPISPVSESKSEGYAGVSSLDCLLADMKLYPYLCKTIGQNLLAKAS
                     LDFLANPNLKLSSFPIGHGSYSCVFKILNRERSVLKFAVSKKRSNIILKEAGFLSQLN
                     EINQLNHNNRYNIVPFYGITYIYKSHYKRLRSNEFVPGIVLEEYEMNLQQFCQNKNET
                     IFTNWWKLCFQMLDCLSFLKAERIIHGDIKTANILVDSKLNFFLADFTSAKRLNDGNF
                     IIGSSLESTMEYCAPEMIEFSKQSFDTDLYALGLCLLALITKCEPFHELQQSKNHGIG
                     SIQQSQWLITAILKNDPIHFNILNNDHLYQLWHKELEFLKIILISRQPVENCIPLRPH
                     LSFANDS"
     gene            complement(<305286..>305999)
                     /locus_tag="HG535_0A01500"
                     /db_xref="GeneID:59233848"
     mRNA            complement(<305286..>305999)
                     /locus_tag="HG535_0A01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286045.1"
                     /db_xref="GeneID:59233848"
     CDS             complement(305286..305999)
                     /locus_tag="HG535_0A01500"
                     /inference="similar to AA sequence:RefSeq:NP_015432.1"
                     /note="similar to Saccharomyces cerevisiae YTH1 (YPR107C);
                     ancestral locus Anc_3.422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141940.1"
                     /db_xref="GeneID:59233848"
                     /translation="MITLYLALKITKFLTESRFKQVLDMSVKMSVVHPDTSEYPFKFE
                     PFLRQEYSFSLDPDRPICEYYNPREGPSSCPRGVSCPKKHVLPIFHNKIVCKHWLRGL
                     CKKNDQCEYLHEYNLRKMPECVFYSKNGYCTQTPECQYLHIDPQSKIALCEDYEMGFC
                     PLGPLCKKRHIKKVLCPRYSTGFCPLGKLCDMAHPKFKMPSSISRLRIKKDEEINTRK
                     SDLEKERRLNAIINGEIDL"
     gene            <306162..>307436
                     /locus_tag="HG535_0A01510"
                     /db_xref="GeneID:59233849"
     mRNA            <306162..>307436
                     /locus_tag="HG535_0A01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286046.1"
                     /db_xref="GeneID:59233849"
     CDS             306162..307436
                     /locus_tag="HG535_0A01510"
                     /inference="similar to AA sequence:RefSeq:NP_015433.1"
                     /note="similar to Saccharomyces cerevisiae RPN7 (YPR108W);
                     ancestral locus Anc_3.423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141941.1"
                     /db_xref="GeneID:59233849"
                     /translation="MSETDTKSASRVDKDDSGADETRYVDPSVNKVPNYEISEKAFIL
                     TQPNSPNNNVELRDSVLNIIKEEEMAPYYKYLCEQYLPRGTLDFDANLYKELLQKNEL
                     RIQELQKKLAKVEENDEGELEQAQCWINLGEYYAQIGDRENAQKTLEKAMSRAISTGA
                     KIDIMLTITRLGFFFNDQSYVKEKLEQINVMIEKGGDWERRNRFKTYKGVHCLAVRNF
                     KEAAKLLVDSLATFTSIELTSYESIATYASVAGLFTFERTELKSKIIDSPELLSLLTT
                     TSALQSISSLTISLYTSDYSSFFPYLLESYDNVLLPCKYLNEHSDYFVRGMRRKVYAQ
                     LLDSYKTLSLRSMAGAFGVSVEFLDNDLCKFIPNKQLNCVIDRVNGIVETNRPDNKNA
                     QYHLLVKQGDGLLTKIQKYGAAVRLTGSDRLA"
     gene            <307985..>309697
                     /locus_tag="HG535_0A01520"
                     /db_xref="GeneID:59233850"
     mRNA            <307985..>309697
                     /locus_tag="HG535_0A01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286047.1"
                     /db_xref="GeneID:59233850"
     CDS             307985..309697
                     /locus_tag="HG535_0A01520"
                     /inference="similar to AA sequence:RefSeq:NP_011602.2"
                     /note="similar to Saccharomyces cerevisiae CTT1 (YGR088W);
                     ancestral locus Anc_3.424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141942.1"
                     /db_xref="GeneID:59233850"
                     /translation="MFTSKEIPPKVYTLENGFAYDHHPYGNQVARPDGPLLLQDVHLV
                     ESMAHFDRERIPERVVHAKGGGCRIEFELTDSLKDITYAAPYQTPGYKCPGVVRFSTV
                     GRESGSPDTVRDPRGVSFKLYTDWGNHDYVFNNTPVFFIRDGNQFAHFIHTQKRDPQT
                     HLGQDDDSSAFWDYLTLNPESIHQITYMFGPRGTPASWADMSSYSGHTFKFVNDKNEL
                     TYVQIHILPENGWEYLSTEEAGNLAGSNPDYNQAKLFKQLENGERPKLTCYVQTMTPK
                     QAEEFRYSVNDLTKIWPHKEYPLRKFGTITLVENVENYFEEIEQVAFSPSNTCIPGIQ
                     PSNDSVLQLRLFSYPDTQRYRLGANYQHLPVNRPRNAGCPFISAFSNGVSEKEVIPGA
                     TKCPHQISNFQRDGPGCQYNKGKEPNYISSLPKAEMKFKNFGDPNMQAFGKEFSGVVL
                     DKDVKQYLKQQEIDRKDHEKIVDAKLNEYYYKSGISELDFEQPRLLYEKVFDDKTKKD
                     FIDNIVGHASKVAVPHIKTRVCQYFGLLNKNLGKSIAEGLGITWEPVSMDQYAQEAGI
                     AKPY"
     gene            <310018..>311067
                     /locus_tag="HG535_0A01530"
                     /db_xref="GeneID:59233851"
     mRNA            <310018..>311067
                     /locus_tag="HG535_0A01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286048.1"
                     /db_xref="GeneID:59233851"
     CDS             310018..311067
                     /locus_tag="HG535_0A01530"
                     /inference="similar to AA sequence:RefSeq:NP_009963.1"
                     /note="similar to Saccharomyces cerevisiae FEN1 (YCR034W)
                     and ELO1 (YJL196C); ancestral locus Anc_1.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141943.1"
                     /db_xref="GeneID:59233851"
                     /translation="MMKNMLLQYATPLLEKYPVLQDYVPNVDRPFFNIYLWDYFNCFI
                     TKATQAKFVPNEFKFVPGKLPLSKLHEVLPTIAAYYLIIFGGRAVLRNIKPFKLNFLF
                     QLHNLLLTTVSFTLLILMVEQLIPMISHNGLYFSICNIGAWTQPMATLYYMNYIVKYI
                     EFIDTVFLVLKHKKLTFLHTYHHGATALLCYTQLVGTTSISWVPISLNLGVHVVMYFY
                     YFLAARNIRVWWKEWVTRFQILQFILDIGFIYFAVYQKAVHLYFPSLPHCGDCVGSTA
                     ATLSGCAIISSYLFLFVAFYIEVYRNKGTKKSRVVKRARGGVAAKVNEYVNVDLKNTT
                     TPSPSPEPTLRNRRD"
     gene            complement(<311264..>312427)
                     /locus_tag="HG535_0A01540"
                     /db_xref="GeneID:59233852"
     mRNA            complement(<311264..>312427)
                     /locus_tag="HG535_0A01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286049.1"
                     /db_xref="GeneID:59233852"
     CDS             complement(311264..312427)
                     /locus_tag="HG535_0A01540"
                     /inference="similar to AA sequence:RefSeq:NP_009964.2"
                     /note="similar to Saccharomyces cerevisiae RRP43
                     (YCR035C); ancestral locus Anc_1.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141944.1"
                     /db_xref="GeneID:59233852"
                     /translation="MTETAVETVDVHPITFPPPVFARISPELSLQRHLSLGIRPSLRS
                     FEEFREVNINEGTLSRFGPNGVAVEETGNNVLGSNVLKCGNTFVVTSITGGIVEINIP
                     VDEEDIGEKELMEISEKRDYVNKCASVFPQIEVERGRTGAPTDEEMTISQKLYDNVLH
                     SGLISKSALDVDCGIRITDSTGKTKIVYFDETKDGDMSQFRPKRKWAYVLYAKIVVFS
                     RTGPVFDMCWNSLVYALKDTKLPRVFIDERATDLKMTVRTRGRSAVVRESYDILFDSK
                     KAVPLKINEFQIGFASNYGIIDLDPEAQVVRNDEGHDVDEEMDKPRAILLADIDSEAE
                     ETSINSTISVIGDSSGKLTNVTIVGGGSKITLEMIKRALALSKARYDDLKTKS"
     gene            <312704..>313762
                     /locus_tag="HG535_0A01550"
                     /db_xref="GeneID:59233853"
     mRNA            <312704..>313762
                     /locus_tag="HG535_0A01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286050.1"
                     /db_xref="GeneID:59233853"
     CDS             312704..313762
                     /locus_tag="HG535_0A01550"
                     /inference="similar to AA sequence:RefSeq:NP_009965.2"
                     /note="similar to Saccharomyces cerevisiae RBK1 (YCR036W);
                     ancestral locus Anc_1.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141945.1"
                     /db_xref="GeneID:59233853"
                     /translation="MGITVFGSLNYDLVTYTDRMPLAGETIRANSFETHAGGKGLNQT
                     IALARLKNTVDDYVVRMIGCVGQDSFGEQLLDLLKESKVDVSAVRQIENESTGTATIL
                     VEEQTGGQNRILLTEGANGRSTYTPAELDVIFNSSKKEDSRGKSDYVVLQHEIPDPGS
                     IILWVKENCPAHEIVFNPSPFHLLGAHIWASVDILVVNELEALQILESLYTREDYERF
                     HGEIEIDFVQGYTKICQEFQKNLVYQSNSATVMITLGVRGAVFSSNAEKTVKYFPASR
                     GIKVVDTTGAGDTFLGALITQLYRGNSLWEAVKISTIASSLAIQKKGAAESIPSYAEL
                     CNYLKQAPCLSIGKLNTA"
     gene            complement(<313890..>317534)
                     /locus_tag="HG535_0A01560"
                     /db_xref="GeneID:59233854"
     mRNA            complement(<313890..>317534)
                     /locus_tag="HG535_0A01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286051.1"
                     /db_xref="GeneID:59233854"
     CDS             complement(313890..317534)
                     /locus_tag="HG535_0A01560"
                     /inference="similar to AA sequence:RefSeq:NP_012338.1"
                     /note="similar to Saccharomyces cerevisiae UBP12
                     (YJL197W); ancestral locus Anc_1.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141946.1"
                     /db_xref="GeneID:59233854"
                     /translation="MQSLEHLTVDSADISVELNDVVGKVEQNTLDSEVHKLQQDDDKK
                     SDYNVDILTLQHQRTLITQLNNSNNERACEGDKVYIIPESWYKDFFDPELTNAESLGP
                     INTSLICRDYNNFILVDYDLQPYLSLPECVFEKLIEWYGLSPGSQPVITSLVYDDENG
                     SLITEYNRCVLKLHYLSVNESNRRYNVNNRPIFISTSMLSNMEQVVNKLLEGFFAKES
                     ALHPDNTRFKLWYVKDFEQNGHKSILQSSYRLNPLKFMELPLRTRISSKLKGHTLKEL
                     KIFAGDFVIEVRQSGQNYHWASNYYMYNNINVSEGITGLTNLGNTCYMNSALQCLVHI
                     PQLRDFFLYSGYEKEINTQNPLGHNGHIAKAFSLLVQNLFGSNMDNNTTAVYSPNNFK
                     TTIGHLNSMFFGYMQQDSQEFIAFLLDGIHEDLNRIVNKPYVEKPSLSFDHNVHDFAA
                     LKKLANDTWTGHLMRNDSVITDLFVGLYESVLHCPECNNVSITFDPYNDLTLPLPVDS
                     VWHATVTIFPESSPPCSLEVQLDISATYQDLKHYIGVHAEMDPKNLYGCEIFNHQFFT
                     NYELPDSNSHFLPLRELISESDNVVFYELHASQNDIIVPVLNTIIEEGFKTPRNFGVP
                     FFIVLTPEEIENPSAIRFKLEKAYTNLSGGFVEFPISSLERETLLESLSLLQRTFENN
                     NLEKLRKNISFSFLEDIDLNEFFRIQLLEVSDPRKETYPSSNEETEASNPSLRTPPTR
                     LNLNHLKDITDCLSPIIDAIYDYPSFVKKFEETAEEKDEYSNGNEKNESKEKQTIDGQ
                     TEGIAKLENNLNLQDDFNAEKSRSVEVSDVLTSPIVNQNTVLICEWQKKNLEDVFSDS
                     QPINWENPGKIVNQNLDGQQNSSKKQTKNMITLDQCLKLFSKREVLGLNDLWYCPKCK
                     KHRQATKQIQLWNAPDVLLIHLKRFENQRSFSDKIDDVVQFPITDLDMSEYLVNKEDP
                     RGSIYDLIAVDNHYGGLGGGHYTAYAKNDADEKWYYFDDSRVSETVPERSVAGSAYLL
                     FYLRRSTDNESLGSVRLQEIIAHSRKEYNLKIAEMKERQREIYFSNKTDSEDDGDDVD
                     ANVNKDNEDNEDNEDNEDSDVDVETSDVDGKRFGLIQNADEINPKSSTDSGSSNENLG
                     STRSTAYSIESLEVGHINQPEYCDGHENNMGRRKLRLINKKYNESPTGTSPTSLGSSD
                     DGDSMNIDFM"
     gene            complement(<317901..>320612)
                     /locus_tag="HG535_0A01570"
                     /db_xref="GeneID:59233855"
     mRNA            complement(<317901..>320612)
                     /locus_tag="HG535_0A01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286052.1"
                     /db_xref="GeneID:59233855"
     CDS             complement(317901..320612)
                     /locus_tag="HG535_0A01570"
                     /inference="similar to AA sequence:RefSeq:NP_009966.2"
                     /note="similar to Saccharomyces cerevisiae PHO87 (YCR037C)
                     and PHO90 (YJL198W); ancestral locus Anc_1.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141947.1"
                     /db_xref="GeneID:59233855"
                     /translation="MRFSHFLKYNAVPEWQSHYMDYSALKNLIYTLQTDELTFNGETE
                     ENTNIQPTLESSTAGASSPKHLAKRLKNKLFSKNESGRDANQKGGEDEGFQEETIELE
                     ELASPKIASNSNGKNFSLKKVKGKFFESRRSSLSSEGKTLFSSYDAFVTSLNEEKLKV
                     DDFYKRMESKFFEKFETLVKDLEKEGICHASSEPLNSTSIINRRPSEPQSVDGGNDHV
                     SNAPSFGPRSDYYSEEDLEDEEEEDFETHDNTALLNYSQFNIKSQKISLLKQSIANLY
                     IDLCQLKSFIELNRIGFSKITKKFDKVLHMNTREELILSGVFFRDTYVFEDETLSRLN
                     DKLTQLNEFYALIKGQPSNIEGCKQELKSFLHDHIVWERSNTWKDMLGLLSHNINGDL
                     GNETSDNNADKLRLELYSYHLPKPIRIKNFSITKLSIPKLFFTWKAFKIAFIITLTGV
                     LLGIKTFNDEAQHRCMALVECVAFLWASEAIPLHTTAFLVPLLVVLFRVLKDSDGNVI
                     GAAAASRVVLSQMWSSTIMILLAGFTLGEALAQYDIAKVLASWLLAAAGTKPRNVLLM
                     SMSVVFFLSMWISNVAAPVLTYSLLSPLLLPLEASSQFGKALVMGVAFSADIGGMASP
                     ISSPQNVISMQYLKPYGVGWGQFFAIALPSGILAMLMAWGVMCVSFKFHKTKVEKFVP
                     IRTSFTLKQYFVIFVTLGTILLWCVENEIEGAFGSSGIIAALPIVLFFGTGLLSTKDL
                     NSFPWSIVILAMGGIALGNAVSTSGLLNTIARALQRRIQSDGLFAILCIFGILMLVVG
                     TFVSHTVSAIIIIPLVQEVGDRLDSPKAAPVLIFGCALLASCGMGLASSGFPNVTAIS
                     MTDKKGERYLSVGSFIVRGVPTSFLAFLCIITLGYGIMISVLKGPSA"
     gene            321938..322010
                     /locus_tag="HG535_0Atrna1T"
                     /db_xref="GeneID:59234619"
     tRNA            321938..322010
                     /locus_tag="HG535_0Atrna1T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:59234619"
     gene            <322318..>324687
                     /locus_tag="HG535_0A01580"
                     /db_xref="GeneID:59233856"
     mRNA            <322318..>324687
                     /locus_tag="HG535_0A01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286053.1"
                     /db_xref="GeneID:59233856"
     CDS             322318..324687
                     /locus_tag="HG535_0A01580"
                     /inference="similar to AA sequence:RefSeq:NP_012335.1"
                     /note="similar to Saccharomyces cerevisiae ACO2 (YJL200C);
                     ancestral locus Anc_1.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141948.1"
                     /db_xref="GeneID:59233856"
                     /translation="MISASRRVNIKRALATHARFPSVPAEWQSRAPPYAKMLKNLSKV
                     KEITNQSPLTLAEKILYSHLCDPEDSITSSNLEDIRGKQYLKLNPDRVAMQDASAQMA
                     LLQFMTTGLSKTFVPASIHCDHLIVGKEGEEKDLKSSIATNKEVFDFLQSCGRKYGIQ
                     FWGPGSGIIHQIVLENFSAPGLMMLGTDSHTPNAGGLGAIAIGVGGADAVDALTGTPW
                     ELKAPKILGVKLTGQLNGWTSSKDVITKIAGLLTVRGGTGYIVEYFGEGVSTLSCTGM
                     ATICNMGAEIGATTSTFPYQEAHRLYLQATGRGILAEQADVALKQYGLLKADENAQYD
                     KVIEINLSELEPHVNGPFTPDLSTPISNFGEKSLKEKWPQKISAGLIGSCTNSSYQDM
                     TRAAELVEQAAKAGLKPRIPFFVTPGSEQIRATLERDGLIKTFTDNGAIVLANACGPC
                     IGQWNRVDVSKTSNETNSIFTSFNRNFRARNDGNRNTMNFLTSPEMVTAMIYSSDAQF
                     DPTKDSIKLENGEEFKFTPPKGLDLPAKGFEHGRNKFYPEIDPKPQSNVEVKVSPESD
                     RLQLLEPFKAWDGKEIKTSVLMKVEGKCTTDHISAAGVWLKYKGHLENISYNTLIGAQ
                     NKETGEVNKAYDLDSTAYDIPELMIKWKNEGRPWVVVAEHNYGEGSAREHAALSPRFL
                     GGQMILVKSFARIHETNLKKQGVLPVTFENEADYDKISSGDILETVNLVDMVAKNGNN
                     GGTLDVKVTKKNGDNFIIKVKHTMSKDQIDFFKAGSAINHIGNLRRAQQ"
     gene            complement(<324823..>328914)
                     /locus_tag="HG535_0A01590"
                     /db_xref="GeneID:59233857"
     mRNA            complement(<324823..>328914)
                     /locus_tag="HG535_0A01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286054.1"
                     /db_xref="GeneID:59233857"
     CDS             complement(324823..328914)
                     /locus_tag="HG535_0A01590"
                     /inference="similar to AA sequence:RefSeq:NP_009967.2"
                     /note="similar to Saccharomyces cerevisiae BUD5 (YCR038C);
                     ancestral locus Anc_1.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141949.1"
                     /db_xref="GeneID:59233857"
                     /translation="MDKHPNATPHLPVHYEDNFISPTKPLEMSSELVDRQYIDTEFEF
                     EETDQRQMIKNVGGHLGASRSLSDDSFITAQSVDATALFPHDDLMNAKPVATWTDEDS
                     GQDLTPTLNVEAIQTEELITPKADEFNTTFGTIDTADAGIDFSESTARETETEPESGL
                     GIATRISRIQINPIATSREMIASERKSSPAKAIRTSMILNGQKTQDATETDKWNNDNL
                     HNRELYNVSYNDPSFIKSSTSLKRTNTVKKSSEMNLDDENYACLFIIAVHSFSANSLD
                     NADDISICLSFEKNDIAFVHTVDESGWGEVTLLKNVKRGWVPFNYFSDTVKSINEQTK
                     TYDLQEKTETRLPLRKLLSASAKFLLHPHDTMLPDNSGKTFNIDYINGVRDGVKVILE
                     MTECVSRSNDLVQSKPNIRKARKTLLANWYNLMIKADYYKHSVKEEHIETLIKLLFAV
                     LNQAFIFFDTWSTEKASFDEENRKGKNHSPVEEKTNLAAVEKGPSQNLIYLEEPPTAM
                     NRLHEIYDLLFCYSGLILGRLDMIEHNPSGCEVLETIVHQVIVLLRDLLYISKSCSAI
                     IQEKFQYAYENTLHKNLDPLLSLVSELVSCVKVLVTQTLQEDYQIETSKHLIKDEGYH
                     YTDQGQRLTDIVANMVTLIANSINGCNSYLRLIGDIPLGTDRKYLDLKQIQITPEKFT
                     QLCSKGMTRNLDKKLISELLNTVGHQPHHNKLARFSTIRAGNEGELGFTYEGTQLLKG
                     VMLDQTPFGRDSTFDPFTIDEKNRSIEPEHNIINNKELLGNEMVFSSDGSLIAASFRA
                     LVFKLTDEVDKPDDTFADAILLNFHSFGTEADLIDSLIARFDLTDKSLANDIGNKFGL
                     YSSRSSRLKNRRKLVCKVFQTWMESYWDYNSGQKHLPTLINFFNEGVSFYLPFQGKCL
                     LETAARLSAVNVAFKKTQDTVPMIRDQLSPRTINKLKTSSIYSDVSNSSTDSRLSVFS
                     LDEKVIEEYELTKLPSQNTNSLSLPLPVLNLGTSSLLSKRNLQDMEKLVLSYRSMLNC
                     SIPLTNSSTFSPKEDTLRLIFEWNEMIMSGAKAPQNIIHNDINLADLNPLELAKQLTL
                     IESHLFLGIKPSELLDENFLGKKSSLGLAPNVRSIVNFTNELCDYVLESILYPQMTLK
                     KRIARLKSWLKIALATTYFRNYNSLTSIMIALQNHAITRLTGVWNGLDSKEYELYDYL
                     SKIVHPNNNFKVYRKKLKKYVDESPFGELQSEKSPIPVVPFFNLFLQDLTFIYEGNNT
                     YKSPESFRPNKMVNIDKFLKITKTINMVRYFQVNYNTYEERDENAQSFFNISAQIDVD
                     TQHIKPISLLQEFIFYELWRVNTLYIASKDRAYQLSILSAPRK"
     gene            complement(<329482..>331398)
                     /locus_tag="HG535_0A01600"
                     /db_xref="GeneID:59233858"
     mRNA            complement(<329482..>331398)
                     /locus_tag="HG535_0A01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286055.1"
                     /db_xref="GeneID:59233858"
     CDS             complement(329482..331398)
                     /locus_tag="HG535_0A01600"
                     /inference="similar to AA sequence:RefSeq:NP_012334.1"
                     /note="similar to Saccharomyces cerevisiae ECM25
                     (YJL201W); ancestral locus Anc_1.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141950.1"
                     /db_xref="GeneID:59233858"
                     /translation="MLYVNVSSIFFKSYSVDPISGHIIYVFDSTYLPSPEEVGDKQVY
                     DLLIDELMDKLIGKLPRGPFSLVVFSSGFSKKKISWIYGIKMFAKLPKELRGFLQKTY
                     IVHESFFIRTVYQVLSNAMNIKLLSINPLQDPQASSENAEPHLFSHNQSMVHVENLTE
                     LATLIDITTLRISLNVYLHDYQFNDYITLPEAYFTRLSSGGVRQYRQLIFDKIFKRLV
                     HEAPSHQLVFQKPGSYKKVNILLDIIERNNYIDLSQWDIYSLATVFLHFLKTKTHPLI
                     PIDLIPLPISDDYDYTYMTFCNIIKSNHYFDLFETIFPLFKSLLQAANVTNHTMRTLS
                     KALTPTICQEKVSMTTSDRLAVGTRFIGNLLEHFNDIMERIERARTGRTQIVSPLRNK
                     TTGKLPPRQPLSSQPVSSVLPSTTMIPPPVPCARKSSPTKYGNLETVRPSRPTSPFAC
                     QQKTRRSTSSTSTLSVENTNSTSLKPGEDIYSSSRVNSDSTATVSETPNSSSSRISSS
                     SSSSSSSLVSPVIASATSGTANIPESISQMVTEESDTPALDISRDLTQQSTQHDINIT
                     ELKIDDKFLQFDKDLTKKKKLNSNVGKDIKFSAEGYSDIKVGNKVSKLAALYEERLQG
                     FQVMNEIQRSSRLS"
     gene            complement(331659..331747)
                     /locus_tag="HG535_0Atrna2K"
                     /db_xref="GeneID:59234624"
     tRNA            complement(join(331659..331695,331710..331747))
                     /locus_tag="HG535_0Atrna2K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:59234624"
     gene            <333241..>334227
                     /locus_tag="HG535_0A01610"
                     /db_xref="GeneID:59233859"
     mRNA            <333241..>334227
                     /locus_tag="HG535_0A01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286056.1"
                     /db_xref="GeneID:59233859"
     CDS             333241..334227
                     /locus_tag="HG535_0A01610"
                     /inference="similar to AA sequence:RefSeq:NP_011600.3"
                     /note="similar to Saccharomyces cerevisiae PIL1 (YGR086C);
                     ancestral locus Anc_3.420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141951.1"
                     /db_xref="GeneID:59233859"
                     /translation="MHRTYSLRNSRAPTASDLQNPPPPPSSTKSRFFGKGGIAYSFRR
                     NAAGSWGPELSRKLSQLVKIEKNVLRSMEIASNERRDAAKQLSIWGLENDDDVSDITD
                     KLGVLIYEVSELDDQFIDRYDQYRLTMKSIRDIEGSVQPSRDRKDKITDKIAYLKYKD
                     PQSPKIEVFEQELVRAEAESLVAEAQLSNITRSKLRAAFNYQFDSIIEHSEKIALIAG
                     YGKALLELLDDSPVTPGETRPAYDGYEASKQIIIDAESALNEWTLDSAQVKPTLSFKQ
                     EEYGDYDDEVEDEEAEQVEGGQPADEEEQRWAENADVTDDVEPAAATVQPVV"
     gene            <334572..>337124
                     /locus_tag="HG535_0A01620"
                     /db_xref="GeneID:59233860"
     mRNA            <334572..>337124
                     /locus_tag="HG535_0A01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286057.1"
                     /db_xref="GeneID:59233860"
     CDS             334572..337124
                     /locus_tag="HG535_0A01620"
                     /inference="similar to AA sequence:RefSeq:NP_015430.1"
                     /note="similar to Saccharomyces cerevisiae COG4 (YPR105C);
                     ancestral locus Anc_3.419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141952.1"
                     /db_xref="GeneID:59233860"
                     /translation="MNPHTSSWDSNVLDGQLHRNVTKYSNFLQKLSTSSQVDKLSQLI
                     KRERSEQLQSLDQFIEEAQTKHNSAIRKLELQRTDLTSTLSQYHSAVSVISDSNVVAK
                     TINYDISTIDVEDKLIKKTLDFVSHVKKLKNNISVVHGALESKNYILAAKSIQEIRNV
                     PKEILESEFAKKTVPSSEIPEEPSVLLDIWCEQFSELLRTNFLNAAKSQDVQQLTMMF
                     KMFPMVGQDSLGLDLYSKYVCDIIAEESRKVVTGDIKKNGVFARALFHLFRIVSTIIN
                     DHSKIISSCYGVNHMIHVMEKVEKEADLQGGLVLDMFTETRKVDRFVKEITEWFSKRE
                     SIDNQDEKNNIDSDDDTRYDSDDINDNEENNSTVIGANELSNLVNEFSEMLKTWSMYA
                     KFFSARWYEFSNIKDVDCLVPPPPILDGRFTLKLKNDNVATNFETLIMFSLNKAFTKS
                     LLLEELPSLNNLITLKSVKHDEVSSYPISSVLEDTALLIRENLMLTVNTGQYQIFSHF
                     LDQLAKFYQNEFLVKFLQSKFKNLQPKLTVSLALKKYVPTGASPSNSNVNSRGISPSI
                     TESYASAKLSQLGFNFRGAAANALTNFQTNLQSVVSDEEAVLAFHHFLIYINTLSLSR
                     RFVHKLLSIEILTERPNLLRCNFPFEDNAQQLITKVNACEDLMVKQNNKLQKWAVKFL
                     FENIVSKRIRTITTNCFINGNDNNYVSGADDFEVMPGMNEFVKKWKQNMIPFQNILYD
                     DAYTELLTLIVEYIIKIVEQRIWLLKVNELGATKLDRELSLFIQTICWFNYTLREKFT
                     RLTQIVLILGFDDDNFDVTTGDIKEELVSSIKWVLSPQDRIEARNLKIDKRQ"
     gene            <337621..>340509
                     /locus_tag="HG535_0A01630"
                     /db_xref="GeneID:59233861"
     mRNA            <337621..>340509
                     /locus_tag="HG535_0A01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286058.1"
                     /db_xref="GeneID:59233861"
     CDS             337621..340509
                     /locus_tag="HG535_0A01630"
                     /inference="similar to AA sequence:RefSeq:NP_015429.1"
                     /note="similar to Saccharomyces cerevisiae FHL1 (YPR104C);
                     ancestral locus Anc_3.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141953.1"
                     /db_xref="GeneID:59233861"
                     /translation="MEAVHKALAEPNTVESEKYDSTSPDVRNKINEQAFDALQEYNTG
                     DAKPASIRDGVPSDEQTVDEDKEMQEGVHHLVENEDLKLDLPDNLDSEDFSKLLVFDE
                     RHDDDLFATHDILEKTIRDADSQEQQGHQEQQEKSELPETITQYGGNDEVLASKAENK
                     AEVNVSGDEEVKLSEARDISPNLTADVNSTSSSMPGELSKFSVKEETLSPRRTFSDID
                     NNTISLQNPTNPIEPENTANDTGTENGQITNLSANSPASHSNSGRETPAAILHEKESL
                     VYLKRHDSLTPMIFQQHELKQFVNNGDIPNSAGKDALTQESPTASEEQPTISAYARLD
                     FQSFTFYVQTLHLIIGRRSENDFTHKVDVNLGPSKSISRRHAQIFYNFGTGRFELSII
                     GKNGAFVDDIFVERGNTVPLKDRTKIQVGQIPFQFALPEHDNSEKTLATPEASQLHSS
                     TVNGKQNGTESLKDEDEKKEKDAPTSPKKPVKKQVVKKEKKPVKIPKKVYTLEEIPPE
                     YRTKPTFSYSALLTTCIRKYSTTKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLS
                     LNKSFRKVSKEGKGWLWGLDEDYIAEREHLKKKQAEAAAAKAQAAQQRLEQQQKQQQQ
                     QQQQQQQQHQHQHQHQHQQTKKASTLKNTVSAMKEKTAVKSTNVKQQNISQTLAANRA
                     ADKKSNMDDHQRTMKYLQEQLMILTRDRKGLSKQVIASILTQALAMTINQVTQAARNK
                     RITGNPLTALMDKNPQHLNLILAAAVNAATSKVTNGEVKQLVNLPQSNDLSKQVKKSA
                     NPPGSEQPTTSDNSSLPRATINTPEGKPSSGSFDPSSLSRFFQPRQPARAPAAPIVKP
                     TIPQKRSIEEEEDETSSSEESSGSEEDESDDDDDGSDDGSDDSESSSTSSEDENKDKV
                     DQNEGEEDDDDDGGDDNNNDESTDESSGDSESASDTNNNQEVETIRVK"
     gene            complement(<340644..>341507)
                     /locus_tag="HG535_0A01640"
                     /db_xref="GeneID:59233862"
     mRNA            complement(<340644..>341507)
                     /locus_tag="HG535_0A01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286059.1"
                     /db_xref="GeneID:59233862"
     CDS             complement(340644..341507)
                     /locus_tag="HG535_0A01640"
                     /inference="similar to AA sequence:RefSeq:NP_015428.1"
                     /note="similar to Saccharomyces cerevisiae PRE2 (YPR103W);
                     ancestral locus Anc_3.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141954.1"
                     /db_xref="GeneID:59233862"
                     /translation="MQAIAERFATPNALVRELQYDEEENLEQDFVMGSSQFKRMAPSI
                     AMPPISSPQQFLRAHTDDSQNPDCKIKIAHGTTTLAFRFQGGIVVAVDSRATAGSWIA
                     SQTVKKVIEINPFLLGTMAGGAADCQYWETWLGSQCRLHELKEKERISVAAASKILSN
                     LVYQYKGAGLSMGTMICGYTKKEGPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDAN
                     YKWDLTVEEALYLGKRSILAATHRDAYSGGSVNLYHVTEAGWVYHGNYDIGNLFWEVK
                     EKEGSFNNVLG"
     gene            <342280..>342804
                     /locus_tag="HG535_0A01650"
                     /db_xref="GeneID:59233863"
     mRNA            <342280..>342804
                     /locus_tag="HG535_0A01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286060.1"
                     /db_xref="GeneID:59233863"
     CDS             342280..342804
                     /locus_tag="HG535_0A01650"
                     /inference="similar to AA sequence:RefSeq:NP_011599.1"
                     /note="similar to Saccharomyces cerevisiae RPL11B
                     (YGR085C) and RPL11A (YPR102C); ancestral locus Anc_3.416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141955.1"
                     /db_xref="GeneID:59233863"
                     /translation="MSDKTQNTMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQT
                     PVHSKARYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNF
                     GFGVEEHIDLGIKYDPSIGIFGMDFYIVVGRPGNRVARRKRCKAVVGNSHKTSKEDSI
                     AWFKQRYDAEVLDK"
     gene            complement(<342868..>343473)
                     /locus_tag="HG535_0A01660"
                     /db_xref="GeneID:59233864"
     mRNA            complement(<342868..>343473)
                     /locus_tag="HG535_0A01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286061.1"
                     /db_xref="GeneID:59233864"
     CDS             complement(342868..343473)
                     /locus_tag="HG535_0A01660"
                     /inference="similar to AA sequence:RefSeq:NP_015426.1"
                     /note="similar to Saccharomyces cerevisiae SNT309
                     (YPR101W); ancestral locus Anc_3.415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141956.1"
                     /db_xref="GeneID:59233864"
                     /translation="MDYLPFIDEPQIDDTHLEKVETRMKLELERIMANDQIHPEVLRL
                     LESQPHKQSRFDEELYELYNSGSENVEVNGSARKRPYNEELLLEEHKKKNARVRMDIY
                     DLDNPQCNVERLAIIDNYLKHQELILREALPKTLLNQWAINNHYLSNRSEQLQQVIDL
                     QSKHIQELNAYRKNVQLQNEPVFERDVQNWRNKLIRNLNVQ"
     gene            <343726..>344640
                     /locus_tag="HG535_0A01670"
                     /db_xref="GeneID:59233865"
     mRNA            <343726..>344640
                     /locus_tag="HG535_0A01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286062.1"
                     /db_xref="GeneID:59233865"
     CDS             343726..344640
                     /locus_tag="HG535_0A01670"
                     /inference="similar to AA sequence:RefSeq:NP_011598.3"
                     /note="similar to Saccharomyces cerevisiae MRP13
                     (YGR084C); ancestral locus Anc_3.414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141957.1"
                     /db_xref="GeneID:59233865"
                     /translation="MLVFKRFASTGSPKAKLEEFFTYHTTSALLKPWIYRPKNANYLL
                     TMDMKDPNSNRPLQPRKPVGPLSRKVLNDYIESIPARSNELVEWFRNWTQVTPRKRQV
                     FNYVSSQHIQLMLVSSFFKLGSYDELLMNLYNNKAKFLKAQNNEAFDVEHFFNTIIMC
                     KLHKNHLCNYRDAELAKRKLIKTWKAITNRNDKTGLANALVSVLARQQGFEVDLKGLS
                     VTDIVLPKLGEIENTNPSKLLNFIQENRYVYLMLRTIVEFSNDGPIDSIIENFISSYR
                     RAAEELGKDDIYDNYIESMKNLWITKSE"
     gene            <345261..>347150
                     /locus_tag="HG535_0A01680"
                     /db_xref="GeneID:59233866"
     mRNA            <345261..>347150
                     /locus_tag="HG535_0A01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286063.1"
                     /db_xref="GeneID:59233866"
     CDS             345261..347150
                     /locus_tag="HG535_0A01680"
                     /inference="similar to AA sequence:RefSeq:NP_011597.1"
                     /note="similar to Saccharomyces cerevisiae GCD2 (YGR083C);
                     ancestral locus Anc_3.413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141958.1"
                     /db_xref="GeneID:59233866"
                     /translation="MTLGAEAAEGQHDSHATAPKQVDDKKKLSNKELKELKKREKAAK
                     RSAKKQEGGMSIEQQQQQAQMKREKKEVQREQQLQQQRDQQKKREKKAMQSKPSLKKS
                     TLFGHLETAAERRATLLAITSAITTPKASRITASGLMVPTIATAVPGATATTSALSAP
                     NSSTSSTSSTHGGSSPGTLGMGLTATNNSQQEGTNDLAKTFATMTLDSDEFSLVSGIS
                     SVIPHAIEQSFDSPQMVSSVKELLMNKNLIHPAVTLLTSQISNYKIVGSTPRCIAMLE
                     AFQIVIKDYQTPPGTTLSRNLTNYLSHQIDILKKARPLNVTMGNAIRWLKQEISLIDP
                     SMADKKAKQELCEKIAQFAREKIELADQLIIGTASHHIENGTTIVAYGSSKVLTDLFI
                     YNSVDLKKNFKVIVVDSRPLFEGKKMAEALRSHGVNVMYGLITGLDDIFNMDVDYVYL
                     GAHSILSNGFLYSRVGTAMVAMTAKRRNIPVLVCCESLKFSQRVQLDSVTFNELADPD
                     DLIYIDSKKSVNLHSASSTLLHQFLKEREEQKKKTIQENKSNTKSNNSSSTSISKPNT
                     ISEPSGKTVSNILDGWQDIPSLNIVNVLYDLTPPEYIKKIITEFGALPPSSVPVILRE
                     YKSSA"
     gene            complement(<347297..>347719)
                     /locus_tag="HG535_0A01690"
                     /db_xref="GeneID:59233867"
     mRNA            complement(<347297..>347719)
                     /locus_tag="HG535_0A01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286064.1"
                     /db_xref="GeneID:59233867"
     CDS             complement(347297..347719)
                     /locus_tag="HG535_0A01690"
                     /inference="similar to AA sequence:RefSeq:NP_015425.1"
                     /note="similar to Saccharomyces cerevisiae MRPL51
                     (YPR100W); ancestral locus Anc_3.412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141959.1"
                     /db_xref="GeneID:59233867"
                     /translation="MVVKAISQNSIARNGVGAFVFPCKKITLQYCNWGGSSQGMRKFL
                     VSKRLDLLGQKFPHIQFEILRKSGHPLLRAQYSNGREKVICVRNLNIDNVENKLKLLK
                     DSSGDVLRRRTKNDNVETLNDSVRGIWSPLHSQMRYKV"
     gene            <347970..>348519
                     /locus_tag="HG535_0A01700"
                     /db_xref="GeneID:59233868"
     mRNA            join(<347970..348016,348081..>348519)
                     /locus_tag="HG535_0A01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286065.1"
                     /db_xref="GeneID:59233868"
     CDS             join(347970..348016,348081..348519)
                     /locus_tag="HG535_0A01700"
                     /inference="similar to AA sequence:RefSeq:NP_015423.2"
                     /note="similar to Saccharomyces cerevisiae YPR098C;
                     ancestral locus Anc_3.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141960.1"
                     /db_xref="GeneID:59233868"
                     /translation="MSLFKPASHLLLYSFVFGGTTFYSYVASPIAFKWLDRENFSLLQ
                     SKVFPLFFQMQAASPIILGLTAPITLAGGPLAALATASVAGLTNLCWLLPKTRKIKEE
                     RKGLQSRLTGEELESFDGPLRKKFGKFHGLSLLFNLTNACSMLVYGVYLCKGLLKHVP
                     K"
     gene            complement(<348719..>349282)
                     /locus_tag="HG535_0A01710"
                     /db_xref="GeneID:59233869"
     mRNA            complement(<348719..>349282)
                     /locus_tag="HG535_0A01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286066.1"
                     /db_xref="GeneID:59233869"
     CDS             complement(348719..349282)
                     /locus_tag="HG535_0A01710"
                     /inference="similar to AA sequence:RefSeq:NP_011596.1"
                     /note="similar to Saccharomyces cerevisiae TOM20
                     (YGR082W); ancestral locus Anc_3.410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141961.1"
                     /db_xref="GeneID:59233869"
                     /translation="MSNTSSTARALTITSVIAAVSLTGYAVYFDYKRRSNPEFRKQLK
                     HKLKKQAEKEKKEKDEAKQIKLELVSQHLSKDLASDPISINPADREKVFTSNVELGER
                     LSMSPGKELESAVKFYKALSVYPNPADLLGIYQRSVPEAVYEYIVMMIAVLPPANIST
                     FLSGSKDKALAQEAELAAMAEVNEIVE"
     gene            <349592..>350230
                     /locus_tag="HG535_0A01720"
                     /db_xref="GeneID:59233870"
     mRNA            <349592..>350230
                     /locus_tag="HG535_0A01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286067.1"
                     /db_xref="GeneID:59233870"
     CDS             349592..350230
                     /locus_tag="HG535_0A01720"
                     /inference="similar to AA sequence:RefSeq:NP_011595.3"
                     /note="similar to Saccharomyces cerevisiae SLX9 (YGR081C);
                     ancestral locus Anc_3.409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141962.1"
                     /db_xref="GeneID:59233870"
                     /translation="MVAKKRNTLRSKAEAAAASRGTAAQALAGSGLEGIAGGQDAEAT
                     QNPPLSTFLYQPRETKKSKQLNKQQTFLSKVRERSTNSDPALAGVSKSAVRRRKRHMR
                     EDLKPKMNDLLTSLGQEEDLKEHVTAEQQDDDSTKENKRKVTKVVRREELPEIESAFV
                     RRKKNEPNIRNQRGAKALTIKETTRMVEVLSNKSFQSNTFSSLRDVIKMRNR"
     gene            complement(<350261..>353338)
                     /locus_tag="HG535_0A01730"
                     /db_xref="GeneID:59233871"
     mRNA            complement(<350261..>353338)
                     /locus_tag="HG535_0A01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286068.1"
                     /db_xref="GeneID:59233871"
     CDS             complement(350261..353338)
                     /locus_tag="HG535_0A01730"
                     /inference="similar to AA sequence:RefSeq:NP_015422.2"
                     /note="similar to Saccharomyces cerevisiae YPR097W;
                     ancestral locus Anc_3.408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141963.1"
                     /db_xref="GeneID:59233871"
                     /translation="MVEELTPTEEHYLKRELLKFQLDKELSALNDQFALRRFGYPFSA
                     EDPKLGTPKTPRKGGLMSVMASPAETISRKSTENDTLGKTGNLTSRKNQDEGTDFPML
                     SYVLREIIMPFPMFSKDIAKNEEFWKYKVQVFFEHFMSLGFSNSYDREEATKRRRISK
                     KLGKTVLLLFNSGVGVSQEVKYYNQDAFILKQDEKKKTAGVEEFAIPTRESLQYLYTN
                     EPVFINGWDINIVAVVDDSSLFGRKRLPSEPKPAAFSSKWVKNAFSKPASPAALFSKL
                     GITDSHNTSKDSKYLHYYILKLINVNNPDKTFYTAKSYDDFKQLKRSLKNEFPGKQNA
                     RLPRHTKKSAEIVSQPISFDYSQSLATPKEKIISVFQNDSPGASIASSDSKQDSNSND
                     SVSYESSVVKREKETSDELDDESFEEFHDAQESRSNGLLSEKMRTSLRQYLRTLCGDK
                     EISSSSSLADFFGGDTISQSSFSKGLKEDIERRKAVDITNLENQVQFQKLALEKTLQL
                     RESMKALKTSVLKDEKYLLSFIQELKEKTKVVDLSPLLFSFVEWCKIYVSSTIYQVFL
                     GNDSGYEFFTQIKRLNRLVPYSVMGQIMRFTNPIGIMKAMMDLFMAQPFGSQSLLQTM
                     FSTVLSDDLKSQEKVIQALEQKMQQETSLSSEVIKCLKDCVFKNENDEIISMEAVHKE
                     SAETTVPFSLVLLIKNGELGNLSHEAVGEVIESYSTWKAKQSSSSDLPFIEDQMGDRY
                     FSNVKELLQLYIRERDKKLMRRLWQDPELSQLLKSMLTLLYEPMVKIFKVARVDIALK
                     NFERFMNDLIKLVSNVFDGRLGTSLKFNVVESINDLVTKHQDSFLLFIHDVYQNDTEG
                     IFEGFITWFVKIIKFLQNSKYGTGDLRIDFNKLFKEAEINEKLLIDQLDNVIEKKQAA
                     RQIYKKMLDSRMKEQKDSKLTAAKVVENNWKELNSLVMPPESNAFGLQDGEIVDLDLD
                     AADYGHLFEEGDDKELETKYQSILNKELDESEIEKFGELVFADALENYLNSLV"
     gene            353751..353824
                     /locus_tag="HG535_0Atrna2V"
                     /db_xref="GeneID:59234628"
     tRNA            353751..353824
                     /locus_tag="HG535_0Atrna2V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59234628"
     gene            <355683..>359012
                     /locus_tag="HG535_0A01740"
                     /db_xref="GeneID:59233872"
     mRNA            <355683..>359012
                     /locus_tag="HG535_0A01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286069.1"
                     /db_xref="GeneID:59233872"
     CDS             355683..359012
                     /locus_tag="HG535_0A01740"
                     /inference="similar to AA sequence:RefSeq:NP_015420.1"
                     /note="similar to Saccharomyces cerevisiae SYT1 (YPR095C);
                     ancestral locus Anc_3.407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141964.1"
                     /db_xref="GeneID:59233872"
                     /translation="MNQSLATLIRIKLFQGNSGSAQGSDTPNTDKEKQSDKKPRNWLK
                     AKRSGHKEVSRSSSDSDLLNASTNGSQDLVDDNTAEDPIKSSHEDAEEQEQRKEIPEG
                     NGVETMAKGKACSDACLEQTTSDNSVRKQNSPSALSADGSRSPRKQGKLRTFREKMSI
                     PDLHFRSTSANLRLDRQSYERSKKSESVPPNGQVKSARVYSILPSSMSPKRLSAEYSY
                     KSPAQLPKYSFENASNDTSMLSRTSSNTSLLSSTRFSPRKTNIVNGSSTSSSVRFIEP
                     VVNMSNGNLSNGTKTKGKFNSVSNGHTYQHSKTNSVEVKNATGKSLLLGRRRSRTVDV
                     SDYTRTSSSQWQQSASTNSDFISSITIHLKKSRSNSLLTKSPLATPLDKASYQNPDEK
                     GSVNSVRLSESTTSSTMPGASMTQPTIPSMSRRSSSLVNALNSFVNLRSSSASSVKGS
                     SSKAVTPKFDLKLEDFPSPPEPEIDETHANFLRRLTPYGKFIAVILCQKSNAFKDECL
                     RFYLSNFFDFSGEPLDISLRKILMFLELPQETQQIDKLLTEFAHCYYQTHLKDEEYCP
                     WKDENQVYFIVFSLLMLHTDYFNLNNRSKMTKNEFIQLVHEDQLSGGCDIPKDILLYY
                     YDNIISKESPKFDFSCYQELLSSEEADEQNSLTTEKSSADFYSPVAIIKATSSNVCHD
                     CTPSSFAITGRTSSNSFSSYFPQIPASTSSSNTSLVQDDIDIYAQILDDSLKGLNMSS
                     EVERLWNGVSLTNRLIADDNKYEKYFTILNETKGGYLKIHKNQIGKIALSNFETLNKT
                     DNDYALLKIVHMGEIQKLTVNKKFSIVGSVNKILWKKEYAILTPCCLLLFENADWVDP
                     SLVRDENSGTSNYIIDYKANGSILFTPPLACNGLLAISKISEAAKANTEKLDIDVDPC
                     ANLDVLPRDQESKVNNTDDYILHLYASQKKFIWKCSSVYERDNWIDSINLVAAYDGCY
                     YNPKSLENVIISHRKHDAKLKLEKLANTRAEKSERLLAFQHSLPLYKQAIPISYKTKN
                     DLASQIRQLAVKLEWLVHEIERSQLYYEIIQQVVSQFGPFVNQNLKDQGKESESDLKS
                     IKGSFIFNDELLNASLNQDRS"
     gene            complement(<359119..>359451)
                     /locus_tag="HG535_0A01750"
                     /db_xref="GeneID:59233873"
     mRNA            complement(<359119..>359451)
                     /locus_tag="HG535_0A01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286070.1"
                     /db_xref="GeneID:59233873"
     CDS             complement(359119..359451)
                     /locus_tag="HG535_0A01750"
                     /inference="similar to AA sequence:RefSeq:NP_015419.1"
                     /note="similar to Saccharomyces cerevisiae RDS3 (YPR094W);
                     ancestral locus Anc_3.406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141965.1"
                     /db_xref="GeneID:59233873"
                     /translation="MSRHQLDLVMCMKQPGVHIGLLCEKCDGKCPICDSYVRPKRKVR
                     ICDQCSFGKTGTSCIICGLPGVTEAYYCWECCRLEKDRDGCPRIINVGSNRTDKHFEK
                     KVTVNKER"
     gene            <359568..>360548
                     /locus_tag="HG535_0A01760"
                     /db_xref="GeneID:59233874"
     mRNA            <359568..>360548
                     /locus_tag="HG535_0A01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286071.1"
                     /db_xref="GeneID:59233874"
     CDS             359568..360548
                     /locus_tag="HG535_0A01760"
                     /inference="similar to AA sequence:RefSeq:NP_015418.2"
                     /note="similar to Saccharomyces cerevisiae ASR1 (YPR093C);
                     ancestral locus Anc_3.405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141966.1"
                     /db_xref="GeneID:59233874"
                     /translation="MTSLIRSDRPKELRLCRNTQAKKADLVDGMLDATMVDELAVCPI
                     CLDEITDSIATLKPCNHQFHKDCIRKWHTYADDLKCPICRIESKHLEMGYKLGGYHKN
                     IKINLEKGFNIKITIEQAEDHSLPELIEQFGSIHLNNQSSLIRDARCVFCDICGQECS
                     GRDDQYCEQCDSHYHEECLRSLACEVGDRESWQQCIGCRNLVIKGNTRTDAHPHLFDQ
                     RIVREQALEYPGNSAARMVSASEEELSRLLNVKTMIQTHVRGVLNEYYQSGVDGIKIN
                     KRHFTEVNKTVSRRLYRLSKYRYQEDLINYDTEAKRQVHIELCRLGYVYI"
     gene            complement(<360551..>361540)
                     /locus_tag="HG535_0A01770"
                     /db_xref="GeneID:59233875"
     mRNA            complement(<360551..>361540)
                     /locus_tag="HG535_0A01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286072.1"
                     /db_xref="GeneID:59233875"
     CDS             complement(360551..361540)
                     /locus_tag="HG535_0A01770"
                     /inference="similar to AA sequence:RefSeq:NP_011594.3"
                     /note="similar to Saccharomyces cerevisiae TWF1 (YGR080W);
                     ancestral locus Anc_3.404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141967.1"
                     /db_xref="GeneID:59233875"
                     /translation="MSSQSGILATKELLDTLNDSEDSSGLAIFTAKISADSTVVERDG
                     SFNSVEQLQKNLNSDPLYIFVKNPSDNLYVFASYVPDGSPVRAKMLYASTKNTLIRQV
                     GSNSIGKQLLFTEAQEVRDILDDSRPSQNAVLTESEKVNIQIAQQQQKMKLAQHFPNG
                     KKLVSQTNGAPSQLSFEVDSKGFSISSILNKYNAVSFTIDLSNEQIHIASKENVDSPY
                     ALRITAENPSYTIFKNGSLHYFIYSCPSGSKVKDRMVYASNRAGFVNYLTNEEKLAFA
                     KIIEIGEPSELEVSLISSSSEEEQKRQTALEKSESKPKFNRPSGPGRRSKPTL"
     gene            complement(<361732..>362613)
                     /locus_tag="HG535_0A01780"
                     /db_xref="GeneID:59233876"
     mRNA            complement(<361732..>362613)
                     /locus_tag="HG535_0A01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286073.1"
                     /db_xref="GeneID:59233876"
     CDS             complement(361732..362613)
                     /locus_tag="HG535_0A01780"
                     /inference="similar to AA sequence:RefSeq:NP_011593.1"
                     /note="similar to Saccharomyces cerevisiae YGR079W;
                     ancestral locus Anc_3.403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141968.1"
                     /db_xref="GeneID:59233876"
                     /translation="MAVKKGSLKAAAASATAECSSENGRSFQLSNSTYSQEEILPWSK
                     TENGTVGAAGICGGEEQSDFSRGGDATTDPDMLFSPLNNGESDEEDEYDKGYLSPFYF
                     GAQYPKRFHHGSVQAKTGAVEQHNRSGSSCSMPSSELLGINEDFWKEVALTQEESICY
                     TPETALGDVQRAQADAQAGTQPESQGEATCADTSFEEYITEDLDISTATGPDSTNWNQ
                     DFKIKLLCYRDGKGNFRLKTEEDIKNNHGGNAVTKKSIKKLKKNRDKKLLKRALRRKS
                     GVWEMVNTGVGIREFML"
     gene            <364083..>366497
                     /locus_tag="HG535_0A01790"
                     /db_xref="GeneID:59233877"
     mRNA            <364083..>366497
                     /locus_tag="HG535_0A01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286074.1"
                     /db_xref="GeneID:59233877"
     CDS             364083..366497
                     /locus_tag="HG535_0A01790"
                     /inference="similar to AA sequence:RefSeq:NP_015416.1"
                     /note="similar to Saccharomyces cerevisiae YPR091C;
                     ancestral locus Anc_3.402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141969.1"
                     /db_xref="GeneID:59233877"
                     /translation="MISLKLFLLIYLIGGITFLPLIALGILYVNGILDGKDEGVREQA
                     DSRRRETLMDPDFKAAEFEEAKGVHVTRQGWVSVTTKYYYFHTEIPSSANSDNTSEAG
                     EFPERSQLKKKHKFYAVIKHGNLFLYRDNSPKSNLIHAISLQDSFVTLWPRDTKHEIP
                     DSALFSKRTCISILRKGATSLKNGELGFTPNESSEDDTQTASQFFLYFGNNMEKEDWY
                     FDLINVSKNETTSGSKTNGLIDPNVSARAAHLRTADMLYLIQTINSTEGQLTTKWINA
                     ILGRLFLSLQRTETLKYFFHERLYQKLSKVKKPDFLDDFVVEEVDVGNSAPIFTNPKL
                     IELSLEGLTKISCDFLYKGDLSVLVSTKATINLGSRFKQREVALQLSLKLKELSGPLI
                     FLMKPPPSNRVWYTFETEPILDVEVEPVVSSNKLSYNMITNAIKGKFAEALKESLVQP
                     NWDDIVFFSTEKDIYRGGIWENYGKSDEEEKKSSTNSEPPSHDKRASFSNLEKDISKN
                     DNSQISNRESDNDVEDTEKDSCHDDASMKRRSSQKIENFRRILKTKSKEEFDDEHVQT
                     EKASQASPFNEENDDLSGSKKYFKNPIKKLNKWYKEAVNIDMLDNDSTNTNTASGAES
                     SVKNVNTPEMISNRRTSIPRRPRPSNINQMSHSATDSQLANISQPLNSTEMFVNKNKD
                     EAQSSSSNDIGAPPFLSNNYSTMPVRAFVKMEDTKQFPGEYVVDPRDDPRDDPTKSVS
                     PISYHFQSENTKRQQFETSSALSQCNFQKSETEMNKKQIEIVKNEIDDTKKVLSTSAK
                     RETSHV"
     gene            complement(<366538..>373671)
                     /locus_tag="HG535_0A01800"
                     /db_xref="GeneID:59233878"
     mRNA            complement(<366538..>373671)
                     /locus_tag="HG535_0A01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286075.1"
                     /db_xref="GeneID:59233878"
     CDS             complement(366538..373671)
                     /locus_tag="HG535_0A01800"
                     /inference="similar to AA sequence:RefSeq:NP_009694.3"
                     /note="similar to Saccharomyces cerevisiae MEC1 (YBR136W);
                     ancestral locus Anc_3.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141970.1"
                     /db_xref="GeneID:59233878"
                     /translation="MEAHVKYLSELILAIRESRLNETAVDGHSKKIQTKLPSNDSELK
                     SLKIITTLIKNLNNDQRANLMQNDSIFAKTIDALDLLVRTNPYLLVHSGKGIDITIIF
                     DEFISLSISNYKNYHRMWFIRRKLGKWCKIGAQLYGNHFKNTLSNHCSLHLDRCERTL
                     TQLLSTRSELDDLLYALRKLYVLCFWFCSKQDCFGNSITILDSSLAVNIWNFQFEKLM
                     RIVFYVFESIVMPSDALELQELSAQYLTLVVEHLYNKSSPLIPNAQIVSTAQLKFTLE
                     LLRQFLEGQNFVVKGQDSAIAKCVLRVYLLCTSQYCDHSSDFFRTFVDNFPVEQWFNL
                     DNLIKESSGYFANSPITNKAISLVVFDIKRRTIPREALVYEKTYGIWSCESDENNFFA
                     LLMEPFEKRYKQLNNMRILLLKQFDATHKNTLLHYELIFLAPGIVERAGNDFQKLLDE
                     VSFSIKQCFESKKDSDLISWTRVLGRLVCFESTQRSLSDGLKSWEVCSHCDKLRSGNI
                     FQSIDPDRPSATKSATFQLFKKAFLNHPDLESFSECLLGGILMCMQRSFSHYQPPRLI
                     LPASGNLVSLENNEFNIIQKCYPTQSRYLRSLSSRLIPLWNITNLNNPDDQHTAILIR
                     FLQENEDLYMIETSVMTWVQLALTTSGEVFDFLLLKLISTFNSDDYSAHIMMEFQIKH
                     MAKTLRKTPYLLLSPILPVLLKQVGKNLVERNFYFQRLIRLLGYSAKTILEIYQRYII
                     PHAITQYKTDAFNEIARIMCDNDTNAINEKKYMLLDKNSRQIFAVALVKYGFFSVDTI
                     ETLFMNRVPSFEKKYISAYLPDYKTLTEVLKMCKGEDTHDTTSFENENMVIGSLRFLV
                     TNFEKDKRHGSKYKNIKEWSSEQEGIFQTKLQENILGIFQVFSSDIHDVEGRTSYYEK
                     LRVINGILFLIKWASTKAIISALAQISICLQTGLEISEVRHCSLKCWKQLIMRLNEEE
                     LSTIIDGLICFILQSWDVFDTRLRTTVYEIFDILIKFKANLLLKIKPYITLTLVMKSE
                     IDILSRDGAFSRSVSKVQSNTDWTPIFCDNMKSNNKYVLHQTLNDLKLHLRRQQSEHS
                     SDIFYKHNEASNITLILGALLDLSHRFKNIDRVLCENCAKCISMIGSLDATKFKLDRG
                     VSTKNKVYDLNDEAQTIKFLIWVINDFLVPAFWESENPSKQLFVALVMQESLKYCGLS
                     SASWKVEKAELYPNEAKLWDKFNTISKTTLYPLLSSLYLAQSWKEYAPLQYPSFAFKE
                     GYCPWIKSVCLDILKTGTSEEHPLHVFSSLIREDDGSFSNFLLPYISMDIIIKAAPFT
                     IYAEIMQNIIMEFKSIFDYDSNGLNHLQIDSLKMCYQSIFGVFEYCKKWATQFKQNYN
                     RVNGTFIIKESRHSSMLQRIDRFLQEFPSALLAQRSLETSSFERSALYLEQCYREGCA
                     TSEVRSNILKSLQNTYEEIGDVDSIDGMLKSFTSGNLVSKIEELKYSDNWRMAQDCFG
                     VLGQFSHAPQTTTKMIRSMYDHQLYSQLLLQLEPLTCELKSELDPEICQWYRMGLEGA
                     NLEGNIEVLKNWLTKIESIKHVTDPEILLQYNIAKVLCYAHFNESEKVSDYMEKCYKL
                     IGTHFTTSTIATTLLKKQTLLMKLHSLYDISLLSSSIDEFDYQTKRDIVNYRSKRIGA
                     DFEPNHYVLSMKKTYGLLKNEPYAKNDLGDIFFSISRLCRDNGRLDLASESLMRCLKD
                     DYPQTELEFAEILWKQGENERALMLVQEIHQKYKDDTSLKSRDRAIVLLKYTEWLDLS
                     NNSASDQIIKQYQNIFELDPKWDTPFYSIGLYYSRLLERKKAEGYVTDGRLEFKSISY
                     ILLALEKNPVRVRETLPKVVTFWLDIASEAMTETAKYRREVLQKTAGDICKHVEESLT
                     KSPAYIWYSVLTQILSRLLHVHSTTSELLTNILVRLTVEYPAHMLWYVSVLLNSTSQS
                     RISRGKEIIDRYNQAKRSTENLVAEASDLTTALTRVCLKELRGSSRGGRSLEKDLKFD
                     TNMAPSGMAVPVRINLQMISVITSESFKVYQPFQRTVSIARFGSSYKVFSSLKKPKQI
                     NIVGSDGNIYGIMCKKEDVRQDNQYMQFATTMDFLLRKDMESMKRDLGITTYSVLSLR
                     EDCGLLEIVPNVVTLRSILVTKYESLKIKYSLKSLYEQWQHLSENKKFSFYQTQLKTF
                     PPILYQWFLENFPDPINWFNARNMYARSYAVMAMVGHILGLGDRHCENILLDIQTGKV
                     LHVDFDCLFEKGKRLPVPEIVPFRFTQNLQDALGIVGTEGTFKKSCEVTVSLMRRNEV
                     SLVNVIETIMYDRNMDNSIQKALKVLRNKIRGIDARDGLMLSVPGQVESLIQESASKD
                     NLSKMYIGWLSFW"
     gene            complement(<374080..>374496)
                     /locus_tag="HG535_0A01810"
                     /db_xref="GeneID:59233879"
     mRNA            complement(<374080..>374496)
                     /locus_tag="HG535_0A01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286076.1"
                     /db_xref="GeneID:59233879"
     CDS             complement(374080..374496)
                     /locus_tag="HG535_0A01810"
                     /inference="similar to AA sequence:RefSeq:NP_009693.3"
                     /note="similar to Saccharomyces cerevisiae CKS1 (YBR135W);
                     ancestral locus Anc_3.400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141971.1"
                     /db_xref="GeneID:59233879"
                     /translation="MYHHHHTFQGRRLTDQERARVLEFQESIHYSPRYSDDTHEYRHV
                     MLPKAMLKVIPSDYFNSETGTLRILTEDEWRGIGVTQSLGWEHYECHAPEPHILLFKR
                     PLNYEAELRAAAATQQLQQQQQQHQHQEEAGVRAPH"
     gene            <375028..>377568
                     /locus_tag="HG535_0A01820"
                     /db_xref="GeneID:59233880"
     mRNA            <375028..>377568
                     /locus_tag="HG535_0A01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286077.1"
                     /db_xref="GeneID:59233880"
     CDS             375028..377568
                     /locus_tag="HG535_0A01820"
                     /inference="similar to AA sequence:RefSeq:NP_009691.1"
                     /note="similar to Saccharomyces cerevisiae HSL7 (YBR133C);
                     ancestral locus Anc_3.399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141972.1"
                     /db_xref="GeneID:59233880"
                     /translation="MESNVFVGVKFGSAANAASSELTGHMKGSTKLPNNYDYILMPVT
                     NGRYKDTVRASFQKFKYRQGNGAILMDETILKIPEPELQDLCIPPFTVPENEPPSYIG
                     LLSSWLELESHDNLVREMCYQVLLNECKYARFVGINKLILAPPRELSELQMYSQVIAR
                     LLNHELIYSTPPLLLSISLPLYEDSDSLATWDLWHTIRKLCGYHPSLSISLAVPRTKT
                     PSHVLNRWLCEPVSCLLISSSIFATNQYAYPVLHKFNQNLIMKFQKINGNSLPSNNSE
                     LCIILHGMEKYSNRIKGGESAYLEYINYLLKKGDNLSVPGDKNSRSSQHDNTLFQQQQ
                     QRQHYFDLHSPRLMPPLKPHSESLTNYVYSVFEQDSIKYDMYQDAIQKALHDLIASSR
                     SQSLVVLIAGAGRGPMVERAIRASKYLKVLDKVKIIALEKNKQACLYLQKRNFDSWNN
                     KVQIIKEDMRLWKDESIKVDLCVSELLGSFGCNELSPECLYTVERYHSKTNTIFIPQS
                     YTSYIAPIASYLLHQKVNELNKDNESVWIMHNVPYCILSSKINELWTFEHPISEFELS
                     AAPFIKNVVTEFKVKYRGEIHGLIGFFTAKLYNDIHISTLPDESIVKLLPDSDVQGLK
                     KLNVSSSPDPFMYPSEAGVNVVGGKYKKFSHTPNMHSWSPLVFPLKEPFSVTDDTELS
                     VFISRNYSVQNRSVWYEWSVESFVYLLLSGASTRRATNQKAASQTTTSSHKPGLHRSG
                     HQANPIGLSSEGDGAAFSNTLPENAFLPVHESGWQSVNDIHGLSNGFDGEERPLFDLG
                     ADDIGKLDEEEEDEDDEDEEDEEDVHVRVKTGASALHNVNGQSFSLQL"
     gene            complement(<377689..>380157)
                     /locus_tag="HG535_0A01830"
                     /db_xref="GeneID:59233881"
     mRNA            complement(<377689..>380157)
                     /locus_tag="HG535_0A01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286078.1"
                     /db_xref="GeneID:59233881"
     CDS             complement(377689..380157)
                     /locus_tag="HG535_0A01830"
                     /inference="similar to AA sequence:RefSeq:NP_015414.2"
                     /note="similar to Saccharomyces cerevisiae YPR089W;
                     ancestral locus Anc_3.398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141973.1"
                     /db_xref="GeneID:59233881"
                     /translation="MLDDVWGAGSKLPVNSSEVSEKAELIKATVEQLRKPDGHEDPWV
                     DLVLLMADAEEEEEELTTFAQLLANVRDVNDTKKTGVALIHYTIVYNHAPYIELLHNQ
                     CYSLDLDLNIYDKKVGLTPLMWCFQLMRANCCIELFSFIDELNFDLTSKDGTNTWDFV
                     VPGSSFEEFLDQNNIFQYKLTAKPSELDSNTTFESAHLQQDDDFDKLNLQLAGMTVDA
                     ENAFFNDDNDTSGAKNIIKFSKFLEDFEFDKLLKDQYLEFSDYDIPQILDLLISLPEK
                     YAHITTYPAALIFQCVRYADHKLNSKPLVESLIHLSLTRIIAAASNDLTIDTETTGDI
                     VIQSYWLSAVSFLYYYFCRDDLFFKRYATVLQDIVNTIRALMIEITSSIHARLLPLIE
                     PTILAYTTIDVVRQTLYKKDWNFFKKRKQTKHDLLEKEKKKETLPYYNSTMLKHLYPP
                     SLEEQMKLSPMKVVQIFGALAYVLELHQSHQLFQQQCLSLSVEWFSSTLFNKILKNKR
                     KKTLSRAHAVQIRLNLSSLEAWIKNNDLVVPKPNLVDDFMWQRFPYTLVCALGDINFS
                     DPPVKNVATFKPVKTNVQSQEVPIVYDNTNSLFYYQPFHRIAHIHFERVFELLQWLQV
                     ATTLTNDDSLDATMELLPCLTPQQLLKVTDKYNYETEEPKFSSTLRKKLSTMVKAQTM
                     RNDPYLVEQPKSLLALPTVAELTDTYTRSIDSRSFQPLLPIEIQDIVDELHDENTRLR
                     KNHSYSSEKLGEEEQDNDSVDDDTDDKDRGKQSQYSGMVSDSYHTDVGDLQTADEYFK
                     ELDAPLATAQKPQWNNEEIEANPW"
     gene            <381930..>383699
                     /locus_tag="HG535_0A01840"
                     /db_xref="GeneID:59233882"
     mRNA            <381930..>383699
                     /locus_tag="HG535_0A01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286079.1"
                     /db_xref="GeneID:59233882"
     CDS             381930..383699
                     /locus_tag="HG535_0A01840"
                     /inference="similar to AA sequence:RefSeq:NP_009690.1"
                     /note="similar to Saccharomyces cerevisiae AGP2 (YBR132C);
                     ancestral locus Anc_3.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141974.1"
                     /db_xref="GeneID:59233882"
                     /translation="MSGPSKEMSIVNLKKFGTADIESITSRAAGEHFGRGNRSGGWIG
                     LKDRGYESEIGTDETQSIESTHTFRKLKNRHVQLISISGVIGTALFVAIGRALYRGGP
                     ASLLIAFAAWCVPILCITVSTAEMVCFFPVSSPFLRIAAKCVDDSTAVMASWNFWFLE
                     CVQIPFEIVSVNTIIHYWRDDYSAAIPLVVQIVLYFLISIFAVKYYGEVEFWLASFKI
                     FLALGLFLFTFITMLGGNPRRDRFGFRYFGDEPFKQYFPNNDESAGKSAGYFQGFLAC
                     LIQASFTIAGGEYISMLAGEVKLPRKVLPVAFKQVFVRLTFLFIGSCLCVGILCSPND
                     PNLTAAIDNSRPGAGSSPYVIAMNNMGIRILPDIVNAALVTAAFSAGNAYTYCSSRTL
                     YGMALDGYAPKIFTRCNRFGVPIYCVLVSLIWGLISLLQLNDNSAVVLNWLINLITAS
                     QLINFCVLCVTYLFFRRVYLAQKDNLPALPFKSWWQPYTAIFGLVSALAMTLIQGYTV
                     FFPSLWDVQDFLFCYLMVFIDLGIYLIYKFVWSRGRDKFKDPKTVDFSQDFKEIENHE
                     LDNAYEKFIYYQSQSRSESIECT"
     gene            <384435..>384965
                     /locus_tag="HG535_0A01850"
                     /db_xref="GeneID:59233883"
     mRNA            <384435..>384965
                     /locus_tag="HG535_0A01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286080.1"
                     /db_xref="GeneID:59233883"
     CDS             384435..384965
                     /locus_tag="HG535_0A01850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141975.1"
                     /db_xref="GeneID:59233883"
                     /translation="MDSLFLNKSPGNSIYKCHKNCNDVSKSNHIYDKCKLQKLKEIFD
                     FDYLIRDCNEPQVAKCCHEHREKTRISDSGEVRHYANMWNHRTGDIKEDDYLYAPLEC
                     VSSSSYPLSLPPPRSDADIVPVSSSISSYQPNTLSNIGTGTIGSSSNKDIDTYSSDTQ
                     RQLLLYDLLSGDIYDN"
     gene            complement(<384990..>386963)
                     /locus_tag="HG535_0A01860"
                     /db_xref="GeneID:59233884"
     mRNA            complement(<384990..>386963)
                     /locus_tag="HG535_0A01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286081.1"
                     /db_xref="GeneID:59233884"
     CDS             complement(384990..386963)
                     /locus_tag="HG535_0A01860"
                     /inference="similar to AA sequence:RefSeq:NP_009689.3"
                     /note="similar to Saccharomyces cerevisiae CCZ1 (YBR131W);
                     ancestral locus Anc_3.396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141976.1"
                     /db_xref="GeneID:59233884"
                     /translation="MMLQYVTVFDPSRSTNEEDIHKQLLLYHSFTGSETTLQDKLSKI
                     GVIQGIWSLTDSLNDGEKSCEKVIDLDAGVILTIKVESKFFICMSIARNESELAIPHQ
                     LYMSQMWYCYYFFTLNYGKLKNIEDTRKLTASLNEHFVSFWNDIVLRPEVIARRGITG
                     LWPHSCKIAELEFNAEEESWESMVKQSILLETDSYLGIKDILVYHLPSQNSVVEHKKQ
                     IKLGYKTYGLVRHFSPDLEITNELSNWIYHKHAVYDFLSSHVLAGAAHYKEAFEGLDT
                     SHESNNDFTTEAQSTGTQQSQTDFQLNLQKQGKVLLHNLTLPFTFAYDAVQEVSYTAG
                     ISKSMSLFMDYVPKWRKSGSDNPFTDDIDDSNNTNSRYGFLISPLCSQMLPTSYKVKS
                     VKYYDKDTGDRKEYHLLFWYYGDVLAVIVCEPNFSKIWDTQYLQDLSYKLRLSMECFY
                     RTAFKNPEIQGKENKKESFSYVVLKKDDKTIKSSLSPSHDISLQNDSVTPLELVVNGV
                     DQLFGAANTHYYDDSGIRIRGLDMMGGIFGNKNTNKTEGSNNSRDLTNIYEKTYENFV
                     DGLPQDKKWDLQLQILAFLKSFENSQKTRNIIEERLLKLNNGILCYIKENDDNLTVVL
                     KNWYENEESYKSSKSLFMSLGVDVYNWWNSLSQ"
     gene            <387197..>388789
                     /locus_tag="HG535_0A01870"
                     /db_xref="GeneID:59233885"
     mRNA            <387197..>388789
                     /locus_tag="HG535_0A01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286082.1"
                     /db_xref="GeneID:59233885"
     CDS             387197..388789
                     /locus_tag="HG535_0A01870"
                     /inference="similar to AA sequence:RefSeq:NP_015413.1"
                     /note="similar to Saccharomyces cerevisiae SRP54
                     (YPR088C); ancestral locus Anc_3.395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141977.1"
                     /db_xref="GeneID:59233885"
                     /translation="MVLADLGKRINNAVNSALSNTEDDYATTVDVLLKTLVTALLEAD
                     VNIKLVSNLRNNLKETLMGNKGTGKSTSNAQTKKLIQKAVFDELCNLVDCESEQPFQP
                     KKRKTNVIMFVGLQGSGKTTSCTKLAVYYSRRGFKVGLVCADTFRAGAFDQLKQNAIK
                     AHIPFYGSYTETDPVKVAAEGIAKFKKEKFEVIIVDTSGRHHQEQALFQEMVEISNVV
                     KPNQTIMVLDASIGQAAEQQSKAFKESADFGAILLTKMDGHAKGGGAISAVAATNTPI
                     IFIGTGEHIHDLEKFSPKSFISKLLGIGDIESLLEQFQTVSNTDDAKATMENIQQGKF
                     TLLDFKKQMQTIMKMGPLSNIASMIPGMGNMMNEVGEEEASKKMKKMIYVLDSMTKQE
                     LESDGRIFIDAPTRMVRVARGSGTSVFEVEMILMQQQMMARMAQSTRAAQQGGGMPSM
                     PGMPNIPGMPKMSPQMMQQAQQRLKQNPGLMKNMQNMLGGAGGFPGMPGAGGGMPDMN
                     EMMKMMQNPQMQQMAKQFGMSM"
     gene            complement(<388988..>390061)
                     /locus_tag="HG535_0A01880"
                     /db_xref="GeneID:59233886"
     mRNA            complement(<388988..>390061)
                     /locus_tag="HG535_0A01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286083.1"
                     /db_xref="GeneID:59233886"
     CDS             complement(388988..390061)
                     /locus_tag="HG535_0A01880"
                     /inference="similar to AA sequence:RefSeq:NP_015411.1"
                     /note="similar to Saccharomyces cerevisiae SUA7 (YPR086W);
                     ancestral locus Anc_3.394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141978.1"
                     /db_xref="GeneID:59233886"
                     /translation="MSAPAAVLARERNGRRGPNLNIVLTCPECKVYPPKVAERFSEGD
                     IVCALCGLVLSDRLVDTRSEWRTFSNDDQNGDDPSRVGEASNPLLDGNSLSTRIGQGE
                     SGDVRAMRDLNRAQEKNVMDKKDNELQAVFAKITMLCDAAELPKIVKDCAKEAYKLCH
                     DEKTLKGKSTESIMAAAILMGCRRAEVARTFKEIQSIIHVKTKEFFKTLGIMKAILRE
                     KSSDGLIKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTAAEYTAKKCKEIEEIAGKSP
                     ITIAVVSIYLNILLFKLPVSAAKVGQILQVTEGTIKSGYKILYEHREKIVDPQLIANG
                     TVSFDNLPRVDKDRSSKAERKKE"
     gene            <390642..>391973
                     /locus_tag="HG535_0A01890"
                     /db_xref="GeneID:59233887"
     mRNA            <390642..>391973
                     /locus_tag="HG535_0A01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286084.1"
                     /db_xref="GeneID:59233887"
     CDS             390642..391973
                     /locus_tag="HG535_0A01890"
                     /inference="similar to AA sequence:RefSeq:NP_009688.3"
                     /note="similar to Saccharomyces cerevisiae SHE3 (YBR130C);
                     ancestral locus Anc_3.393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141979.1"
                     /db_xref="GeneID:59233887"
                     /translation="MVEFLGESSQGMWKSSQSQLQSPTKIDLQSVSPDGSPPKLGPNH
                     SLFMASIGNSPTRRRLQIDSTAELNSQAGETDMNAGGRSSTRAIESLHQRIDSLTNTN
                     LQLTIQSNSLLEKLENAQQRELKLLESTSSLKHENENLGSMLNRKTRKLKDVEEELYQ
                     IKLEHNAVLEERVKLEAEHKFTDEKARTLESKMEMGCAQYDAIVDSLTHYKTHYKVQI
                     NELREELETLRSEQTQHFDKVCRDSKTLDLKLQDFDYKYENLQQAEDVRLQFFNDQCG
                     DILKQFNLHSWVDLYRESKKMVIAYAERMELDLPKSFTKLIEDPLLVDVESASFQIPG
                     ARSTSDNACSHPLKVPKLRNKSHGSSGNNSHTKRSSFYGGNKQIHNSPLPGTLPGVRR
                     SSSRRVKSSTSDISNSSAESSPIITSSASRNASSPSPRMVQTPSFRKKNDA"
     gene            <392334..>393644
                     /locus_tag="HG535_0A01900"
                     /db_xref="GeneID:59233888"
     mRNA            <392334..>393644
                     /locus_tag="HG535_0A01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286085.1"
                     /db_xref="GeneID:59233888"
     CDS             392334..393644
                     /locus_tag="HG535_0A01900"
                     /inference="similar to AA sequence:RefSeq:NP_015410.2"
                     /note="similar to Saccharomyces cerevisiae YPR085C;
                     ancestral locus Anc_3.391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141980.1"
                     /db_xref="GeneID:59233888"
                     /translation="MDDIRLPSFTLRYHSSDVTALQFIDLRPDRAVPGLLSGDASGQI
                     ALWDVIIRRPLMTQAIEGSSEIVSIQVIDDNLIAILSKDHKMRIFRLLKATTSIIRPQ
                     QGSPKQSSNYELQECYHIPINTLNFANFLVRKLGDSFYRLICCNTQNSESIDIYTFHL
                     SDLHSLCRIHKGINFYDHVKPLAANFDSSKVNKLGIVMKFAQRDEITYCGFESGYIIG
                     FRLCENSDPKNRNENIHGYVANTIEVVYVSAVHYPNPVLDLYAGKHAVLSSSVDDVIG
                     IHQIDVDFKRQQKDRYLSEMNESVVCREDLVLKGDVSRKVPLSQVGHVIEIEDYLILA
                     SWSGNTIVVDSTGMVHMKFLKSKSNVLVNESPQGSLQEDNQLHKKQSSCIKVCSIAGI
                     SKCHLAEDLSTILSLGQRRRIKHFTSACWCLIGYADGSIAVQHL"
     gene            complement(<393712..>395133)
                     /locus_tag="HG535_0A01910"
                     /db_xref="GeneID:59233889"
     mRNA            complement(<393712..>395133)
                     /locus_tag="HG535_0A01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286086.1"
                     /db_xref="GeneID:59233889"
     CDS             complement(393712..395133)
                     /locus_tag="HG535_0A01910"
                     /inference="similar to AA sequence:RefSeq:NP_015409.1"
                     /note="similar to Saccharomyces cerevisiae YPR084W;
                     ancestral locus Anc_3.390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141981.1"
                     /db_xref="GeneID:59233889"
                     /translation="MSNQRPIRLAILGGEATGKSSLISRLTVDIVHEVHYPTRKQANW
                     LFDFTPHSMLAKTLLDGQAHERLMQRTPSSQRVEPIFSSPSVSANVLLSPLVYQSFLN
                     DYTFVKDIHSNRSTNQLKNVDLKGRDTPFYSYLEPDKDLIDSKLHNSITNSNANILRS
                     ISSHSSTAAQSIKSDELPNTNNNYLPPNYSSISIDIIDTPGFKPDMVVPFLEVSLFTK
                     LDKRVLQGLAEGPRQPVSTTSMLTASGASELNGKVDGYVFVYSAVPELNRGADPPGYE
                     SSSASGGKPENASNEDAPNSKRKDSWSSFDKLADGGFSLLEVIRNCILDAWTEYRDYE
                     KRWKLGKEGDVYSLIYSLKSMWKSEKERREKLKQLRSFTTKLNSLNLDPSSPDSPPPC
                     LIVCTHVNDPMASPILIESGKNLGMKWQSGFVAIDSMDDFNVDIALSLIIREIVEKNK
                     LLSHKRSNSFTNSANPIRNLVKS"
     gene            <395363..>396454
                     /locus_tag="HG535_0A01920"
                     /db_xref="GeneID:59233890"
     mRNA            <395363..>396454
                     /locus_tag="HG535_0A01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286087.1"
                     /db_xref="GeneID:59233890"
     CDS             395363..396454
                     /locus_tag="HG535_0A01920"
                     /inference="similar to AA sequence:RefSeq:NP_009686.1"
                     /note="similar to Saccharomyces cerevisiae ATG14
                     (YBR128C); ancestral locus Anc_3.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141982.1"
                     /db_xref="GeneID:59233890"
                     /translation="MNCPICHNSGRPIYCSHCMNTSPNLLVRLRIDLFLLRDMNSKLK
                     NQVERILEYGLKRVEQQGRSESRKSPSEQSKNSEGGVLGKRLLKLDLLRLRKKNNRLR
                     YRISQEQSRITDKKRTKEQIQEQLQLSSGQKARQDNNEAFSEYESIIEETKLQIAQVQ
                     KIVTGMQTLKLKNLIEWFVVRKRDSYEFPYSLAFQPLVSLKNFYKLPTIVAWNSISKM
                     SQYIVLVAKILQFALPFKLGDPSPNFLVDFDDHEEPTINDNGIAEYIAKLVINLLQLS
                     RHLNLLSQEPLDLVWLLDQYDLDTLFYNLISNQIMKARPISHHWTYDRVLAIVSEALQ
                     LSIYASSPASRPTLSGTMANNTDKWYLVG"
     gene            <396772..>398325
                     /locus_tag="HG535_0A01930"
                     /db_xref="GeneID:59233891"
     mRNA            <396772..>398325
                     /locus_tag="HG535_0A01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286088.1"
                     /db_xref="GeneID:59233891"
     CDS             396772..398325
                     /locus_tag="HG535_0A01930"
                     /inference="similar to AA sequence:RefSeq:NP_009685.3"
                     /note="similar to Saccharomyces cerevisiae VMA2 (YBR127C);
                     ancestral locus Anc_3.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141983.1"
                     /db_xref="GeneID:59233891"
                     /translation="MVLSDKELFELNKKAVSQGFKIKPRTTYNTVRGVNGPLVILENV
                     KFPRFNEIVNLTLPDGSVRQGQVLEVRGDRAIVQVFEGTSGIDVKKTTVEFTGENLKI
                     PVSEDTLGRIFDGSGRPIDNGPKVFAEDYLDINGSPINPYARIYPEEMISTGVSAIDT
                     MNAIARGQKIPIFSASGLPHNEIAAQICRQAGLVRPTKDVHDGHEENFSIVFAAMGVN
                     LETARFFKQDFEENGSLERTSLFLNLANDPTIERIITPRLALTTAEYLAYQTERHVLT
                     ILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEGRNGSITQIPI
                     LTMPNDDITHPIPDLTGYITEGQIFVDRQLNNKGIYPPINVLPSLSRLMKSAIGEGMT
                     RKDHGDVSNQLYAKYAIGRDAAAMKAVVGEEALSIEDKLSLEFLEKFEKTFISQSAYE
                     NRTIFESLDQAWSLLRIYPKEMLNRISPKILDEFYDRSRDDNDEDDENENPDKRPGSK
                     KDTPAESLI"
     gene            complement(<398458..>399699)
                     /locus_tag="HG535_0A01940"
                     /db_xref="GeneID:59233892"
     mRNA            complement(<398458..>399699)
                     /locus_tag="HG535_0A01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286089.1"
                     /db_xref="GeneID:59233892"
     CDS             complement(398458..399699)
                     /locus_tag="HG535_0A01940"
                     /inference="similar to AA sequence:RefSeq:NP_015408.1"
                     /note="similar to Saccharomyces cerevisiae MDM36
                     (YPR083W); ancestral locus Anc_3.387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141984.1"
                     /db_xref="GeneID:59233892"
                     /translation="MNQDGDYRDSIISVFKDGNHSVDDAAIRSLIDQQTSNANEVDVK
                     NCELVLNVYIEFLKLEYFIEKTWDIKTLETSVVVKFESYSGGVDDTKTTFSGSKDDDT
                     FYKDVALKCIRNCEKLSGRLTKCLNSLSNARNYIHSAQARLLEDPVTLLLEIWLTCNK
                     KLKLLRNRIAGIFLRSKLLIIDHELETFREHLSDANIISSYRSFIKIFVEQLQDAEIS
                     GDQSMLDECLCVFLDIEAMFNSLHISMLQSQNKSLRDSLLTAEDQDQDHNFDRRDGSP
                     TDFLCDHSRTSSMSTSTDLSCIMERTHLSKELPSLLAAFNNAKRLEQELENVRTVPKH
                     FPLSASASALPPSLSPSNLMGISTEGGLPSTTLFKSKLMMMEQHKNLINQFTPPLSQG
                     KAPLSSSGSGVLSNLYGISRP"
     gene            <400634..>402106
                     /locus_tag="HG535_0A01950"
                     /db_xref="GeneID:59233893"
     mRNA            <400634..>402106
                     /locus_tag="HG535_0A01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286090.1"
                     /db_xref="GeneID:59233893"
     CDS             400634..402106
                     /locus_tag="HG535_0A01950"
                     /inference="similar to AA sequence:RefSeq:NP_009684.1"
                     /note="similar to Saccharomyces cerevisiae TPS1 (YBR126C);
                     ancestral locus Anc_3.386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141985.1"
                     /db_xref="GeneID:59233893"
                     /translation="MNSEETTQIEKDKASPGNIIVVSNRLPVTINKNAETGQYEYKMS
                     SGGLVTALQGLKKTSTFQWYGWPGLEIPDHEKEVVKKDLLEKFNAVPIFLTDEIADLH
                     YNGFSNSILWPLFHYHPGEINFDENAWLAYNEANLTFAKEICKNVHDNDVIWVHDYHL
                     MLLPEMIRDHLTQSKKLQNVKLGWFLHTPFPSSEIYRILPVRQEILKGVLSCNLIGFH
                     TYDYARHFLSAVQRVLNVNTLPNGVEYQGRFVNVGAFPIGIDVDTFTEGLKQEKVKKR
                     IQELKQTFKGCKIIVGVDRLDYIKGVPQKLHAIEVFLNEHPEWIGKVVLVQVAVPSRG
                     DVEEYQYLRLVVNELVGRINGQFGTVEFVPIHFMHKSIPFEELISLYAASDVCLVSST
                     RDGMNLVSYEYIACQEEKKGTLILSEFTGAAQSLNGALIVNPWNTDELSDAINEALTL
                     PDEKKDANWEKLYKYISKYTSAFWGESFVHELFSASNESK"
     gene            <402511..>403683
                     /locus_tag="HG535_0A01960"
                     /db_xref="GeneID:59233894"
     mRNA            <402511..>403683
                     /locus_tag="HG535_0A01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286091.1"
                     /db_xref="GeneID:59233894"
     CDS             402511..403683
                     /locus_tag="HG535_0A01960"
                     /inference="similar to AA sequence:RefSeq:NP_009683.1"
                     /note="similar to Saccharomyces cerevisiae PTC4 (YBR125C);
                     ancestral locus Anc_3.385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141986.1"
                     /db_xref="GeneID:59233894"
                     /translation="MGQLLSHPLTEKYLEYNDYKHVSQDQTSNITSADGNLVPHFYNC
                     VGSMQGYRLTQEDAHLVLNEDKAIHVKFYDPFKNKMEQLKLSIFSLFDGHGGADCSNF
                     LSGGHQHSAKKGIARWIAYSFERHQYGAYLDNDSDSLRPPNSKRAFRTLQGLITQVIK
                     DAFMLQDQELYQHFANSSCGSTAVVAIIINNEFLYVANCGDSRCILSSKNLGIKTMSY
                     DHKPQHIGELLRINDNGGTVSLGRVGGVLALSRAFSDFQFKRGVNYGKNKGHHQNAGI
                     PPQEAQVTAEPDVLMHKIDFTKDEFLVLGCDGIWDIYSNKQLVQFIKYHLTLGVNLPG
                     IITKLLDHGIAQANSNTGVGFDNMTAILVVLNNGGESLQDWYTKMKVRLERERGLQ"
     gene            <403911..>405794
                     /locus_tag="HG535_0A01970"
                     /db_xref="GeneID:59233895"
     mRNA            <403911..>405794
                     /locus_tag="HG535_0A01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286092.1"
                     /db_xref="GeneID:59233895"
     CDS             403911..405794
                     /locus_tag="HG535_0A01970"
                     /inference="similar to AA sequence:RefSeq:NP_009681.3"
                     /note="similar to Saccharomyces cerevisiae TFC1 (YBR123C);
                     ancestral locus Anc_3.384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141987.1"
                     /db_xref="GeneID:59233895"
                     /translation="MDSSEDAELVQLSTLPGTSTAVAKEYTLDIPRIPSVELPLNISE
                     NQASVLKAINMCGGIDKIKEALNEYGETTDSQKGLELYMNESQDNLDYFNEHPIIGKK
                     VPNRDESIVLKIQMPKGTLANHAGNVQKALASLDSRDVRINPVAIINNTIKFREMSDF
                     QIRLDNAPSANEFKDSFGTLDWDSFKKYVNSVPDNDPRPFENISNLVMDRNSVVPSSD
                     FQLPPPPRLSMVSFPLLYRYKTNPFATKKSSGAVEVKGTYIKNHQQFVHEMGDDIKIP
                     TKPHELVAKDYEVAQKNLVWPGTKKESKFFELLQRCLETLHKLFDARPVWVKKHIDGI
                     VDQEVHHTLKIALALISYRFTVGPWRNTYIKLGLDPRSSSEYAKYQTEYFKIERKLLL
                     SSTIRKNIPSPPPAVFNSNNPGDIDSRFKFNGKQIPWYLMLQIDLLVEEPAIKEVYEK
                     AEYLTKANELTGWFTELDLAKIRKIVKYELGCMVQGNYKFNQYKLKYFKTMLYVKESM
                     MKAQGKDADGYIDISGSDTTKKESGQRFAREDSNVEDEDEDNGVETGEVDDTVLEAEE
                     ADDDLRVEVNSDDEGDDIADDSFDVRSATFQEIIKQIAKCDPEKANVLQKTLNGFISE
                     SSL"
     gene            <406041..>406571
                     /locus_tag="HG535_0A01980"
                     /db_xref="GeneID:59233896"
     mRNA            <406041..>406571
                     /locus_tag="HG535_0A01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286093.1"
                     /db_xref="GeneID:59233896"
     CDS             406041..406571
                     /locus_tag="HG535_0A01980"
                     /inference="similar to AA sequence:RefSeq:NP_009680.2"
                     /note="similar to Saccharomyces cerevisiae MRPL36
                     (YBR122C); ancestral locus Anc_3.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141988.1"
                     /db_xref="GeneID:59233896"
                     /translation="MIRTLISIRRASTGAYKGASQISIPRRPLKKIRLGKARPAIYHQ
                     FDVHVELSDGSVIVRKSQFPKDQIRLIQDQRNNPLWNPSRDDLVIVDATAGGSLDKFK
                     QRYSSIFSIEEDPKTPDNETAMKTKSEIPSKGEENAEIATEDTALEIDDYLSLLDDSS
                     KQISTGKLATKKKPKK"
     gene            <406722..>407249
                     /locus_tag="HG535_0A01990"
                     /db_xref="GeneID:59233897"
     mRNA            <406722..>407249
                     /locus_tag="HG535_0A01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286094.1"
                     /db_xref="GeneID:59233897"
     CDS             406722..407249
                     /locus_tag="HG535_0A01990"
                     /inference="similar to AA sequence:RefSeq:NP_015407.1"
                     /note="similar to Saccharomyces cerevisiae DIB1 (YPR082C);
                     ancestral locus Anc_3.382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141989.1"
                     /db_xref="GeneID:59233897"
                     /translation="MTSKNGHDVFFLISTCICVHDRTDTYIPVATKSMGSVFLPHLHT
                     GWHVDQAIVTETERIVVIRFGRDWDKQCMIMDELLYSIAEKVKNFAAIYLCDIDEVPD
                     FNEMYELQDPLTVMFFYQNKHMMCDFGTGNNNKMNFLVDDKQEMIDILETIFRGARKN
                     KGLVISPYDYNHKRV"
     gene            <407679..>409670
                     /locus_tag="HG535_0A02000"
                     /db_xref="GeneID:59233898"
     mRNA            <407679..>409670
                     /locus_tag="HG535_0A02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286095.1"
                     /db_xref="GeneID:59233898"
     CDS             407679..409670
                     /locus_tag="HG535_0A02000"
                     /inference="similar to AA sequence:RefSeq:NP_009679.2"
                     /note="similar to Saccharomyces cerevisiae GRS1 (YBR121C)
                     and GRS2 (YPR081C); ancestral locus Anc_3.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141990.1"
                     /db_xref="GeneID:59233898"
                     /translation="MSAAEIKMVRSTAEINRENLEAVLRGRFFYAPAFDLYGGVSGLY
                     DYGPPGCAFQANVIDVWRKHFILEEDMLEVDCTMLTPFEVLKTSGHVDKFSDWMCRDF
                     NTGEIFRADHLVEEVLEARLKGDKEARGLLEDANASAQEDNNKKKRKNKVKQIKAVKL
                     EDDVVKEYEEILAKIDGYSGEELGQLMEKYNVGNPVTGESLEAPRAFNLMFETAIGPS
                     GQLRGFLRPETAQGQFLNFNKLLEFNNSKTPFASASIGKSFRNEISPRAGLLRVREFL
                     MAEIEHFLDPEDKSHPRFAEVKDTKLSFLPREVQQAGSTEPIVMSIGEAVKTKLVDNE
                     TLGYFIARIAKFLLTIGVDETKMRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCA
                     DRSAYDLTVHSNKTKQKLVVRQKLDTPVEVKKWEIDLTKKLFGPKFRKDAPKVEAYLL
                     NLSQAELKAKSEELKANEKIIFQVDGIEGNLELDGNFITIEERTKTEHVREFVPNVIE
                     PSFGIGRIIYSVFEHSFWNRPEDTARSVLSFPPLVAPSKVLLVPLSNHKDLAPITAQI
                     SKLLRAEKIPFKVDDSGVSIGKRYARNDELGTPFGITIDFASIKDGSVTLRERDSTKQ
                     VRGSATDIIGAIREITYNGVSWDEGTKDLAPFVSQSETV"
     gene            <410411..>411115
                     /locus_tag="HG535_0A02010"
                     /db_xref="GeneID:59233899"
     mRNA            <410411..>411115
                     /locus_tag="HG535_0A02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286096.1"
                     /db_xref="GeneID:59233899"
     CDS             410411..411115
                     /locus_tag="HG535_0A02010"
                     /note="WHO gene family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141991.1"
                     /db_xref="GeneID:59233899"
                     /translation="MRPWLAEYVQRDITDKELIAMAWMIGFWLGDGHRSGAVFSLNST
                     DADLNQFLKEQAELWGMTYRYVKQIEPVGNLCANAYLHTYTNGIRNLNKANPLVDTLK
                     GLKFYAAGVIKRPKNFPDFVQTEEIIVREALLAGLLDADGSTSIYRSQISMRIATVYP
                     PLRDGAMLAARSLGLNVSVSHAAAKSFETYNAQEVWNLFITPGSNIERFFGIIDRCGL
                     ERRRDMPVYPKKKTDA"
     gene            complement(<411292..>413454)
                     /locus_tag="HG535_0A02020"
                     /db_xref="GeneID:59233900"
     mRNA            complement(<411292..>413454)
                     /locus_tag="HG535_0A02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286097.1"
                     /db_xref="GeneID:59233900"
     CDS             complement(411292..413454)
                     /locus_tag="HG535_0A02020"
                     /note="similar to Saccharomyces cerevisiae DUR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141992.1"
                     /db_xref="GeneID:59233900"
                     /translation="MPGTLNIPLPQGAGYAIVVGLGMVFSVGMILTTFVLRRYQKEII
                     TSEEFSTAGRSVKTGLISAAVVSSWTWAATLLQSSTQAYRNGISGPFFYAAGATCQII
                     LFAFIAIKAKQKAPEAHTYLEIVKARYGSAAHGVFIFFAFATNVLVSAMLLTGGSASI
                     SDVTGMNTVACIFLLPVGVMVYTLFGGIKATFLTDYVHTIAIVVIILTFAFTTYATSD
                     VLGSPGRVWELITQAAIDHPVEGNAEGSYLTMHSRSGGIFFVINIVGNFGTVGLDNGY
                     WNKAIAASPAAALPGYILGGLAWFAIPWLTATTMGLACLALESTPAFPTYPNRLTPDQ
                     VSAGLALPSAAVALMGKGGAVATLFMIFMAVTSAMSAEFIAVSSIFTYDIYKGYVNPK
                     ASGKRLILMSHASMVVFSLAMSGFATGLYYAGISMGYLYELMGIIISAAVFPVALTLL
                     SKRQNTIAAIWSPILGTGLAIMSWLACTKGMYGSITVANTFEDDPMLVGNVVALLSPC
                     IFSPLLTLIFKSQNFDWEILKSIKRVDEFEELEDVIEPRSSILMENSANEENSSNTEK
                     LNPITSQVSEVVNHLVDERRVMEMKEEEEHLRKASKYAGYLCLFLSIAMLVVWPMPMY
                     GSSYIFSRKFFTGWVVVAIIWMFFTGFAVIIFPLYEGRNGIYTTFRGIYWDCTGQTHK
                     LREWQNEHPEELHVVQSQLSAEVRRRAANIDDNLGDAP"
     gene            <414262..>414810
                     /locus_tag="HG535_0A02030"
                     /db_xref="GeneID:59233901"
     mRNA            <414262..>414810
                     /locus_tag="HG535_0A02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286098.1"
                     /db_xref="GeneID:59233901"
     CDS             414262..414810
                     /locus_tag="HG535_0A02030"
                     /inference="similar to AA sequence:RefSeq:NP_009678.3"
                     /note="similar to Saccharomyces cerevisiae CBP6 (YBR120C);
                     ancestral locus Anc_3.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141993.1"
                     /db_xref="GeneID:59233901"
                     /translation="MTCNDLNTEFKVTQCRLNIFEGRMSSQGVREAAKSLVKALERFP
                     NERIKHLVSFKQSQMERFNRVAGLQIGQSKDASDSKVSLDDIKDIINRTSAPLGLQKN
                     LLKKMQSAMVNEDLTEQSIKEQISALNTLTTDKYKQYYDVSDKLYKPQGNPQYYKRIL
                     DEIEGKKKETFMTALRTVILGK"
     gene            complement(<414854..>415738)
                     /locus_tag="HG535_0A02040"
                     /db_xref="GeneID:59233902"
     mRNA            complement(<414854..>415738)
                     /locus_tag="HG535_0A02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286099.1"
                     /db_xref="GeneID:59233902"
     CDS             complement(414854..415738)
                     /locus_tag="HG535_0A02040"
                     /inference="similar to AA sequence:RefSeq:NP_009677.1"
                     /note="similar to Saccharomyces cerevisiae MUD1 (YBR119W);
                     ancestral locus Anc_3.379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141994.1"
                     /db_xref="GeneID:59233902"
                     /translation="MHDLKTLYLQNIPSRPRSKANFTRLLLKHLNPKNEYVKNPRLPL
                     PKNETVGNSKLQLLDTTNNIVAVSLSRSLKLRNQCFITFINHAAAQRFVETFGSKLMI
                     GGRKIDIHFSNKDSLLGLALEDGAALDRALKTKQLKRKLASDSTKREQHLLKRRLRRL
                     RFNLRSKGLDENTIGQICEAVKATKKQNITAKSISRNKVTNRKLGQGTTKLPASATSA
                     NPPNKILLIQNLPPDTTTEALKDVFQGENLVEIRLVNVRRVAFVEYQQIDDAKSIKDS
                     LGDTCRFQNSDISIGFAK"
     gene            complement(<415972..>417348)
                     /locus_tag="HG535_0A02050"
                     /db_xref="GeneID:59233903"
     mRNA            complement(<415972..>417348)
                     /locus_tag="HG535_0A02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286100.1"
                     /db_xref="GeneID:59233903"
     CDS             complement(415972..417348)
                     /locus_tag="HG535_0A02050"
                     /inference="similar to AA sequence:RefSeq:NP_009676.1"
                     /note="similar to Saccharomyces cerevisiae TEF2 (YBR118W)
                     and TEF1 (YPR080W); ancestral locus Anc_3.378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141995.1"
                     /db_xref="GeneID:59233903"
                     /translation="MGKGKSHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK
                     EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYEVTVIDAPGHRDFIKNM
                     ITGTSQADCAVLIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKW
                     DESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEPTTNASWYKGWEKETKA
                     GVVKGKTLLEAIDSIEPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV
                     TFAPAGVTTEVKSVEMHHEQLEAGMPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKA
                     TESFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKIEDAPKFI
                     KSGDAALVKFIPSKPMCVEAFSDYPPLGRFAVRDMRQTVAVGVIKSVVKTDKAAKVTK
                     AAQKAVKK"
     gene            complement(<417478..>417954)
                     /locus_tag="HG535_0A02060"
                     /db_xref="GeneID:59233904"
     mRNA            complement(<417478..>417954)
                     /locus_tag="HG535_0A02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286101.1"
                     /db_xref="GeneID:59233904"
     CDS             complement(417478..417954)
                     /locus_tag="HG535_0A02060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141996.1"
                     /db_xref="GeneID:59233904"
                     /translation="MHPKGYCPKTFPSQPICLDCWCKPVHPLASSLWHPCTRLANYFP
                     SFPPILAISFCHRQRKKTNLTSKTQKMKNLSIRKARKRKKINWQIRKRSRTWCRNPDP
                     TPMTHAFSSLFTFSIVEKFFSLSASPKFLEKRREKKKQGPYKEGFKFLILKMVCWI"
     gene            complement(<418085..>419311)
                     /locus_tag="HG535_0A02070"
                     /db_xref="GeneID:59233905"
     mRNA            complement(<418085..>419311)
                     /locus_tag="HG535_0A02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286102.1"
                     /db_xref="GeneID:59233905"
     CDS             complement(418085..419311)
                     /locus_tag="HG535_0A02070"
                     /inference="similar to AA sequence:RefSeq:NP_015404.1"
                     /note="similar to Saccharomyces cerevisiae MRL1 (YPR079W);
                     ancestral locus Anc_3.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141997.1"
                     /db_xref="GeneID:59233905"
                     /translation="MATLRVLRQNGRSNPAPIMISSKKSVAIVSTLIICFGAVAYFHS
                     FHTTSTETTRSTIGKLNGKGDESNIERDDKDENEDDLFCAVFNPLSGTYIDLSQLSST
                     PNKPLVDDGKKGSNTGSTKNPPKSRWMIRGWDYDTNFTLGICSSPVTAQEEPQLDNHT
                     GGFYTDPKDESKLVSIGDFATKPKVSGNRKLTLQYHNGSMCPNKVDRKSTLLYFVCDK
                     EISAKAQMTYIGNLHECSYFFEVRSIYACPTTNKSKEVNVLGIFVGIFAVFFIVEYGG
                     RRWLYGKMKTHFNSSGLASSSSGLSSLSPSQGLNLSNERSFRPRWEYIEREPKWKSIF
                     KTLGNLLTTGLRAPRKYVKPTLGAGGPIRLSSQSTRGHDSFLQDMEQQNNILDSLEVA
                     TSDSNSTIDSTTRRLD"
     gene            <420595..>421209
                     /locus_tag="HG535_0A02080"
                     /db_xref="GeneID:59233906"
     mRNA            <420595..>421209
                     /locus_tag="HG535_0A02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286103.1"
                     /db_xref="GeneID:59233906"
     CDS             420595..421209
                     /locus_tag="HG535_0A02080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141998.1"
                     /db_xref="GeneID:59233906"
                     /translation="MKFSSFLLAAVVSVAVAVRFDIKNATCTNLHGRHCGTYALRVVG
                     TNDTFLGVSTFVGSEALSGGAEYSWDQYLNQKPGFLTRLTTVGTNETANFKPITMTTT
                     RPNCNVQSIDTGMIAFANTVTNEISFNDWAYTAFNSSVPTALANQLMNSTSVGVQCAQ
                     CWPGFTSTLLSTPTVNIFSSDDILPPWCSEIEFEPVCPAEAGFA"
     gene            <421712..>422236
                     /locus_tag="HG535_0A02090"
                     /db_xref="GeneID:59233907"
     mRNA            <421712..>422236
                     /locus_tag="HG535_0A02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286104.1"
                     /db_xref="GeneID:59233907"
     CDS             421712..422236
                     /locus_tag="HG535_0A02090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141999.1"
                     /db_xref="GeneID:59233907"
                     /translation="MGQNTDFYKKNIITTYMSAFALNSYPTSPNQKNKIHEEDEFLFM
                     FEEDNCNDSYAKCVQNYANENEKLQLLVNHGGPKRKNTTRHSEIDQDKACPRTCKGSL
                     RLLSDQEFLCEDICSIEDIDRSKRVIEKKQEEYHKWRCWFLDWKNREIVQNEDKTTIE
                     REETLEKITTNLMH"
     gene            424581..424652
                     /locus_tag="HG535_0Atrna1E"
                     /db_xref="GeneID:59234612"
     tRNA            424581..424652
                     /locus_tag="HG535_0Atrna1E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:59234612"
     gene            complement(<426432..>427175)
                     /locus_tag="HG535_0A02100"
                     /db_xref="GeneID:59233908"
     mRNA            complement(<426432..>427175)
                     /locus_tag="HG535_0A02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286105.1"
                     /db_xref="GeneID:59233908"
     CDS             complement(426432..427175)
                     /locus_tag="HG535_0A02100"
                     /note="ancestral locus Anc_3.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142000.1"
                     /db_xref="GeneID:59233908"
                     /translation="MGLKFTQSPVKKEDLPSDKNEIIKFSELMTEDVEKKWKKGKLYK
                     FQGKKDRKFQVQTYSTTKGTDFWLSRVSKHKIDTALYDKVVYYLNGSERTEDNQWSMK
                     DRTKRSKLEKEYIEVLDKVDIIEKLENGWNLVHIEYDLGKPLTIRDFNEWVYPVEPYT
                     NDQGKEVSMIISLNAGHLDKSLTTNHTPAYYVSVEKLEYDYNTNELLWLMVTTNDAGG
                     NVPKWLQNATIAKTVSKDVPFLFDYIESH"
     gene            <427532..>428815
                     /locus_tag="HG535_0A02110"
                     /db_xref="GeneID:59233909"
     mRNA            <427532..>428815
                     /locus_tag="HG535_0A02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286106.1"
                     /db_xref="GeneID:59233909"
     CDS             427532..428815
                     /locus_tag="HG535_0A02110"
                     /inference="similar to AA sequence:RefSeq:NP_015400.1"
                     /note="similar to Saccharomyces cerevisiae OPY2 (YPR075C);
                     ancestral locus Anc_3.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142001.1"
                     /db_xref="GeneID:59233909"
                     /translation="MSSARSSLIATSTVSSTSPSSSGAYVDCGPPPACPQCASGEICV
                     MTELTRTQCSTTICIRNSSSGGSQSSRSNSRLIGGVVGGVVGGVAVLVALLLFFLYHR
                     FWKGKLRERSDRLNSNRSVYHDEGLFEDDDYDDEDDEDDEDDEDSEEGIRGRTENNHA
                     NYKRPMMDTASNVGDRNSTVTIQTRASNILPIAYIPGVTNGSGTMSGSGSGGLSSRLF
                     RGLNTSNLHSVGDMRSHITLGSSILGGLDDDDEEPEKTEKTIPLGSSANEKTSENLTT
                     AIRAKPKLVQIAEEDGDDERKAENPVQDFELSEKQPEDSLASESKEDRLSSTQLLDEV
                     EQADDGHKQEQGHNNSDDNDRHTLDTIEIAAEEGDDDDDDDDDDDGSFILDLTIPDSI
                     HHKPSINTSTVDDHHNQDEDSGSPFEDKFRIDVDL"
     gene            <431376..>433418
                     /locus_tag="HG535_0A02120"
                     /db_xref="GeneID:59233910"
     mRNA            <431376..>433418
                     /locus_tag="HG535_0A02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286107.1"
                     /db_xref="GeneID:59233910"
     CDS             431376..433418
                     /locus_tag="HG535_0A02120"
                     /inference="similar to AA sequence:RefSeq:NP_009675.3"
                     /note="similar to Saccharomyces cerevisiae TKL2 (YBR117C)
                     and TKL1 (YPR074C); ancestral locus Anc_3.372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142002.1"
                     /db_xref="GeneID:59233910"
                     /translation="MTTFSDIDRLAISTMRLLAVDAVSKANSGHPGAPLGMAPAAHVL
                     LRNMRMNPKNPGWINRDRFVLSNGHACALLYSMLHLTGYDFSIEDLKSFRQLHSKTPG
                     HPEFELPGVEVTTGPLGQGVCNAVGIAIAQANFAATYNKPEFTLSDSYTYVFLGDGCL
                     QEGVSSEASSLAGHLQLGNLVAIYDDNKITIDGDTKVSFDEDVLKRYEAYGWEVLTVN
                     KGDDDLASIDAAIKQAQKSKDKPTIIKLTTIIGYGSLNEGSHSVHGSPLKADDVKQLK
                     KKFGFDPEQSFVVPQEVYDFYQKSVAQPGAELNAKWDQLFSSFQKRYPEVGKELVRRL
                     SGKLPENWDEKLPRYTPKDSAVATRKLSEMVFEDIYAELPELIGGSADLTPSNLTRWN
                     EAVDFQPTNSGIGNYAGRYIRYGIREHGMGAIMNGISAFGANYKPYGGTFLNFVSYAA
                     GAVRLSALSGHPVIWVATHDSIGLGEDGPTHQPIETLAHFRALPNTSVWRPADGNEVS
                     AAYKSALESKHTPHIIALSRQNLPQLKGSTVENALKGGYVLQEVSNPDIILIGTGSEV
                     SLCVEAAQLLAAKNIKTRIVSMPDTLTFDKQPTEYRLSVLPDRVPIMSVEVLSTAGWS
                     KYAHQSFGLHTFGASGKASDVFKYFDFVPEGVASRAEKTIAFYKGKEVDSPLKTAF"
     gene            <433615..>434103
                     /locus_tag="HG535_0A02130"
                     /db_xref="GeneID:59233911"
     mRNA            <433615..>434103
                     /locus_tag="HG535_0A02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286108.1"
                     /db_xref="GeneID:59233911"
     CDS             433615..434103
                     /locus_tag="HG535_0A02130"
                     /inference="similar to AA sequence:RefSeq:NP_015398.1"
                     /note="similar to Saccharomyces cerevisiae LTP1 (YPR073C);
                     ancestral locus Anc_3.371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142003.1"
                     /db_xref="GeneID:59233911"
                     /translation="MTNKEQHPISVAFVCLGNICRSPMAEAVFQNVVRQKNLEDRFHV
                     IDSFGTGGWHCGENPDSRSAATCKFHNVPINHKAQQIKGNHFDKFDYIICMDESNLRN
                     LKRLQPKGSKAKLFLFGNWNTDGKFNKIVDDPYYGGNEGFEYNFKQISYFSEEFLKNE
                     LL"
     gene            complement(<434204..>435976)
                     /locus_tag="HG535_0A02140"
                     /db_xref="GeneID:59233912"
     mRNA            complement(<434204..>435976)
                     /locus_tag="HG535_0A02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286109.1"
                     /db_xref="GeneID:59233912"
     CDS             complement(434204..435976)
                     /locus_tag="HG535_0A02140"
                     /inference="similar to AA sequence:RefSeq:NP_015397.1"
                     /note="similar to Saccharomyces cerevisiae NOT5 (YPR072W);
                     ancestral locus Anc_3.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142004.1"
                     /db_xref="GeneID:59233912"
                     /translation="MSQRKLQQDIDKLLKKVKEGLLDFETVYEKFQSTNSENTSYREK
                     LESDLKREIKKLQKHRDQIKTWLSKEDVKDRQTVLTENRRLIENGMERFKSVEKLMKT
                     KQFSTEALTNPDIIKDPRELRKREQFVFIQECLEELQKQIEGYEAQEDEEQVERHEFH
                     IHNLENILKLLQNNEMEPETVQDYQEDIKYYVENNDDPDFIEYDTIYEDMGCESTPGS
                     DENRENVASGTSDSQIASTNATSSPSAHTITAKIAKRQERSPRKRAQQPTDTPSAVTT
                     PIHGTPTPVSLQQSPTPESSTTLSQHAHTNGTTNSTDNNINHTNEIGNSHKKKDMNPT
                     QQEVLYPQDKTEEINEQIERMLSENAAFKNPLFKDDLKYWLQSKRPLMQPYKKMPDRM
                     KAQLESSLLNCPDSLDADSPHFYRKPLSLPHPTSIFFPSEPIRFVYPIDNVNPISVQE
                     QQQQEQQQSPVKEQSSLNKPDDKRTEDKNIGSDENEDVYSRTSLARIFSKFDLDTLFF
                     IFYHYQGTYEQFLAARELAKNRKWRFNKKDRRWYYKEVEKSPPGMPQGEEESWRYFDY
                     QRSWLARRCNSEIVPTEEDFEKLF"
     gene            <437726..>441880
                     /locus_tag="HG535_0A02150"
                     /db_xref="GeneID:59233913"
     mRNA            <437726..>441880
                     /locus_tag="HG535_0A02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286110.1"
                     /db_xref="GeneID:59233913"
     CDS             437726..441880
                     /locus_tag="HG535_0A02150"
                     /inference="similar to AA sequence:RefSeq:NP_009673.1"
                     /note="similar to Saccharomyces cerevisiae LYS2 (YBR115C);
                     ancestral locus Anc_3.369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142005.1"
                     /db_xref="GeneID:59233913"
                     /translation="MDDQGWIERLDNPTLSVLPQDFLRPQQAPFVEQDVYSISLPQLD
                     AVSSSRNPYLVTLTVWAALLYRFTGDDDIVLYIDGNKVLRFTIQPSVSFQELFDLIRK
                     EVDSLPGSQELSFDELSETIRKANDLERCPQLFRLGVVSNKFDFKLDNFKHHPMDLAL
                     NVEQKEGFTSLQIIYNKFLYSPERISILADQITQFITRVVEEPSVCITKVSLITEKSS
                     QALPDPTANLGWCDFVGCIHDIFQDNAEKFPERSCVVETPPFNSTKTRHFTYQDINRA
                     SNIVAHYLIDTGIKTGDVVMIYSSRGVDLMVSVMGVLKAGATFSVIDPAYPPARQTVY
                     LGVAKPKGLIVIRTAGELDQLVEDYISKTLDIITRVPSIAIQDDATLQGSVDPQKDIF
                     EPYEHLKDTRTNVIVGPDSNPTLSFTSGSEGLPKGVLGRHFSLAYYFKWMSKQFNLSE
                     HDKFTMLSGIAHDPIQRDMFTPLFLGAQLYVPTQDDIGTPGRLAEWMGKYGCTVTHLT
                     PAMGHLLTAEATTLFPELHHAFFVGDILTKRDCLRLQTLAENCNIVNMYGTTETQRAV
                     SYFEVQSRSKDAKFLKKAKDVMPAGKGMLNVQLLIVNRYDSAQVCGIGEIGEIYVRAG
                     GLAEGYRGLPDLNKEKFVNNWFVDKDHWKYLDVDKKEPWRKYWFGPRDRLYRTGDLGR
                     YLPDGNAECCGRADDQVKIRGFRIELGEIDTNISQHPLLRENITLVRKNADNEPTLIT
                     FLVPRFDKPKELSKFQSEIPAEVESDPIVKGLVGYHLLAKDIKEFLKKRLASYAIPSL
                     LVVLDKLPLNPNGKVDKPKLQFPSPKQLELVAANSKSEIDDSAFTPAEREIRDLWLSV
                     LPTKPASVSPDDSFFDLGGHSILATRMIFSLKKNLNIDLPLGIIYKFPTIKAFAAEVS
                     RIKNSETSSKDFVEVFDYAKDAKDLVKALPSTYASREPFVKPSIASGNNITINAFVTG
                     ATGFLGSYILADLLTRQIPFCDIKVFAHVRAKDEKAGMERLEKAGITYGTWSHKFMSR
                     VEVVLGDLSKPQFGLNSEKWDRLTNEIDIIIHNGALVHWVFPYIKLRDANVVSSINVM
                     NLAATGKAKFFNFVSSTSTLDTENYFSLSDKLVAEGKPGIPESDELMGSATGLTGGYG
                     QSKWAAEYIIRHAGERGLRGCIVRPGYVTGASTNGSCNTDDFLLRLLKGCAQIGKIPN
                     INNSVNMVPVDHVARVVVASAINPPMENEFTVAQVTAHPRISLKDYLYQLKEYGYDVE
                     IVDYESWGKFLEKSVEEGKDNALYPLLHMVLENLPAGTRAPELDDSNAVLSLKKDIEW
                     SGEDVSCGKGGTPEQIAIYIAFLRKVGFLSAPSGGKVLPKITITQEQLDLVASGAGAR
                     SSSATN"
     gene            complement(<441998..>444337)
                     /locus_tag="HG535_0A02160"
                     /db_xref="GeneID:59233914"
     mRNA            complement(<441998..>444337)
                     /locus_tag="HG535_0A02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286111.1"
                     /db_xref="GeneID:59233914"
     CDS             complement(441998..444337)
                     /locus_tag="HG535_0A02160"
                     /inference="similar to AA sequence:RefSeq:NP_009672.1"
                     /note="similar to Saccharomyces cerevisiae RAD16
                     (YBR114W); ancestral locus Anc_3.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142006.1"
                     /db_xref="GeneID:59233914"
                     /translation="MVEDGGFIRPRRTRRQRKKVDYVEMSDGGERSQNEDDDDYKGDI
                     VDLTQQDGSIIKGEPADMGGAAGADETEILKADADEGEGDGDEEDEDDDEPLSKRRKT
                     TAKKRAPRKPAKKKRKTDDEKKTDRYNRNTERLYGWHPELRSVFSNLKEAPCYVAKRA
                     TQPKGMSIKLLPFQLEGLRWLINQEASKYNGGILSDEMGMGKTIQTIALLMNDLAKRP
                     SLVVAPTVALIQWKNEIDQHTNGALKTYIYHGASRTNDYGDLGDIDVILTTYSVLESV
                     FRKQNYGFRRKNGMVKEKSLLHHIDFHRVILDEAHNIKDRQSNTARAVNSLKSLKRWC
                     LTGTPLQNRIGEMYSLIRFLDVEPFANYYCTSCDCKSKEWKFSDNMHCDHCGHVIMQH
                     RNFFNHFMLKNIQQFGATGLGLESLNNIQLLLKHLMLRRTKVERADDLGLPPRIVTVR
                     KDYFNEHEKDLYKSLYMDVRRKYNSYVEEGVVLNNYANIFTLITRMRQLADHPDLVLK
                     RLNDKNGNESTDNGVIICQLCDDEAEEPIESKCHHKFCRLCIKEYVESFMEEEKRLTC
                     PVCHIGLSIDLSQPALEVDLDLFKKQSIVSRLNMKGNWKSSTKIEALVEELYSLRSDK
                     KTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDETINYFMNNIHCEVFL
                     VSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIE
                     SRIIELQEKKANMINATINQDEAAINRLTPADLQFLFNN"
     gene            <446370..>449906
                     /locus_tag="HG535_0A02170"
                     /db_xref="GeneID:59233915"
     mRNA            <446370..>449906
                     /locus_tag="HG535_0A02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286112.1"
                     /db_xref="GeneID:59233915"
     CDS             446370..449906
                     /locus_tag="HG535_0A02170"
                     /inference="similar to AA sequence:RefSeq:NP_009670.3"
                     /note="similar to Saccharomyces cerevisiae CYC8 (YBR112C);
                     ancestral locus Anc_3.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142007.1"
                     /db_xref="GeneID:59233915"
                     /translation="MLAAPGGQQKLQSQPAQAGQQQTHSPQTEGPVAEAAQQALTQTP
                     QQQQQQQQQAQQQPTDPLMQSTAETWLSIASLAETLGDADRAAMAYDATLQYNQSSIK
                     ALTSLAHLYRSRDMFQRGVELYERALAVNPELSDVWATLGHCYLMLDDLQRAYNAYQQ
                     ALYHLSNPNVPKLWHGIGILYDRYGSLEYAEEAFAKVLELDPQFEKANEIYFRLGIIY
                     KHQGKWNQALECFRYILPQPPAPLQEWDIWFQLGSVLENMGEWQGAKEAYEHVLLQND
                     HHAKVLQQLGCLYGMNNVQFHDPQKALNLLLKSLEVDPSDATTWYHLGRVHMIRSDYT
                     AAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLG
                     TLYETCNNQLNDALDAYKQAARLDPENIHIRERLEALTQQLSNPNNNSSMAKNTTVSP
                     DGTVTLQQQGPPPIMLQPTLQSNDQSNPLNIRPPATALYSNGSLGQSQAQQLQAQAQA
                     QAQAQAQAQAHAQAQAHAQAQAQAQAQAQAQAQAHAQAQAHAQAQAQAQAQAQAQAHA
                     QAQQYQAQAQAQAQAHAHAQAQAQAQAQAQAQAQAHAHAQAQAQAQAQAQAQAQAQAQ
                     AQAQAQAQAQAHAQAQAHAQHQRIPGHLMNMPQQHSYGPMSITQPTPPSSTILPLPTQ
                     QQSPQNRQVSSSGHEPHNFSNQQMLQPLPQSALVSNAVESANPMGPIVPQKRHMDGSI
                     HTLVNAAVSSYSGEDPNSNARTDSDKNNNDGSLSESAQVPTLPASQKVQNTNIEPQQK
                     KLKIKKSPKIPAPNLKIKSTTLKDKEKERLARSAKNNQANNTIGENSNGFSASPINPY
                     NLNKENKIDGPGESALPVAKEVEGNKNVIPSVTSINEKGSSGNGSMNSPSMSKDQLSA
                     LPEETSDKVSSSSYPFKIPNNNGRGKATESSNQNDPRTASVGPTDKEIEKSTQQALED
                     AIRRQRLSSSTIETASTVTNPDSVDHTTEDKKSSQTTEIRTSPIEQRPNDLSPLVQRP
                     PLQNERTLSKSTTSSGDAQTQDESFRSSDASINTIDAAASDVEKNKKTDADIEAEVQR
                     QAEIQADPRDDLMKVDSEVVTNANKTEPETVIKPSAEAMERLQEAAKLREEEERERLE
                     QEQLNKKTQPDDNSLTRSSIVRQIEEDENYDE"
     gene            complement(<450070..>450517)
                     /locus_tag="HG535_0A02180"
                     /db_xref="GeneID:59233916"
     mRNA            complement(join(<450070..450149,450226..450365,
                     450429..>450517))
                     /locus_tag="HG535_0A02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286113.1"
                     /db_xref="GeneID:59233916"
     CDS             complement(join(450070..450149,450226..450365,
                     450429..450517))
                     /locus_tag="HG535_0A02180"
                     /inference="similar to AA sequence:RefSeq:NP_878049.2"
                     /note="similar to Saccharomyces cerevisiae SUS1 (YBR111W-
                     A); ancestral locus Anc_3.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142008.1"
                     /db_xref="GeneID:59233916"
                     /translation="MSEATTENGGSSDLKAQIQRYLVASGNYEKISDKLGERLLQDGW
                     VDEVRRLITAEIRATNSTNFSQILSKIEPEALDLVSTPTKEEVLEQIRVFLNEIVGTE
                     "
     gene            <451273..>451971
                     /locus_tag="HG535_0A02190"
                     /db_xref="GeneID:59233917"
     mRNA            <451273..>451971
                     /locus_tag="HG535_0A02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286114.1"
                     /db_xref="GeneID:59233917"
     CDS             451273..451971
                     /locus_tag="HG535_0A02190"
                     /inference="similar to AA sequence:RefSeq:NP_009669.1"
                     /note="similar to Saccharomyces cerevisiae YSA1 (YBR111C);
                     ancestral locus Anc_3.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142009.1"
                     /db_xref="GeneID:59233917"
                     /translation="MFLRPILTKQSLKIEYRVLFTMSPQLKGKPELAKILSSRPAKAD
                     ECKWIGLEKISYADPNGKQRDWDSAIRLTRSNGGVDGVGILVILKYKDGTPNEILLQK
                     QFRPPVGGVCIEMPAGLIDGDESIETAALRELKEETGYVGKIVQQSPVAFNDPGFTNT
                     NLSLVTVEVDMTAEENKNPKSKLEENEFIECFKVPLTDFAEQMIALDKEGYKLDARVQ
                     NVAEGIQLAQKYRL"
     gene            complement(452073..452154)
                     /locus_tag="HG535_0Atrna1S"
                     /db_xref="GeneID:59234618"
     tRNA            complement(452073..452154)
                     /locus_tag="HG535_0Atrna1S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCA"
                     /db_xref="GeneID:59234618"
     gene            complement(<453300..>454874)
                     /locus_tag="HG535_0A02200"
                     /db_xref="GeneID:59233918"
     mRNA            complement(<453300..>454874)
                     /locus_tag="HG535_0A02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286115.1"
                     /db_xref="GeneID:59233918"
     CDS             complement(453300..454874)
                     /locus_tag="HG535_0A02200"
                     /inference="similar to AA sequence:RefSeq:NP_015395.1"
                     /note="similar to Saccharomyces cerevisiae MED1 (YPR070W);
                     ancestral locus Anc_3.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142010.1"
                     /db_xref="GeneID:59233918"
                     /translation="MKLSVVRGNNDHTSGQTSIAMEADTYNEQLGDMIELFQEYKSGS
                     VTLENITKLCQTLGLESFIDDIDAQTARLSTASKIIVIDIDFSKHQKKVTDVKLVLAS
                     NFDNFDYFIDDQHSSSPSNNILLNSLTQYPDLHEFHSNLKFLHLLDNFSNVDIDPTNT
                     SSSNNFGSNNSSNENGGCSGKLDLFKYYTELASFIQQDFSHNGAPFTVATNLGNSFGI
                     YILNENQKVLARIYLEKSRDPKHRLYEFVFAEEKMDWINLSSENYTCGVSLVAEILSQ
                     EDLFPQNFILYDSMVVNYKMVSDAHSGIQETGKLNDWISENKYNIKINDKLQIMNDFT
                     TKLIKVKVFDISNDNIDILRDILNWIQWSETVLKQLHSLLFPSVSMSDDEKNDILGGN
                     LPGMSTSTRGRRRSSVDQKRRKHPNKIRRPSATESVMLKDEGLQQFNLHEIMTDSSSD
                     LKSIAGTSKRDASSTDQDVKMDLDPNNLSVEESTHLLQLVISEDSISLNKIANCSLYE
                     DPKNWKTFMDILKIHI"
     gene            <455364..>456251
                     /locus_tag="HG535_0A02210"
                     /db_xref="GeneID:59233919"
     mRNA            <455364..>456251
                     /locus_tag="HG535_0A02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286116.1"
                     /db_xref="GeneID:59233919"
     CDS             455364..456251
                     /locus_tag="HG535_0A02210"
                     /inference="similar to AA sequence:RefSeq:NP_015394.1"
                     /note="similar to Saccharomyces cerevisiae SPE3 (YPR069C);
                     ancestral locus Anc_3.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142011.1"
                     /db_xref="GeneID:59233919"
                     /translation="MSAQEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKY
                     QDILIFKSTDYGNVLVLDNVIQATERDEFSYQEMIAHLALNSHPDPKKVLVIGGGDGG
                     VLREIVKHEGVAEAWLCDIDEAVIRLSKEFLPDMSASYSHPKVKTYIGDGFQFLRDFQ
                     NTFDVIITDSSDPEGPAETLFQADYFKLLNGALTEKGVISTQAESMWIHLPIIKDLKK
                     ACSSVFPIAEYAYTTIPTYPTGQIGFMVCSKDKDANVKEPLRAVSEEEEAKRYRYYNK
                     RIHAASFILPTWVDKELNA"
     gene            <456397..>457779
                     /locus_tag="HG535_0A02220"
                     /db_xref="GeneID:59233920"
     mRNA            <456397..>457779
                     /locus_tag="HG535_0A02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286117.1"
                     /db_xref="GeneID:59233920"
     CDS             456397..457779
                     /locus_tag="HG535_0A02220"
                     /inference="similar to AA sequence:RefSeq:NP_015393.1"
                     /note="similar to Saccharomyces cerevisiae HOS1 (YPR068C);
                     ancestral locus Anc_3.362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142012.1"
                     /db_xref="GeneID:59233920"
                     /translation="MTKLVISASDFQSQVADLLPSNKGTKSQLTLSLIQCYSLLDGFD
                     HVITKPACSKSDLLKFHSLKYVGIILDEKLNKNLPFDNDEEALSGLNDLRAAWNETHY
                     DEPNKARYIFEKKSDLLSYFNEFSLIPTVKSCKSSFGDAFDKIRLDNNASESEDDLDT
                     YNLEGDCPLFSYLPMYCQTVTGASLLLADYIGKSERTVAINWDGGRHHAFKGRASGFC
                     YVNDIVLLIQKLRKKGFQKMSYVDFDLHHGDGVEKAFQFSSNIQTLSLHLFEPGFFPC
                     TGSLEDSKKGKNIFNIPLLHGLNDAFLFSLVNRIIKPLISSHEPEILLIQCGGDGLIG
                     DSFEEWQLSIRGLSECIMNLLTEFKKCSVILLGGGGYNVTVMSRFYTYLTSKILTKYK
                     NDYMKSISLEFSEDALIPEHEFVEQYAEEHYKFWYYELEGSLKRKTLKNDNRIEYITK
                     LENLYRIRIP"
     gene            complement(<457804..>459153)
                     /locus_tag="HG535_0A02230"
                     /db_xref="GeneID:59233921"
     mRNA            complement(<457804..>459153)
                     /locus_tag="HG535_0A02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286118.1"
                     /db_xref="GeneID:59233921"
     CDS             complement(457804..459153)
                     /locus_tag="HG535_0A02230"
                     /inference="similar to AA sequence:RefSeq:NP_009668.3"
                     /note="similar to Saccharomyces cerevisiae ALG1 (YBR110W);
                     ancestral locus Anc_3.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142013.1"
                     /db_xref="GeneID:59233921"
                     /translation="MLMDTEYSWWIALGSIYMALPLLAYTVIPYLFYGNRSTKKRIIV
                     YVIGDLGHSPRMCNQAASFSKHGWEVELCGYLEGAVPKFIEDDPNITIHELPVCDHVR
                     GKQPLAAMIHKVTFQMLAISKQLWKLRGSDYLLMQNPPSIPIMPLAVLYRFTGCKLII
                     DWHNLGYSILQLKFGSFYHPFVLIYYMIEYFFSKFATYNLTVTKAMKDYLVKNFGLKS
                     KRCVVLYDRPSSQFGPLSTTVDRSHALHNESFIKDYVPKDFDLGKGDKVFVTSTSFTP
                     DEDIGILIGALKIYENSCKKFDKSLPKILCFITGKGLLKQKFIERVRQEKWEKCNINF
                     LWLSPTDYPKLLQLCDYGISLHTSSSGLDLPMKILDMLGSGLPVIASNYPVLEELLVH
                     EKNGLKFLDRRELHEALVFAMKDANIYKSLHETVLLEQGNRWDSSWKTAMKEINLIN"
     gene            <459435..>459878
                     /locus_tag="HG535_0A02240"
                     /db_xref="GeneID:59233922"
     mRNA            <459435..>459878
                     /locus_tag="HG535_0A02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286119.1"
                     /db_xref="GeneID:59233922"
     CDS             459435..459878
                     /locus_tag="HG535_0A02240"
                     /inference="similar to AA sequence:RefSeq:NP_009667.1"
                     /note="similar to Saccharomyces cerevisiae CMD1 (YBR109C);
                     ancestral locus Anc_3.360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142014.1"
                     /db_xref="GeneID:59233922"
                     /translation="MSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSP
                     SEAEVADLMNEIDIDGNHKIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLIS
                     AAELKHVLTSIGEKLTDAEVEDMLREVSDGSGEINIQQFAALLSK"
     gene            complement(<460799..>463369)
                     /locus_tag="HG535_0A02250"
                     /db_xref="GeneID:59233923"
     mRNA            complement(<460799..>463369)
                     /locus_tag="HG535_0A02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286120.1"
                     /db_xref="GeneID:59233923"
     CDS             complement(460799..463369)
                     /locus_tag="HG535_0A02250"
                     /inference="similar to AA sequence:RefSeq:NP_009666.3"
                     /note="similar to Saccharomyces cerevisiae YBR108W;
                     ancestral locus Anc_3.359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142015.1"
                     /db_xref="GeneID:59233923"
                     /translation="MSDFWEKNKGSITSGLKTAGKYGYQGTKYVAKTGYKAGKSASKN
                     SSNRRRERERRKKNGDDEDEEEEDDENPNGNYSKQAHHSRHDGQAQSFGPQYQQWQPS
                     QQPYQQTGQLAQPYAQAPQPYGQPPQPYGQPPQPYGQPPQPYGQTPPPQPYGQTPPPQ
                     PYGQPPPPQPYGQPQQSYGQSSQPYGQPPQQYGQTPPPQPYGQPPPPQPYVQPPPPQP
                     YVQPPPPQPYGQPQQSYGQPQQPYGQPQQPYGQPQQVSQAYQNIPETRQGYQVPQQPQ
                     QAQATPPLQQEASHFQQPTAAPVPLPERTAAPVSQAPQHTQPPGAAQGPQTYFSPPSA
                     QNYDSTSGSSTGPSQQAPAFNRERAMSPPLAERAKPSLSIDTNTSANIGPTVPNVVPY
                     QKEQAEERKLAERLTIPEVDLGSLPPPPTRKDREAYVSRVDSAIRSPSSKNRALSSTQ
                     PSIVTTPQESAHTVANVPSTDVQHIPITLSNDDLGPVASDVSPAVVGETVKETSILSE
                     AETVENPNTGITGKFDYNVQVNYAPPPKPHRGPGSAPSLAPSKSAIRPQAPPCLNETL
                     GPRPPALPGRETSSRGVESSSATGETPVSNFLPPPAPYRRTEPMSSEFSKNPVSSSAP
                     ARSMPNLVSSANRDLSSFPPPPKPKRPDISGSPVLKETESNENKKLSSSTPHGRGRLS
                     MANTEEASFQDSTNLKKDLSNSQVASNETNSNEHPQKKNPPPKLKPKPKKLSTANFRS
                     SSEELESDQRSAAINGQIGDISNELAQFKLKKTGSGFLNNKSIERSEVPPSKVKTPPK
                     IPPKRDSLKKAPPVPAKSSTFKLNASSSQQKIEPEEDNNPFSIYLKSAVPLENDRLHR
                     "
     gene            <463602..>464294
                     /locus_tag="HG535_0A02260"
                     /db_xref="GeneID:59233924"
     mRNA            <463602..>464294
                     /locus_tag="HG535_0A02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286121.1"
                     /db_xref="GeneID:59233924"
     CDS             463602..464294
                     /locus_tag="HG535_0A02260"
                     /inference="similar to AA sequence:RefSeq:NP_009665.3"
                     /note="similar to Saccharomyces cerevisiae IML3 (YBR107C);
                     ancestral locus Anc_3.358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142016.1"
                     /db_xref="GeneID:59233924"
                     /translation="MIHEWSFYVLDGSINWRTQLGSLERLLRSSISIGNQVIYAEDSR
                     EGAKYVRKRFEIESEELISFMELVENKNFRIPTILSFAGNEYIKDLILGWIRSECGVI
                     ILPIEFNGTFMIYVVDAIFYASTLHFSETYRTKLIYDVDTENKNLKKLELELDKDTLK
                     TFTDMEKRSVFEKCIMPYIREETGLILEKLTLSMISLAGFARINKRGISTFANTLETE
                     ILLTLLQRSQLD"
     gene            complement(<464352..>464942)
                     /locus_tag="HG535_0A02270"
                     /db_xref="GeneID:59233925"
     mRNA            complement(<464352..>464942)
                     /locus_tag="HG535_0A02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286122.1"
                     /db_xref="GeneID:59233925"
     CDS             complement(464352..464942)
                     /locus_tag="HG535_0A02270"
                     /inference="similar to AA sequence:RefSeq:NP_015392.1"
                     /note="similar to Saccharomyces cerevisiae ISA2 (YPR067W);
                     ancestral locus Anc_3.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142017.1"
                     /db_xref="GeneID:59233925"
                     /translation="MLFSPVSYILWRTSSTGLISRAPTQCWRFLSIAAEPLIKPVRII
                     NQPAGMQFSISRKAATRLADIYKDSKEVLKISVESGGCHGFQYNMRLVPEKKVDTALD
                     APKQNPRHAQEDVKEKDSGDSDDFDDDFEANKKVVFILPDSEAKVVIDENSLKILNKT
                     TLTYSTELIGSTFKISGGNMKSSCGCGSSFDVDLEN"
     gene            complement(<465088..>466011)
                     /locus_tag="HG535_0A02280"
                     /db_xref="GeneID:59233926"
     mRNA            complement(<465088..>466011)
                     /locus_tag="HG535_0A02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286123.1"
                     /db_xref="GeneID:59233926"
     CDS             complement(465088..466011)
                     /locus_tag="HG535_0A02280"
                     /inference="similar to AA sequence:RefSeq:NP_015391.1"
                     /note="similar to Saccharomyces cerevisiae UBA3 (YPR066W);
                     ancestral locus Anc_3.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142018.1"
                     /db_xref="GeneID:59233926"
                     /translation="MIDCTVLVLGAGGLGCEILKNLAMLQVRNIHVVDLDTIELTNLN
                     RQFLFTEYDIGKPKAEVAAKYINNWNEVRQMENKGYPEVIVTPYVRDLTLFPVEFFKQ
                     YQFVISGLDAIEPRRYVNKVLVQITRETHFEVCIPFIDGGTEGLKGHIKTIIPGITAC
                     WECSLDTLPLQQHSVPMCTVANNPRVLEHVIEYVATVECPDSELDNPEEAALVLERCF
                     TRARKFDIDHRKLNMSYMLGVIKRIVPSVSTTNTIVAAACCNEVVKIYFDMVADYDNI
                     TNFIMINGADGFFMHKFKYERKPNCLVCSGL"
     gene            complement(<466252..>466818)
                     /locus_tag="HG535_0A02290"
                     /db_xref="GeneID:59233927"
     mRNA            complement(<466252..>466818)
                     /locus_tag="HG535_0A02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286124.1"
                     /db_xref="GeneID:59233927"
     CDS             complement(466252..466818)
                     /locus_tag="HG535_0A02290"
                     /inference="similar to AA sequence:RefSeq:NP_009664.1"
                     /note="similar to Saccharomyces cerevisiae PHO88
                     (YBR106W); ancestral locus Anc_3.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142019.1"
                     /db_xref="GeneID:59233927"
                     /translation="MVSPQISNLIIMLVMMQLSRRIDMENEQNILYIRIAYGASVGLA
                     FIIYQLTRKIIVTKNDLTTLKYVQPSSPFGGEGEKLETTTVKDYDLKEIDSAIKSIYT
                     GLAMMGFMHLYMKYTNPLFMQCISPIKTALESNEVKIHLFGKPATGDMKRPFTAASLF
                     GGATSGPKTDKQSIEEAERAGNGGVKAD"
     gene            complement(<467260..>468954)
                     /locus_tag="HG535_0A02300"
                     /db_xref="GeneID:59233928"
     mRNA            complement(<467260..>468954)
                     /locus_tag="HG535_0A02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286125.1"
                     /db_xref="GeneID:59233928"
     CDS             complement(467260..468954)
                     /locus_tag="HG535_0A02300"
                     /inference="similar to AA sequence:RefSeq:NP_015390.1"
                     /note="similar to Saccharomyces cerevisiae ROX1 (YPR065W);
                     ancestral locus Anc_3.354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142020.1"
                     /db_xref="GeneID:59233928"
                     /translation="MDKKNTTSEGTPVIDNFQADKEPTELPGAENVANAATESSINVG
                     GKIPRPRNAFILFRQHHHKVLIDEWTTQGEDIPHNSKISKILGLKWKSLSDEERIYWE
                     GLAKKEKIEHEKKYPNYRYKPVRKHKRKQSKLFMEHGIYENLSRHSTGSSASSSGGFV
                     NSPVIPLPAASALNPSTAGFYHQIAVPGASALIASYSGSSSAADDDKWSQVGQPQQLQ
                     QMQLPAHQHQQSHTQPQSQSQSQSQSQPQSQQMQHPRFPSSVDNSNMYSSVPFRMPHQ
                     NSAGAIPYAQQPNIAQSHLHTPFSYMDTNSQLGNASKPNLLTHPYAPFLLQPNYKPAE
                     KSLLSSVPQSQPQSHQRPVPVPHRSGSASVPAHMHIAGTSSLPASHVSVGSQQGAPSP
                     TPPVIYSPSLQMQQQQQMQQQQQMQQQQQMQQQQQMQQQQQMQMEMQIQMQRQAQMQH
                     QAQVQMQIQHQAQVQHQVHTQNQYPMHSNKIANVPPNQSEYAHEYPYQTYQHSSAFSQ
                     QPSFYKSPEIPNISTPVLSRHPSSSTSKVTVQSIDNNSIESSTQELNNPNSRQNRS"
     gene            <471408..>472439
                     /locus_tag="HG535_0A02310"
                     /db_xref="GeneID:59233929"
     mRNA            <471408..>472439
                     /locus_tag="HG535_0A02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286126.1"
                     /db_xref="GeneID:59233929"
     CDS             471408..472439
                     /locus_tag="HG535_0A02310"
                     /inference="similar to AA sequence:RefSeq:NP_009663.1"
                     /note="similar to Saccharomyces cerevisiae VID24
                     (YBR105C); ancestral locus Anc_3.353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142021.1"
                     /db_xref="GeneID:59233929"
                     /translation="MINEVTKTVADALAKKQAAQRGDGVDDQQDFGNADRCVQQPSSS
                     GVPVLALAHHQQIFSEESLYKCSSADSLASLQQQFVSSSPSLSSSKRYIVEDNSDYGS
                     CTSPAQSRANGSVSGVPRSISATVTNFLKPRMEFTGYQISGYKKYQVVVTLKTVELPK
                     DGISSLSPHLTGFLTIRGLTNQHPEISTYFESFAVTHKDLGFLSSTWSKDRAMTSYMA
                     DDQTDLEHWLNFPSFKQLFLGPGCDSENRTPTINDLLNGQESFGDYLENRYIFMRWKE
                     KFLVPDALIDGVEGASYDGFYYIVHDQVTGAIQGFYYHEDAEKFQQLELVASFKSLND
                     CSNCSFEFA"
     gene            <473055..>473517
                     /locus_tag="HG535_0A02320"
                     /db_xref="GeneID:59233930"
     mRNA            join(<473055..473095,473157..>473517)
                     /locus_tag="HG535_0A02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286127.1"
                     /db_xref="GeneID:59233930"
     CDS             join(473055..473095,473157..473517)
                     /locus_tag="HG535_0A02320"
                     /inference="similar to AA sequence:RefSeq:NP_015388.1"
                     /note="similar to Saccharomyces cerevisiae YPR063C;
                     ancestral locus Anc_3.352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142022.1"
                     /db_xref="GeneID:59233930"
                     /translation="MTANNVKRVDLCVQYKHTLPPKSPFETNMGLSKMVNQSMPMVGM
                     FLRNKFIAWFALIQSFHYYLNADPDQENSSGSKNAMDQSPMMKVVLSIIGICVCYMNI
                     ALPQPDAPPLKPKAVEDAKVVAKSVEGAKST"
     gene            complement(<473591..>474058)
                     /locus_tag="HG535_0A02330"
                     /db_xref="GeneID:59233931"
     mRNA            complement(<473591..>474058)
                     /locus_tag="HG535_0A02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286128.1"
                     /db_xref="GeneID:59233931"
     CDS             complement(473591..474058)
                     /locus_tag="HG535_0A02330"
                     /inference="similar to AA sequence:RefSeq:NP_015387.1"
                     /note="similar to Saccharomyces cerevisiae FCY1 (YPR062W);
                     ancestral locus Anc_3.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142023.1"
                     /db_xref="GeneID:59233931"
                     /translation="MTRGREWDKLGMDIAYEEAARGLSEGGVPIGGCLINNKDGQVLG
                     RGHNMRFQKSSATLHGEISTLENCGRLPGKVYKDTTLYTTLSPCDMCTGAIIMYGIPR
                     CVIGENINFKSEGEEYLKSRGRDVAVMDDKRCQKIMKEFIEQRPQDWFEDIGE"
     gene            <476182..>477168
                     /locus_tag="HG535_0A02340"
                     /db_xref="GeneID:59233932"
     mRNA            <476182..>477168
                     /locus_tag="HG535_0A02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286129.1"
                     /db_xref="GeneID:59233932"
     CDS             476182..477168
                     /locus_tag="HG535_0A02340"
                     /inference="similar to AA sequence:RefSeq:NP_015386.1"
                     /note="similar to Saccharomyces cerevisiae JID1 (YPR061C);
                     ancestral locus Anc_3.350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142024.1"
                     /db_xref="GeneID:59233932"
                     /translation="MLLQRNVPFIYRYRRACTAQLKTRSTLSFSKNVLIKLNFRFFAI
                     PANYAESHNEGGNVHHDTRWPNHENPTPYEVFGITQQECSSSRNINKSILKKRFHEYA
                     KLYHPDISQNVRIIRSPIKQKQLGGSLLSFDEKVLRFKIMTQAYEILSDTGRRNLYDL
                     TKSNWAYGPQSSSTYASSHAYPSSHGYQTNSTYEYWNAGTWEEMNDLNKGTQEREKLD
                     PWTVFLWLCGLVVCLEATALLTRIENSLTSQQYTHEETEFDLAQSYSNYGLDSDKFSR
                     LRRFLWFRTYGLYRAKDDLDREAEKNEGLVQDLIKATAEKDNGACKFSASKK"
     gene            <477550..>478320
                     /locus_tag="HG535_0A02350"
                     /db_xref="GeneID:59233933"
     mRNA            <477550..>478320
                     /locus_tag="HG535_0A02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286130.1"
                     /db_xref="GeneID:59233933"
     CDS             477550..478320
                     /locus_tag="HG535_0A02350"
                     /inference="similar to AA sequence:RefSeq:NP_015385.1"
                     /note="similar to Saccharomyces cerevisiae ARO7 (YPR060C);
                     ancestral locus Anc_3.349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142025.1"
                     /db_xref="GeneID:59233933"
                     /translation="MDFTNPETVLDLRNIRDELVRMEDTIIFNFIERSRFPTCPPVYE
                     KERPGLAIPNFNGSFLDWALLQMEMVQSQIRRFESPDETPFFPDHILKPILPSVNYPP
                     ILAKFASQVNYNGKIKEIYEKEMVPLISKYDGDQPENYGSVATRDIECLNSLSRRIHF
                     GKFVAEAKFQAEEKMFTKLIQEKDVEGLMKSITNSAVEEKILHRLIRKAEVYGIDPTN
                     NKGERRITPEYLVKIYKDFVITITKEVEIDYLLRRLSD"
     gene            complement(<478422..>479345)
                     /locus_tag="HG535_0A02360"
                     /db_xref="GeneID:59233934"
     mRNA            complement(<478422..>479345)
                     /locus_tag="HG535_0A02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286131.1"
                     /db_xref="GeneID:59233934"
     CDS             complement(478422..479345)
                     /locus_tag="HG535_0A02360"
                     /inference="similar to AA sequence:RefSeq:NP_009662.3"
                     /note="similar to Saccharomyces cerevisiae YMC2 (YBR104W)
                     and YMC1 (YPR058W); ancestral locus Anc_3.348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142026.1"
                     /db_xref="GeneID:59233934"
                     /translation="MSEEWPAPQLIDDLELEGSKDKSRVLKDLLAGTTGGIAQVLVGQ
                     PFDTAKVRLQTSTRVTSVSEVVRNLIKNEGFMAFYKGTLTPLFGVGACVSIQFGVNEA
                     MKRMFHSLNTDSLSTLSLQQYYTCGLAGGIANSFLAAPIEHVRIRLQTQTQTGTGASA
                     LYKGPIDCIKKLRSQGGLMRGLIPTLLREGHGCGTYFLVYEALVASDMNKGLDRKNIP
                     AWKLCGYGAIAGTALWSVVYPVDVIKSVMQTDNLKSPKYGKSMRLVAKNLFIQGGIRA
                     YFKGFTPTMMRAAPANGATFATFELAMRFLN"
     gene            complement(<479535..>480581)
                     /locus_tag="HG535_0A02370"
                     /db_xref="GeneID:59233935"
     mRNA            complement(<479535..>480581)
                     /locus_tag="HG535_0A02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286132.1"
                     /db_xref="GeneID:59233935"
     CDS             complement(479535..480581)
                     /locus_tag="HG535_0A02370"
                     /inference="similar to AA sequence:RefSeq:NP_015382.1"
                     /note="similar to Saccharomyces cerevisiae BRR1 (YPR057W);
                     ancestral locus Anc_3.347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142027.1"
                     /db_xref="GeneID:59233935"
                     /translation="MRDNSKHLVDSAFGQSRAFSLNDKLVNPEAVRYLSNVRQEALRT
                     NVSKKKQYTKYKASLYDDEEEETSKVVVLNNNPPPSEVFADFRLRMDKWLEWFIDTKQ
                     IVNENSDVFQGYDGTTMDLLLLYLRRYLSGLPEQKGIVLHLLSILKEAPNIKEDSSLE
                     IDEQWAISTVKKLKNKKIKSIDDIKINIQELNREIPVGFKQWYQYLQEHEPTHTAFTS
                     TINARNIWILVQYMNQEWLKDMMKCKRPPQSIRLSNWLLYILYHLPVNLTAESVSSIR
                     ELGKKCRKVIEEDAVKAASEEAKIKIPALQINLPSEMANLGISSAPCDLNIVGLTLAV
                     IASIYRQRDLVDWV"
     gene            complement(<480976..>481953)
                     /locus_tag="HG535_0A02380"
                     /db_xref="GeneID:59233936"
     mRNA            complement(<480976..>481953)
                     /locus_tag="HG535_0A02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286133.1"
                     /db_xref="GeneID:59233936"
     CDS             complement(480976..481953)
                     /locus_tag="HG535_0A02380"
                     /inference="similar to AA sequence:RefSeq:NP_015381.1"
                     /note="similar to Saccharomyces cerevisiae TFB4 (YPR056W);
                     ancestral locus Anc_3.345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142028.1"
                     /db_xref="GeneID:59233936"
                     /translation="MDAISDPTFRTSKTRPQYAEETPSLLVLVIDTAPKLWAELDGKD
                     GNMITVLQSIIVFLNAHLAFNNSNRVAVIAAHSQGIKYLYPKSVSRQYSEQSYGHASF
                     STKDLSIISNDMYRQFRNVDETLVEELYKLFQEEKNQVDKITQKSTLAGGMSAGLTYT
                     NRLSRELSSISLKSRLLVLTCGSGGGRDEIFQYIPIMNCIFSATKLKCPIDVVKIGGR
                     RDSTFLQQTTDATQGVYLHVESTDGLIQYLSTAMFIDPSLRQIIVKPNQGSVDFRTSC
                     YLTGKVVAVGYICSVCLCVLSIIPPSNRCPACDSEFDERVIAKLKKSRE"
     gene            complement(<482115..>483662)
                     /locus_tag="HG535_0A02390"
                     /db_xref="GeneID:59233937"
     mRNA            complement(<482115..>483662)
                     /locus_tag="HG535_0A02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286134.1"
                     /db_xref="GeneID:59233937"
     CDS             complement(482115..483662)
                     /locus_tag="HG535_0A02390"
                     /inference="similar to AA sequence:RefSeq:NP_009661.1"
                     /note="similar to Saccharomyces cerevisiae SIF2 (YBR103W);
                     ancestral locus Anc_3.344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142029.1"
                     /db_xref="GeneID:59233937"
                     /translation="MSITSEELNYLIWRYLQETGNEVSALALQDDTRVLEFDRKYKQH
                     IPLGTLVNLVQKGILFCECELLVDSTGKLRDVDETHYASIFNLAQALEIDKATCPEVV
                     AKGRFSLENDYESLEDEKKEKEKEVVYSVAPDKDSNTRSKSPPLFIKTLKEEKKLGKI
                     VLSSWNPHFPELLAVGGQDSLARIIHYNSEKATVEKSLELRHPFAFNSSSGITTNQVT
                     CLAWSPDGKKIVTGVENGELRLWNAEGHLQNVFSFHRSPIVSIKWNEDDSHFLTSDVD
                     NVAILWNVITGTALQNFELKENAADSDSLGVDLEWVEKDKFVLPGIQGSLIVYQIGER
                     KPIGKLIGHQGPIGILKFNRNKKLLLSASDDFTLRVWRGGSSNPSNCFYGHSQTIVSA
                     CWLDDDKIISSSMDGSIRLWSLSKNTLIAVTIADGVPILSAELSSDKKKYSAGFIDGH
                     LIVYDVEALLEKLGNDSPISPITFPVYGSYQSPKERDCIFNLSWNYASDKVVVAYSIE
                     EGSIISM"
     gene            <483909..>486086
                     /locus_tag="HG535_0A02400"
                     /db_xref="GeneID:59233938"
     mRNA            <483909..>486086
                     /locus_tag="HG535_0A02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286135.1"
                     /db_xref="GeneID:59233938"
     CDS             483909..486086
                     /locus_tag="HG535_0A02400"
                     /inference="similar to AA sequence:RefSeq:NP_009660.1"
                     /note="similar to Saccharomyces cerevisiae EXO84
                     (YBR102C); ancestral locus Anc_3.343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142030.1"
                     /db_xref="GeneID:59233938"
                     /translation="MVDFSLKKAKNNWKNTRGSSPTKEKLNDSPSKIKTKMPNKKNPY
                     TSMKMSPEYSKLPTMDAKQKTKVASSMQRRLSMQNPNYVPPKLDYSMPLPMSSMESLI
                     QGHNASGANLVHGSNPQPIVDRAHNGKPSAHPKTSQPSTEMPSAIMKPEALRKVLGNP
                     NFNAKSFVHDALGDATAIEIDGFTSNLTDLASEVQEEAKENINRSHRDILTVNNDLGS
                     AAQELKQLRTSINELNEAMQQLLVMAQKRLQTEEHSSQPSSKNSNAPSSGLLPPMRAG
                     TISNAKRDRTSVAILERLWDNQLTELFKNVEGAQKYISSAPGRHVLLESADWLELNVA
                     TLKPLQNVHIFILNDMVLVAGRPRDKQNELVVSQCNHLKEVSISPDGVSSDRLLFSFG
                     NNIKCLYQCRKQQEGIRLLAVVRRAKDDLREISQAEEENTRKIKESFTYLQSTQQTPS
                     RESARSPIKGSRRSVGSMTPGKTGEAVDSYLLETITMSMHSRTRSRDMNSAAKQLKTL
                     GDQSEEIDIELGRLNFDKATTLLVDLESQLDRLSDRIDNEHLMLHDLINLKIDQKRDA
                     IAAKLSQSISNSFEISNLVSCVKNMIKLGFSEEGLDLFLQNRSNLIEDLVLQIGSFDN
                     STNYFTQIAVIRFQTMKKTVLCFQQTFQDSADKFSSILVNWCKEEVDSHFKLIEKQLL
                     NEEMLSAASIKSSRKQIDGLKQVGLDFVYKLDEFIRKNSDKIL"
     gene            <486447..>487316
                     /locus_tag="HG535_0A02410"
                     /db_xref="GeneID:59233939"
     mRNA            <486447..>487316
                     /locus_tag="HG535_0A02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286136.1"
                     /db_xref="GeneID:59233939"
     CDS             486447..487316
                     /locus_tag="HG535_0A02410"
                     /inference="similar to AA sequence:RefSeq:NP_009659.3"
                     /note="similar to Saccharomyces cerevisiae FES1 (YBR101C);
                     ancestral locus Anc_3.342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142031.1"
                     /db_xref="GeneID:59233939"
                     /translation="MEKLLHWSIANSQGDKETVDKIGQPDPKLLAQLFGSGGPDDPTL
                     MKEAIAVISNPEADLENKLIAFDNFEMLIENLDNANNIENMKLWVPLLKTLDAEQEDL
                     RASGLSVIGTAAQNNIPTQDSFLKYDNGLRKLIELGNDLKEPANVRIKAFYALSNLVR
                     NHPSMAQKFKELGGLDIVAPVLTDLNAISKLKMRAISLVAAFLTSTQIDDELIQLLRT
                     ESIIGSTIECLKTETDINIIDRVLNFLSQLISAHIKFSEAEVQGLKTGIQNIEQWKDR
                     LNEEDFSVVKHVL"
     gene            complement(<487397..>489343)
                     /locus_tag="HG535_0A02420"
                     /db_xref="GeneID:59233940"
     mRNA            complement(<487397..>489343)
                     /locus_tag="HG535_0A02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286137.1"
                     /db_xref="GeneID:59233940"
     CDS             complement(487397..489343)
                     /locus_tag="HG535_0A02420"
                     /inference="similar to AA sequence:RefSeq:NP_009656.2"
                     /note="similar to Saccharomyces cerevisiae MMS4 (YBR098W);
                     ancestral locus Anc_3.341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142032.1"
                     /db_xref="GeneID:59233940"
                     /translation="MHNTSRHYNSDEDSKHSSNVTHREIVTILTEEDSERQSNVYPSS
                     PMVLERESQILEIKSVNNGSNTSIELNVPFYQDLSTSIEGDLSTLARNEVTDVNTINR
                     RKRLLDEILDESSSYSGKLNEELYDHTSSCAKNTPPGGGFLRRTKVDSTPAKFGTTLV
                     IEHEGDDVHGCPTRENRCQDSCSSVNFQDLIEAFPLSPICNSAPDYEKCLPIDSRPLT
                     VQEACTTPSNLETTNDLFSKPSQEYELQANKPEIIELSAREFLTERIDKVVSTPSKHE
                     YHTFGPQNSSTSNTSNTIKEPTTSEREIRRLQHYIVQGNCLSRTQSEALVRDWLQRNK
                     SLFKQVNQIHRDNVKARESIVVEIPGYLLEQFEKGEDNIKELLLPATLEAVSNQELPL
                     LRFLRECNSTYDFNNDVYYPSESVTLEETIVMLYYDAQIFFERYRSDKTKLYNDLKSL
                     SSGEKYLIVILSGLNRFKRSLQAQENKRYKNRVQVQLGGSQKGVQSVQIKKRRTFEDL
                     NMTYFDVAQRIQHIDRMWGVKIHTVSSDADFIKTLPNLVSIIGKQRTDPNIRFMRYCH
                     INVKSCKDEKEVLMKSLREINRMPELKASSVVAAYSSFQSLLKDFERREIKSGLDGKH
                     LMTEAMEERLFKLLTCRDPNETIQ"
     gene            complement(<490532..>493564)
                     /locus_tag="HG535_0A02430"
                     /db_xref="GeneID:59233941"
     mRNA            complement(<490532..>493564)
                     /locus_tag="HG535_0A02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286138.1"
                     /db_xref="GeneID:59233941"
     CDS             complement(490532..493564)
                     /locus_tag="HG535_0A02430"
                     /inference="similar to AA sequence:RefSeq:NP_015380.1"
                     /note="similar to Saccharomyces cerevisiae SEC8 (YPR055W);
                     ancestral locus Anc_3.340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142033.1"
                     /db_xref="GeneID:59233941"
                     /translation="MNHLGVPKGRRRGLSVNSVSDAQQRARNTALNSLQDDLSHVESQ
                     WNRILTENSNPLELALAFLDDTSVGLGHRYEDFRQLKTRIGYDLKEAVNEHFQVLNTT
                     VASYSIAVESITNAQDNIVQLKTQIADANKNITMEKGNLRVLNEKSKVQSEMVEILSA
                     IEYLMQLPEKVEDHIRNSDYKDAQKLLARGFLSANTHNLWSLETLQILKQQLEMQEHV
                     LFNTLIEEIHTIVYSKAGLKSSEGTMLEDIGQSWEGFTSLENYIYNVVNVDVSKQSRI
                     MSNRLTKFLDILKAPGYKETTSIPKDDDFGRIFFLLSILHDINQLPNALSILTDRAKE
                     EFHNIIIKCTEEIRMNHPSMLKMALNLTEDSNFGISAKDALSVVIRKCFFRIFVKLLI
                     AAQGHRIVFETVSTLLPSTDASKIYRFDLVWPKLLDEIETLISRYLKNSVLSNDVDVR
                     YGNTSISTSSKKKHSPLFVLQNNIKDSSAAVDHTNELKALLKDIFPGINISTNAELES
                     IYVEEESFEQEESLIAPSVFNMKVLLEPLLIFCQSASDLIPLEFSTRTQSSMNFFVDY
                     MDQSFLPELKMTLSHLFASKIEATNPYTLELTEENKYICKPAADFKNLLYKLLYVMNT
                     THIFRKKICSLLLDFLDKFHNYYLNLFKTLFGTNHSISGKKIITIWLEDKKIMEMENQ
                     ILNEDFSVALKEARALISHCPDFFREENSLQKDDLLNIVTVDAVELFLSTSFWILEWL
                     PSLKKLVTPSLEPNGVYDADHLKDTWSFFESSDLTNMDKMAAPKISMDVDSSEKFDEI
                     VVGFSSLKNRLLSAIRFDIRARCLYHIGSLFQNTRSWNADVDSAELDEHISSLLHDLK
                     MLENKYRQQFPPPILDAVFTGIDKLNNLALLGGMHSIRVLNKNGIKKILKNVSVLQHT
                     CRNILSDPSNVDMSDAMNLYSLCGSDESTFFKQIEAGNLFLCSKDDLKVILRLQFSEE
                     LQKQLKRSSDSSKRVNSLPLNSKKYHDAVKKLETLQLQ"
     gene            complement(<493719..>497963)
                     /locus_tag="HG535_0A02440"
                     /db_xref="GeneID:59233942"
     mRNA            complement(<493719..>497963)
                     /locus_tag="HG535_0A02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286139.1"
                     /db_xref="GeneID:59233942"
     CDS             complement(493719..497963)
                     /locus_tag="HG535_0A02440"
                     /inference="similar to AA sequence:RefSeq:NP_009655.2"
                     /note="similar to Saccharomyces cerevisiae VPS15
                     (YBR097W); ancestral locus Anc_3.339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142034.1"
                     /db_xref="GeneID:59233942"
                     /translation="MGAQLSLSARTAPSIAIFSYIDVLNEVHYVSQLNSSMFLKTCKG
                     LDPNGEVIIKVFIKPMENYDLKDIQQSIMREALRLAPLPTALNFSKVVESNRAGYLIR
                     QHLKSNLYDRLSSRPYLLDVELKFLTFQLLQALDDIHQADITHGDIKTENILVTSWNW
                     LLLADFSSSIKPTYLPEDNPGEFSFYFDTSKRRTCYLAPERFDSKLHESTNKSQGPVT
                     KAMDIFSMGCCIAELNAEGRPLFNLSQLFKYKNKDYVVEGFFSEEIKSKELKSLIMDM
                     IQLNPNKRLSSREIMEKYRGKYFPEYFYTFTYEYFRTLATMSTSTPSTGAVCTHTTLE
                     NQMNVVDGCCAKIYTDFKMICEYMGYTGSLDRKFVVNQEFDWFFSRGVKLAETGVLNA
                     RFIDSNCQPVKDECALLFISYISHGLRNIVSSITKLRCLEMLIALSQFVSDENKIDRV
                     IPYLVSCFEDEYPNVQALAVQALTQVLNTIKKVNPINEYIFVDYLLPRLKRLLLQSKV
                     NSYTRIIVANCLGDILTVANRFQEISYSSNSHQLTDIPNGGLEAFEVTSRNIKKLVQQ
                     VEDLAVGLLTDSETNVKIALLGNILPLCKFFGREKTNDVILSHLITYLNDKDSSLRIK
                     LIQTISGIAILLGPITLEQYILPLLIQTITDSEELVVVNVLKSLKDLCKTGLIQKRFH
                     YDICNTIRPLLLHPNFWIRQYSLLIIVEISANLSKAEVYCVLYPIVRPFFEFDVEFTY
                     DLMLSSCKLPVSRTVYNFLCSWSLRASKSLFWQQVPSNHVDAFGNDNTSFITKDYSQR
                     NYGFNIMKASKSVVRSFDNSEIPLTTEDKNWVDKFKSIGLTESDFWKLAVLRGYILRA
                     AKLISRKTSVLENEKTRNSSRYDRLNLAVPQLMPRTIFFDVKFAEDDETATMTVTEGA
                     VNKPKLQQDIHCDLPTVKDMNGSLMFTTKAAATTTSNLENVYVQLEFKPQKRDVPYDT
                     LEHDVDEQEYTIHDSYEGNVGTIKDYLHNLKILPSLREYKNFGSLISDTIPHETLDQV
                     KGKLVTNLTEGRQLSITALATSSGVNPYLISGSDQGVIKLWDLTKIISGELYTSSLTH
                     DLASPITNIIALTGYDSFCISTKDGLIVVLRVLYQIKESQRKFARFQTIRKFKIDQTE
                     EREVYATTIKAVITDDISQLIALTNTSQILILDIRTMKCIKKISNPVSHGAVASFAAG
                     ESGSVLILGTTKGIIDLWDLRFHLLIKSWAFGDHHPITHLSECGVMGKDTVIVVGGLS
                     SALFTVWDYAKLKCRTAVIHSDEQPSIGTFLPVQKQLDKLRFLNAITVNSIFVTGEYA
                     VVANGSSNKLVMVNMRKLNSSRILREPKSTNDLVTVQATASLSYLLLKKTSSNEGKSA
                     ERIKYSENINCMASAVINGLQLLITADTSGTISLTK"
     gene            complement(<498135..>499457)
                     /locus_tag="HG535_0A02450"
                     /db_xref="GeneID:59233943"
     mRNA            complement(<498135..>499457)
                     /locus_tag="HG535_0A02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286140.1"
                     /db_xref="GeneID:59233943"
     CDS             complement(498135..499457)
                     /locus_tag="HG535_0A02450"
                     /inference="similar to AA sequence:RefSeq:NP_015379.1"
                     /note="similar to Saccharomyces cerevisiae SMK1 (YPR054W);
                     ancestral locus Anc_3.338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142035.1"
                     /db_xref="GeneID:59233943"
                     /translation="MDLSKVLNNKEEALNRQKKDRQQDWKYYRYKPSSDRIKDIMHSH
                     LEKKKFSEGVSSPRTIYEPAKFSLPCRYEVTHILGKGSYGTVCSVRDKFDPENPYSIA
                     VKKITNIFYREVLLKRAIRELKFMSYFKGHKNIVSLIDLEFVPEKPYDGLYCYQELID
                     YDLAKVIHSSVQLSEFHIKHFFYQILCGLKFIHSAEVIHRDLKPGNILCTLNGCLKIC
                     DFGLARGLASQFFASHVARQDITNYVATRWYRAPELILSHKEYGKPIDMWSVGCILAE
                     LYGRKPIFMGKDSLQQVHEIMRVMGNPPKELLVSYGSLRAWNICNDSIYSNQGIEWKL
                     LYPFASEDALDLIDKILLWDMNERLTVEQALSHPFLVEVKCAEDEPSCPLGPFDFSYE
                     TRLNSMPRLREFLMSEVLIFKEDRAFCHPAEQGCSKYVPTTPLGKMYV"
     gene            complement(<499674..>500366)
                     /locus_tag="HG535_0A02460"
                     /db_xref="GeneID:59233944"
     mRNA            complement(<499674..>500366)
                     /locus_tag="HG535_0A02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286141.1"
                     /db_xref="GeneID:59233944"
     CDS             complement(499674..500366)
                     /locus_tag="HG535_0A02460"
                     /inference="similar to AA sequence:RefSeq:NP_009654.3"
                     /note="similar to Saccharomyces cerevisiae YBR096W;
                     ancestral locus Anc_3.337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142036.1"
                     /db_xref="GeneID:59233944"
                     /translation="MAVGNVFKWLFYLYLFSSYKSLPGAYFIRFYWHIFPLIFIPWFT
                     GAKDSKIIRKLANNKYGCFANTNTDTYASPFECDFYFHKNNSTYFEELDISRGELMGK
                     IFQKLLLNSKRWPYIPVANVFTNFLKEIKPFERYSVTSVILCWDQKWIYVMSRFTKHN
                     GKVLCSLSLTKYVLKDGRKTISPSVALESCGLYNEEVAKIAEKNMKLLTEQCGFHETK
                     PLEELDHSFFQI"
     gene            <500598..>501704
                     /locus_tag="HG535_0A02470"
                     /db_xref="GeneID:59233945"
     mRNA            <500598..>501704
                     /locus_tag="HG535_0A02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286142.1"
                     /db_xref="GeneID:59233945"
     CDS             500598..501704
                     /locus_tag="HG535_0A02470"
                     /inference="similar to AA sequence:RefSeq:NP_009653.2"
                     /note="similar to Saccharomyces cerevisiae RXT2 (YBR095C);
                     ancestral locus Anc_3.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142037.1"
                     /db_xref="GeneID:59233945"
                     /translation="MTSDDVLSVSDEHKYISTFCRHVIKEKSGNYPVLKRSLDGTIVY
                     QDAAGVTSNRGNKLLQKSELVSREVINSSKPINEDFVYYNGSEHKLLQRKRIRFTPPE
                     TEWEMADETGYDAENVDNNEEELSRLVDVKKVLLPISSLADVSKRSPIARVFENNVLR
                     NLALQSILMIEKEQYSVIKYSKFLEVFLGDNPKPLYEPDLHLPAYDHNLTLPDEEDTN
                     DAEEKEKETAKDQPDLQNEDPFFALPKISASDTMLQLLPEMDSVQVSEEAETARQLAQ
                     IALQRNQEYIRNLRKIRNVLVKANRMKERIQAWSREYVGMQEDDVIVPNALRVVKRGL
                     ISATTNRSMSGRKVDAGEELNEENEIDDVNEANE"
     gene            complement(<501813..>503732)
                     /locus_tag="HG535_0A02480"
                     /db_xref="GeneID:59233946"
     mRNA            complement(<501813..>503732)
                     /locus_tag="HG535_0A02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286143.1"
                     /db_xref="GeneID:59233946"
     CDS             complement(501813..503732)
                     /locus_tag="HG535_0A02480"
                     /inference="similar to AA sequence:RefSeq:NP_009652.2"
                     /note="similar to Saccharomyces cerevisiae PBY1 (YBR094W);
                     ancestral locus Anc_3.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142038.1"
                     /db_xref="GeneID:59233946"
                     /translation="MNPDVSSDDIEWILIDGTPASCSNIGLYHLSREPFDLVISGPNV
                     GRNTSAAYITSSGTVGAAMESVIAGSTRSIALSWAYFNGEKNVDQKILQVAAVRSLEI
                     IDHLYHHWNDNTDFYSINVPLSSELDASTKAHYTILWDNRWNAIFNGPKIGSDSGENG
                     NEIEDGNEYQTITFDWAPNFKHHTNSHHYHESSSSNVDKNIIEKKMISVTPLRATFKN
                     VENLVGELLLSRKDLSPNKVVISIDPKEYVYTPLRKAILKYLPDYDILSNLPSLPNFK
                     GRIFHYGDYEQLDMEKLSSDVDHYFANSYIYRKSLIRKHYLAQTIRAFVVKNPNSILS
                     KAFPETFSFDLDYAEFLDDSLDENWELRQELEKNEKWWIVKPSMSDKGQGIRIFKSIQ
                     DLQEIFDSFDEDATDDEEEYDVKRDENKIIISQLRHFIVQEYLNTPLLLPSMDNRKFH
                     LRVYVSCKGCLEVYVYDRMLALFAPNSFEELAESHYNPTDVNFLKSHLTNTCLQSDKE
                     QKNISVLEFDQLKDMSVDDKKVIKKQIYEIAHDVFLAAVKVDSFGFQPLPNAFETFGV
                     DFLVDSGLEVKLLEINAYPDFKQTGEALKNVITNLFDNCAQHIIAPLLNENKKIQSGK
                     TDNMIKVLDYSANNW"
     gene            <503859..>504560
                     /locus_tag="HG535_0A02490"
                     /db_xref="GeneID:59233947"
     mRNA            <503859..>504560
                     /locus_tag="HG535_0A02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286144.1"
                     /db_xref="GeneID:59233947"
     CDS             503859..504560
                     /locus_tag="HG535_0A02490"
                     /inference="similar to AA sequence:RefSeq:NP_009649.1"
                     /note="similar to Saccharomyces cerevisiae MRS5 (YBR091C);
                     ancestral locus Anc_3.334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142039.1"
                     /db_xref="GeneID:59233947"
                     /translation="MSFPDPRFLHMRNTDCQVPMWVVLFQLLHEGPDISRKLIIERPI
                     IVGQQHTHSAQRFKVSCQVNESIAILLICKNTLCTHRAPADGEKRPAVAKNDNEKKHH
                     HQLSTSERKGRSASRAPPLEKTTMSLFVNPFASQEVSQEKLDVAEVQFDAMNSTFNNI
                     LFSCLEKCIPHDHYSESELNKGEMSCVDRCVAKIHYSNRLIGAYVQAKGFAPDTHLPH
                     YKPFKTSTADTGMQK"
     gene            <505653..>505934
                     /locus_tag="HG535_0A02500"
                     /db_xref="GeneID:59233948"
     mRNA            <505653..>505934
                     /locus_tag="HG535_0A02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286145.1"
                     /db_xref="GeneID:59233948"
     CDS             505653..505934
                     /locus_tag="HG535_0A02500"
                     /inference="similar to AA sequence:RefSeq:NP_015377.1"
                     /note="similar to Saccharomyces cerevisiae NHP6B (YBR089C-
                     A) and NHP6A (YPR052C); ancestral locus Anc_3.333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142040.1"
                     /db_xref="GeneID:59233948"
                     /translation="MSAPRETKKRTTRRKKDPNAPKRALSAYMFFANENRDIVRAENP
                     DVTFGQVGRILGERWKALTPDEKTPYEAKAEADKKRYESEKELYNATRA"
     gene            <506350..>507126
                     /locus_tag="HG535_0A02510"
                     /db_xref="GeneID:59233949"
     mRNA            <506350..>507126
                     /locus_tag="HG535_0A02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286146.1"
                     /db_xref="GeneID:59233949"
     CDS             506350..507126
                     /locus_tag="HG535_0A02510"
                     /inference="similar to AA sequence:RefSeq:NP_009645.1"
                     /note="similar to Saccharomyces cerevisiae POL30
                     (YBR088C); ancestral locus Anc_3.332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142041.1"
                     /db_xref="GeneID:59233949"
                     /translation="MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSR
                     VLLVSLEIGIEAFQDYRCDHPVTLGVDLTSLSKILRCGNNSDTLTLIADDTPDSVLLL
                     FEDTKKDRIAEYSLKLMDIDADFLKIEELAYESTLMMPSPEFTKIVRDLSQLSDSLNI
                     MVTKETIKFVADGDIGSGSVILKPFVNMDKPEESIKLDMEQPVDLTFGAKYLLDIVKG
                     SALSDKVGIRLSSEAPALFQFDLKSGYLQFFLAPKFNDEE"
     gene            complement(<507212..>507733)
                     /locus_tag="HG535_0A02520"
                     /db_xref="GeneID:59233950"
     mRNA            complement(<507212..>507733)
                     /locus_tag="HG535_0A02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286147.1"
                     /db_xref="GeneID:59233950"
     CDS             complement(507212..507733)
                     /locus_tag="HG535_0A02520"
                     /inference="similar to AA sequence:RefSeq:NP_015376.1"
                     /note="similar to Saccharomyces cerevisiae MAK3 (YPR051W);
                     ancestral locus Anc_3.331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142042.1"
                     /db_xref="GeneID:59233950"
                     /translation="MISYRPLDLGNLLHFEHLKRLIDADLSEPYSIYVYRFFLNRWPE
                     LAYLAFDDDSEKSDEPIGCVICKQESHRNRRMRGYIGMLAVESKYRGRGIAKTLVKKA
                     IKKMQKEGCDEIMLETEVSNNVALNLYEGMGFLRMKRMFRYYLNEGDAFKLILPLTAK
                     SCVRTTFLEENVD"
     gene            <508027..>511374
                     /locus_tag="HG535_0A02530"
                     /db_xref="GeneID:59233951"
     mRNA            <508027..>511374
                     /locus_tag="HG535_0A02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286148.1"
                     /db_xref="GeneID:59233951"
     CDS             508027..511374
                     /locus_tag="HG535_0A02530"
                     /inference="similar to AA sequence:RefSeq:NP_015374.1"
                     /note="similar to Saccharomyces cerevisiae ATG11
                     (YPR049C); ancestral locus Anc_3.330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142043.1"
                     /db_xref="GeneID:59233951"
                     /translation="MSNDAHIINAITGESVSTDLKFFMSLDDFKRFIIQKWNIPWDQL
                     LILLPFGNKLKASSFKDCLSNTAIGANEFYVYDRRLFSVINEPVYPQHDMSSNPELAE
                     KVESLLHLLTRDIQSKNECTLFKPISSPLEDVDLKLENLSHRTIISLLTTNLGWLSAL
                     EIDVHYFRKMIQEYLSQTSSIFKCLSICEQYLKLYCYDVEKLYNSNVQFLNQLADDTS
                     SKKWKDCYNNTLLRLDGLNGTLEQYVHREMLEENEMKLILLDQTIDNKLKKIRQELDF
                     NAELRNKVTKSVESIQKEFAPGSIKDRFEKVMLDKFDELVQDTRSTSRAILEQDFAET
                     QNSDLENAQQYLESIKNGVARKLLTIANAVYAQIELVLEQRGSLQKRAIITLGEIAFV
                     QMETLGIKKILLDDCNKELDVYQKLELELSQVESLPFIYGLYLIECYRRQIWCTLVTK
                     SIIKCSKELKDVLEKEKISRSRWIEKFGSVASIFSNSLDDLSDLHQLAKSFDETSYFQ
                     TTSQEYSTSSEDTKQFTLQVIEKYMKQMKELNVSTEITDILWQNFYEANSLSLELYMN
                     DKEPSDSPRTMTAGHQINGYRARIKKLESLLHDVKYSDPSRWPSGILNSNYMQPFHNS
                     ITTIGARAKLCDSNNSYNVMEMQLKIKNLQELAYQSNKTNDTKDLQLSAVNAKVADLE
                     IENAAFKENLSHLKKELARLAVVEEEKQSYILLQQKSFKSDIQSVIKENTSLVGELTS
                     ISENFRNVQDERDNLLLEFRRLKEKSVKQMDAFTSEGDKLTERNKQLENSMAGLRKTN
                     EELASKNTKAVYVDEATQTVEEPIEQSSLISNSHDMKDLLKRIEARTFEVFKSDVFIL
                     ENIGLLLAFDEEGFIKIKRVKGLKKDQNASILDESTQIPENDTVLKSSVFRGIKQLYN
                     ELQIKPESDKHNDFLFRLNKVYDDKLFENAVIGRFKDIEFLAKKLTKENKRKKGLLET
                     YQKERLALNNFQVGDLALFLPTRETISSCESSESSLISSFSSVDLSTPPPLDASIAVA
                     SSGGRKEKSAKARRNPPWAAFTAFEDNTRYFLKDENGLTKGREWFVGRILNLESNVVD
                     RQNYNPYKLPQGTVWFHLSATMISLSG"
     gene            complement(<511494..>513371)
                     /locus_tag="HG535_0A02540"
                     /db_xref="GeneID:59233952"
     mRNA            complement(<511494..>513371)
                     /locus_tag="HG535_0A02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286149.1"
                     /db_xref="GeneID:59233952"
     CDS             complement(511494..513371)
                     /locus_tag="HG535_0A02540"
                     /inference="similar to AA sequence:RefSeq:NP_015373.1"
                     /note="similar to Saccharomyces cerevisiae TAH18
                     (YPR048W); ancestral locus Anc_3.329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142044.1"
                     /db_xref="GeneID:59233952"
                     /translation="MTQTKASKRIAILYGSETGNAHDFASILSYKLRRLHFAHTLSTI
                     GNYSPSHILNCKYLFVICSTTGQGEIPRNGQERSDGTRNNTLWSFLKRKDLPEDFLSH
                     VHVSFLGLGDSSYPKFNYAIKKLHERIVNQLGAKELFARLEADEQCLIGSNKGTGAGI
                     EAVYFEFEKKTLKYLCDTFSLRKLNGELVKRQGISTDLYLEPISSLKKSDETENMIHN
                     TEPPRFLGDDNVKIGTVLNNKRITAEPHFQDVRQFVFKGIEHEEYYPGDTISMYPCNS
                     DEAVNQFLSLQPHWSNVADMPLEFNHGIPPDLMDGGLIGKLTLRGLLKYHCDIESIPR
                     ASFFMKIWTFATEIDKLERGREQLEQQREKLRQFAYDEDMQDLFDYCNRPRRSILEVI
                     EDFGSLKLPWEHMTDYLPIIKPRYFSISSAPCDPNIELTIAIVKYKTILRRIRKGVCT
                     EYVSKLAIGDSFRYKVQNKGTFHHNLKKKSMILVSPGVGIAPMMCLIRSNICKDISLF
                     FGNRYKEHDFLYESTLREWHNDKKISLYTCFSRDKENSSDIKYVQDNLWKFGEEMTRK
                     ILNNEALIFICGSSGKMPIQVRLTFVEMLKKWGNFEEDEQAADYLRQMEKNYRYLQET
                     W"
     gene            complement(<513698..>515137)
                     /locus_tag="HG535_0A02550"
                     /db_xref="GeneID:59233953"
     mRNA            complement(<513698..>515137)
                     /locus_tag="HG535_0A02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286150.1"
                     /db_xref="GeneID:59233953"
     CDS             complement(513698..515137)
                     /locus_tag="HG535_0A02550"
                     /inference="similar to AA sequence:RefSeq:NP_015372.2"
                     /note="similar to Saccharomyces cerevisiae MSF1 (YPR047W);
                     ancestral locus Anc_3.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142045.1"
                     /db_xref="GeneID:59233953"
                     /translation="MLHIKYTYKYMASRIPLKYWCSQVCSRLYSNGSKIIEIGGKKYQ
                     PDGNFTNVTPSMISLTGRSLHLKDRHPVGILRDAIENKLNSTDNAFLAYNTYKPVVST
                     YENFDSLGFPKDHPGRSKSDTYYVNSKYLLRTHTSAHELECFAKAKSGETNKPGFLIS
                     ADVYRRDEIDRTHYPVFHQMEGCRIWNRDNTAYTSNVEPGHITKMREDLKKLEQQLHQ
                     QQTKVVVEDDTSLDGNPKQNYMTDLEVDLCSKHLKRSIELVISDVFHRKLESLRKTNK
                     DASEIPTELQVRWIKAYFPWTAPSWEIEVWWQGEWLELCGCGLVQEDVLKKAGYAPDS
                     TISWAFGLGLDRIAMLLFEIPDIRLFWTQDERFQKQFQKGIINTFKPYSKYPSTMRDV
                     AFWLPQTENVEKIHENDLMEIVRNAAGDLVESVKLVDEFVHPKSGKKSLCYRINYQSM
                     DRNLTNNEINALQEEVRNELSRKYNVHLR"
     gene            <515692..>517539
                     /locus_tag="HG535_0A02560"
                     /db_xref="GeneID:59233954"
     mRNA            <515692..>517539
                     /locus_tag="HG535_0A02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286151.1"
                     /db_xref="GeneID:59233954"
     CDS             515692..517539
                     /locus_tag="HG535_0A02560"
                     /inference="similar to AA sequence:RefSeq:NP_014305.1"
                     /note="similar to Saccharomyces cerevisiae APP1 (YNL094W);
                     ancestral locus Anc_2.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142046.1"
                     /db_xref="GeneID:59233954"
                     /translation="MNQYDRGNKSSYINHDKDIVNETTLGKRQRFFNLVKNTKDVYIP
                     SITSTISQKTVDGFKRGINDRNEPQLNLPTDVDILFYPTYSTKVGEQFETTIRFSASS
                     PGNPASRKNRLLFSLCKQLVKPFPLEELDDASSDAMPDDAIGSSESRSNLSSRSTSTS
                     LNSSGQNSTSNSLPLHELDNLKERTLGFFARSVPNFPVILDILPEEGISNSQTITKTT
                     DERGYLYAKVRTDFQPSSIRITLDTPIDFPKIISREYPCNYVKPEGYGIISDIDDTIK
                     HTGVTGDKRSMFRNVFVNNIDTWLISEVSQWYKTLEEHFEIDFFYISNSPMQIYPVLQ
                     QYITRNFPKGPLFLKRYSGNLLSSIMTSSANRKILAIKQVFNDFPHKRFILVGDSGEQ
                     DFEAYINTAMQHPDQVVGIYIRCCKNSMSDMGLREIEVMRELNGMVQDEYLSPIGIKN
                     QEDTFSGRNFGQKMNLKQTVPTPPPVPPKKPKLTAEQERTIRDSRAPPIPTRKPVLSA
                     KQEEAIKESHLSSNASTENRTSDSIKAHPMQEPQDETDPMVYYTPSTQNDYGAYSTFF
                     DKKADNWRNRVLNGIRELKHLKKNRSIRLMFFTKPDAPLKDCLEEIQQK"
     gene            complement(<517670..>518695)
                     /locus_tag="HG535_0A02570"
                     /db_xref="GeneID:59233955"
     mRNA            complement(<517670..>518695)
                     /locus_tag="HG535_0A02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286152.1"
                     /db_xref="GeneID:59233955"
     CDS             complement(517670..518695)
                     /locus_tag="HG535_0A02570"
                     /inference="similar to AA sequence:RefSeq:NP_014734.2"
                     /note="similar to Saccharomyces cerevisiae TMA46
                     (YOR091W); ancestral locus Anc_2.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142047.1"
                     /db_xref="GeneID:59233955"
                     /translation="MPPKKNQQPQLAKKKDNVDKTFGMKNKNRSTKVQKFIKQVNAQA
                     DPQKEEMKRKKLEEKKRLEAQEAERRALFNPTDQRVRAGVDPKTVLCAMFKIGNCNKG
                     ARCKFSHDLSIGRKVEKKDLYQDGREEREKDTMDQWDEEKLRNVILSKHGNPKTTTDK
                     VCKFFIEAVENGKYGWFWTCPNGGNKCMYRHSLPEGFVLKTKEQKRLEREALENQPKI
                     TLEEFIETERGKLDKSKLTPITVQNFAEWKAANISRKIQVAKQNDIKRKLSGREVIMK
                     LYVENKKFDENDFEDPNEGSEWDLSEFTKALKNVENSNDSGIKDYGDGSNPTFEIRPL
                     KSNTASA"
     gene            <519473..>521215
                     /locus_tag="HG535_0A02580"
                     /db_xref="GeneID:59233956"
     mRNA            <519473..>521215
                     /locus_tag="HG535_0A02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286153.1"
                     /db_xref="GeneID:59233956"
     CDS             519473..521215
                     /locus_tag="HG535_0A02580"
                     /inference="similar to AA sequence:RefSeq:NP_014733.1"
                     /note="similar to Saccharomyces cerevisiae PTC5 (YOR090C);
                     ancestral locus Anc_2.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142048.1"
                     /db_xref="GeneID:59233956"
                     /translation="MMSSVIRTVKFRRSSKVLVKALSRKQISDVIYRTYFVGTSRLSG
                     SSSGNPNGNSSSSDATPSNKYMSPFKSRRDLKFALVGGSMLVLTYSYFSSKSVLSLDT
                     VKGIRQYTTGPVKGPNGSSTAANGGSASSSGGNDSITLLTESEVNAKLQDLQESYFVN
                     RGKGVLRYDVAQLPSNNPIEDSHVEQIVTVPSTNSADAGVEEDLCFFGIFDGHSGCFT
                     SKKLSTDLVPYVAQNLGKIYSDNSEVLSSSKLIDTAIEDAFVQLDNDIVYGSLRNLFK
                     NPTKEAMVHSLPAISGSCALLCGFNSYDSTIKVAVSGDSRALLCGLDDTDNWVVQSLS
                     TDQTGDNPREVERIRSEHPGEDNVIRNGRVLGSLQPSRAFGDYRYKVKEIDGKSLAEL
                     PEHVKIYFRSKPRDFLTPPYVTAKPEITTTKIDQKSKFMVLASDGLFELLSNEEIAGL
                     IVKWMEVNIVPKPHSSAPNGKLPKIKDLSSDKDLLRPAFRYQSTQKRSGPEYLMEDTN
                     VATHLIRNALSAGGRKEYVSTLVSIPSPMSRKYRDDLTVTVVFFGDSDNEPQNIDGSI
                     VVNNGATSQLKSKL"
     gene            <521592..>523106
                     /locus_tag="HG535_0A02590"
                     /db_xref="GeneID:59233957"
     mRNA            <521592..>523106
                     /locus_tag="HG535_0A02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286154.1"
                     /db_xref="GeneID:59233957"
     CDS             521592..523106
                     /locus_tag="HG535_0A02590"
                     /inference="similar to AA sequence:RefSeq:NP_014275.3"
                     /note="similar to Saccharomyces cerevisiae NAF1 (YNL124W);
                     ancestral locus Anc_2.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142049.1"
                     /db_xref="GeneID:59233957"
                     /translation="MSNEDVFSRALENDNADLKLTLPKNDVDTGIIDVGESADSAASS
                     SSSEGNSSVEEDGESSKDDESLEEESDSNESSTRADEEEEEEEEEVGATVAIRSKHEF
                     AEEPLPEVPENYQIPEKATISEIGMIKSAFDCNLIIYSTSSGERRVPKEGSIFCLEDR
                     TLLGPLCEVFGKLEAPVYRVSLPSSKLQQFNELKEHVGAKAFIVLPEAHWVDTFELKK
                     QKGTDASNGYDEELSNDEQEFSDDEKEALFKKMRKDQRRKKDGITKPKKQKSRVDQQE
                     VPQIKASWNSTSHSYRPRNARQHVNEEPSSSVPVPPRSAPYVQTNIQRKQTLMQPTMI
                     PSMTQPSLQPGVQPIRNIVSQDTQQGTHQCIDRTPYNAPNQQIPAYQLQSQFDQTLFQ
                     AQYGSPYGNHSQQMYGGFPNGQFYSPQQSVMQNPYVQQGPPQLQGGNMQQVLQLHQIL
                     MQQQQHQQQHQQQYQQQHQQQHQQQHQQQQQQQQQQQQQQQQYPEYRQEFNYDD"
     gene            complement(<523137..>526097)
                     /locus_tag="HG535_0A02600"
                     /db_xref="GeneID:59233958"
     mRNA            complement(<523137..>526097)
                     /locus_tag="HG535_0A02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286155.1"
                     /db_xref="GeneID:59233958"
     CDS             complement(523137..526097)
                     /locus_tag="HG535_0A02600"
                     /inference="similar to AA sequence:RefSeq:NP_011988.1"
                     /note="similar to Saccharomyces cerevisiae MSH1 (YHR120W);
                     ancestral locus Anc_2.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142050.1"
                     /db_xref="GeneID:59233958"
                     /translation="MLAAIIKEKNKNIEENDSSTNCIILRCHVCTIMRQLRGLRACWT
                     FVRRNHNLKKSSQVPALTKLRIIFDTTSKDNEADMPTNSAPLDTTQDKILTASGGSGT
                     HGAAKDLLPPTLLYVRDLMDRYENHVVLTQMGSFYELYFEQATTYAPKLNISLTNRTY
                     SCGKVPFAGFPVHQLSRHLKVLVNHYGYSVTIADQFKKNNDADNESFRFFRRVTRIVT
                     PGTFIDEAFENLQENTFLLNLEFPENSMEKPAESNLKIGLCWCDVSTGEIFVQQVILR
                     DLISAVTRIQPREILLDQSLSRYNLEAGSWYSELVELRKYFIKYQKAPSQHRTISSFF
                     GLFAAAGSSEGGIRQLKIQLQHFTQKEITALRRILVYVCDHLPDCTMNFQLPQRRITS
                     SIMQIDSRTSRALELHATVRDNRVRGTLFSTIRRTVTPLGTRLLAQWLSGPSLDLHEI
                     KNRQKLVEFFKNNSDTRESLRSMLKSIHDLPRILQKFSFGRGEASELMQIAGSLKTAS
                     IIKKLLKNEAQKSERKTEVLLHSFVTGLEFDGTLILDVLKYLNEDELIKSQKRTDEKM
                     EELPNNSPDSRSVDIFKLVSWSVHPSYSESLQDLHEKYQQVWLEKEKLRLTYQNFFVE
                     KEGAKSLTLKQRQNGEYALYLQGSSNNLKKISEFIRNGFNFEGYPFQILQQATQTRWL
                     SHKLWSNNGYELELALLRIKKEEMHIIDRFKGQFLEKSAEIRKISEILGYIDVLASFG
                     ALALEKSLVCPRMDKTNKLEIIGGRHLMVEEGISNRSLEKFIKNDCALEGGKSWIITG
                     PNMGGKSTFLRQNAIIVILAQMGSFIPCLKAQIGLVDKIFTRVGSADDLYNEMSTFMV
                     EMIETSFILRGATDRSLAILDEIGRGTSGKEGVGIAYATLRHLIESNRCRSLFATHYG
                     QELNEIISSKLGEDIKNKIEFFKSTTIETSDSDFCYDYKLKSGICSVSEAIKVAKAAG
                     FPKEALETARALLM"
     gene            complement(<526370..>529474)
                     /locus_tag="HG535_0A02610"
                     /db_xref="GeneID:59233959"
     mRNA            complement(<526370..>529474)
                     /locus_tag="HG535_0A02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286156.1"
                     /db_xref="GeneID:59233959"
     CDS             complement(526370..529474)
                     /locus_tag="HG535_0A02610"
                     /inference="similar to AA sequence:RefSeq:NP_011987.1"
                     /note="similar to Saccharomyces cerevisiae SET1 (YHR119W);
                     ancestral locus Anc_2.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142051.1"
                     /db_xref="GeneID:59233959"
                     /translation="MSGHYRRSVVPPSGPQRSYYSQYQYSNNRKDYQHRSRNFSSANE
                     YSGNPSEAWNSAAAYRANHDQNAIVATDHRFQYSYGEDHLDESYREIRYQLENRDRNK
                     LAIRARSEPIVQKRPAPVIRYDSELFKSKYHYFDPFKKVLIHKEEMFSWRDDPKIPVN
                     GFVLVQEFHGGQARSIMRERNPKESAQDPRERAIATKSFRKYRDKLDLLPFIAYDKYS
                     VGPPPPNEVVIYFASDVNTIQDISVKNYFKKYGEISHFEPFYDPNNALPLHVYLIRYA
                     SSHSGKSNEFKAARLAVKEHEKKGCFILGVKFNVILNKDDSLEKVISELVEKNIQKAN
                     RVQREIQRKTEENLKLSLTSSNLNNATQQADDQRIPADIEKLVNNRPALFVPNSFISH
                     HAMKVEDFKFKLRKYRWARMVDHIQGIFIVFNDLENARVCLAAESERMTIVSRTKKRP
                     VEITLILIVPTKNDRYNKAGSLTDLSSQLKEKSYDTEADLLEAATNFILQDLKYALHL
                     DIRKRVIGPAVFDTLNPSSFPELLVKKESKEREKREAALKLTEEAKKKQKTVNDFDIF
                     NLYGGYGSAAKVKRGPRKRAPVSRDISLLGSVKKLKVAKPMAHMLNEDSAPKEKEFSD
                     DSKSISEHSDAEMSSTSATSSDNEEEYEEISREGGVGTKSTTPEPILEQKPILSDEKS
                     VEMMSVPEIYRPTASKIPEPVFSDDTLAKDLSLIGFQDTIKDHEDLKLLRKTLGVNPH
                     IDNTLIDPLLNYEVWKLRTRYNSKARVQESQMRLNEVAFDHQLQSTHGSVKADGFCKI
                     PDRLKACYLPHRRKIHQPLNTVSHHIEPADGTPDSQREDSECLENSESVLQEISSSRD
                     NRASNRRFQQDIEAQKAAIGTESELLSLNQLNKRKKPVTFARSAIHNWGLYALEPINS
                     KEMIIEYVGERIRQPVAEMREERYLKNGIGSSYLFRVDENTVIDATKKGGIARFINHC
                     CNPNCTAKIIKVGGNKRIVIYALRDIAMNEELTYDYKFEREEDDAERLPCLCGAPNCK
                     SYLN"
     gene            <529799..>531034
                     /locus_tag="HG535_0A02620"
                     /db_xref="GeneID:59233960"
     mRNA            <529799..>531034
                     /locus_tag="HG535_0A02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286157.1"
                     /db_xref="GeneID:59233960"
     CDS             529799..531034
                     /locus_tag="HG535_0A02620"
                     /inference="similar to AA sequence:RefSeq:NP_011986.1"
                     /note="similar to Saccharomyces cerevisiae ORC6 (YHR118C);
                     ancestral locus Anc_2.149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142052.1"
                     /db_xref="GeneID:59233960"
                     /translation="MSSQQVQRCIRDVLGINDDDPVDWTESHMKKLASATSVLYNSSM
                     AKVMLKKAEETARCHLCAYMAAQRLQKKHDPDLQYYLDRIPLEPTKSRKLVELFEQNL
                     LQTSPMKNFTWTPSPKKRKMQSPIKGNVRFTSLNPSELRQQLFDTPTREKNERPIPEP
                     PVEISPEKTSPSKARRKLAFEEEFTEEEVLPSTPMEGIAINERISELSMQDEEYLSND
                     SPSKRKKSAQSSEQTLKRRKDGKGRQEISLLHKKYYKVTPVEVINTCNSFELPKDVAY
                     NILDQYMNYASNLVYPWQLVCGLVLNATFVVFTKRRRKDPRVDHLILSKMCGLMKCSQ
                     LGDIVESINLVKELIEGEKWYRDLQIKHDHYNGASYSEAISAKLGSMLQPNNILVSDE
                     QFNNWRRNIEQDLSLRNIS"
     gene            <531310..>534264
                     /locus_tag="HG535_0A02630"
                     /db_xref="GeneID:59233961"
     mRNA            <531310..>534264
                     /locus_tag="HG535_0A02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286158.1"
                     /db_xref="GeneID:59233961"
     CDS             531310..534264
                     /locus_tag="HG535_0A02630"
                     /inference="similar to AA sequence:RefSeq:NP_014276.1"
                     /note="similar to Saccharomyces cerevisiae NMA111
                     (YNL123W); ancestral locus Anc_2.150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142053.1"
                     /db_xref="GeneID:59233961"
                     /translation="MTIETWSGKRPASAVEEMIEETGICLKRPNNEDSLSDVDGDGNL
                     GAEFALETGNICKDSENYVKWQKTISKVVQSVVSIHFTQVASFDSEPPLVSEATGFVV
                     DSSVGIILTNRHVVGAGPFVGYAVFDNHEECDVTPIYRDPVHDFGFLKFDPKKIKYMK
                     IEALELKPTLARVGSEIRVVGNDAGEKLSILAGFISRIDRNAPEYGEMTYNDFNTEYI
                     QAAASASGGSSGSPVVNIDGYAVALQAGGSTEASTDFFLPLDRVLRALKCVQNNEQIT
                     RGTIQTQFLLKPYEECRRLGLTSGREDEARRMFPDKIGLLVATTIIREGPVDEKMKEG
                     DALISINGELISSFIQVDNILDQNVNKEIEILVQRGGVDHTIKCEVGDLHKITPDRYV
                     EVCGASFHELSYQMARPYALPVRGVFLCSASGSFDFDAKEKVGWIIDAIDNLETPNLD
                     TFIDVMQRIPDRKRVSVRYHHMTDQHSPQVTSIYIDRHWYRDLRVYKRNDITGVWDYK
                     NIGKPLPAEAIEPSTARIVDIPINNPDISKLSHSLCAVTSICAVPIDSLPADSHKTSG
                     LIVDAEGGYVIVSRTVISHDCLDVLVTIADSIMIPAEVVFLHPTQNYAVVRYDPSLID
                     APLVTPKLSTQRLKRGDKAHFVGYTFNSRVVTAETHVTDISSVSIPSNIIPRYRATNL
                     EGIFIDCNVSTKCNSGILADDDGTIRALWLSFLGERQESREKMYLMGLDITECLDIIE
                     ILRKGKKPKVSIVDAEFGSLSILHARIRNVPESWIKRMENESENRVQFIPATRVSYTT
                     DTVNLEAGDVILSVNDKLVKSMSDLEGIAAASDDPTIPEHLKFKVVRAGEVNELDIRL
                     VDVHETDRLVVFGGCLLQRPHHAVRQTMLNLPSEVYCTYRGDSSPAAQYGIYATNFIT
                     HVNETPTPDLDSFLETIKAISDNTYCKMRLVSFDNVPFAISLKTNYHYFPTGQLRKNL
                     DSNQWIQEEFNC"
     gene            complement(<534468..>534743)
                     /locus_tag="HG535_0A02640"
                     /db_xref="GeneID:59233962"
     mRNA            complement(<534468..>534743)
                     /locus_tag="HG535_0A02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286159.1"
                     /db_xref="GeneID:59233962"
     CDS             complement(534468..534743)
                     /locus_tag="HG535_0A02640"
                     /inference="similar to AA sequence:RefSeq:NP_014277.1"
                     /note="similar to Saccharomyces cerevisiae YNL122C;
                     ancestral locus Anc_2.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142054.1"
                     /db_xref="GeneID:59233962"
                     /translation="MLLNKLMWPVLRICFSAIRPQSQSLILTRNLMKTHKGAAKRWKK
                     TATSFKRGKAGRNHGNCGWSRRSLKVLSGKTLADDTHIQRLKRLLPY"
     gene            complement(<535201..>536994)
                     /locus_tag="HG535_0A02650"
                     /db_xref="GeneID:59233963"
     mRNA            complement(<535201..>536994)
                     /locus_tag="HG535_0A02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286160.1"
                     /db_xref="GeneID:59233963"
     CDS             complement(535201..536994)
                     /locus_tag="HG535_0A02650"
                     /inference="similar to AA sequence:RefSeq:NP_011985.1"
                     /note="similar to Saccharomyces cerevisiae TOM71 (YHR117W)
                     and TOM70 (YNL121C); ancestral locus Anc_2.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142055.1"
                     /db_xref="GeneID:59233963"
                     /translation="MSSESSLGSFVSRNKTAIIATVAAGTAAVGAFYYYRQLQETSGE
                     GEEADNKSVSKKKKNKKKKNGSASKPKYPVKENGEPDLDHIEEATDNEKESYAVALKD
                     KGNEYFKTKDFGNALKYYNHALAFKKDPVFYSNISACYVSLGQLDKVVENSTKALELK
                     PDYGKALLRRASANESLENYADAMFDLSVLSLNGDFNGASIEPMLERNLNKQAMVVLK
                     EKLGKNEVQQLPSDTSLASFFSIFPSETSLENFDENSEADKLLLNGLENIYRRSSEGY
                     KVADESFEKAASLYKAKLNDSSKSADEALKQNAATAFEYNGIFKFLKNDPLGAHAEIE
                     KAIELHPRVNSYIYMALIMADKGQADEYYQFFDKAIELDPKYAPIYYHKGQLYFITAQ
                     YEKSGKDFDKAKECDENNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNF
                     YAEILSDKGDLEAATKQFEIAKRLEEALEGIHVGVSPLVGKATLLARQPTVENFIEAT
                     KLLEEACEKDPRSEQAKVGLAQLKLQQEEMDEAIELFEQAAQLARTVDEKLQAITFAE
                     AAKVQKRVRADPVACAKIEETLAAYRAQGLI"
     gene            complement(<537252..>537617)
                     /locus_tag="HG535_0A02660"
                     /db_xref="GeneID:59233964"
     mRNA            complement(<537252..>537617)
                     /locus_tag="HG535_0A02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286161.1"
                     /db_xref="GeneID:59233964"
     CDS             complement(537252..537617)
                     /locus_tag="HG535_0A02660"
                     /inference="similar to AA sequence:RefSeq:NP_011984.1"
                     /note="similar to Saccharomyces cerevisiae COX23
                     (YHR116W); ancestral locus Anc_2.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142056.1"
                     /db_xref="GeneID:59233964"
                     /translation="MTNVQDNHKNGSQTTATNEAKNAPKVDFKDTSKVDFAPKGSDPD
                     TFKYYPDNPESGMNRYLFTMKGPSEYYDPCQQSAQMSFNCLERNDYDRAMCREYFDAY
                     RECKKQWLKARREARKQWD"
     gene            <538032..>539465
                     /locus_tag="HG535_0A02670"
                     /db_xref="GeneID:59233965"
     mRNA            <538032..>539465
                     /locus_tag="HG535_0A02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286162.1"
                     /db_xref="GeneID:59233965"
     CDS             538032..539465
                     /locus_tag="HG535_0A02670"
                     /inference="similar to AA sequence:RefSeq:NP_014280.3"
                     /note="similar to Saccharomyces cerevisiae NCS2 (YNL119W);
                     ancestral locus Anc_2.154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142057.1"
                     /db_xref="GeneID:59233965"
                     /translation="MAEQLICQRCRKEPATVVSRKERFSNDCFRKFVSQKQRKQMMSD
                     PYFQDIFKVMYQDRFRTSKEADLQNMQSTVLVPLSFGSSSLVMLDVLNDTLTEQKTTQ
                     RGKTGFQVDLIICYQTTEEKEAFKELAHNIINTRYASNKEKFKFHLIDLDSFFSSSKD
                     CLRVVALDARGATAIKANYSVEPSNSYNLKDLLNQCTDRTTREDILSFIRRHLIKKFA
                     SQHEQRAIMWGHSMTKLADETISLIVKGRGSEIAASMDCSKFDEDYNSSFKNLFPMKD
                     ILLSEIDAFCLVAKLDEFLYDYKPQDTLLIQKVQIINDTKYSTLVKNMTVNEIARKYF
                     DDIEGDYSNVISTVVKTANKLAEPQSLLIEKERSKKCVLCFSNIYTNGFKWLSDITIN
                     EGVPIEDDAEREIFNEWKNSTIGNKTEGYNRATELVTAHSCDVPVCYGCIIIFNRIKE
                     RRLTWPTKSKSELEGVLDECVLTDDES"
     gene            complement(<539632..>542082)
                     /locus_tag="HG535_0A02680"
                     /db_xref="GeneID:59233966"
     mRNA            complement(<539632..>542082)
                     /locus_tag="HG535_0A02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286163.1"
                     /db_xref="GeneID:59233966"
     CDS             complement(539632..542082)
                     /locus_tag="HG535_0A02680"
                     /inference="similar to AA sequence:RefSeq:NP_014281.1"
                     /note="similar to Saccharomyces cerevisiae DCP2 (YNL118C);
                     ancestral locus Anc_2.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142058.1"
                     /db_xref="GeneID:59233966"
                     /translation="MSLPLRPALENITSVDRVLEDLLVRFIINCPPEDLASVERELFH
                     FEEASWFYIDFVRIINPTLRALKIKSFAQNIIRLCPLVWKWDIKADEALQKFSKYKRS
                     IPVRGAAIFNENLSKILLVKGTESDSWSFPRGKISKDEDDVACCIREVKEEIGFDITD
                     HIDENQFIERNIQGKNYKIFLVSGVPENFSFKPLVRNEIDKIEWRDFKKMSKTIFKST
                     SKYYLVNSMIRPLSMWLRRQKQIKGDDQLKLYAEEQLKLLLGLTKDEQVDPGRDLLNM
                     LHSAVQANDTNLDSPSHDHPHIAQSTELWPPAYPSSNTSAPVPPPGFPAPFPQHAPPL
                     MGFQPFAPFQFTNGTLPYSNPHMMPLNMPSLPVPNMGPLPPPGAVLSTPDASSLSKPV
                     IASKQEDSGNTSSSKLLLDLLHTKPTASNKMTNGLGSDYDSTTNSSSQQSTNSDTVRN
                     PSITNVTDSLALLSILKGSNNKTFAENDSTTESKNEMRGNVVKQEVTYNTDRSTQREM
                     QQKISALENKKNVAVQDNYITDTQSNMNGNKSEVEDESYENYEDSTDEAGGHSVSEDE
                     DEDEDSDDGFGYEDFESESELEEEMKVENIQKEEEPAANSIGQDALKANRFQDGEVPH
                     KDERTESAKSVEGTRIANDAAKPKPKFKLLKRGENLEDVLTDIDNRSSQRSYSIGTVS
                     LVPETAAEKSEFDPLHTHSGILNETAFKNSEVLQPDVITPEKQTPEEELMSMLKKPHS
                     NHVASQQPTNEPYSSGHLLSILRKMPPKNVEVYPPTQQQDPPMSAENNLDASSVLLGI
                     LKGPKGVNITSSTRSDIQ"
     gene            <542381..>543277
                     /locus_tag="HG535_0A02690"
                     /db_xref="GeneID:59233967"
     mRNA            <542381..>543277
                     /locus_tag="HG535_0A02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286164.1"
                     /db_xref="GeneID:59233967"
     CDS             542381..543277
                     /locus_tag="HG535_0A02690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142059.1"
                     /db_xref="GeneID:59233967"
                     /translation="MSILRVGYIPEHFSTPIQFARLNGYFKEQGTTVELIEYPSGSGH
                     LISSLNADEIDIAVGLTEAFVRGIADTANPKDLKYEIVGTYVNSPLNWAVSTGVDRDD
                     INSLKDLQNGKMGVSRIGSGSYVMSFVLAADQGFEEPFQEFPVCHTFQQLRKRANDGS
                     CDAFMWEYYTTKKYYESPKELKMVGNIYTPWPSWVIVRNKKQDNKCTLAFTKAIDLGI
                     EYFNKYPQDAIDYIHKNLDYSEADAREWLKTVEFNTSGCHNFLNSDQVILKTLGILRS
                     ANVLQLDDVQQEENMKYGIAQF"
     gene            <546371..>548035
                     /locus_tag="HG535_0A02710"
                     /db_xref="GeneID:59233968"
     mRNA            <546371..>548035
                     /locus_tag="HG535_0A02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286165.1"
                     /db_xref="GeneID:59233968"
     CDS             546371..548035
                     /locus_tag="HG535_0A02710"
                     /inference="similar to AA sequence:RefSeq:NP_014282.1"
                     /note="similar to Saccharomyces cerevisiae MLS1 (YNL117W);
                     ancestral locus Anc_2.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142060.1"
                     /db_xref="GeneID:59233968"
                     /translation="MVKVSLENVKLLVDLDKEPQFAPSETTVETILTKDAFEFIVLLH
                     RTFNNRRKQLLQNRQVVQKKLDSGDFQLDFLPETARIREDPTWQGNILAPGLIDRSTE
                     ITGPPLRNMLVNALNADVTTYMTDFEDSSSPTWLNMIYGQVNLYDVVRDQVAFKTPRK
                     EYKLNKPISESPTLIVRPRGWHMEEKHLYVDDEPISASIFDFGLYFYHNAHQLIKIGK
                     GPYFYLPKMEHHLEAKLWNDVFNVSQDYLGIPRGTIRATVLIETLPAAFQMEEIIYQL
                     RNHSSGLNCGRWDYIFSTIKRLRNLPGHVLPNRDQVTMTSPFMDAYVKRLINTCHRRG
                     VHAMGGMAAQIPIKTDPIANEKAMTKVRNDKIRELTNGHDGSWVAHPALAAICNEVFA
                     NMGTRNQIHFVPENKVTAQDLVNTEIENGQVTTEGIIQNLDIGLQYMEAWLRGSGCVP
                     INSLMEDAATAEVSRCQLHQWVKHKVVLKDTGEQVTPELTARILREQVDKLSQESPVG
                     SKNKFSLAAKYFLPEITGEKFSEFLTTLLYDEILTVKDFPIDLSKL"
     gene            <548560..>550368
                     /locus_tag="HG535_0A02720"
                     /db_xref="GeneID:59233969"
     mRNA            <548560..>550368
                     /locus_tag="HG535_0A02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286166.1"
                     /db_xref="GeneID:59233969"
     CDS             548560..550368
                     /locus_tag="HG535_0A02720"
                     /inference="similar to AA sequence:RefSeq:NP_011983.1"
                     /note="similar to Saccharomyces cerevisiae DMA1 (YHR115C)
                     and DMA2 (YNL116W); ancestral locus Anc_2.157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142061.1"
                     /db_xref="GeneID:59233969"
                     /translation="MFNSSANSTALASGNGVNASTNTGTSTNTNTGIRRFSGSGAGSG
                     SGNMNNIITSGISPGGASGSSGSGQQRRRRGSGLNTFLNTFGIRQSNTSSANNNNASG
                     NSGNINGNNGFSNSNVIGSDNGSNTRTATATANTLAAPTSAVTNTMATASRTASNSSG
                     RFDPLESSNVATDFDPPQINAPALAHTSTHSQSFHRLPISISLTAQPEPSMPQNLQVR
                     HRSSVSASTSPIGQLGSISNPVVSNQPITDIDPLNPDNQGSNSESHNDNNSNSSGGGN
                     MNNNLATNNSNGGTELNNIASLKSLRHYIYAADQPNADELLNLDLPRNSALPEPVDEA
                     GLQQRKDKHGLFSIRLTPFIDNSFSTNSGLAFDPIIRTAGPGSQLVIGRYTERVREAI
                     SNIPEQYHPVVFKSKVVSRTHGCFKVDSDGNWYIKDVRSSSGTFLNHIRLSPASTLSK
                     DTLVHDGDVLQLGMDFRGGTEEIYRCVKIRVELNRSWKRRANAFNKEALQRIRNLQLT
                     MGIEEEDCSICLSKIKPCQAMFISPCSHCWHFQCIRRILMTSYPQFVCPNCRATCDLE
                     ASLENSDSESESDSDGGQLVDELGVLLEDPKDINMD"
     gene            complement(<550566..>552506)
                     /locus_tag="HG535_0A02730"
                     /db_xref="GeneID:59233970"
     mRNA            complement(<550566..>552506)
                     /locus_tag="HG535_0A02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286167.1"
                     /db_xref="GeneID:59233970"
     CDS             complement(550566..552506)
                     /locus_tag="HG535_0A02730"
                     /inference="similar to AA sequence:RefSeq:NP_014284.1"
                     /note="similar to Saccharomyces cerevisiae YNL115C;
                     ancestral locus Anc_2.158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142062.1"
                     /db_xref="GeneID:59233970"
                     /translation="MASKSISTSNRSIKSQDHSAIVAGVADGAASAGNSAGIMTNEAD
                     AALGEDQPLLSNSAQSQRKPSRRAIGANGQSGASEDVESETQFQGRLYKIHRKYQLFV
                     HNSKWILNILIIINSVWLVTTLICDYFFDVNIFWGNNRYGSFSDITLIFISIIANSFN
                     LWFNKLGLYSSLDYILNIILCLLTLFNLELLYIISYSRHRIGFIGTFTYLWAATSFFI
                     GVVLDWYLQFYNKEVYVPFNDSTDGEAGESGDNRNRDRISNGTSNSGKHTLKEWVYIG
                     LRNTVKALLLIFYILFTMNNILSAWDIHRVTGGIVDLKTETASYDAFHWVDDSHSYKL
                     HIKCYGDVFNSEDSYDGGKKQQAILLYEHGGFDTGYLSATWIQELFHLNRVQRYCTYE
                     RPGYGLSDSAPAPISIAMVADSLKHALLNEAKIKGPFVTVGYDVGGLFTQVFTAKNVD
                     IVEGMMLVESWHEDLLLKKYLQRILPPDHGGDGDGDNQPDRDPDDISWLPPEIRRYNE
                     FRIWWDGIWSTLGIKLQTSWLLAHHGSNERIYGRDMQYQGRFLRAKFLESVTSSLLSY
                     NDVLNYKDKLKNVKVSVVSAKEMIRKSPQWGNWQRELSKISGKVQEWKIVDGGHEFYK
                     FNLGKQQTQDVLLRLIDEKDRY"
     gene            complement(<552963..>554822)
                     /locus_tag="HG535_0A02740"
                     /db_xref="GeneID:59233971"
     mRNA            complement(<552963..>554822)
                     /locus_tag="HG535_0A02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286168.1"
                     /db_xref="GeneID:59233971"
     CDS             complement(552963..554822)
                     /locus_tag="HG535_0A02740"
                     /inference="similar to AA sequence:RefSeq:NP_011982.1"
                     /note="similar to Saccharomyces cerevisiae BZZ1 (YHR114W);
                     ancestral locus Anc_2.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142063.1"
                     /db_xref="GeneID:59233971"
                     /translation="MSESFSIGNEIKDSYKETQNWASNNVKWLKDIEAFYRDRAKLEK
                     EYSEKLDHLSKEYAAKKSTVSVSLSVGDTPKVTPGSLEAACLVAWNEVLSQTSFISQD
                     HSQLSKEFDNVIAHQLSGLNAKLDMTLSKINGFNGEVTDKRDAIYSELEKAKKNYDDV
                     CMAMEAARSKHTKSPNDRNKRKLEEKETEMNIAKNEYLIKINQANRVKDKYFFQDVPE
                     VVDLLQDLNESRILFLNTIWTSASSVEIAASDNIIKRLESANSVIAQNKPSMNTAMFI
                     KHNLKNWNEPTDFRYQPSAVWHDDDKFAVPTHTELNDLRIKLAKSEKDYNKFHDLSQS
                     ELSRLSSLNQKKRELKSSENSLDGQDFYETLKSYLSVVMSFTSHETLKLKAEVEIESI
                     QNNVPSNMDLSTDDIDLSRLKKKTGILSKLKKNILNTESKSGNSSSFFGAITSHTHDF
                     GGKENSSENDGADNYSIKNAATTSKHAVPSKSNNNKVLFAYSKQDSDETTISVGDSVT
                     LEVPDTGSGWTKVRNNTTGESGLVPSTYVEINEETPSKNGNSNAPQVPPPRRTTLPTR
                     ILTAQYDYEAQGDDEISISAGDAIEVIRGDDGSGWTYGQLNGAKGLFPTTYCT"
     gene            <555077..>555886
                     /locus_tag="HG535_0A02750"
                     /db_xref="GeneID:59233972"
     mRNA            <555077..>555886
                     /locus_tag="HG535_0A02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286169.1"
                     /db_xref="GeneID:59233972"
     CDS             555077..555886
                     /locus_tag="HG535_0A02750"
                     /inference="similar to AA sequence:RefSeq:NP_014758.3"
                     /note="similar to Saccharomyces cerevisiae TRS33
                     (YOR115C); ancestral locus Anc_2.160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142064.1"
                     /db_xref="GeneID:59233972"
                     /translation="MERHTVAGVSATVNSERSDVDAMTEQQRIQQQLHVFQSSLPKVN
                     ELAYQLLFNEIIPLSMAVEKKLLNKTNLQDDQKVAKQDDDKATKDFEKLHINASLDAP
                     SHKMCQEISESDQTKQERVFERVRNIGFQIGNKITELLVFSNNPNLRFKDMDLLAIMK
                     FICRDVWKQLFGKQIDNLKTNHRGTFYLFDYDYRPIQSFSLESGSAEKELALVKPFLE
                     LPIGIIMGVLSSLGYSGEEVQCMATFVNRPDDRPKSTFHKGISFHVQVNSQ"
     gene            complement(<555978..>556823)
                     /locus_tag="HG535_0A02760"
                     /db_xref="GeneID:59233973"
     mRNA            complement(<555978..>556823)
                     /locus_tag="HG535_0A02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286170.1"
                     /db_xref="GeneID:59233973"
     CDS             complement(555978..556823)
                     /locus_tag="HG535_0A02760"
                     /inference="similar to AA sequence:RefSeq:NP_014757.1"
                     /note="similar to Saccharomyces cerevisiae YOR114W;
                     ancestral locus Anc_2.161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142065.1"
                     /db_xref="GeneID:59233973"
                     /translation="MHCSKVLRAQLSQTVYHTKKAFDKRLDSVPTTAFHYYYQTKIKE
                     MQTYSGPSSSRDQLNFAHYNNGFKRYIRKEWSLLSGTRRRLYYAFFFHFTKIDHTTLN
                     ECELARIMEISTPAISEYMLFRNKYKSKFDTIWSEQEATVQRKKTPGTRRNAKISDES
                     MKVTLSNTQRDHLLSLSVDNTRDDIKNLTKRFREMCRECRTAWETCISDGRKLEIKKK
                     WQEQKRRFELQLQYERRILDYNLNKLSQIDFRCNSLCVELPVTHTLVDTKSMDVLRLA
                     SHKKK"
     gene            complement(<557233..>560040)
                     /locus_tag="HG535_0A02770"
                     /db_xref="GeneID:59233974"
     mRNA            complement(<557233..>560040)
                     /locus_tag="HG535_0A02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286171.1"
                     /db_xref="GeneID:59233974"
     CDS             complement(557233..560040)
                     /locus_tag="HG535_0A02770"
                     /inference="similar to AA sequence:RefSeq:NP_014756.3"
                     /note="similar to Saccharomyces cerevisiae AZF1 (YOR113W);
                     ancestral locus Anc_2.162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142066.1"
                     /db_xref="GeneID:59233974"
                     /translation="MNDENHPKDSGSHAGSAGAPVGVGGNSANVAGGSGVGSSMSGGN
                     MGGGAGSGDGVSGNGAVFALKQPQRQDSISMFTNFSHPRFSTDASISSFLNIASERPS
                     VSGGVPSNGDLSQIGRGYSIINNMWPQQMGGLGGGANGGTPRNSDVGQGQFNTVRRQS
                     ETLEPFMPPRFKTPSFSSKQPSQQQQRQQQQQQQQQFADSNTGVSNSNMVPQQYRFPT
                     TPQPSSKRNSIYFGPNDAADLEFFHSATAGSQTAAATSKRDSFTANSMKPPMIVPLSS
                     GAVPTVNNNGKFSYNSSNTNTSTNTSANTNANPNVGMNSHANAGINSNANVSANGNTN
                     ANAIANTNPNTNPATSVSEFDTLFSSANGGANNSGVINGNSLLNTRNNSLKFNAEDFD
                     FQFKRRDSSVRATLDNQSYTPGPRGFPNGSSNNNNNNNNNNSNNNNNGNVNNNDTDNG
                     STLANSNNNNGNVIDDTQKLSNVKRQKRSASSNNNDHVNEIGKEELIHSDLDVNVNST
                     HEALSKLPNPLLDTSDSSQLDDSKPLLGVTKVDQLMLMIQARKKGVTEKVTTTADGRL
                     LINEDSDILPQPYQLVGGVEKPKGSHGVKQHECPYCHRFFTQSTHLEVHIRSHIGYKP
                     FQCEYCGKRFTQGGNLQTHQRLHTGEKPYECELCGKRFSRKGNLAAHIVTHQKLKPFV
                     CKLDGCNKSFTQLGNMKAHQNRFHLNTLNELTQRLAEMDPNENIAPQERELLEYFASL
                     YKNSNKGIKGRGKGSTRISPESSRNFTHMHSNSQSHRSSASPTSALVQSQSQPPQQMV
                     MNTSASGNSLNPAVYAAIKSQHLHHHHHHHHQQQQQQQQQQQQPQSVHLKNDSEMKYG
                     YPAIHNHSTQGSPDSAILNSAAQIPLRNTTSASSASSVSSNNAFAFSLDQPDKIDENS
                     ANVTGTIGKGQVQFKNVNYKA"
     gene            complement(<560387..>560959)
                     /locus_tag="HG535_0A02780"
                     /db_xref="GeneID:59233975"
     mRNA            complement(<560387..>560959)
                     /locus_tag="HG535_0A02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286172.1"
                     /db_xref="GeneID:59233975"
     CDS             complement(560387..560959)
                     /locus_tag="HG535_0A02780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142067.1"
                     /db_xref="GeneID:59233975"
                     /translation="MRCCAVLAAQLIGHVCDTLLTLFFSVIQLCLLEERPREPFVRSG
                     RVTPVHRRLGRVACSPQLCVLPGLLPGVPIPRLAPRRPAESWRSRRAGFSMLPEAVRC
                     PVSALRHRTLSQPSRTDGSQQEMLLNNPPLTRSGKEGQDQAKTKKTTERKKSKEQSIN
                     KDMIRIDHFIKKQVQETRDDRHSKSYCKSV"
     gene            <560976..>561365
                     /locus_tag="HG535_0A02790"
                     /db_xref="GeneID:59233976"
     mRNA            <560976..>561365
                     /locus_tag="HG535_0A02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286173.1"
                     /db_xref="GeneID:59233976"
     CDS             560976..561365
                     /locus_tag="HG535_0A02790"
                     /inference="similar to AA sequence:RefSeq:NP_014286.1"
                     /note="similar to Saccharomyces cerevisiae RPC19
                     (YNL113W); ancestral locus Anc_2.163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142068.1"
                     /db_xref="GeneID:59233976"
                     /translation="MAEQVEPPVVDEDVIMDPEAEVVDEEEEPDREKIKLLPQASTED
                     GTCASFQIVDEDHTLGNALRYIIMKNPDVEFCGYSIPHPSENLLNIRIQTYGESTAVD
                     VLHKGLKDLTDLCDVVEEKFTQRIKEM"
     gene            <561654..>564183
                     /locus_tag="HG535_0A02800"
                     /db_xref="GeneID:59233977"
     mRNA            join(<561654..562920,563810..>564183)
                     /locus_tag="HG535_0A02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286174.1"
                     /db_xref="GeneID:59233977"
     CDS             join(561654..562920,563810..564183)
                     /locus_tag="HG535_0A02800"
                     /inference="similar to AA sequence:RefSeq:NP_014287.3"
                     /note="similar to Saccharomyces cerevisiae DBP2 (YNL112W);
                     ancestral locus Anc_2.164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142069.1"
                     /db_xref="GeneID:59233977"
                     /translation="MSRDSQFNRSNYNSRGGDFRGGRGSDRNSYNRDGNRSSGGSFQG
                     NSRSFQQGPQELMKPNWDEELANLPTFEKNFYVEHESVRNRSDAEIEAFRKENEMTIS
                     GHDIPKPITSFDEAGFPEYVLSEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSG
                     KTLSYCLPSIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCV
                     YGGVPRGQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFE
                     PQIRKIVDQIRPDRQTLMWSATWPKEVKQLASDYLNDPIQVQIGSLELAASHNIKQVV
                     EVVTGFEKRDRLLKHLEIASEDKESKILVFASTKRTCDDITKVLRDDGWPALAIHGDK
                     DQRERDWVLNEFRTGRSPVMVATDVAARGIDVKGISYVINYDMPGNIEDYVHRIGRTG
                     RAGASGTAISFFTEDNKSLGSSLISIMREAKQEVPAELLKYDRRGHGGHPRYGGGYGG
                     RGGRGGYGRGRGGYGGRGGRGGFGGGRPRDGGWGGNRY"
     gene            complement(<564301..>566574)
                     /locus_tag="HG535_0A02810"
                     /db_xref="GeneID:59233978"
     mRNA            complement(<564301..>566574)
                     /locus_tag="HG535_0A02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286175.1"
                     /db_xref="GeneID:59233978"
     CDS             complement(564301..566574)
                     /locus_tag="HG535_0A02810"
                     /inference="similar to AA sequence:RefSeq:NP_014755.1"
                     /note="similar to Saccharomyces cerevisiae CEX1 (YOR112W);
                     ancestral locus Anc_2.165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142070.1"
                     /db_xref="GeneID:59233978"
                     /translation="MLSAWLHQVSLGAIPGMSFINIFKSISNFQFPYSLEDKPVYEST
                     LWQVLNGTRKSDSSPVTVFKANRSQQNEDLILNAIHKAKVLRIPGLCPVLETFDSDPQ
                     STFIITERVKPFPWDDIRELQSNGESIQLGISQLLTTLKFLNEFVVGTISRESIFIDS
                     KGQWLLFGMELCQKKSEISSRKFASDVQLYNKLMGLQTTTDDFQRIDSLQLSNLIIEL
                     IGSASKVPTDWQVPLQNLSRTRITFDAFMSRLESTNTWLSNPLISISQQLKELHIKDP
                     QDKLAVMLQIQSIFFDARNVFHNMTPGFIEGLLLPELSNIIQWLISTQNSSASSIARL
                     IPFLAIFLDLTIDKDFFPEASKTLIYECFALPDRQVRFLLLIYLPKVAKKLSSTELSG
                     KIFPRFAQGLADSDPTLRLQTLKNIPIIVPHITERQLNNELLRHLAKTQVDQDVDIRT
                     WTVIIITQIATLLSTSSGNRASILATAFTKSLKDPIIKPRLAALYGLKKTIDLFDVTT
                     IANKILTVIAPELLDKDPLVRSKAKNLFEKYLNKLESEAKCIQESSKSVTQSEDINFD
                     EYGKNEEKNDAELVKQFMSTVVISSFPDQSPSPNVTTVEPAPLDAWDTFDDDKNNEGN
                     SDSTGVPFSTRSTPNSHGHTSYPSKVTVEESWNDDFDNDGFGNDDSTDAAWADGGIWE
                     AEQESKPVPSIGKPVKPVKKVSILANTKTRTSILTPRSKSSQASAKSRASIKDRLKVN
                     KSMEEEPVGDDGWDNTW"
     gene            complement(<566813..>567181)
                     /locus_tag="HG535_0A02820"
                     /db_xref="GeneID:59233979"
     mRNA            complement(<566813..>567181)
                     /locus_tag="HG535_0A02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286176.1"
                     /db_xref="GeneID:59233979"
     CDS             complement(566813..567181)
                     /locus_tag="HG535_0A02820"
                     /inference="similar to AA sequence:RefSeq:NP_014288.3"
                     /note="similar to Saccharomyces cerevisiae CYB5 (YNL111C);
                     ancestral locus Anc_2.166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142071.1"
                     /db_xref="GeneID:59233979"
                     /translation="MSNVFTYQEIAEHNSPEDAWIIIDGKVYDVTKFVDEHPGGDEII
                     LELAGQIATEPFNDIGHSDDALKKLEKLLIGRVDVNSEPLNQTEASQSTQTTGGEGSG
                     KLAILCAIVFFAVAYYLSNH"
     gene            complement(<567575..>568273)
                     /locus_tag="HG535_0A02830"
                     /db_xref="GeneID:59233980"
     mRNA            complement(<567575..>568273)
                     /locus_tag="HG535_0A02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286177.1"
                     /db_xref="GeneID:59233980"
     CDS             complement(567575..568273)
                     /locus_tag="HG535_0A02830"
                     /inference="similar to AA sequence:RefSeq:NP_014289.1"
                     /note="similar to Saccharomyces cerevisiae NOP15
                     (YNL110C); ancestral locus Anc_2.167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142072.1"
                     /db_xref="GeneID:59233980"
                     /translation="MVKKTTKQRDEKSVKAPKPEPVEKVEEEENVESTLNSEASSSAV
                     KASNSESDSNSDSNLDSDEEADDIKGLDVDDETSTHKIKKLETKKQSDNKQKNDRDHS
                     GVVYVSRLPKGFHERELSKYFAQFGDLKQVRLARNKKTGNSRHYGFIEFVNKEDAKIA
                     QETMDNYLLMGHILQVRLLPKGAKIEKLFKHKGRVFIQTEIKKSVDELKAQAKNKHEL
                     RMEKLTQSGIEFKW"
     gene            complement(<568502..>569185)
                     /locus_tag="HG535_0A02840"
                     /db_xref="GeneID:59233981"
     mRNA            complement(<568502..>569185)
                     /locus_tag="HG535_0A02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286178.1"
                     /db_xref="GeneID:59233981"
     CDS             complement(568502..569185)
                     /locus_tag="HG535_0A02840"
                     /inference="similar to AA sequence:RefSeq:NP_014754.3"
                     /note="similar to Saccharomyces cerevisiae YOR111W;
                     ancestral locus Anc_2.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142073.1"
                     /db_xref="GeneID:59233981"
                     /translation="MVSSHGSRISHTIASKFDIILASSSPRRYEILHDVMGIKELTLM
                     KPSFAEDLDKSVYQDNPIGYVCDTSRCKAEGIVGDLKRMNCEQGKPKLVICADTVVID
                     SNNRIYEKPKSKEIQLQNLKNFCYSKGYSPLKVVTAVTIIRWKCEEDYQIRKTFHETT
                     DIVCDDEIPLKLLEDYVDSEDGINVAGGFKIQGMSAMIIKKIDGDYYNVVGLPLNRTF
                     MAIIHETSD"
     gene            complement(<569343..>570608)
                     /locus_tag="HG535_0A02850"
                     /db_xref="GeneID:59233982"
     mRNA            complement(<569343..>570608)
                     /locus_tag="HG535_0A02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286179.1"
                     /db_xref="GeneID:59233982"
     CDS             complement(569343..570608)
                     /locus_tag="HG535_0A02850"
                     /inference="similar to AA sequence:RefSeq:NP_014291.1"
                     /note="similar to Saccharomyces cerevisiae YNL108C and
                     TFC7 (YOR110W); ancestral locus Anc_2.169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142074.1"
                     /db_xref="GeneID:59233982"
                     /translation="MTVKTIYIARHGYRSNWLPTGPYPPPPTGVDSDVPLAKHGIDQA
                     KELAHYIVSLDNQPELIFSSPFYRCIQTSEPIADILELPIQIERGLGEWYRPDRPIIP
                     VAAPIETLEHFFPGKVNPKWESISVVSDKGETEINLFKRCADLWPKFIGKIENEYPNV
                     ETILIVTHAATKAALGMSLMGYSNWKEPLDEDGSIIRSGSCSLDKYEVHLTGSIEAGE
                     EYINVPFTKRNWRMTMNGNAEFLSLGEEMNWDYRNAFEAGSDADIKLRKEAAAKGAKD
                     VVANTSPGDEKEFESVYVSVDIPSADYRGKSEIDRTACLQHSGLETEAPLFKIKDKIY
                     EGSWKKLVGTELAFFNEASVNKKSDKGAKESNNISSNQDEQGNMNSSQQAASHESDEQ
                     EDANEDKAKHSEKIYKITDRVVLSGLRRL"
     gene            <570780..>571415
                     /locus_tag="HG535_0A02860"
                     /db_xref="GeneID:59233983"
     mRNA            <570780..>571415
                     /locus_tag="HG535_0A02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286180.1"
                     /db_xref="GeneID:59233983"
     CDS             570780..571415
                     /locus_tag="HG535_0A02860"
                     /inference="similar to AA sequence:RefSeq:NP_014292.3"
                     /note="similar to Saccharomyces cerevisiae YAF9 (YNL107W);
                     ancestral locus Anc_2.170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142075.1"
                     /db_xref="GeneID:59233983"
                     /translation="MPPGVSKRIKTLSVTRPIIYGNTAKKLGEKRPPNAPAEHTHLWT
                     IFVRGPQNEDISYIIKRVVFKLHDTYPNATRTVEAPPFELTETGWGEFEINIKIHFVD
                     EANEKLLNLYHHLRLHPYNNINPDYPQKTDEISSIYYDEIVFNEPNEDFFKILMSTPG
                     NLLPSNKTESCVFSRQLEQEELDRIDIGIKKVADEYNNLKAEITKQFGGNA"
     gene            complement(<571599..>574967)
                     /locus_tag="HG535_0A02870"
                     /db_xref="GeneID:59233984"
     mRNA            complement(<571599..>574967)
                     /locus_tag="HG535_0A02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286181.1"
                     /db_xref="GeneID:59233984"
     CDS             complement(571599..574967)
                     /locus_tag="HG535_0A02870"
                     /inference="similar to AA sequence:RefSeq:NP_014293.1"
                     /note="similar to Saccharomyces cerevisiae INP52 (YNL106C)
                     and INP53 (YOR109W); ancestral locus Anc_2.171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142076.1"
                     /db_xref="GeneID:59233984"
                     /translation="MIILLSTQPERRIAIVSDSFALILKSVGEKQSKRPRCAIELVPK
                     NDLDNHGFKKLSLREIYGFVGLIEIDGLIFIGTITGKSKVAQPIPGETVNKIFAVDFF
                     CLNDSRWDFVEIDASGYPVVSDNDTQDYQESSPRHPCYELRKLLSNGSFYYSSDFDLT
                     STLQHRGFSDYSLSVDNFQEEYMWNSFLMQEIITYRDRLDGDAKQTLDEQGFLTTVIR
                     GFAETFVTYIKKLKVGLTVISKQSWKRAGTRFNARGVDDEGNVANFVETELIMYSSQY
                     CYAFNQIRGSIPVFWEQDTSLINPKVQITRSLEATQPIFDEHFMNLINEYGPVHIVNL
                     LSTKSAEIELSQRYKEHLKKSKKLKLGEDVFLTEFDFHRETAQEGFSAVEKVIPKILD
                     SLLVSGYFSYDVKEKKVISEQQGIFRTNCLDCLDRTNLVQQTISIAAFKTFLEDFHLA
                     SASSSNDSDDYIVKHNNLWADHGDQISQIYTGTNALKSSFSRKGKMSFAGALSDATKS
                     VSRMYINNFMDKGKQQNIDTLLGRLPHQQCVQLYDPINEYVTTKLEEIFDEFTSHSTI
                     NLLVGTFNVNGTSRQSDLSKWLFPIGDKFKPDFVVLGLQEVIELTAGSILNADYSKSS
                     FWESMVGKCLNQYEEKYILLRAEQMSSLLILFFVRSDKAQLVKKVEGASKKTGFGGIT
                     GNKGAVAIRFEYGVTSFCFVNAHLAAGSGSIDERRNDYESIVKSICFTRSKTIPHHDS
                     IFWLGDLNYRIQLPNEEVRSELLNQNDGYIEKLLRYDQLTQEINSGVIFQEFKEPTLK
                     FRPTYKYDYGTDTYDTSEKARTPSWTDRIVYKGDNLHPLAYSDAPLMMSDHKPVYAAY
                     RAKVTYVDEAIKLDLTKRLYNDYKAAHPEELEKNGRSLMEADLSGQNTNQKLRKFEPA
                     STAILLDLPNSSASLNTSVSSSSSSSLSSVLLQPAARKENSPPIDGYGKAKLRAPPPP
                     APRSSTASLTKVSDISPEVSSYLPRKSYTTAVTSRSTPPPVPQARKPVPPGFNEVIMT
                     PKNNSSRSVSAANSKAGSPAAEGVNSSCMAVPTSSSTITSANQSTRIKEDKLSHSEPK
                     VSISPKRKVPPMRPAKKPELENLSLDSWKPLTPK"
     gene            complement(<575298..>577142)
                     /locus_tag="HG535_0A02880"
                     /db_xref="GeneID:59233985"
     mRNA            complement(<575298..>577142)
                     /locus_tag="HG535_0A02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286182.1"
                     /db_xref="GeneID:59233985"
     CDS             complement(575298..577142)
                     /locus_tag="HG535_0A02880"
                     /inference="similar to AA sequence:RefSeq:NP_014295.1"
                     /note="similar to Saccharomyces cerevisiae LEU4 (YNL104C)
                     and LEU9 (YOR108W); ancestral locus Anc_2.172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142077.1"
                     /db_xref="GeneID:59233985"
                     /translation="MIFRQTLVTLAENVSRSAKSIPPVKLAYKNMLRDPSVKYRSFPV
                     PKLPNRTWPNNTITKAPRWLSTDLRDGNQSLPDPMSVEQKKEYFHKLVAIGFKEIEVS
                     FPSASQTDFDFTRYAVENAPDDVNIQCLVQSREHLIKRTVEALTGAKKATIHTYLATS
                     DLFREVVFNMSREEAIVKAVEATKLVRRLTKDDPNQQGTEWSYQFSPETFSDTPVEFA
                     VEICEAVKAAWEPTAENPIIFNLPATVEMTTPNVYADQIEYFATHISEREKICISTHC
                     HNDRGCGVAASELGVLAGADRVEGCLFGNGERTGNVDLVTVALNMYTQGVPPNLDFSD
                     LTSLIEVVERCNKIPVSPRAPYGGDLVVCAFSGSHQDAIKKGFNLQEKKRAEGNQIWA
                     IPYLPLDPKDIGRDYEAVIRVNSQSGKGGAAWVILRCLGLDLPRNLQIEFSTIVQDKA
                     DALGRELKADEISKLFRETYNYNNEFFNKIALLDYNVEKVGDDRRNLTGQVSIDGKVY
                     DISGSGNGPVSSMIDALSNLFNIKFAVANYTEHSLGSGSSTQAASYILLNYRRDSDNQ
                     NAYQWGIGVTEDVSDASIKAIFSTVNNIVASGEVPLPESSQARAAGHA"
     gene            complement(<578348..>579274)
                     /locus_tag="HG535_0A02890"
                     /db_xref="GeneID:59233986"
     mRNA            complement(<578348..>579274)
                     /locus_tag="HG535_0A02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286183.1"
                     /db_xref="GeneID:59233986"
     CDS             complement(578348..579274)
                     /locus_tag="HG535_0A02890"
                     /inference="similar to AA sequence:RefSeq:NP_014750.3"
                     /note="similar to Saccharomyces cerevisiae RGS2 (YOR107W);
                     ancestral locus Anc_2.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142078.1"
                     /db_xref="GeneID:59233986"
                     /translation="MPDSSRSANVVNFPPLSELLSQLTLDEGEGRSEKDERDKALDSS
                     EESPFNIKNFEAFLLRSHCAENFEFWKDCNYYLANYHREDFDYKGWNKKIYENFIQEN
                     SSMECNLPDRMRKLFGEWYRSETIADRDAVLRAKQHAIDLMSDAYRHFVRSVNTSYSV
                     PASNSVSTSSVYTSTTTSTEKAESDATIEAAKRAEVRRTETSSQSNREVCSLKTKSKK
                     VSRSADSLSSLAAFSSQDSDTEGRTTGSKDIMRSNSSGSYNFFDKGLALMTKLKKKKV
                     RPKLNSPPSASGDEPSFYLHLKQSAINRTSNE"
     gene            <579925..>581772
                     /locus_tag="HG535_0A02900"
                     /db_xref="GeneID:59233987"
     mRNA            <579925..>581772
                     /locus_tag="HG535_0A02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286184.1"
                     /db_xref="GeneID:59233987"
     CDS             579925..581772
                     /locus_tag="HG535_0A02900"
                     /inference="similar to AA sequence:RefSeq:NP_014296.4"
                     /note="similar to Saccharomyces cerevisiae MET4 (YNL103W);
                     ancestral locus Anc_2.174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142079.1"
                     /db_xref="GeneID:59233987"
                     /translation="MSNNEGTSSYTADFRNIFGSDVGNKEENGEEMSGRGHRAETARG
                     NGDMHESAISVPPSSLLAVEGTSFNHMNQRNEGDDITPSILLEQLAYVDNFLPSLEQD
                     FANLDSWVMGGNEFGSANTPTSQGIQHHNAMGVDERLALELNAFADDSFIFPDEDKSQ
                     MLGHGKEGDSDDEEGGVDASDSNKNNNNNNNNNNNNNNNNNNNNNNNNNSYNSINNNN
                     NNNNSSSGNSNNTGSHFLTQRRNTFLTSQYDHSKSRFSARKRQKVDQNNDDETTSNHS
                     SSSNQDHGGFSNFDVIPNNGDASNMMSNLYSPSISSPLNNLRASQSLSTLNSGNVTPG
                     PPFIEGVSGNDANPQIQMPDYSTIPTSTLVSLLPKVKVPPNAYKNLIDQGLDSDQINA
                     IAVIIAHHQREKMKENRNANVQYQQASHNSNDASRSASFLLDVLSRGNSTRDIADNSQ
                     TEKKKDEKLPSLENNEYFAENVSSRTSKESTPRAEKPPTNSVIKQEEPFSIANPGRRE
                     GSASEGKSTAMRKQNVRDSSAQVPTTRKSHQKRKLKENELEASVHELSELAISLQQKI
                     HTLEMENNLLKNLVTSSGELEGIEKAENMRKGVFAKIVNGSKDETYDCA"
     gene            complement(<581887..>582741)
                     /locus_tag="HG535_0A02910"
                     /db_xref="GeneID:59233988"
     mRNA            complement(<581887..>582741)
                     /locus_tag="HG535_0A02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286185.1"
                     /db_xref="GeneID:59233988"
     CDS             complement(581887..582741)
                     /locus_tag="HG535_0A02910"
                     /inference="similar to AA sequence:RefSeq:NP_014749.1"
                     /note="similar to Saccharomyces cerevisiae VAM3 (YOR106W);
                     ancestral locus Anc_2.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142080.1"
                     /db_xref="GeneID:59233988"
                     /translation="MSFFDLESQNASALREHPNGGTDSGDLSSRLIMDLARQLKLLKQ
                     ENSKMGTKKDSVELRDSVETGLIPNCNSLRDKIEEQIWAAPKDVTDGSKLYNDFQMLK
                     TELRHLERDYSDKKLKNFLRKSRSNPISPSKAVRRDPESGYVSIQVSEQTPLLLGEEK
                     TENQPIHPKQQQQYSQVQQDAIDQDELDFTTIIQRERSQQINKIHSAVQEVNAIFHQL
                     GSLATEQGEQVNTIDGNIGQLSSNMQKANEQLNKADEHQRQRNKCGLITLIIMVVVVL
                     IIILAVLS"
     gene            <583710..>588125
                     /locus_tag="HG535_0A02920"
                     /db_xref="GeneID:59233989"
     mRNA            <583710..>588125
                     /locus_tag="HG535_0A02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286186.1"
                     /db_xref="GeneID:59233989"
     CDS             583710..588125
                     /locus_tag="HG535_0A02920"
                     /inference="similar to AA sequence:RefSeq:NP_014297.3"
                     /note="similar to Saccharomyces cerevisiae POL1 (YNL102W);
                     ancestral locus Anc_2.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142081.1"
                     /db_xref="GeneID:59233989"
                     /translation="MIRNAEKLEKLKKLQAARAGKQSDVREDDDKLYDEIDEQEYRIR
                     KRQELLQDDFVVDDDGLGYVDRGVDYDRNQVSDEESEEEVEESSVIRSSKSQDGATKD
                     RNAVSNLLRAQHNKARLSMQKGKPKEKNISVDQFDDILSEFGDGVPYPRRQQFKRKII
                     SSPTVLHVTRKPAGSFEIDSSEIDSGTFKKQKLDADKSVYQCEDIDSSPLRSRGINNK
                     NNSEAKSNKTKFEQVDDHSLNIGFSDVEEETFKVKSEQSQNGTADVDLEEDSDDEIVF
                     GRRTLRTVKTARHINLSSGDIHPSSPFVTAPGTPISMKSSQANIGISSSGEAGYLGGK
                     YTREQIVDPATNSFQMFWLDYCEVDGSLVLFGKIKTNDNTIISGMVQINGLCRELYFL
                     PRENKTPQDIHEEIIPLLLDKFGLDNIRAKPVKRKYCFELPEIPSESEYLQVLLPYNC
                     PKSKRDMLPPDLSSENFSHVFGGNANIFESFVLQNKIMGPCWLEIKNGDFHALANASN
                     CAAEVAVNISRNITLLDVKKSPNLSAVSLAIQTMMNLKENKQEIIAITISSYKEVPLD
                     APIPEETKPNDVVTLLRPPRGTSFPLGLATLTKQKVKGNVRLFNNEKSLLSCFCAILK
                     VSDPDVIIGHRLESIYLDLLAHRLHDLAIPTFNALGRRARKVWPDRFGRSNSGMNHIY
                     IRELVAGRLICDIANDMGQSLTPKCQSWDLAEMYQVSCGVDHKSLDINYQNPQYQDDA
                     NSMIMALTENIKNSAIIAEISFRIQLLSLTRQLTNLAGNAWSQTLGGTRAGRNEYILL
                     HEFSRNCFIVPDKENNRFKSAKQSKMHDISTEREPEISSKKAKFQGGLVFEPEKGLHS
                     NYVLVMDFNSLYPSIIQEFNICFTTVDRNLNDADELPETPDTDKDQGVLPRLLATLVQ
                     RRREVKKIMATETDAFKKAQCDIRQQALKLTANSMYGCLGYVNSRFYAQPLAMLVTNK
                     GREILMNTRQLAESMNLLVVYGDTDSVMIDSGCDNYADAVKIGNNFKKLVNERYRLLE
                     IDIDNVFKKLLLHAKKKYAALSVSLDKDGQERALLEVKGLDMKRREFCPLSKDVSIHV
                     LETILSDTDSETALQETYEYLENVRAKIENNEIRIDRYKINTRLSKDPSAYNGGKSMP
                     AVQVALGMRKNGRVVKAGTVITFVITEGSDCTPNESKDSAQSVAERARALNEVMVKNS
                     NLRPDAAYYLEKQIFAPVERLLERIEGFDIRRLGESLGLDSKRFINRGINLNDGMSRG
                     NGIDDLQPLESTIPDVERFKDTANLELACPSCRQKFLFGGIVASNYYSICYNGLQCKK
                     CNHMFTPLQTTCQLERCIRSHISLYYAGWLHCDDPTCGNVTRQISVFGKRCLVENCTG
                     VMGYRYSDKQLYNQLLYFDSLFNCEKNKKQEIKPLYHSGDEQYPKEQLTDSSIKALAE
                     QNRELMNLNRGIVQKYLSDCGRRYVDMGNIFEFMI"
     gene            <588617..>590770
                     /locus_tag="HG535_0A02930"
                     /db_xref="GeneID:59233990"
     mRNA            <588617..>590770
                     /locus_tag="HG535_0A02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286187.1"
                     /db_xref="GeneID:59233990"
     CDS             588617..590770
                     /locus_tag="HG535_0A02930"
                     /inference="similar to AA sequence:RefSeq:NP_014298.1"
                     /note="similar to Saccharomyces cerevisiae AVT4 (YNL101W);
                     ancestral locus Anc_2.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142082.1"
                     /db_xref="GeneID:59233990"
                     /translation="MFVPNSHASGDQQPLVPKAAITIPRNRSRKPSALMAASFTTSGK
                     ESFSRSLHMTAARASKSFDSHVLVDVESPNFKTQLPEEQDEILNSLRKNYLVDHYKRD
                     SRSLGESHDMTNTDSLDVDKGTSVTSDISDHTLTPNLSRAGGDITRDIYKYATNENNP
                     RISRSLEDIALADENRRRRSTASGLNVPGGFRREFIVKKVRKQQNQQKSNSNDYASSA
                     PSSSFSSVSKSPSPINPSDIEQVPFLTRNFMEFLYIYGHFAGESFEDDFLSDESDLER
                     NAAEGSLLIPDEGRAMNAVDSVKGTTPTSKAFLLLLKSFIGTGVLFLPHAFSNGGLLF
                     SIAMLAFFGLYSYWCYYILIVSKNLTGVSSFGDIGYKLYGSWMKFIILLSLVLTQFGF
                     SGAYVIFTAENLKAFTKNIFLIPDISIVYFIILQLIIFIPLSFIRNVSKLSLPCLFAN
                     FFIMAGLVIVFVFSFAHLSDLDLRPAEGTIIGFNSNHWTVFIGTAIFAFEGIGLIIPV
                     QDSMRNPEKFPLVLGLVIMTATVLFILIGTIGYMAYGSTIETVILLNLPQKNIFVNLI
                     QFFYSLAIMLSTPLQLFPAIKIVENKVFPKFTKIYVKRPDNTTNVEVRLNSGKLSWKL
                     KWLKNFVRAIMVSLVCSVAYFGADHLDKFVSIIGSFACIPLVYMYPPMLHLQSCSRPN
                     AKGKRIPWASLLDYGLIVFGGVAMLYTSYQSIFSG"
     gene            <591182..>591886
                     /locus_tag="HG535_0A02940"
                     /db_xref="GeneID:59233991"
     mRNA            <591182..>591886
                     /locus_tag="HG535_0A02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286188.1"
                     /db_xref="GeneID:59233991"
     CDS             591182..591886
                     /locus_tag="HG535_0A02940"
                     /inference="similar to AA sequence:RefSeq:NP_014299.1"
                     /note="similar to Saccharomyces cerevisiae YNL100W;
                     ancestral locus Anc_2.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142083.1"
                     /db_xref="GeneID:59233991"
                     /translation="MGTNFYGKNEDQIASAAGPLVPAVISTSTEMQSSTLPNGNQILQ
                     SIPLTETSHRLRSNLINLIASLKAEWGTQKSAVKNEIASAKEYLQDNIFTDIYENREL
                     LVPSSILSLGAFLSGRVLTNKHNWGKSSVLLTPRVSVIGRLFTSLPSRICLPFILAGA
                     IFHQVTPVSSENLWTRVEKDVLPEKLVDTYHSIRTEYLKNGLLKRNNELCDAVDNYLQ
                     SNIRLLRETVGKRFKS"
     gene            complement(<591985..>592638)
                     /locus_tag="HG535_0A02950"
                     /db_xref="GeneID:59233992"
     mRNA            complement(<591985..>592638)
                     /locus_tag="HG535_0A02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286189.1"
                     /db_xref="GeneID:59233992"
     CDS             complement(591985..592638)
                     /locus_tag="HG535_0A02950"
                     /inference="similar to AA sequence:RefSeq:NP_014747.1"
                     /note="similar to Saccharomyces cerevisiae PIN2 (YOR104W);
                     ancestral locus Anc_2.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142084.1"
                     /db_xref="GeneID:59233992"
                     /translation="MDVCAINHLFVRSSFTDNVVSTANSFKHWDTCMNNTACKVIAIV
                     GICLAAITAIWLIGALLTCFRQGVTGIGQFCCWCCRCGRNSATVPRNEGMYRNSMAPP
                     PATVVYQPIQQPESAYYRNRDDSFYDERIKSKSEDVFELEQDFDLEKQRAKSTKRHRL
                     PLVTNDLADEQSAYRPSENYATNPWQSINDNLPANSRRTVYPTDDQSYHGYNYYHGG"
     gene            complement(<594031..>594717)
                     /locus_tag="HG535_0A02960"
                     /db_xref="GeneID:59233993"
     mRNA            complement(<594031..>594717)
                     /locus_tag="HG535_0A02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286190.1"
                     /db_xref="GeneID:59233993"
     CDS             complement(594031..594717)
                     /locus_tag="HG535_0A02960"
                     /inference="similar to AA sequence:RefSeq:NP_014300.3"
                     /note="similar to Saccharomyces cerevisiae OCA1 (YNL099C);
                     ancestral locus Anc_2.180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142085.1"
                     /db_xref="GeneID:59233993"
                     /translation="MSLAGVNDDNYSNKSNLCENTPFDEDVDEEEDNIYINEETELGR
                     EHVLIAHGPQRRIVPPLNFCPVERHLYRSGQPSPVNFPFLLNLNLRTIIWLANEEPQD
                     SLLEFCDIHNIRLEFAAINPDGGEDDNPWDGLTEHSIINALQTIVNQDNYPLLVCCGM
                     GRHRTGTVIGCLRRIMGWNLASVSEEYRRFTGSRGGRILVELLIEAFDTNLVKIDSSK
                     APSWLLTALE"
     gene            <594854..>595390
                     /locus_tag="HG535_0A02970"
                     /db_xref="GeneID:59233994"
     mRNA            <594854..>595390
                     /locus_tag="HG535_0A02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286191.1"
                     /db_xref="GeneID:59233994"
     CDS             594854..595390
                     /locus_tag="HG535_0A02970"
                     /inference="similar to AA sequence:RefSeq:NP_014746.2"
                     /note="similar to Saccharomyces cerevisiae OST2 (YOR103C);
                     ancestral locus Anc_2.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142086.1"
                     /db_xref="GeneID:59233994"
                     /translation="MTTSKDNIDLALISQKHLYKDFKLAYQYYYRLRSVIMAVKNKKA
                     SVPASPAGVATTPKGKPLTTVAVGKDFSDAYSLAMKSYWLQISKDNRLKLIDMFCVFL
                     VAIAAVQCLFMVVVRDTFPFNAFLSGFIACVGQFVLLISLRLQYVDTFKGISKNRAFG
                     EFILASLVLHFICLHFIN"
     gene            complement(<595578..>596444)
                     /locus_tag="HG535_0A02980"
                     /db_xref="GeneID:59233995"
     mRNA            complement(<595578..>596444)
                     /locus_tag="HG535_0A02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286192.1"
                     /db_xref="GeneID:59233995"
     CDS             complement(595578..596444)
                     /locus_tag="HG535_0A02980"
                     /inference="similar to AA sequence:RefSeq:NP_014301.1"
                     /note="similar to Saccharomyces cerevisiae RAS2 (YNL098C)
                     and RAS1 (YOR101W); ancestral locus Anc_2.182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142087.1"
                     /db_xref="GeneID:59233995"
                     /translation="MSLSKSNIREFKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIE
                     DSYRKQVVIDNKVTILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSKTSFDELMT
                     YYQQIQRVKDIDYVPIVVVGNKSDLEEERQVSYEEGANMAREMNAPFLETSAKQAINV
                     DDAFYTLVRLVRDAGGIFNKHSQRNATPGNLAADGQTQQGNDNQYQDGDDQHGLQKNV
                     NTISSKTDASQQYADATVNNNGTTTQKESHLPKSSKTTGDVSKQARAQQSTALGAENE
                     SKKKSGGCCIIS"
     gene            complement(<596987..>598039)
                     /locus_tag="HG535_0A02990"
                     /db_xref="GeneID:59233996"
     mRNA            complement(<596987..>598039)
                     /locus_tag="HG535_0A02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286193.1"
                     /db_xref="GeneID:59233996"
     CDS             complement(596987..598039)
                     /locus_tag="HG535_0A02990"
                     /inference="similar to AA sequence:RefSeq:NP_014302.3"
                     /note="similar to Saccharomyces cerevisiae PHO23
                     (YNL097C); ancestral locus Anc_2.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142088.1"
                     /db_xref="GeneID:59233996"
                     /translation="MSSVPANLYPGLNDIVDVLEEIPLETSRYLTLLHEIDAKCVHSM
                     PALNSHIGEFLSLNKSAGNACKTDQLMDINRLFKELMPSLEEEMHVSSIMLESLQKLI
                     VRLELAYEIAIRNQEVPAKLRLGVDNHPAMHLHYELMEKIDGKSTNGNNGNGTGNGSK
                     TTQALRSESRREAMVANKKHGNDSASQVAGTELNTSQGDLVSTNDDLQQQHIDSGFAT
                     QEQDASRKRTNVNSNGALPESKKRKRRANVKTVPNGSVSMTADPVAVTSASITATAVE
                     TPNPVYAHAHQNGTKARTNDYGEPLYCYCNQVAYGEMVGCDGENCELEWFHLPCINLD
                     HLPKGKWYCDDCKKRL"
     gene            <598853..>599830
                     /locus_tag="HG535_0A03000"
                     /db_xref="GeneID:59233997"
     mRNA            <598853..>599830
                     /locus_tag="HG535_0A03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286194.1"
                     /db_xref="GeneID:59233997"
     CDS             598853..599830
                     /locus_tag="HG535_0A03000"
                     /inference="similar to AA sequence:RefSeq:NP_014743.1"
                     /note="similar to Saccharomyces cerevisiae CRC1 (YOR100C);
                     ancestral locus Anc_2.184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142089.1"
                     /db_xref="GeneID:59233997"
                     /translation="MSSDTTLSESAYLKQEDAFVDNKEADHSNSLVENLKSLTAGGVG
                     GVCAVLTGHPFDLVKVRCQNGQAKSAGEAVAKILSSARGAVGGTMVTNSVKGFYKGVV
                     PPLLGVTPIFAVSFWGYDMGKKLVTWKEDTNTLGNVPLTTSQMAAAGFISAVPTTLVM
                     APTERVKVVLQTSSGGSFLSAARKLVSEGGVQSLFKGSLATLARDGPGSALYFASYEV
                     CKKFLNSKSGNTQNGEINIKNVCISGGIAGMSMWIVVFPIDTIKTKLQASSTRQNMLS
                     ATREIYNTRGGIKGFFPGLGPALLRSFPANAATFLGVELTHSLFKKYNI"
     gene            complement(<599940..>601139)
                     /locus_tag="HG535_0A03010"
                     /db_xref="GeneID:59233998"
     mRNA            complement(<599940..>601139)
                     /locus_tag="HG535_0A03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286195.1"
                     /db_xref="GeneID:59233998"
     CDS             complement(599940..601139)
                     /locus_tag="HG535_0A03010"
                     /inference="similar to AA sequence:RefSeq:NP_014742.1"
                     /note="similar to Saccharomyces cerevisiae KTR1 (YOR099W);
                     ancestral locus Anc_2.185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142090.1"
                     /db_xref="GeneID:59233998"
                     /translation="MLRDKIPSGKERLYKTIGLAVVALITIFVILNNTGVTSSNGLIS
                     SITSSVTTQDSKTADGLKQPAPVSPKKYSGHKEKATFVTLARNRDLYSLLPAIRSVED
                     RFNRKFNYDWVFLNDEEFSEEFKRVTTALISGTTKYGVIPKEQWQLPDFIDKEKAANT
                     RKEMAEKGIIYGDSIPYRYMCRYESGFFYRHELMADYEYYWRVEPDVKLYCDIDYDVF
                     RFMKKNDKKYAFTISIKEYAETIKTLWETTREFITSHQEYINKNNMLDFISDDEGYSY
                     NLCHFWSNFEIASLDLWRSDAYTAYFDHLDKSGGFFYERWGDAPIHSIAAALFLDRNQ
                     IHHFDNIGYYHPPFHSCSVDEDVRMKNKCDCNPADDFTWKSYSCTTKFYTVNGLTKPK
                     NWQIYAD"
     gene            <601503..>604469
                     /locus_tag="HG535_0A03020"
                     /db_xref="GeneID:59233999"
     mRNA            <601503..>604469
                     /locus_tag="HG535_0A03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286196.1"
                     /db_xref="GeneID:59233999"
     CDS             601503..604469
                     /locus_tag="HG535_0A03020"
                     /inference="similar to AA sequence:RefSeq:NP_014741.1"
                     /note="similar to Saccharomyces cerevisiae NUP1 (YOR098C);
                     ancestral locus Anc_2.186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142091.1"
                     /db_xref="GeneID:59233999"
                     /translation="MAAQSRSISSFLTGFFRRPVGDNDYDGAYQIDEESLSGRYDKQT
                     VRKDYACGTSDQLDKLDESTLEHQGTLVLTGDETNYRPPIVSILPIERLRLLRLKQEW
                     RRRVNSKLLLELSYEGPARDDAPTVHQEYVRDVLNTDESQFSYKLSNTPSPVKQDAKK
                     SSQISSNDIVPLRTLKRKKVSGSKRRGTKWSADFEYDLTEYDNILQHKKDEPLANLDS
                     SEIDSPQLSSAKNAGLENHSLQGTSHSGLSSIQRSLLINGPNSITNSTNGNNTKLDSN
                     IEEKGSSIMLSLKDTNHCTTNEKKNKLILPSVGFDFIKKDDNETPSKKPSFVPTEVAS
                     KSQGAKPHISSTASSTQQNDKKESAISFPLTVGSEKQSVGTHPTFRFGKNTHQISNQN
                     QEEEEEEQDTKRKKRTISSNDQVIEKPSFSFAKASADAGSKKSAFKFGTVKEKVPAIP
                     PFHFGKENGACKQDIETEATAKSPNQGFKVGGSGSPASATPPSQPDGQNQSVPTEKPI
                     FSFHGKEKSKEQEKSSSFKFGSKNNSGTNFKSDSSFSFGRGATESKVAPSFNVDATAE
                     TKSSSNPSFSFGTKTAPDTKVIPTFNLSAGSSEDRTNKPSFIFGNQVDKKASPKPLTI
                     SRTKEENALGAHPTSTENHPTSSVPNPSFSVATPAVTDKIDSEPKSTFNFNAAQLNGK
                     KRDHQTGFNFGSTNQESLNSAETAGQAGFSFSRISSQPDNGKEKAQLSFGASIGNAPK
                     VDFSFGKSSSEVSQAKTLPISGFSFSRSSSPSISGPTSVVGIPSLNSNPTPSIAKSQS
                     PGVSALNPFINSSIAGTGATGATGGFTFGSINQGTNVPLSVFSNGQTLNAPSASSATS
                     VPAFQQSITVSGTSTNPPSRSFTPSNTINLNFGNTAAVDPTSIFADASHPTGSIGGAT
                     PAPQQIFGGPSLPPSQIFGGGSSVQQPTQSFNNSQTGFGNNNIMQSQQGMQASATSFQ
                     LPPGRKLARMRNARRG"
     gene            <604673..>605188
                     /locus_tag="HG535_0A03030"
                     /db_xref="GeneID:59234000"
     mRNA            <604673..>605188
                     /locus_tag="HG535_0A03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286197.1"
                     /db_xref="GeneID:59234000"
     CDS             604673..605188
                     /locus_tag="HG535_0A03030"
                     /inference="similar to AA sequence:RefSeq:NP_014740.1"
                     /note="similar to Saccharomyces cerevisiae YOR097C;
                     ancestral locus Anc_2.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142092.1"
                     /db_xref="GeneID:59234000"
                     /translation="MDRIQVPIAKYAKKLQAKVRTDPVDEIHLPSFILGSFLVLSLSL
                     VGPFLKVFIGNILLSLITVVKYAVVVGGIAACITLGRKNNDTALQGNEANKKPTRKHK
                     NPVCQTDKGIHLQKTEKAEGLAAEGQLEKDDFETLKYYKIPITKSEHRRYPLNNAYDS
                     FINRAAEKNNE"
     gene            complement(<605339..>606168)
                     /locus_tag="HG535_0A03040"
                     /db_xref="GeneID:59234001"
     mRNA            complement(join(<605339..605767,606025..>606168))
                     /locus_tag="HG535_0A03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286198.1"
                     /db_xref="GeneID:59234001"
     CDS             complement(join(605339..605767,606025..606168))
                     /locus_tag="HG535_0A03040"
                     /inference="similar to AA sequence:RefSeq:NP_014303.3"
                     /note="similar to Saccharomyces cerevisiae RPS7B (YNL096C)
                     and RPS7A (YOR096W); ancestral locus Anc_2.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142093.1"
                     /db_xref="GeneID:59234001"
                     /translation="MSAPQAKILSQAPTELELQVAQAFVELENSSPELKAELRPLQFK
                     SIREIEVAGGKKALAVFVPVPSLTAYHKVQTKLTRELEKKFPDRHVVFLAERRILPKP
                     SRRSRQTQKRPRSRTLTAVHDKVLEDLVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQ
                     QVDYKLESFQAVYNKLTGKQIVFEIPGETH"
     gene            <607321..>608364
                     /locus_tag="HG535_0A03050"
                     /db_xref="GeneID:59234002"
     mRNA            <607321..>608364
                     /locus_tag="HG535_0A03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286199.1"
                     /db_xref="GeneID:59234002"
     CDS             607321..608364
                     /locus_tag="HG535_0A03050"
                     /inference="similar to AA sequence:RefSeq:NP_014738.1"
                     /note="similar to Saccharomyces cerevisiae RKI1 (YOR095C);
                     ancestral locus Anc_2.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142094.1"
                     /db_xref="GeneID:59234002"
                     /translation="MISPARHWSSSSLVEFSGRLHRNCISLTSWTRERRYWNTRSALK
                     PHLSFGSTSKTRLSPSKSKKIRIAAKMTEEMPDTLKHYKVPKIEDMPSLGLPIENAKR
                     AAAYLAVDENLDIFHHRIIGVGSGSTVIYVAERLGQYLKDEKFRDYVSQFICIATGFQ
                     SKQLIMDSGLQYGIIEQHPVIDIVFDGADEVDPNLQLIKGGGACLFQEKLISTSAKTF
                     IVVADSSKRAPSKLGSHWRKGVPIEVVPPAYVRVRNDLLTKVNAKTAVLREGGKAKAG
                     PIVTDNSNFIIDADFGEIEDPKTLYKEIKLMVGVVEAGIFVDNAAKAYFGNADGSVEI
                     LDKQGSAARITSV"
     gene            complement(<608599..>609150)
                     /locus_tag="HG535_0A03060"
                     /db_xref="GeneID:59234003"
     mRNA            complement(<608599..>609150)
                     /locus_tag="HG535_0A03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286200.1"
                     /db_xref="GeneID:59234003"
     CDS             complement(608599..609150)
                     /locus_tag="HG535_0A03060"
                     /inference="similar to AA sequence:RefSeq:NP_014737.1"
                     /note="similar to Saccharomyces cerevisiae ARF3 (YOR094W);
                     ancestral locus Anc_2.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142095.1"
                     /db_xref="GeneID:59234003"
                     /translation="MGNSVSKTLGKIFGSREMKILMLGLDNAGKTTILYKLKLDQIKT
                     FAPTVGFIVETVSYKNVKFNMWDVAGQERLRPLWRHYFPATTALIFVIDSGDIDRLNE
                     AKEELYSIISEKEMENVVLLVWANKQDMKNAKNPREISDFLQLGQNLRNQLWCVIGSN
                     ALTGQGLVEGLSWISNNTKGRKN"
     gene            <609862..>614751
                     /locus_tag="HG535_0A03070"
                     /db_xref="GeneID:59234004"
     mRNA            <609862..>614751
                     /locus_tag="HG535_0A03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286201.1"
                     /db_xref="GeneID:59234004"
     CDS             609862..614751
                     /locus_tag="HG535_0A03070"
                     /inference="similar to AA sequence:RefSeq:NP_014736.1"
                     /note="similar to Saccharomyces cerevisiae YOR093C;
                     ancestral locus Anc_2.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142096.1"
                     /db_xref="GeneID:59234004"
                     /translation="MPDLSIPENLPTYLQNQLNELVDDFTEENLTLKGYQNKRKQLLD
                     NYARGKSNPLTPVKSQVHPQSVNHSRTQSCNSTIRTGHSTPHIGDDSSIASSINRSRN
                     GDLDSMSPALHASQQHNRETQHAKTPQGRHHSLYRVTTVNSNSDYSSPSSRRKRSSIQ
                     LSLPSNEITGVPYNPMVPLLPRQEHPVAAESLPSIVRGRFDHYSSETAFISINEKGKE
                     TSISWDRLYLRAEKIAYVLSKEKLYKMDKIPLWYNRNEVIEFTIALLGCFIAGMVAVP
                     VSFETYSVAEITEIIKLTNSKQILISNDCHNQLENLYSTVNHTKMKLTKNDFFSQINF
                     IKTDDLGAYSKAKKTAPTFDIPNVSYIEFTRTPLGRLSGVVMKHKILSYQYKTLAGIL
                     NSRVLPHWKKNEINRSPHKKDTCPRYTILNSLDPTRSTGLILGVLFNIFSGNLLVSID
                     YRILQKLGGYENIINKFRADILLNDQLQLKQVVINYLDDPQSTFSKKQRINFGCIKCC
                     LTSCTTIDTDVSDMVVNKWLKNLGCPDAPMCYSPMLTLLDFGGVFLSLRDQIGKLDNF
                     QIHCSKLRLEDELFVNKENLRSNIIQPSVSAIVNSSNSFNEYLRVAAYGFPIPDATLC
                     VVNPDDNTLVSDLTVGEIWVHSDSLTNEFYQMDRVNDFVFKAKLNYQKMYNFLLEQNN
                     SSSALERLDTIMTICPSSLQFLRTKLIGFIHNGKIYVLSMVEDMFLQNQLIRLPNWSH
                     TSDVSRAKISTEKPPPPTRNSTIGIRDKKRVVQTYYLHQITETLVRTVNTVSEVSAFE
                     LNHNKEEHFLAVVIESSMARPAATALISAGQNKNEVLEKRMNELTEQVYRILWIFHKI
                     QPMCVVVVPQGSLPRRYCSLELANSTVEKKFLNGELPSTFVKFQMDNITLDFVPHSLY
                     FNESIFSEHLSNLRSAALKETQSTTSLAKESQWQISGIDYRETSIDVGTGKRLTDFPN
                     ILDILEWRMKNNSNDSAFDDGGDNNASNNENNIHKRVSWSSFECIIASFLKKIIGSKS
                     PLKRGDRVLIMSENSVEYVAIVMACFYCKFVVIPYPILREKYAEKDVEDFCNVVKAYG
                     IKRIFTDAKTYNFFDGNVPVSKVLKKNKHVLPKITVFTKVKRKTGLSISIFKKYLKAN
                     YSSKPGTNSNAVPCIVWINREYDIKSNIHVTMTHSAFMNSCKMLKETLQLSPDRPLFS
                     LCSYTTGIGFMMSCLLGIYVGCTTSLFSLSEVTLDPKEFLIGLQNLNVKDLFLRAETL
                     CMLVEKANNLISLSRKNTTVSKKGNTTLLRPDLFRNVQNFMIPFSGRPNIYKIEGLIK
                     KNTQVILSPVQINYVYENHFNPHITLRSYLGIPPVDLYLDPISLREGLIKTVDPSTVD
                     TGGYLRVQDSGIVPVCTDVSIVNPETNMTCYNGEFGEIWCCSEGNAFNYSICAEGENS
                     GKRILTKDPFINEQFNCKLKKDVDNGLSYLRTGDLGFIKSVSCPDAYGNVVDLNLLFV
                     LGSINETVEILGLTHFVEDLERTVMNLISCFENCMISKAGGLLVCLVECRGDKQPKMA
                     NLTALIVSELLKNHGVILDLCAFVKHGTITNFDWNKNRATLMKDWFNQKLIIENQFGV
                     NFGENISIYLLSEFEKQSQ"
     gene            complement(<614903..>616705)
                     /locus_tag="HG535_0A03080"
                     /db_xref="GeneID:59234005"
     mRNA            complement(<614903..>616705)
                     /locus_tag="HG535_0A03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286202.1"
                     /db_xref="GeneID:59234005"
     CDS             complement(614903..616705)
                     /locus_tag="HG535_0A03080"
                     /inference="similar to AA sequence:RefSeq:NP_014304.1"
                     /note="similar to Saccharomyces cerevisiae YNL095C and
                     ECM3 (YOR092W); ancestral locus Anc_2.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142097.1"
                     /db_xref="GeneID:59234005"
                     /translation="MSIPLGAVIWSSFKPIIKIYLIIGTGFLLARVGILSVQATRSIS
                     DIVLTLLLPCLSFNKIVGNIEDRDIKTVGIICLTSVLLFGTGLFFAYVIRRTMPVPRQ
                     WYGGILAGGMFPNISDLPIAYIQTMDQGFIFQPEEGDKGVACVIIFMAMFMLCVFNLG
                     GFRLIESDFHYKDIESAVTPEENDSLKNEQEGQELEQGGPTHQPQRTDDSSILSSSSI
                     IKPEKAITRSWDNESSSSSRPNPSSISLAYDDDGTENHERGNKDAPGNMWDYITTRKT
                     QSQPVAYTADESQNQQRQIRVRRPSIRSIDLRDLPSENVTELIREYSNVNQYGRPRRN
                     SALSDGDLDVALDEDEPLRYIPSSTSGSLINRNKSNLTKILTSDATVNTQDIRTSGSS
                     LPSVLKKFPLTPFIVFFLKNCLRPASMALILALTIAFIPWVKALFVTTSSTPNLNQAP
                     DQQPALSFVMDYTNYIGAASVPFGLLLLGATLGRLKLTKLYPGFWKSALTLVVLRMCI
                     MPIFGVLWCDRLVKAGWVNWDDDKMLLFVIAIDWALPSMTTMIYFTASYTPPDSTDTI
                     QMDCTSFFLMIQYPIMVVSLPFLVSYFLKVQMKI"
     gene            <617858..>618523
                     /locus_tag="HG535_0A03090"
                     /db_xref="GeneID:59234006"
     mRNA            <617858..>618523
                     /locus_tag="HG535_0A03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286203.1"
                     /db_xref="GeneID:59234006"
     CDS             617858..618523
                     /locus_tag="HG535_0A03090"
                     /inference="similar to AA sequence:RefSeq:NP_009515.1"
                     /note="similar to Saccharomyces cerevisiae MRPL16
                     (YBL038W); ancestral locus Anc_3.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142098.1"
                     /db_xref="GeneID:59234006"
                     /translation="MIALLSLKDGLLASRASGIPRTLVRFKHEYAPRFKEVQKKQKGR
                     VPVRTGGSIKGSTLQFGTYGMRLKTEGTRLTAQQLKEADNAIMRYVRPLANGKLWRRL
                     CTNIAVCIKGNETRMGKGKGAFDHWMVRVPTGKVIFEMRGDNLHEKVAREAFRKAGSK
                     LPGVYEFISSDSLIRVGLHGFKDPKDDPKINYLEKLVNKPTKEFLNIQKSKDPQYRLF
                     KGR"
     gene            complement(<618596..>619666)
                     /locus_tag="HG535_0A03100"
                     /db_xref="GeneID:59234007"
     mRNA            complement(<618596..>619666)
                     /locus_tag="HG535_0A03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286204.1"
                     /db_xref="GeneID:59234007"
     CDS             complement(618596..619666)
                     /locus_tag="HG535_0A03100"
                     /inference="similar to AA sequence:RefSeq:NP_009644.3"
                     /note="similar to Saccharomyces cerevisiae RFC5 (YBR087W);
                     ancestral locus Anc_3.326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142099.1"
                     /db_xref="GeneID:59234007"
                     /translation="MSLWVDKYRPRSLDTLSHNDDLTNLLKSLAHRPRDLPHLLLYGP
                     NGSGKKTRCMSLLESIFGAGVYRMKIDVRQFVTPSNRKLDLNVVSSPYHLEITPSDMG
                     NNDRIVIQELLKEVAQSEQVDFQDSKEGLAHRYKCVIINEADSLTRDAQSALRRTMEK
                     YSRNIRLIMVCDSMSSIIAPIKSRCFMIRCPAPQDRETIEILKIVAKEENVKLESETI
                     LQDIATASSGNLRVALLMMESMSLANEMQLKSTTPIIRPDWESVILKMANKIQKDRSV
                     DCLLECRSIIYDLLAHCISAKIILQELTFALMKNANSEKIKVDIISTSSMFDERLSLG
                     TKSIYHLEGFIARVMCCMDSSQ"
     gene            <620048..>623083
                     /locus_tag="HG535_0A03110"
                     /db_xref="GeneID:59234008"
     mRNA            <620048..>623083
                     /locus_tag="HG535_0A03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286205.1"
                     /db_xref="GeneID:59234008"
     CDS             620048..623083
                     /locus_tag="HG535_0A03110"
                     /inference="similar to AA sequence:RefSeq:NP_009516.1"
                     /note="similar to Saccharomyces cerevisiae APL3 (YBL037W);
                     ancestral locus Anc_3.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142100.1"
                     /db_xref="GeneID:59234008"
                     /translation="MMDSRKPASNGSSHNYSTTIKGLQLFIADLRSSQYSDEHEKRIQ
                     SEIVKIKQQFDSAAKKSANGKDKLGGYQRKKYIAKLAYIYVTSNTTKLNDILFGLDQM
                     LELLASDSFSEKFMAYMTLEFLYEHAIVISKVRDKVTHQLIKDISGSNDNFVALALNF
                     IGVAGKLDIEMSKDDNLTTEVFQILRSPTSTVYLKKKSALAFLTLLKTNPGILIDDPQ
                     RKQLWIQRILSLLDDTQNYRLMLAVLPLVEYIAKNIDLECCIRLLRQLTQILYNCVIV
                     GTSNSEKFPSEFKFANVPNPWLITKIVSLLSILIVSPTEANNTSSAVLQSSNIDRETL
                     GKLRMCVTKAIEVGTKSCNDPMERIVLNTILFSLINFASKLDPSPEAISNSVSALCSL
                     LTSAEINIRYLTLDSLVKLCSISGRHAIDTVRYKNLNLIFHILDSERDSSIVRKVVDL
                     LYTFTDSENLQIIVQKLFEYVQSSRHPTDPFIKSDIAVKIAILSEKFAIDAHWYINVS
                     LNLLSLTSNSTLNDDEIWQRLCQIVVNNTSLHQITCEHLVDYLRETHTSEAIVKTGAF
                     LLGEYANLVFEKASVGELFNLFTDKYFTTSNVTRAMILTTIVKLYRFSTAIESVVIKF
                     FQIELNSLDIELQTRSFEYLNFVQLSKLNGNTKLLDVLFSPMPPFNTRSNPLLKRLGS
                     LPSSGYSSTFSESIGSLHGDKDRSTTPPTSFSQASGRPAPPRSRGTKSASINTLASEP
                     MLSSGWEEGFSRMLSHRKGILYTSGFLRVIYRITNPETENLTRLKISLTFINQSELKI
                     NGLSTEINAIRTADNPEYVLRNIEPPSSIDVNPRGRSEQSFEVIVRKTFSVIDSPTVK
                     VYFSCGGSTNSIVLKAAIGVTSTITSSAAAKNTISLPQFVTRWKTLREALGDDGEYIL
                     EKIQLRRKKSGNPDGEYLRSIYQCISRMGFNIVEQTSVNNTLFIAGIIHTKSEGSFGC
                     LIKLKYDEPKREVSLTCRTTSNGSLAQNISECLKYAISN"
     gene            complement(<623174..>623998)
                     /locus_tag="HG535_0A03120"
                     /db_xref="GeneID:59234009"
     mRNA            complement(<623174..>623998)
                     /locus_tag="HG535_0A03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286206.1"
                     /db_xref="GeneID:59234009"
     CDS             complement(623174..623998)
                     /locus_tag="HG535_0A03120"
                     /inference="similar to AA sequence:RefSeq:NP_009517.1"
                     /note="similar to Saccharomyces cerevisiae YBL036C;
                     ancestral locus Anc_3.324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142101.1"
                     /db_xref="GeneID:59234009"
                     /translation="MSLLVTERLEVVNILRKSINTSYKGLRGWNVSKAICSMSRKQEL
                     IKNYEDAVKECKNNNVLLLAVSKLKPASDIKILYDHGVRHFGENYVQELIEKSQLLPR
                     DIQWHFTGGLQTNKCKDLAKIPNIAMVETIDSVKKAKKLNEARRTYNADEPPIACNIQ
                     INASNEEQKSGLTDAEEIFALVEFFLKPDTKNIVLNGLMTIGSWDVSHSAGTENQDFT
                     KLVEWKELLDEKYGLDLKLSMGMTADYKQAIKQGSSEVRLGTTIFGNRPSRADAFV"
     gene            <625228..>628206
                     /locus_tag="HG535_0A03130"
                     /db_xref="GeneID:59234010"
     mRNA            <625228..>628206
                     /locus_tag="HG535_0A03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286207.1"
                     /db_xref="GeneID:59234010"
     CDS             625228..628206
                     /locus_tag="HG535_0A03130"
                     /inference="similar to AA sequence:RefSeq:NP_009643.2"
                     /note="similar to Saccharomyces cerevisiae IST2 (YBR086C);
                     ancestral locus Anc_3.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142102.1"
                     /db_xref="GeneID:59234010"
                     /translation="MPETFDQLDPNYVITLEYTRDNLIQLTTELAVKGLHVLTRPGYD
                     SNTLYAFTRVEDRGFHTNVKSPKSIRVTEQSGNEILYRVCQPLKFVKSITPIHDFETR
                     QKLESFSSKLIKGSFKIPADDDLIKLSYLTKNPRESLYFAFFKTYIQWLWPISMVGVF
                     FRLFSKNTPSSEFNIQYSMCVSIWSLLFAATWVFQNESKFSSKFGKVNGYFNYTGKQL
                     SSPTTVLYKKLCFIPVACLFAATLIAYQLFCFFIEIFVTQFYQGPLKSVISLTPLVLL
                     SIFVPFLTNFYNRFFVDKLVEWENGSDPNKSKVEKNFVLAFLTSYMPLIITLFFYLPM
                     GYKITPELKDFIVERSSHYRIPVQATDFIVDVNRYKNQFFYFTVTNHIVVMLMEDIVP
                     YLTDRFLSSITKKPKEDIKAKKLNSIMKSNYPSEFKLWNDINNFNKTAYGEFNVDDNY
                     KKVIVQYGYITMFSTIWPLAPFCCLCFNYLIFKIDLWRALKRCKPSSCPNDLEVAKDS
                     FTARSASAGPWNTILETLTWIGTITTPSLIVMYRYSDFPGVGLNTVLQKRDLWYRYSP
                     LSVSWTTILVTAILSEHVALLAYFYLTRIFSASTQKFVYGFVPAVESQEPPKINLSSM
                     IKETVGIMNLVAEAKLPTPSERSEHINEKDKQIEKVNGTSGFSQRQIKSTESLDESEN
                     TNYRKNGPNTDVSKTVDNSERLDNGAALPKGEIFASPEDALETDGIAANGKMDHMRLP
                     FEGLKDDSMENHKGKSKEKSKESPKESSLNQVKTSNSNDEVLSTAGATLPETIPTSKN
                     YHLRYDKYGNPIQSSNSTKTSKSSLVDDTVGSSENSEYASKPTEIQHDEKPKDLEHEE
                     KPEKSEQNGVVGTVRSKKDEILTNREQDLAAAAASNAISNHSRTSSKINAVQQFSRDV
                     PTSLVSGKSSQDQAHTSMKAVASLKSKAASSVEHDGHVAPRKKSSSSKRSSVDMSSKE
                     SKEHKHKHKMGLLRKLKKKL"
     gene            complement(<628300..>630282)
                     /locus_tag="HG535_0A03140"
                     /db_xref="GeneID:59234011"
     mRNA            complement(<628300..>630282)
                     /locus_tag="HG535_0A03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286208.1"
                     /db_xref="GeneID:59234011"
     CDS             complement(628300..630282)
                     /locus_tag="HG535_0A03140"
                     /inference="similar to AA sequence:RefSeq:NP_009518.1"
                     /note="similar to Saccharomyces cerevisiae POL12
                     (YBL035C); ancestral locus Anc_3.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142103.1"
                     /db_xref="GeneID:59234011"
                     /translation="MTIESEILSQFGPEANTPEIVSGLEHLVKLHALSIEDLYIKWEQ
                     FSYQRHDINSLSESALGQFKNFLQLQVEKRAARIPNISKPTSSTKKPKVLKPLGSSPL
                     FGLNVQKTPTQPKRKLNPSPSNPDKKSRLEFTAHSLEKDSLISSVKDGESKSQNAYIK
                     QCADALTSPRRNVEPGKILDSLNPENLEIGRGIDVKGEQHVKIIPLYEPQLYKFRTMR
                     QNLLDASDVLDEQIESFTKIVQQHFQLSPSDFGDPTIQAQNEIYTVGRIVPDSPSSDD
                     FLNTESLALEISRMVGIGRRVRLDLTYVSEGSFFSGQIVALRGTNATGDSFTVSELLH
                     LPYPNSPVSTADELEAYKATLNGSDLKVILTSGPYFSDTSFDMDYLMDFVDRINTKVR
                     PHVLIMFGPFIDVTHPMVAEGTIPHFTNLKTQPNTLDEVFIKVVAPVLKKIDQNIQVI
                     LIPSTRDAISKHAAYPQDSLDKKQLQLTKNFKLFTNPATFQLNEVFFGCSNVDAFKDL
                     REITKGGNTSMRNRFDRVSELILQQRRFYPQFPGAIKKLEISPGKSDDKVFEHISGAD
                     LEIPYLGLTEMVGDFAPDVIVIPSELQHFTKVVQNVIMINPGKFIKPSGAPGTYAQIT
                     ISSPNINDGKLTRMSDTEPVYLHNVWKRARIDIVSN"
     gene            complement(<630632..>634996)
                     /locus_tag="HG535_0A03150"
                     /db_xref="GeneID:59234012"
     mRNA            complement(<630632..>634996)
                     /locus_tag="HG535_0A03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286209.1"
                     /db_xref="GeneID:59234012"
     CDS             complement(630632..634996)
                     /locus_tag="HG535_0A03150"
                     /inference="similar to AA sequence:RefSeq:NP_009519.1"
                     /note="similar to Saccharomyces cerevisiae STU1 (YBL034C);
                     ancestral locus Anc_3.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142104.1"
                     /db_xref="GeneID:59234012"
                     /translation="MSDTDGFDSGFPLYEKLVANGTAGAVGNDSESDRAHVEQSIQLL
                     ARFKGHVKKELVHVASIPRYFEALIFVLDTYSFARAFKLVMLAHSSLCYLVKRVVMQR
                     PSFFDSLQIVENITVHLFMLESFEAFDSKNCWLSSVKAFEAIYLLQPSILTDCMLVLF
                     ARYEHDDKRLLRFLLVVDELLQMIKKHEKIDGAFDTRLLSKLSDVVSRCHGSQVDVVK
                     VIQEVISKNFKNQEKEVFSQIRDDSVKKLFEIEENAQEPHTFDVNFEIGRIMEDCNIH
                     PRQSENVLTGYPNDLTCDNITSVLENLLVPFQNPKETEQNWRLRQANLTELRKIIRTT
                     FANNNSSQFITLCKELQTFECIGKAVLSLRTTLSMTACEVFKDFLQIFTKELDLGILD
                     QMFSILKNLLTTAKKIASTSALSCLIIMFTNIGFHQKLFHNCLMLINEKSITPRNCSA
                     LLLRIFLIEFTDSKVLDNSLIYIEEWLKKGITDAQTSVRESMRLTFWYYYKGYTLNAK
                     NFLLTQFSSQLKKAIELSIPSHLELNYHLNTSARTSTTNPFSIVENSSRNNYHHRKYP
                     SYARPTHSYNASVQRTSNGRSTSEYAPTDIVPNVLNRRKVSAPPPMLTKRSLTTEQYQ
                     ERSHFSQLTPHIDTSSFEHRHDVENTIQIDLTSDFSGVHSNTLISKYLNNEDQFDGKL
                     MYQNLDSSSPDNIKEGVQTLQKFLLKNNSFTTNESLDLNHLINSIKLIKLRYPQELKP
                     LLSLSSFCESMPLTFVIEIHAINFVDLNEDIMHRLTPTALLEAISELFAHLNSISDDR
                     EVENNPELSLYYMKYKQFILNFCFGLLIKVFSLVLNNQQVNSNVIQTLIRKLGALYGQ
                     EFDECLYIECFEKMHAHDETSFTSAVQSINSMPTKLKICEELEKKGSIESTEIEQIIN
                     RNNSTSSRQLDNDENDNLENNGNGNTENIIVDDRKYLEMTMVNPFGQSRSISGGSVVY
                     HDPSLTSPLEENADAISLNGKSNEEPRVSEITKVVSIYEVARPHESNASTIDLDGDSK
                     MIDNGEGNSVTLSDIFASQRQEHTVKFSDASPKVINAETSHPSSSVKADAFEENMEIG
                     NDMSRKASFERDRSPVTPLTERQSKELSQALNSIEIGKKPEPMNNLEPSNLSAELLVN
                     TMLEAIEGKSIEDNFFGDKLLGSLTYYEITLATKMIDAANVDENLNQMKKAIARIQNR
                     SFTIMHLNCLIGRLIMCSQQQPMREWLEVQKGYETLLQLGRTLLISTDETSLFPLNMA
                     SKSIVLIQCLIILNKKLNNVPSLFSPAIKDIWEEILQMVTKLRDYSNEFYLLLQELRD
                     LLSQLNFFNSKSVASILSTLASEAQETGPGIKETFLMETISAILVKSPNVLQKHQPEE
                     IIQMMLLFAESDITEWRHACFTVMANVLQYLRQAFANEKDIEKQFGDLSEVQFRVVCT
                     LASSNYAEDHLHDISTFK"
     gene            <635745..>636005
                     /locus_tag="HG535_0A03160"
                     /db_xref="GeneID:59234013"
     mRNA            <635745..>636005
                     /locus_tag="HG535_0A03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286210.1"
                     /db_xref="GeneID:59234013"
     CDS             635745..636005
                     /locus_tag="HG535_0A03160"
                     /inference="similar to AA sequence:RefSeq:NP_061491.1"
                     /note="similar to Saccharomyces cerevisiae YBR085C-A;
                     ancestral locus Anc_3.320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142105.1"
                     /db_xref="GeneID:59234013"
                     /translation="MSSALYKQNTNFTHSTGSFLKSAPVELTTVKGYNDFVSKLEKKN
                     DKISTILSEDKSQGYVLQDGEVIATIYGEAKDYLLSLGGMTE"
     gene            complement(<636227..>637168)
                     /locus_tag="HG535_0A03170"
                     /db_xref="GeneID:59234014"
     mRNA            complement(<636227..>637168)
                     /locus_tag="HG535_0A03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286211.1"
                     /db_xref="GeneID:59234014"
     CDS             complement(636227..637168)
                     /locus_tag="HG535_0A03170"
                     /inference="similar to AA sequence:RefSeq:NP_009520.1"
                     /note="similar to Saccharomyces cerevisiae RIB1 (YBL033C);
                     ancestral locus Anc_3.319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142106.1"
                     /db_xref="GeneID:59234014"
                     /translation="MTVDSVTKKAMPEAKCIARARIPTTQGPDIFLHLYTNDRDDKEH
                     LAIVFGEDIRSRSLFARRPNETQQDRMIRGAYVGKLYPGRTSADIDERLGLSMQFDRE
                     TGELAADSSSTWDGHTEKTLVRIHSECYTGETAWSARCDCGEQFDRAGKLIACSQEEE
                     SGIIGGSGHGVIVYLRQEGRGIGLGEKLKAYNLQDLGADTVQANILLNHPVDGRDFSI
                     GKSILIDLGIENIRLLTNNPDKIEQIEEPGLLTCVERVPMVPLHWTHEHQGIDSKEIE
                     GYLRTKIERMGHLLQRPLTLHTQTHTHTHAHAHTTAV"
     gene            <639924..>641129
                     /locus_tag="HG535_0A03180"
                     /db_xref="GeneID:59234015"
     mRNA            <639924..>641129
                     /locus_tag="HG535_0A03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286212.1"
                     /db_xref="GeneID:59234015"
     CDS             639924..641129
                     /locus_tag="HG535_0A03180"
                     /inference="similar to AA sequence:RefSeq:NP_009521.1"
                     /note="similar to Saccharomyces cerevisiae HEK2 (YBL032W);
                     ancestral locus Anc_3.318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142107.1"
                     /db_xref="GeneID:59234015"
                     /translation="MSESGMGSGSGSMLPTGVDSRVTAASVATASTTFPTINHRVLLS
                     LREGAKVIGTKGATIQRIRENNDVKIGLSEKQAGCSDRVLSCAGRIPNVANALGEIVE
                     VLNDYDASHDTEGNSIGAVKYPYHFLNPILPPPSKDEIKDSEQLKNIGSLRLLTTNSQ
                     LSSIIGKGGCRIKSLIDKHGVKIVASRDFLPDSDERILEMQGFPGSITITLMEISEIL
                     LNEIDINFGSETRYYPHLRSHSSANSHPNTYPQPHVYQNQGGNTNLRATNRQYNSSAS
                     HNIPRNVSTNIAITPNKSNWSSGTDNEKRYSNEFKVILRVPEIYVGAIVGRQGNRIAN
                     LRKFSKTKIIVDKKDESADPTNSHRNFTITGDLLKNVKLAESMLLKNLDAEIERRQER
                     VKSKLSKGN"
     gene            complement(<641992..>642906)
                     /locus_tag="HG535_0A03190"
                     /db_xref="GeneID:59234016"
     mRNA            complement(<641992..>642906)
                     /locus_tag="HG535_0A03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286213.1"
                     /db_xref="GeneID:59234016"
     CDS             complement(641992..642906)
                     /locus_tag="HG535_0A03190"
                     /inference="similar to AA sequence:RefSeq:NP_009523.1"
                     /note="similar to Saccharomyces cerevisiae PET9 (YBL030C)
                     and AAC3 (YBR085W); ancestral locus Anc_3.316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142108.1"
                     /db_xref="GeneID:59234016"
                     /translation="MSEKQQSSFLVDFLMGGVSAAVAKTVASPIERVKLLIQNQDEMI
                     KQGSLDSKYKGIGDCFKRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKSLFG
                     FKKEEGYAKWFAGNLASGGAAGGLSLMFVYSLDYARTRLAADSKSSKKGGERQFNGLV
                     DVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGNLEGSFLASFV
                     LGWVVTVGASTASYPLDTVRRRMMMTSGQAIKYDGAFDCFRKIVAAEGMGSLFKGCGA
                     NILRGVAGAGVIALYDQLQMILFGKKFK"
     gene            complement(<643656..>644024)
                     /locus_tag="HG535_0A03200"
                     /db_xref="GeneID:59234017"
     mRNA            complement(<643656..>644024)
                     /locus_tag="HG535_0A03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286214.1"
                     /db_xref="GeneID:59234017"
     CDS             complement(643656..644024)
                     /locus_tag="HG535_0A03200"
                     /inference="similar to AA sequence:RefSeq:NP_076874.1"
                     /note="similar to Saccharomyces cerevisiae YBL029C-A;
                     ancestral locus Anc_3.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142109.1"
                     /db_xref="GeneID:59234017"
                     /translation="MDICRRPFKGRNATTQRLLLASEHPSTVACKMSFVCIPIICGVK
                     QWDTPYANDPKLNAIYCPNCHNRSVGPVKRKEFISIWFIPLFPIYWGKQLRCPICNWR
                     QDFKNKAQLEKVLREQQNIA"
     gene            <645684..>647042
                     /locus_tag="HG535_0A03210"
                     /db_xref="GeneID:59234018"
     mRNA            <645684..>647042
                     /locus_tag="HG535_0A03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286215.1"
                     /db_xref="GeneID:59234018"
     CDS             645684..647042
                     /locus_tag="HG535_0A03210"
                     /inference="similar to AA sequence:RefSeq:NP_009524.1"
                     /note="similar to Saccharomyces cerevisiae YBL029W;
                     ancestral locus Anc_3.314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142110.1"
                     /db_xref="GeneID:59234018"
                     /translation="MYSRIIEGLDILSDTKDELNDNTLNFISNVGIFDREVGDDAEES
                     TVENCNYDYREMSEDSDIINDTYSLAQNLDLNYPVSANDFRSKKATEYSNLNSNFSSV
                     SPVITMNFGKDVNFGSTGKNQFGDSHVNQEFGFNFGFGLVDNDTIGIKDKHNEINRDP
                     LMSSVAGSISSSSFSLNLSNDQLSPSSILSSNDIKSFNQSQSDLDKDITVDHDCTPAL
                     QSMASSSSFLMVNMPTKVAARKSKESSPAGRSPTINYVKQPRQGRYTASRRTPVSCAG
                     TDKNTLTSLNPADCMDPFTSNDSLSLSSQSAIPNTTMISGINSSNAAGPVENDFNKKV
                     SDSRLSAQGLAQVLRLDSPVEALKRERYILDIFENELHYPLGYKTWVRDTKKEYRTKL
                     IDELHDRVKEKYPEYDHHVLETIIRRATYYMMQSRLRRERRAKAKGIKVSRSTSVSSS
                     LS"
     gene            complement(<647259..>647576)
                     /locus_tag="HG535_0A03220"
                     /db_xref="GeneID:59234019"
     mRNA            complement(<647259..>647576)
                     /locus_tag="HG535_0A03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286216.1"
                     /db_xref="GeneID:59234019"
     CDS             complement(647259..647576)
                     /locus_tag="HG535_0A03220"
                     /inference="similar to AA sequence:RefSeq:NP_009525.1"
                     /note="similar to Saccharomyces cerevisiae YBL028C;
                     ancestral locus Anc_3.313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142111.1"
                     /db_xref="GeneID:59234019"
                     /translation="MAKSIRASSHLHAKSIKRHNVFQKVADARAERISEKLKRDLMEQ
                     KMKELEKKSNGNAMEVEAKASEEISKPNKKISTSGWRNARHHDYKKAKKMKKTKKNAF
                     TKF"
     gene            <648273..>649173
                     /locus_tag="HG535_0A03230"
                     /db_xref="GeneID:59234020"
     mRNA            join(<648273..648274,648606..>649173)
                     /locus_tag="HG535_0A03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286217.1"
                     /db_xref="GeneID:59234020"
     CDS             join(648273..648274,648606..649173)
                     /locus_tag="HG535_0A03230"
                     /inference="similar to AA sequence:RefSeq:NP_009526.1"
                     /note="similar to Saccharomyces cerevisiae RPL19B
                     (YBL027W) and RPL19A (YBR084C-A); ancestral locus
                     Anc_3.312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142112.1"
                     /db_xref="GeneID:59234020"
                     /translation="MANLRTQKRLAASVMGVGKRKVWLDPSETTELAQANSRDSIRKL
                     VKNGTIVKKAVTVHSRSRTRAYALSKRNGRHTGYGKRKGTREARLPSQVVWIRRLRVL
                     RRLLAKYRDAGKIDKHLYHVLYKEAKGNAFKHKRALVEHIIQAKADAQREKALKEEAE
                     ARRSKNRAARERRAQRVAEKREALLKEDA"
     gene            complement(<649417..>649647)
                     /locus_tag="HG535_0A03240"
                     /db_xref="GeneID:59234021"
     mRNA            complement(<649417..>649647)
                     /locus_tag="HG535_0A03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286218.1"
                     /db_xref="GeneID:59234021"
     CDS             complement(649417..649647)
                     /locus_tag="HG535_0A03240"
                     /note="similar to Saccharomyces cerevisiae YBL026W-A
                     (Scer_YGOB_YBL026W-A)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142113.1"
                     /db_xref="GeneID:59234021"
                     /translation="MITSASEWVYNETLHGELQKRDRNKNKQESQIYQRRHVLFPPIV
                     AGQFIPGSKEYIPLHHDGIVIGQLQMFTETLQ"
     gene            complement(<649873..>652758)
                     /locus_tag="HG535_0A03250"
                     /db_xref="GeneID:59234022"
     mRNA            complement(<649873..>652758)
                     /locus_tag="HG535_0A03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286219.1"
                     /db_xref="GeneID:59234022"
     CDS             complement(649873..652758)
                     /locus_tag="HG535_0A03250"
                     /inference="similar to AA sequence:RefSeq:NP_009640.1"
                     /note="similar to Saccharomyces cerevisiae MIS1 (YBR084W);
                     ancestral locus Anc_3.311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142114.1"
                     /db_xref="GeneID:59234022"
                     /translation="MLSRLVCLRQLSALKKTVSPTLYHTLSGTKIAKSIREQANSEIQ
                     SIRKNFPDFEPKLKILQIGAKPDSSTYVRMKLKASTESGIACDVEKMPDTITEVELLN
                     KIEQINDDDSIHGLLIQLPLPKNLDEARITNAVSYKKDVDGFHRYNAGELAKRNGSPF
                     FIPCTPNGCIKLLQEAKIDLNGKNAVVIGRSDIVGTPVSNLLKNMNATVTMCHSRTKN
                     IPEILSTADVVIAACGMPQYVKGEWLKEGAVVIDVGINYIPDNTKKSGVKLVGDVDFE
                     SAKNKCSYITPVPGGVGPMTVAMLVQNVLSAAKRQLTESDNMPKIAPLPLHLKQPVPS
                     DIEISRSQQPKPVLEIAEELGIHNHELELFGHYKAKVSLSILNRLQDRENGKYVLVAG
                     ITPTPLGEGKSTTTLGLVQALSAHLNKPSIANVRQPSMGPTFGVKGGAAGGGYSQVIP
                     MDEFNLHLTGDIHAIGAANNLLAAAIDTRIFHEKTQKKTSTFYSRLVPKKKGKRTFTK
                     SMLNRLKKLGINKPNPDELTEEEIEKFARLNIDPETITIKRVVDVNDRMLRQITIGQA
                     PTEKGQTRSTGFDITVASELMAILALSNDLKDMRGRIGRIVVAANYDGEPVTVEDIGC
                     AGALTALLKDAIKPNLMQSLEGTPVMVHAGPFANISIGASSVIADKIALKLVGKSKKS
                     HVQNQEGGFVVTEAGFDFTMGGERFFNIKCRASGLTPDAVVLVATVRALKLHGGAPDV
                     KPGQTLPLAYTEENVDLVAKGVANLCKQISNARQFGVPVVVAINKFETDTEAEIEVIR
                     KAAKEAGAFDAVATNHWEKGGAGAIDLANAVVKVTNEPSDFKFLYDVQQSTENKLATI
                     VKKMYGGADIDILPEAQKKIDMYNKQGFGNLPICIAKTQYSLSHDASLKGVPTGFTFP
                     IRDVRASIGAGYLYALAAEIQTIPGLSTYAGYMNVEIDDNGEIEGLF"
     gene            complement(<653032..>655308)
                     /locus_tag="HG535_0A03260"
                     /db_xref="GeneID:59234023"
     mRNA            complement(<653032..>655308)
                     /locus_tag="HG535_0A03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286220.1"
                     /db_xref="GeneID:59234023"
     CDS             complement(653032..655308)
                     /locus_tag="HG535_0A03260"
                     /inference="similar to AA sequence:RefSeq:NP_009639.3"
                     /note="similar to Saccharomyces cerevisiae TEC1 (YBR083W);
                     ancestral locus Anc_3.310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142115.1"
                     /db_xref="GeneID:59234023"
                     /translation="MVEPAGTTISTREDCASDSNFEEDNDMKQEDQEVQVQVDGQSHD
                     RDTAKRMSESIPGQPNDSGKYNRNSNDDDANDDDEVQQGEVGAGGEAGKQGEVADKGS
                     SIIGESTAQEGEPVAMAGASTRAGTSQKISINSKNTSNINSNSKSNINSSSNRYSNTN
                     SSGESTAWNPANAKVFDVYMDNGSSQTSQLLDIFACENNHKELSESNINSKRKHGEEG
                     LELYNSGTGERSHGFLDKMNEKKIKLDSTIVSEKKQPSSLSLPMVKLEPHQQLPQQMQ
                     RQSSLPSATPPQVTQLPWGMPNALPHSAPIHGDQLTTFGQTDKWPSKMENAFIAALRL
                     IIKNGTSKFKILDRNYGRNELISLFVQYHTGEVRTKKQISSHIQVWKKSISNKISSNY
                     KVNALDEEILLLIEEGAPQTNESIKLFYMCFEEIVSVLSKQSQHMQARNSAARDSMPP
                     YPYFLSPAQSAKNPLTPFSQTELLQHQQQHQQHEHQNSPRPATPLDYAKSIYGSLKTY
                     KCVPVKVQDQDSMHHDIQQQYHQPIQKPQQLSQQQMSPQQQDSLLRHRTQQQQQQQQQ
                     QQQQQQQQQQQPVYVIPPQKNHSVPHSILQSAKDLEYQQRQLIENLSQTQNQLKLPSV
                     SPNLYIRNFQPPTISAQQKVFQNSSQPIVSRSIQNYTTPYPKVQHGGEQIPVNMVVPP
                     HKYYQQPQIYVPVSAPPAPINTNGNFSGFPSTQLPMKDVTQRQQHPSSDSSSSSTTYN
                     QSSHAQGKETYQLDGNKH"
     gene            complement(<656893..>659976)
                     /locus_tag="HG535_0A03270"
                     /db_xref="GeneID:59234024"
     mRNA            complement(<656893..>659976)
                     /locus_tag="HG535_0A03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286221.1"
                     /db_xref="GeneID:59234024"
     CDS             complement(656893..659976)
                     /locus_tag="HG535_0A03270"
                     /inference="similar to AA sequence:RefSeq:NP_010345.3"
                     /note="similar to Saccharomyces cerevisiae MAK21
                     (YDR060W); ancestral locus Anc_3.309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142116.1"
                     /db_xref="GeneID:59234024"
                     /translation="MSGNPGLKSLKGMVSAKLQKNGKKSKKAKRSPRPERDLEAKLST
                     NDESDILHREAIELGATEEDIKLVKDLEDQDEEKLSEQEFGPSADEDEDTEFQDDLQS
                     FLKTLGLEKTQVDIVSDTEVEEPDQKAVREEEGKPVEEDEDGESELIEASLSSDPNSE
                     ADPESSEAEVSEHEEPEDKPKEKKNSGFIAQNDMVDSDKLIISFDKVWYELPLDPQLE
                     RNMNDNDIELTAEQITKLYERGKETLEKDNETYYAEFTKESSQKKFMSQILTGGTLND
                     KISALTLLIQESPIHNIKSFETLLSFCNKKSRNSILQSVNALKDLFLNGLLPDRKLRY
                     FKNQPGLSMMINKKSLAIFYFEDYLKKKFFQILEVFEKLSHDPIIHVRLQCLNHMYDL
                     LSAKPEQEFNLLRLIVNKIGDIDAKVSSKASFLLSKLEQAHPNMKSVIIDAIVDVALK
                     PNADYHTTYYSVITLNQTILKRAEDSVANKLIKTYFTLFEKFLLNTDADNVEDGNNEG
                     NEKSAAQGYEARRKKNYKKGKKGGKSVKGDKTESELVSEKNSKLFSALLTGVNRAFPF
                     AQLSAKVYEAHLETLFKITHSSNFNTSVQALVLINQVVSKAQLDNDRYYRTLYESLLD
                     PRLISSSKQGIYLNLLHKSLKQDSQNVSRVEAFVKRILQVCAHWINMGTIAGFFYLLL
                     QLVDFIPQIKNLLINTPTDYEYQSDDETTDKDNFKKREVYDSRKRDPKFANADKSSLW
                     EINYFTNHFHPTIQLYSQAFIENKKDETTKPDLGLYTLAHFLDRFVYRNSKQKANVRG
                     TSIMQPLYGGSKLESNLLVRSTDYVNKEIPANTENWLDKKVEDIKPDERFFYQYFTTK
                     QNAMKKAQGTQQVSHDGSDLDEDDVWDALVKSRPDVEDDSGDEDGFNFDDEELDMSSG
                     EEDPEEEIDAASEVEEQDSNSDDDEFFSFADEDDLEGSAKRLHAELEEGSSESVSEPE
                     SESESLQPHSASDSTSKSGGTKAHKLKNKKQRLGDLPLYGSIEDYAKYLDSDKED"
     gene            <661049..>661381
                     /locus_tag="HG535_0A03280"
                     /db_xref="GeneID:59234025"
     mRNA            <661049..>661381
                     /locus_tag="HG535_0A03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286222.1"
                     /db_xref="GeneID:59234025"
     CDS             661049..661381
                     /locus_tag="HG535_0A03280"
                     /inference="similar to AA sequence:RefSeq:NP_010339.1"
                     /note="similar to Saccharomyces cerevisiae CDC34
                     (YDR054C); ancestral locus Anc_3.301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142117.1"
                     /db_xref="GeneID:59234025"
                     /translation="MGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFTTKIYHPNINAN
                     GNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEATAR
                     EWTKKYAV"
     gene            complement(661748..661819)
                     /locus_tag="HG535_0Atrna1D"
                     /db_xref="GeneID:59234611"
     tRNA            complement(661748..661819)
                     /locus_tag="HG535_0Atrna1D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:59234611"
     gene            complement(662020..662091)
                     /locus_tag="HG535_0Atrna1R"
                     /db_xref="GeneID:59234617"
     tRNA            complement(662020..662091)
                     /locus_tag="HG535_0Atrna1R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:59234617"
     gene            <664105..>668172
                     /locus_tag="HG535_0A03290"
                     /db_xref="GeneID:59234026"
     mRNA            <664105..>668172
                     /locus_tag="HG535_0A03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286223.1"
                     /db_xref="GeneID:59234026"
     CDS             664105..668172
                     /locus_tag="HG535_0A03290"
                     /inference="similar to AA sequence:RefSeq:NP_009637.1"
                     /note="similar to Saccharomyces cerevisiae SPT7 (YBR081C);
                     ancestral locus Anc_3.307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142118.1"
                     /db_xref="GeneID:59234026"
                     /translation="MIDMSTIVKYQGTNVRPVLQLTEKLFSEAFFNPYLTAQQLIVLE
                     SLLSINDRSTKLNVWQELMNGNVTLNIVNVAPKISEDDIKKSTQEAQLGGGEERSDEG
                     QTMSDLNNSAGNEQVEDDLSQLDLEDFRQKVTGSDFIGNLSLKIRYVIWQCAIDHLWR
                     NSPDDDYDNGSDFLLLETDGVEECSEANEFVNISISTTQRSEDDDYDEENDYDGNYDD
                     DRDRKRDGLQSSLMSFNNIEVSKDGNNHMTLTLRVSKDILPKLRSNDVEEVMRNCNRI
                     YHNFEHDKETMQKRLRLEANDKLLEGTRKKRSHSEIDVGQTNNTELNANAVEIDEKLP
                     PSHNLSPNENLVLVSEGGVQDGKRPRRDSVPLPVNLGAANLSLKHLLSNIQENKSRLK
                     ISDYELKHLIMDVRKNRSKWASDEKIGQEELYEACEKVVLELRNYTEHSTPFLNKVSK
                     REAPNYHQIIKKSMDLNTVLKKLKTFQYKSKQGFVDDVMLIWKNCLTYNSDPSHFLRG
                     HAIAMQKKSLQLLPLIPDIVIRNREDVEKELEEMEKEKGFEEEEEEEEEEEEEEEEVA
                     STGRKGLSMGAHKPSKAYGSNSEEPGNLAEKRNTPETVNKTTKGKSHDENIFTEENEV
                     NLLSDTKSVEIKSNEISTSKDESLQNTNDSKHMEMGRRDHVIGALREGDGGKQDEEKV
                     GVNGGREEKEEAEEEKEEEEEEEKEAEAEAEAEEEEEAEEEEEEDDEDNDEEDEEEEE
                     EEEEEDDMTETQEYYTEKNDDKDDVEISVWKSVTAKVRAEICIERSRYFENGKLNSNS
                     NALLKNPQKMKGFSQLYTEYKEQKELELQRKKLEQESIMKNGFHAVIKQEEEDPKLTG
                     DDSSPVNSDPFEKESNDIELDTNMFLQEYDVTNSLPAFKYMGIDGKILDRKEDAQVKK
                     LLDNGNSKESIFLLNRNRGLSPLINKNIELIQNIRHICHKISLIRLLQSPSSMLNNRN
                     GSNTQQLINSHQYKFDRIDDSLDIDPISQLDTHDFKNNKLLMWKLMHKNVSKILMSSG
                     FETTKPSATNMLTEIASEYLSNLIKSIKIHHESNSLIHAKPSDILRMSLLENGIGRPD
                     DLYTYIDSEFTKKTKKLVDMKMKLEAFLKDLLRPTLQELSERNFEDESQSFLTGDFAT
                     ELTGEDFFGFKDLGLEKEFGVLSSSVPLQLLTFQLQSNDTEAEVQVKKIQPEEFDNVV
                     YSKISREEIDKGAFWSVLMPLLRKSWERSKMYRQKLAKSFSSQYQDVHQASDNSNELL
                     VEDEEMILKAKSGNRPRLPPTGKIGSSYKKKAICDAFILPEDEEEDQNENEESSAAQM
                     LRKGVDVTPDKNEKIGPSNTPAENSFDLSLSGLEK"
     gene            complement(<668256..>669824)
                     /locus_tag="HG535_0A03300"
                     /db_xref="GeneID:59234027"
     mRNA            complement(<668256..>669824)
                     /locus_tag="HG535_0A03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286224.1"
                     /db_xref="GeneID:59234027"
     CDS             complement(668256..669824)
                     /locus_tag="HG535_0A03300"
                     /inference="similar to AA sequence:RefSeq:NP_010342.3"
                     /note="similar to Saccharomyces cerevisiae YOS9 (YDR057W);
                     ancestral locus Anc_3.306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142119.1"
                     /db_xref="GeneID:59234027"
                     /translation="MWQVIAFLVAGCFHISSANLTPVVDPICMNKYLITYMTPKLWDK
                     TFGNNETALSLGRIMNVGDEMSCYVYNNLTSSFNVSNQVDEEYLGDHLASILETGVDI
                     IINSITECLRNFRGFWNYEYCPNGTLVQFHGDPKTSSLYYVLAGMRTLGSNREFRLLH
                     NDFGYYITETVSSGDICDMTGQPRVVNLQYVCGPAAGSAGIQWVREHKTCHYEVQIAV
                     QSLCKLELLSTTGDKKFSTPLICSKESRQIKDVLHTIAEFEPTFMGNELYFLRPCNPI
                     NQTERTSLVYSGQLIIEGKPSEKETEIVRMRFKKAIGRMLIQELILLPDGSPLQNGDE
                     ISWFSEVVDLKGNFLTTVHFTINSSSIPHITFDPYFDTKGKGNVLSYKKNDKPDEKPF
                     NLQNNEMTFESQLSLDFKDKFKFVLIHEKIDSGEQLVLDETDYILEDVLSAEQIAELL
                     VKLESEQQTNNRAEKNKEDKTPESRMKDDTSNEETTKGEKDEQVSGDEDITNPKENAD
                     PIVEEKAGNIHDEL"
     gene            <669997..>670584
                     /locus_tag="HG535_0A03310"
                     /db_xref="GeneID:59234028"
     mRNA            <669997..>670584
                     /locus_tag="HG535_0A03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286225.1"
                     /db_xref="GeneID:59234028"
     CDS             669997..670584
                     /locus_tag="HG535_0A03310"
                     /inference="similar to AA sequence:RefSeq:NP_010341.3"
                     /note="similar to Saccharomyces cerevisiae YDR056C;
                     ancestral locus Anc_3.305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142120.1"
                     /db_xref="GeneID:59234028"
                     /translation="MRVFHLFTMLALAMASQFSLLARSIDSDEQTFLGTFAYDETFNT
                     SIIELNTNLIPNHGPHCLNALAENGELALRCFQVMEILSPLHYNLILHVYDNQLQRVT
                     LAYNPDVDGIVPKVNLAARGPNPQAIKLKRVTKTYKDKKAGDKALTAQFEEDVVVENK
                     SWFQRNWKKLIMGAVIYSAISSYGAQPKQAPTKND"
     gene            <671229..>673511
                     /locus_tag="HG535_0A03320"
                     /db_xref="GeneID:59234029"
     mRNA            <671229..>673511
                     /locus_tag="HG535_0A03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286226.1"
                     /db_xref="GeneID:59234029"
     CDS             671229..673511
                     /locus_tag="HG535_0A03320"
                     /inference="similar to AA sequence:RefSeq:NP_009636.3"
                     /note="similar to Saccharomyces cerevisiae SEC18
                     (YBR080C); ancestral locus Anc_3.304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142121.1"
                     /db_xref="GeneID:59234029"
                     /translation="MEKFRLPSFGKATAHHSPPDMSNVDSTPRNLIVANCPNNAYALA
                     NVAAVSPNDLPDNIYVLVENLFVFTTRHSNEVPPGTIGFNGNQRTWGGWSLNQEIHVR
                     PFDLFKYSGKHSYLGSVDIDISFRSRGKAVQTPFDQDELASQFAKTFESQIFSPTQYL
                     IFEFKGNIFDLKVRNLQTIDLGDIEPVAPVSSGIEAKGILTKQTQINFFKGRDGLVNL
                     KSANSLRPRSDAVIRSDFKFEDLGVGGLDAEFTKIFRRAFASRIFPPAVIEKLGISHV
                     KGLLLYGPPGTGKTLIARRIGKMLNAKEPKIVNGPEILSKYVGSSEENIRNLFKDAEA
                     EYRAKGEESSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMDGVDQLNNILV
                     IGMTNRKDLIDSALLRPGRFEVQVEIHLPDERGRLQIFEIQTKKMRENNMMDKDVDLG
                     ELAALTKNFSGAEIEGLVKSASSFAINKTVNIGKGATKLNPKDIAKLKVTREDFLNSL
                     EEVTPAFGISEEDLKACVEGGMIRYSESVDSILKNGARYVRQVRESSKSRLVSLLIHG
                     PPGSGKTALAAAVALKSQFPFIRLITATEISGMSESAKIAYIDNTFRDAYKSPLNILV
                     IDSLETLIDWVPIGPRFSNNILQVIKVALKRKPPQDRRLLIMTTTSAYSVLQQMDILS
                     CFDNEIAVPNMTNLDEFNNVMIESQFLDDEDRVKVINQMAQVCPHFNIGIKKALTNIE
                     TARHDDDPVNEIIELMAQSA"
     gene            <673774..>676812
                     /locus_tag="HG535_0A03330"
                     /db_xref="GeneID:59234030"
     mRNA            <673774..>676812
                     /locus_tag="HG535_0A03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286227.1"
                     /db_xref="GeneID:59234030"
     CDS             673774..676812
                     /locus_tag="HG535_0A03330"
                     /inference="similar to AA sequence:RefSeq:NP_009635.1"
                     /note="similar to Saccharomyces cerevisiae RPG1 (YBR079C);
                     ancestral locus Anc_3.303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142122.1"
                     /db_xref="GeneID:59234030"
                     /translation="MAPPALRPENALKRADDLISVGQRSAALQSLYEYLTARRIRWAQ
                     PSAVEPIVFRFLELGVELRKGRLIKDALHQYKKLVQGTPEGLVSVGAVARKYIDCVEE
                     KIASEQAKAEELQKQDEDDDLDGGVTPDNLLISVYEKDQSVGGFNDEAVTTWMKFTWE
                     SYRAVLDLVRNNSHLEITYSGVVSRSMQFCLKYKRKNEFKRLAEMLRQHLDAANYQQS
                     KSGNNIVDLSDDSTLQRYLEQRFHLVNVCVKLELWHEAFKSIEDVYHLSKMSKNPPKP
                     STLANYYDNLAKVFFVSNNQALHTAAWEKFYRLYTTNKNATEESLQHYASLIMLSALA
                     IQPDYLPTVGYDPHARLNRFLGYERKPTRDETIESALKEDVFPKVDKDIKKLYEILES
                     KYNSETLKDELKILLPRLESKSYFSQYATQLRDMIVRKTFVSASQNNSVIKTDELYAL
                     ASLPAPLDMSYWDMEKALLQAAVDDNVSFIIDHESNTVNFVKDPFEVFTSIEISVDGE
                     EIENEEVDGESDQEEEIEAGSKEEETLESEEPEAEPVTTRNNYIRNKLAELSKELNEN
                     GDFQQASYLEKIKLARESLIFKTQAIIENTRRIAEERAKKSQEQRQKYMANAAANAEQ
                     DSESRQKRIMEERAAIEARMEEEAQRRLVEKKKRELNALKEAEVRKFIEEVNAKGQIY
                     IDPTEAKTLEIKDVRKLIVGQLSKDQLELNDRMDFALKKLDHTERALRKVELPLLKKE
                     ADALKDADMKEFEKTKAKIINTAKEDHDARLADHERLSRAFNDYKKLKDQIIAKTEEE
                     VSKLRAEKQAEFEAAKKARIERVRQERYEELVAQRKEELEAKEREEREIKQAEIQRKQ
                     DENARKQREMETAAAEKQAELNRKQDAVAMRQREIEEAAAKKQGKSSEPSRSFIKPFG
                     NQKSRDELDAIARRQREMEEAAANKQDRSSGTSMSSGRPFGNQKSRDELDAIARRQRE
                     IEEAAEKKQAGRTATNTSSGAPKQMTYTERMRQKREGKLQ"
     gene            complement(<677228..>678689)
                     /locus_tag="HG535_0A03340"
                     /db_xref="GeneID:59234031"
     mRNA            complement(join(<677228..678444,678632..>678689))
                     /locus_tag="HG535_0A03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286228.1"
                     /db_xref="GeneID:59234031"
     CDS             complement(join(677228..678444,678632..678689))
                     /locus_tag="HG535_0A03340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142123.1"
                     /db_xref="GeneID:59234031"
                     /translation="MQLKNSVIAAALVTGTALAANSTVSVPSSCTITSSATATAQGDL
                     DDYSSCSTLVGNLTISGSSLSNAALANVEAIHGSLTITNATSLDSFHADSLTSVTNLR
                     LNQLTVLSSASFGSLQRVELIEFIALPALQTFTTNLRSANMIYISDTSLESVNAFSSL
                     EEVAIFNFNNNRYLTNLQSTLRTVSNALEFSSNGEGANVTFDSLIWANNVTLRDVNSA
                     SFAALRNVNASFGLINNSITSLNMSHLAAVGGSFAVVSNDQLTDLHCSNLSQVGGGFV
                     VANNTELNQINGFHNLSSVGGALEVQGNFTQLDLANLRSVRGGANVDTRSGNFSCNPL
                     RSLQRNGGIQGDSFVCRNGATSTSIQLSSTSSSDSSSTDSADASSTDDGSSSSATATV
                     SSSSSSKHNGAAQFAPAGSFFAVVAAAAAALL"
     gene            complement(<679526..>681289)
                     /locus_tag="HG535_0A03350"
                     /db_xref="GeneID:59234032"
     mRNA            complement(<679526..>681289)
                     /locus_tag="HG535_0A03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286229.1"
                     /db_xref="GeneID:59234032"
     CDS             complement(679526..681289)
                     /locus_tag="HG535_0A03350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142124.1"
                     /db_xref="GeneID:59234032"
                     /translation="MTFSQAVTPAADEAKFQKYEPLIEKYNQDKWAQIERFDPHFYKL
                     CLSKLPKECELDSEPINATQFVTEKEYGLLSNLEYKIVNAYTMSELLAKQRSGELSAE
                     TIAKSYIKSAIIAQFTTNAAMQFLIPQALEKAKRLDGHLKRTGELIGPMHGIPISLKE
                     HMNYEGQITTASYVSLIDNVVKESAVTTQIFDKLGAVFHVRTSQPQCIMHLDTWNNIS
                     GRTRNPLSTRLSPGGSSGGESAMVGMHGSVIGVGSDIGGSIRCPSAFANLFGLCPTTK
                     RLSSMHCVSGGRGQESIPSTEGPLARSIEELEYFMDSYINHGKPWEYDPTNVPIPWKP
                     ASLPADRKIRIGVLSTDNLVTPYPAVTRGINETVAALLESAKFEFVDLTPHWFTETEM
                     EEIYNCNLKLYTVDGNQQQLELVEPSGEPVLPLTKHFLEFGGGNELSVYENKKLNIKR
                     DSVRLAVFEKFFSRKPGSLNVDFILSPTYVGPSEIPGQSLYWGYTSFWNLTDYPNVVF
                     PTGHTHDKAIDTFEAPDKLRGNKYEKMVWLNDDAKTLKYDPEHYVGGPVALQLTGRRF
                     HDEDVVAAVKLISDTLKLSRR"
     gene            <682423..>683835
                     /locus_tag="HG535_0A03360"
                     /db_xref="GeneID:59234033"
     mRNA            <682423..>683835
                     /locus_tag="HG535_0A03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286230.1"
                     /db_xref="GeneID:59234033"
     CDS             682423..683835
                     /locus_tag="HG535_0A03360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142125.1"
                     /db_xref="GeneID:59234033"
                     /translation="MGRSSGDLKANRIQIEEKENNGEETVDTEIEVPDGGYGWVVLLA
                     VFLYNFCTWGANAGYAVYLAHYLEQNTFPGGNKLDFAAIGGLSYGAGLLFSPLITVLS
                     HKTSVHFTIAIGIVFQGAGLLLAAFSKKLRQIYLTQGLLISLGLAFILIPSISLLPQW
                     FRTKRSLAMGIATGGSGLGGIMYNLAMQRIIEKKSVKWALIVQFILGTTLSFIALLLT
                     RTRREIVLKNSKVEVQLLDKQLLINLCPWLIYGWVSMTVLGYIILLYSLSAFTTSLGY
                     SSEQGSYVSCMVSVGNVVGRPIIGHIADRYGPISIGVLVHLLVAIFAWAMWIPCRNLA
                     TAITFALIEGALMGTLWPILGSVLARAVGLRKLDAAFSTMWLFLAISSIPAPVIGLQL
                     RSNDPSDPNTYINTALLAGFGYFCAAIFLWLLRGYIIARDNSISDSKAVDKDELHIKV
                     SPLALLGGLMTVKSTSQRVV"
     gene            <684373..>685245
                     /locus_tag="HG535_0A03370"
                     /db_xref="GeneID:59234034"
     mRNA            <684373..>685245
                     /locus_tag="HG535_0A03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286231.1"
                     /db_xref="GeneID:59234034"
     CDS             684373..685245
                     /locus_tag="HG535_0A03370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142126.1"
                     /db_xref="GeneID:59234034"
                     /translation="MSHLKSSAASLLLRQYRELTDPKKAIPSFHIELDDDSNIFVWNI
                     GVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQS
                     GDPTTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPDQYKQRV
                     KMEVERSKQDIPQGFVMPTSDSAAYVSKISKQDEVEDNKDIADNFWYDSDLDGDEDGN
                     GGLHDDSFSFEEVDDETYDYQTGYRNGSDEEELEFEDDDSMDNDSVMDRKQPHKAEDE
                     SEDLEDVEKVGKSL"
     gene            <685685..>686209
                     /locus_tag="HG535_0A03380"
                     /db_xref="GeneID:59234035"
     mRNA            <685685..>686209
                     /locus_tag="HG535_0A03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286232.1"
                     /db_xref="GeneID:59234035"
     CDS             685685..686209
                     /locus_tag="HG535_0A03380"
                     /inference="similar to AA sequence:RefSeq:NP_009633.3"
                     /note="similar to Saccharomyces cerevisiae SLM4 (YBR077C);
                     ancestral locus Anc_3.300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142127.1"
                     /db_xref="GeneID:59234035"
                     /translation="MIIQSQNVMDLLQKLLRPVSIDCVSFQSKPLQSAALLSKLNGSV
                     LSFSTSAPTTEIHSINNLKMMSLLIRDKWAEDELVKQEQVDTTNGHATWPPSNIKNCY
                     QYETPSTEGGEPLTTNIYTYEIEELHACVCQLPRSDLLLLFIAEASFPFGLLALKMQK
                     AVTPFQGLHGYQLG"
     gene            <686451..>688235
                     /locus_tag="HG535_0A03390"
                     /db_xref="GeneID:59234036"
     mRNA            <686451..>688235
                     /locus_tag="HG535_0A03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286233.1"
                     /db_xref="GeneID:59234036"
     CDS             686451..688235
                     /locus_tag="HG535_0A03390"
                     /inference="similar to AA sequence:RefSeq:NP_010337.3"
                     /note="similar to Saccharomyces cerevisiae DBF4 (YDR052C);
                     ancestral locus Anc_3.299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142128.1"
                     /db_xref="GeneID:59234036"
                     /translation="MATRSPLKEADANLKHRILSVNDRNGESTTNITCEESNGTKKRA
                     LERLDLQDRKKVKAERARSIEGAVKVARTTGLKNTESKVTPNELLEWQNNWKKIIKRE
                     SRIYFDIADDADFNKHLKSLDKKKELLKRGFLSLGAQITQFFDCNVTIVITRRSLEAL
                     NMMNSSDVLARAKKSYMKIWGYEKAARFLKNLDVDLDLLERNNATPLATPTLSNLLQN
                     EKLYGPTDRDPRSRREDVHYFKYAHVYMYDLWQMWAPIITLEWKPQELTDVKKLPYPV
                     LKMGTFGRCPFIGDNSCDESSYKRVVKRYSRDKANKPYALKLRRLYQDYATPCESSDH
                     LKFIPHTCLSSKQCYEKLKLKFEQSNSQKNMGNCSKDSVDFKATEKTTSNKEEHEKPQ
                     LQPENEVSQVIDTPEQNNLPELTKIASLTRQETEDFPDDLCNNKKKSRIPQEIKASGV
                     HQSNDVATSFGNGLGPTTASVTNKNIKTLNRLVVDRKLGSKTSNPVHALTIRSLGAVG
                     SDGQMPAPKACNSKEAVLEPATKKKTDNVPITRRDTTKNAGYCENCRVKYESLEEHVL
                     SERHQSFAQNPLNFEAIDSLIEKLKFQF"
     gene            <688542..>690728
                     /locus_tag="HG535_0A03400"
                     /db_xref="GeneID:59234037"
     mRNA            <688542..>690728
                     /locus_tag="HG535_0A03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286234.1"
                     /db_xref="GeneID:59234037"
     CDS             688542..690728
                     /locus_tag="HG535_0A03400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142129.1"
                     /db_xref="GeneID:59234037"
                     /translation="MSSEIRYRARRSSSNKRKVSDFLKITEKRSRNGCLNCRKRRKKC
                     DEVKPVCTACKRNFLQCVWPEGGMPVEKISSSARRYNPISFSNLTIHDLNDIYSCSST
                     VNVSLGNDFTKVRKRADAFITLSVKNGILELRNNGKKYMETCDFPTAEQLCGFEDDLS
                     KSTDLQNRVSIEAEDRLVPNMVDNLEYKEYFDLQLKPSKIFGEPNFAFNWFTRYDNLE
                     ELVNHGIGCGENRSLDEGIITAVNNMNKERNHRDKVGRRVNYDYLYDEQDPLARKYND
                     VMNQFDQGDYSILRQTSTDEDFLIYACVHRWLPKMGPQDTHPLLTTAATFTSHFLSNY
                     VVKEVFLCCGATYLEWYQYDLFNELSNKLYKSSLALIDKYLNENAFHGTEAWLLASYQ
                     LLCLRNKTTSSSTVDDCVYCLSNSYRIIKATYYVSDNVMTDQARDNSNSSKFFYQQTT
                     KQVHELTYEIENQVLEIEEQIDNVKNHLVLQAHERMFIESFIYNYSVAILWSSDTSKL
                     PNPFTFFKEINHLLRCPIYHCKAQWMNNPILGAASDGFEILAKVSYLTRLSMPLPRDS
                     IWIKRCQQLLKMSKFYTSPIILPRATEEDPRMNESCVLNIYVGKIIAKLCYLLLCKIM
                     RYETYRINEAQPIVDEIIEIMEKIPEKNLMWGILLWPIIICGIFVINPIHQLKILKYL
                     SNIGELLHKSSILNSNLFLKNIWSTENGDERLNVIFDKKKLMKVNP"
     gene            complement(<691085..>691294)
                     /locus_tag="HG535_0A03410"
                     /db_xref="GeneID:59234038"
     mRNA            complement(<691085..>691294)
                     /locus_tag="HG535_0A03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286235.1"
                     /db_xref="GeneID:59234038"
     CDS             complement(691085..691294)
                     /locus_tag="HG535_0A03410"
                     /note="ancestral locus Anc_3.298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142130.1"
                     /db_xref="GeneID:59234038"
                     /translation="MNIHTGRKPFACPSPNCGKSFNAKSNMLRHFKLHFKLSSGVFLL
                     PNGEVTHTKPSSKDLHLYLERYSPI"
     gene            <694003..>696066
                     /locus_tag="HG535_0A03420"
                     /db_xref="GeneID:59234039"
     mRNA            <694003..>696066
                     /locus_tag="HG535_0A03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286236.1"
                     /db_xref="GeneID:59234039"
     CDS             694003..696066
                     /locus_tag="HG535_0A03420"
                     /note="ancestral locus Anc_3.296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142131.1"
                     /db_xref="GeneID:59234039"
                     /translation="MEQKLREIELLHRDISRSCGQLALQMDDVSMAFKILSGNLARDP
                     FDLATILLLCDLYLKNADYSNVVELLGDPLQKGWPSAISGDRRVWTRLSLAYFHLHNL
                     SEALAAISKAIELSSREDPYLFVLRCRIFLKMPKARYSLDSVMPFFEKTLILTQASQI
                     PSLHVEALLSRSRLFMEYADFGRARMDIDDSMSILHDPNALNFFEVEDFLLKATLTYC
                     LAATVQETSEKSSEVVELGLRNFEHTDKTALPLLLMKTIHRCIQHKNLNDILSELILS
                     LNCLPTQFHRMISYAIARVFLEIDNVSHSPDAYQYLHKSLELADDQDPLALVSLGFLH
                     FNQKRFNDSLSTFFHAIKLPDSVNYKSEDYIASLKAYSWYGIAKNYFSAADITKGEKA
                     LDMFRKIITASPVSSSVLNLDICKISENCEEYFDLPPEFLKDEIIKQECSNFIFDERM
                     EQSPISSLPHENVSRWNCDSRFDPISNISGSLTSILNNPLFCDKEKATKKKAKSLKKK
                     KNDIFRKMPLSITKPVSKKPKRDQQRTLRKTTPSNEVANLNDQILNPSDISPHYDSDK
                     NSDFSNPYQVPFKSAHTYSSYRTPAMHMQQQITFPASTTSSMIYYSQEGPYMSFNNVT
                     QISNNYPNNNANNGQRVLVDPTFGNSLYIVEDTRLRATQMPSVASSPTPYRMTQSYRD
                     VYHHA"
     gene            complement(<696221..>699118)
                     /locus_tag="HG535_0A03430"
                     /db_xref="GeneID:59234040"
     mRNA            complement(<696221..>699118)
                     /locus_tag="HG535_0A03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286237.1"
                     /db_xref="GeneID:59234040"
     CDS             complement(696221..699118)
                     /locus_tag="HG535_0A03430"
                     /inference="similar to AA sequence:RefSeq:NP_009630.3"
                     /note="similar to Saccharomyces cerevisiae YBR074W;
                     ancestral locus Anc_3.295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142132.1"
                     /db_xref="GeneID:59234040"
                     /translation="MLSEFLKSVFRFRKTNLSVLLSTTYIILWLLFAYDRSSYKFAAP
                     SNNDFDGAPILLETAWLDLQVVTKGFHPYFTKDNTRVHDYLLNRVLNVTKAVPFAQVY
                     DDMREKSSIALKRNDVFNPSSKIDRAYYFESANILAKIEGKNVELPGILLSAHYDSVP
                     TSHGATDDGKGIVSLLGVLDYFSRHQPERTIVFNFNNNEEFGLLGAEAFMRHPWSKIV
                     SYVINLEGTGTGSQAVLFRASDTALAKVYRNAVRKAPFGTSIYQQGFNDGSVRSQTDY
                     AVYTNYGLRGLDIAFYKPRDLYHTIKDSIQYTSKEALWHMFHSTWQLTNYFSRNEEID
                     NGDLTPAIFFSVLGLKFFAFSARTLFKYNCVILLAYPLLILIFNIAGQKNDKEKRSYW
                     NVSVRLPLSFGISVAIAYLTQFALTTLNPFVLSRSYFLPLFAVAGAFSVANYLILSFM
                     EYISPMQDFKTTIFHQVTILLWFVLLSSTITLYRNGYKETGAYICTFLYLLMSIGTIL
                     GRVCKIFKKAQIEEKNGTRKPLSSYGTDDNAGHSYEQSADEDLENAGSAEVATNDANS
                     TTNGQNGLVEQSESELDERAPLLENRSPKVDSAAESKFKGIAIKSLNYDWSIQFLFVF
                     PLATFIVFNALDLTLDAVHQTIQEDKIATAFTWNIVLIGGIALSLPLLPFLYKINYVL
                     GLLLSSLFFISALLSIVLAPFTEEAPLKLRFSQEIDLSNKNEPIVAIYGRQGGFISSM
                     LNDLPSIKQNNETVWCEDLSNGMENCFYRGLSPSLVDSDTFMGPNDLMSIKVLENDRT
                     SPDRSLYAPINARFEVKVKQNRACSLWFNSLTQKDSPVRQVTIYKSWHYEKNETESEV
                     IRINTGIDQLHLYKVDFDMPYYDIGVQWLPKIVTADPSNTIVEQEKGDEDILGVTIKC
                     YWAEYETESIVSGEHYRKVPAFDELLEYAPINYSFANVDKGLVFISDEIKL"
     gene            <699364..>700464
                     /locus_tag="HG535_0A03440"
                     /db_xref="GeneID:59234041"
     mRNA            <699364..>700464
                     /locus_tag="HG535_0A03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286238.1"
                     /db_xref="GeneID:59234041"
     CDS             699364..700464
                     /locus_tag="HG535_0A03440"
                     /inference="similar to AA sequence:RefSeq:NP_010332.3"
                     /note="similar to Saccharomyces cerevisiae HEM12
                     (YDR047W); ancestral locus Anc_3.294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142133.1"
                     /db_xref="GeneID:59234041"
                     /translation="MTSPAKFAPLKNDLILRAARGETVERPPCWIMRQAGRYLPEYHK
                     VKDGRDFFETCRDAEIASEITLQPVRRYEGLLDAAIIFSDILVIPQAMGMKVEMIEGK
                     GPHFPEPLRTKEDLQKVLSYEVDVIKELDWAFKAITLTRTKLNGQVPLFGFCGGPWTL
                     LVYMTEGGGSRLFRFAKEWINKFPELSQQLLQRITDVAIEFLSQQVVAGAQILQVFES
                     WGGELSYEDFKEFSLPYLKQISEKVPRRLLELGVKEDIPIIIFAKGSWYALDELCNAG
                     YNVVSLDWLWDPREASKINNNRVTLQGNIDPGVMYGSNEIITRKVQKMIEGFGGGKKN
                     YIVNFGHGTHPFMDTEKIRFFLEECHRIGSAK"
     gene            <700641..>702557
                     /locus_tag="HG535_0A03450"
                     /db_xref="GeneID:59234042"
     mRNA            <700641..>702557
                     /locus_tag="HG535_0A03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286239.1"
                     /db_xref="GeneID:59234042"
     CDS             700641..702557
                     /locus_tag="HG535_0A03450"
                     /inference="similar to AA sequence:RefSeq:NP_010334.1"
                     /note="similar to Saccharomyces cerevisiae YDR049W;
                     ancestral locus Anc_3.293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142134.1"
                     /db_xref="GeneID:59234042"
                     /translation="MSDKKYKRSDLYVYDLSPAILSSLGLISFDDTLQEVASFDDLNA
                     GTTGSASAEDAKERSTVKFQRCTTCGTDFGDQVNNREHYKNELHTYNIKRHLNGLPPV
                     TEEEFATMLNKLKSNGEVHSESDSEDNISEDETSRSDHQSEAASNEIYDKRDDYLGSL
                     IEEEMDKFSLENNSNEENKSSVSHLNTRSAQIFFNSTFLDVSEAFALYKSLFNKQTIT
                     KPLNTIKKWNEIDDQSMELSALFMIGGGHFAGAIVSHNRANVSGNSKKSGENFQEQAV
                     RFLEHKTFHRYTTRRKQGGSQSAMDQAKGKANSAGSSLRRYNEAALKTDIQNLLKLWE
                     PYLSKCQNIFLRAHNSAERNIFTGNPLIGMKRENLKSFPFTTGRPTITELKRCWCELT
                     YLKPSAKPTPLQMKKESSVSESISSKESGKAARQSSIKKPPVEEVHTEELLSLLKKGK
                     APLLMAYLRKHKLNGDFKLMPENQYSATPTMLHYAAQNGLKQMITILMTNMKCNPCIQ
                     NAVGKTAVDLAKDTQIKQSFQISRHLLGENYVNWNDSHIGKPLSREEVQDMNKLEEER
                     RNSEIAAAVKEELENAKRKQKAGVKNKEVSGRPLEAKPVYPNQNLNSLSDEQRRKLMR
                     EQRARAAEARMQKS"
     gene            complement(<702637..>705450)
                     /locus_tag="HG535_0A03460"
                     /db_xref="GeneID:59234043"
     mRNA            complement(<702637..>705450)
                     /locus_tag="HG535_0A03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286240.1"
                     /db_xref="GeneID:59234043"
     CDS             complement(702637..705450)
                     /locus_tag="HG535_0A03460"
                     /inference="similar to AA sequence:RefSeq:NP_009629.6"
                     /note="similar to Saccharomyces cerevisiae RDH54
                     (YBR073W); ancestral locus Anc_3.292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142135.1"
                     /db_xref="GeneID:59234043"
                     /translation="MFSWQLYQSHRDKPLMRVHKYENKPFKPPKRLNDSHATQNVIRS
                     TSTKRQGVAESETTSVKKAKPMSSMSVHSSDPSDNKRYFTLMYRKPTQKKHKTWAGDG
                     YATFREGGKLSFYDATGKSIGSAQYKNAPGDMLENLFKSSGLEIQLDYEVSDAKEYQE
                     VKNVLLGNRQEKSSSSQHFDLGETSLTVESSSHNNDNQITPAPLFQNKRANKFKPLIK
                     TCPARNSLISGRKSESESHTNPERKMSYQPVFDASKIDDPIIMNKHCSAEVDVIVDPF
                     ISKNLRSHQREGIKFMYDCVLGLSRPPKDLATNQEGFTSRSIILEQDSDIRGCLLADE
                     MGLGKTLMTISLIWTLLKQTPIASTVSCSQSGVPLQGLISKVLIICPVTLIANWKKEF
                     SKWLNLSRIGILTLSPQNTLERDKYEVRTFLRVQRTYQVMILGYEKLLSVSEELEKNK
                     SVLDLLVCDEGHRLKNGSSKILNVLKSLDIQKKILLSGTPIQNDLNEFYNIIDFINPG
                     ILGSYQHFKKRFILPISKARDPSNRHNETAVQKGEELSQEMIEITQRFILRRTSSVIE
                     SYLPPRMDLILFCRPTETQVMAFKDILQNCGPDLLTTSSNSSLSVITLLKKVCNSPSL
                     IESDAYFNTTLGDSRIFKKYTQALNSGKLKVLMTLLERIRNGTEGEKVVIVSNYTQTL
                     DIIQNLMISADMRICRLDGSTPSKQRDGIVTSFNRDLSLFALLLSAKSGGVGLNLIGA
                     SRLILFDNDWNPSVDLQAMSRIHRDGQTKPCYIYRLVTTGCIDEKILQRQLMKQSLSQ
                     KFLSDCNNGKDSSNDDLFNKEDLKDLFSVILDTPSNTHDLICSCDGAGEEVNSESVAS
                     TMNNKGKRYSPDTWISALEAQKLLEDKEDQNLEEKASLMKRCLVGYKHIGSKHFCNLL
                     DTVAMEAAQNAQSDVTFAFMKPS"
     gene            complement(<705751..>706389)
                     /locus_tag="HG535_0A03470"
                     /db_xref="GeneID:59234044"
     mRNA            complement(<705751..>706389)
                     /locus_tag="HG535_0A03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286241.1"
                     /db_xref="GeneID:59234044"
     CDS             complement(705751..706389)
                     /locus_tag="HG535_0A03470"
                     /inference="similar to AA sequence:RefSeq:NP_009628.1"
                     /note="similar to Saccharomyces cerevisiae HSP26
                     (YBR072W); ancestral locus Anc_3.291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142136.1"
                     /db_xref="GeneID:59234044"
                     /translation="MSFNTPFYDFFDAINNEVNSFSRLLDNTGYNVYDSSARNAQLPS
                     TDKQVTRAGKNNQITHSKAAPLTALDDWFENDWPLIPEAVGKSSFVPPVDILDHDKNY
                     EVTVTAPGVKDKKDINLEYHKERNQIVVSGEIPSTFDDSTKDKLKVQERFSGKFKRII
                     SLPDYPGIDADNIKADYSNGILTLTIPKLKPSKDGSGIQKIEIFSQESSNKK"
     gene            complement(<707053..>707685)
                     /locus_tag="HG535_0A03480"
                     /db_xref="GeneID:59234045"
     mRNA            complement(<707053..>707685)
                     /locus_tag="HG535_0A03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286242.1"
                     /db_xref="GeneID:59234045"
     CDS             complement(707053..707685)
                     /locus_tag="HG535_0A03480"
                     /inference="similar to AA sequence:RefSeq:NP_009627.3"
                     /note="similar to Saccharomyces cerevisiae YBR071W;
                     ancestral locus Anc_3.290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142137.1"
                     /db_xref="GeneID:59234045"
                     /translation="MLRRSKSTINNNGKKRHSMFIDLKHSILSANDPITESTFKHSFQ
                     TKNKSLDSLALEDDLTLQEVPQKMNRKAITAKKTSKLKRSSVVLDNSLLRDYNIAVNH
                     FENPVSTTIQSSHSNHSISSVASKISSLFSSNSCLSIHDLLNEDITDENKKQKTSIRK
                     QEPVKAVRGAMIYLFDADQGSVSEHIWDFDDEYISGHNNRTYNRTELIFD"
     gene            <708300..>708998
                     /locus_tag="HG535_0A03490"
                     /db_xref="GeneID:59234046"
     mRNA            <708300..>708998
                     /locus_tag="HG535_0A03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286243.1"
                     /db_xref="GeneID:59234046"
     CDS             708300..708998
                     /locus_tag="HG535_0A03490"
                     /inference="similar to AA sequence:RefSeq:NP_009626.1"
                     /note="similar to Saccharomyces cerevisiae ALG14
                     (YBR070C); ancestral locus Anc_3.289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142138.1"
                     /db_xref="GeneID:59234046"
                     /translation="MMRTTHISIGLLVLYAIYLVRLICILPFFLKQRQDDSPLRLNSK
                     RKGQLKVFVFLGSGGHTGEMLRLLENYSDLLLANSNTLFVGYSDTQSRAAFAQLAKKT
                     DLKCRIEFYEFIKAREVNSSYFSSFVTIVRTLVDSCFKALSISLRFYSSPHLVLLNGP
                     GTCCVLALWFKLFEWVNLFQSRSNIVYVESLARITSLSLSGKLLYWLADSFVVQWKEL
                     QIAKPRAEYYGILV"
     gene            complement(<709078..>709824)
                     /locus_tag="HG535_0A03500"
                     /db_xref="GeneID:59234047"
     mRNA            complement(<709078..>709824)
                     /locus_tag="HG535_0A03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286244.1"
                     /db_xref="GeneID:59234047"
     CDS             complement(709078..709824)
                     /locus_tag="HG535_0A03500"
                     /inference="similar to AA sequence:RefSeq:NP_010335.1"
                     /note="similar to Saccharomyces cerevisiae TPI1 (YDR050C);
                     ancestral locus Anc_3.288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142139.1"
                     /db_xref="GeneID:59234047"
                     /translation="MARTFFVGGNFKLNGSKPSIKEIVERLNNADLPQNVEVVLCPPA
                     PYLEYTASLITKPQLAVGAQNTYLKASGAFTGENSVDQIKELGSKWVILGHSERRTIF
                     HEDDKFVADKTKFALGQGVGVILCIGETLEEKKAGVTLKVVERQLNAVIDEVKDWSNV
                     VVAYEPVWAIGTGLAATAEDAQDIHKSIRDFLATKLGEKTAGETRILYGGSANGANVA
                     SFKDKSDIDGFLVGGASLKPEFVQIVNSRK"
     gene            complement(<710587..>711543)
                     /locus_tag="HG535_0A03510"
                     /db_xref="GeneID:59234048"
     mRNA            complement(<710587..>711543)
                     /locus_tag="HG535_0A03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286245.1"
                     /db_xref="GeneID:59234048"
     CDS             complement(710587..711543)
                     /locus_tag="HG535_0A03510"
                     /inference="similar to AA sequence:RefSeq:NP_010336.3"
                     /note="similar to Saccharomyces cerevisiae YDR051C;
                     ancestral locus Anc_3.287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142140.1"
                     /db_xref="GeneID:59234048"
                     /translation="MSAQSIECVGCHKPRLIVLIRHGESESNKDKTINQHTPNHLIPL
                     TKRGWDQARQAGVELLKVLNIDDKDLAHKLESKYESKENLGDKLELSGYQRYDKKKDR
                     HVVFYTSPYKRTRETLKGILDVFDEYNELNCGVKICNDDRYEPCGKNKLATWTPPRFP
                     SGVYENSNVKESDLLELKNSEKHFIQYRVKDDPRIREQDFGNFQHISSMQDVMRKRST
                     YGHFFYRFQEGESAADVYDRVASFQETLFRYFEKTNKRPRDAIVLVTHGIYSRVFLMK
                     WFRWTYEEFESFVNVPNGCMIVMEYNSESDRYELRTQLPKWC"
     gene            <711748..>712236
                     /locus_tag="HG535_0A03520"
                     /db_xref="GeneID:59234049"
     mRNA            <711748..>712236
                     /locus_tag="HG535_0A03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286246.1"
                     /db_xref="GeneID:59234049"
     CDS             711748..712236
                     /locus_tag="HG535_0A03520"
                     /note="ancestral locus Anc_3.286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142141.1"
                     /db_xref="GeneID:59234049"
                     /translation="MLSRVYRVRSRVGFTLNRRPYWNWIASNFFAGNKGNGPSVREPN
                     QVFLSVRNENEMTDTLIASNRVPLVMNFTIRNNESCDILTGALNRIVMLETDKKINCV
                     DVETDWPETKEILLRFGVHDIPSLVAVKKSFPVDYYTQKHLMNGEIDWYSLKSWIEKN
                     AD"
     gene            <712646..>712978
                     /locus_tag="HG535_0A03530"
                     /db_xref="GeneID:59234050"
     mRNA            <712646..>712978
                     /locus_tag="HG535_0A03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286247.1"
                     /db_xref="GeneID:59234050"
     CDS             712646..712978
                     /locus_tag="HG535_0A03530"
                     /inference="similar to AA sequence:RefSeq:NP_010330.1"
                     /note="similar to Saccharomyces cerevisiae RPC11
                     (YDR045C); ancestral locus Anc_3.283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142142.1"
                     /db_xref="GeneID:59234050"
                     /translation="MLSFCPVCNNMLLIAHADSGLYSLTCRSCPYEFPIEGIEIYDRK
                     KLPRKEVDDVLGGGWDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVN
                     CGHRWKEN"
     gene            complement(<713257..>714282)
                     /locus_tag="HG535_0A03540"
                     /db_xref="GeneID:59234051"
     mRNA            complement(<713257..>714282)
                     /locus_tag="HG535_0A03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286248.1"
                     /db_xref="GeneID:59234051"
     CDS             complement(713257..714282)
                     /locus_tag="HG535_0A03540"
                     /inference="similar to AA sequence:RefSeq:NP_010329.1"
                     /note="similar to Saccharomyces cerevisiae HEM13
                     (YDR044W); ancestral locus Anc_3.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142143.1"
                     /db_xref="GeneID:59234051"
                     /translation="MGQKHRSSFSTLKMPAPQDPQHLPIRQQMESLIRRKQAEITKGL
                     ETLDNVKFRADSWTRGNDGGGGTSMVIANGDTFEKGGVNVSVVYGQLSPAAVSAMKHD
                     HKNLELCEDPSTGLPSADGVKFFACGLSMVIHPNNPHAPTTHLNYRYFETWNPDGTPQ
                     AWWFGGGADLTPSYLYEEDAVLFHQNHKNALDKHDKDLYPRFKKWCDEYFLIAHRGET
                     RGIGGIFFDDLDDRDPQEILKIVEDCFDAFLPSYLPIIAKRKDMPFTPEQKKWQAIRR
                     GRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEYASWLYDHHPEPGSEEEKLIKVTT
                     KPREWVK"
     gene            complement(<715303..>716010)
                     /locus_tag="HG535_0A03550"
                     /db_xref="GeneID:59234052"
     mRNA            complement(<715303..>716010)
                     /locus_tag="HG535_0A03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286249.1"
                     /db_xref="GeneID:59234052"
     CDS             complement(715303..716010)
                     /locus_tag="HG535_0A03550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142144.1"
                     /db_xref="GeneID:59234052"
                     /translation="MRRRNEYDQEVGFPVANWKGRRFPEKVTIAGDYCVLEPLDCARH
                     AEQLFEAFGREDAGSMWTYLPVGPFRDAEEFQKHVRSLAESTQAVHFAIVNRRTGRAM
                     GSFCLTRIDAENGVAEVGLVVFSPGMQKTVMSTEAHYLLLRHAFESLQYRRLEWKCDV
                     CNEPSKRAALRLGFQHEGMFRQTAVWKGVNRNHHWFSIIDAEWETCSEAFRQWLCDAN
                     FENGKQKRALVDIRNGC"
     gene            <717461..>718180
                     /locus_tag="HG535_0A03560"
                     /db_xref="GeneID:59234053"
     mRNA            <717461..>718180
                     /locus_tag="HG535_0A03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286250.1"
                     /db_xref="GeneID:59234053"
     CDS             717461..718180
                     /locus_tag="HG535_0A03560"
                     /inference="similar to AA sequence:RefSeq:NP_009622.1"
                     /note="similar to Saccharomyces cerevisiae NRG2 (YBR066C)
                     and NRG1 (YDR043C); ancestral locus Anc_3.281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142145.1"
                     /db_xref="GeneID:59234053"
                     /translation="MMFGNDCSVLVLPSPNVNSHGMAMSGNYPIMCSHADVSGQKHFT
                     LLPPLTNSQLIDNDLKYKLNRYSFSIGSSSDTSASTPATSPVSRAMSNSHIHDHDHVH
                     VHDLFHNSEYTVAAPRNTRNESTSSLAGSDAATANSYVLRAGTTLNSKHIVRKDSPRE
                     LQSEILRQQPPVKVEQRRRYVCKVCSKAFTTSGHLARHNRIHTGEKNHICPFEGCNQR
                     FSRHDNCIQHYKTHFKKKASS"
     gene            <718783..>719901
                     /locus_tag="HG535_0A03570"
                     /db_xref="GeneID:59234054"
     mRNA            <718783..>719901
                     /locus_tag="HG535_0A03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286251.1"
                     /db_xref="GeneID:59234054"
     CDS             718783..719901
                     /locus_tag="HG535_0A03570"
                     /inference="similar to AA sequence:RefSeq:NP_009621.3"
                     /note="similar to Saccharomyces cerevisiae ECM2 (YBR065C);
                     ancestral locus Anc_3.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142146.1"
                     /db_xref="GeneID:59234054"
                     /translation="MSEQDEPPMICDLCLGDSNRIRITKNTHGASCKICTLPFTVYQF
                     KSGKRNVNLVKTLICRKCAKQRNICQCCMLDMTWHISLQLRDRMLSMISRDKSMITEE
                     VKNDMMRRFLALKDTELGGAKITSDPKKIDVVMNELQHILTSQSSTSASKSAPASDQS
                     LEESDSLKESDSLKDKVINKYKSVDISHVLRKLPLKESFELTDQSKSFFLYNISSSLP
                     EWRINRAISEILNVTDWQSETSNSLIVHHKAKCGGIRFKNDELGAKFIENLLSSRSYL
                     KTPNDLKRGILKVSHYQVFVIPWKTGFSTSSFGSTTGEEIKLSLSLDQFLKNEFSKGS
                     AVESATNKVTATSTSKSKTKGKVTKKKNKLKRVSKIDL"
     gene            <720092..>720742
                     /locus_tag="HG535_0A03580"
                     /db_xref="GeneID:59234055"
     mRNA            <720092..>720742
                     /locus_tag="HG535_0A03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286252.1"
                     /db_xref="GeneID:59234055"
     CDS             720092..720742
                     /locus_tag="HG535_0A03580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142147.1"
                     /db_xref="GeneID:59234055"
                     /translation="MWLSVQQLWEWIIKFSLHLFYTFKSTSRWVSETKSIELSLEKYG
                     VKSLSESFSEPSIFVTDCSTDIANTMLMTEKTSYLSIYTLAAVFSVFIHCVFLYKVNK
                     GNANRISRLQYDYQIPLVISGEILRWELARHETKVKYISCNHNQRFRSLSPFSESDDD
                     PCLDWRCESSVTSQTDISMLQGNSVRFKRTTNTGFLQDDFTTLRSSAISLLLWDTN"
     gene            <720888..>721476
                     /locus_tag="HG535_0A03590"
                     /db_xref="GeneID:59234056"
     mRNA            join(<720888..720903,720971..>721476)
                     /locus_tag="HG535_0A03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286253.1"
                     /db_xref="GeneID:59234056"
     CDS             join(720888..720903,720971..721476)
                     /locus_tag="HG535_0A03590"
                     /inference="similar to AA sequence:RefSeq:NP_009618.2"
                     /note="similar to Saccharomyces cerevisiae YBR062C;
                     ancestral locus Anc_3.279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142148.1"
                     /db_xref="GeneID:59234056"
                     /translation="MSNYQEEHGIQDDAVSRTATDDNEATRQDIRTQLREIFRLYSSD
                     EDHQEDNTTLLELLSQLIPESLQEEWLEQLDQHDKKGCPESFIDSLPRVSKRNLSSTS
                     ACSICFSVFLEDDYPLVVELPHCDHRFDLECISIWLSKSTTCPLCRDDVMSHKVKIDS
                     SKAELEEDWGMYG"
     gene            complement(<721554..>722243)
                     /locus_tag="HG535_0A03600"
                     /db_xref="GeneID:59234057"
     mRNA            complement(<721554..>722243)
                     /locus_tag="HG535_0A03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286254.1"
                     /db_xref="GeneID:59234057"
     CDS             complement(721554..722243)
                     /locus_tag="HG535_0A03600"
                     /inference="similar to AA sequence:RefSeq:NP_010326.1"
                     /note="similar to Saccharomyces cerevisiae RSM10
                     (YDR041W); ancestral locus Anc_3.278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142149.1"
                     /db_xref="GeneID:59234057"
                     /translation="MLRRGLPALRLVRLQSTARTSVAPSLTNLPFQKAVNSKNEESPL
                     PINVKAVYYAPLKLPIQYGDLVADLQLRSYDNENLDFYADFILRVGFYLGMPMTGPKP
                     LPSRRERWTVIKSPFAQAKSKENFERHTHKRLIRVWDTNPEVVQIWLSYISKHAITGV
                     GIKCNVFQRSKISLDMDLNNVALLEPQSGARDETPDESKSTDIIPHTLDEAVGAKVME
                     LLNRPEFKRHL"
     gene            <722691..>723644
                     /locus_tag="HG535_0A03610"
                     /db_xref="GeneID:59234058"
     mRNA            <722691..>723644
                     /locus_tag="HG535_0A03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286255.1"
                     /db_xref="GeneID:59234058"
     CDS             722691..723644
                     /locus_tag="HG535_0A03610"
                     /inference="similar to AA sequence:RefSeq:NP_009617.3"
                     /note="similar to Saccharomyces cerevisiae TRM7 (YBR061C);
                     ancestral locus Anc_3.277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142150.1"
                     /db_xref="GeneID:59234058"
                     /translation="MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLNDQFHFLDDPNL
                     KRVVDLCAAPGSWSQVLSRKLFEGQKDVEGRKIVAVDLQKMSPIDHVTTIQADITHPK
                     TLNRILELFGNEKADFVCSDGAPDVTGLHDLDEYIQQQLIMSALQLTCCVLKRNGTFI
                     AKIFRGRDIDMLYSQLGYLFDKIVCAKPRSSRGTSMEAFIVCLSYNPPQDWEPKLDIN
                     QSTEQFFEKIPSLNGISELSIDDQSHTKAQLPSWSLEERSIAEFMSCGGLDSFDSDAT
                     YHIDADDSRQRESLDPVQSPTNPPYKEALELKRRGKLTRAI"
     gene            <724496..>727807
                     /locus_tag="HG535_0A03620"
                     /db_xref="GeneID:59234059"
     mRNA            <724496..>727807
                     /locus_tag="HG535_0A03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286256.1"
                     /db_xref="GeneID:59234059"
     CDS             724496..727807
                     /locus_tag="HG535_0A03620"
                     /inference="similar to AA sequence:RefSeq:NP_010325.1"
                     /note="similar to Saccharomyces cerevisiae ENA1 (YDR040C);
                     ancestral locus Anc_3.276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142151.1"
                     /db_xref="GeneID:59234059"
                     /translation="MKEHKGSSSIDYEFAAFHTLSSAETAGFLKTDLENGLTKQEHEE
                     RLKEVGDNSLGDDAKIDYKGIIVHQVCNAMILVLFISMVISFAIHDWITGGVIAFVVG
                     VNVVIGVYQEYNASKTMNSLKALSSSNAHILRNGKSENLESKDVVPGDICYVKVGDTI
                     PADLRLITAENFETDEALLTGESLPVSKEANSIYSADEETPVGDRLNIAFSSSTVVKG
                     RAQGIVIKTGLNTEIGKVAKSLKDIGGIVSKDSSKSKLENFWITSKQTVGAFLGTTTG
                     TPLHRKLSKLAILLFGIAVIFAIVVMASQKFNVDRGVAVYAICVALSMIPSSLVVVLT
                     ITMSAGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGRMIARQVWIPNFGTI
                     TINSSNDSFNPTGGEINYIPKLSPHEYYHNETEDVGIVQNFKNKYYDNELPENVNVGL
                     FSQWLETATLANIATVFQDRDSLEWKAHGDPTEIAIQVFASKMDLPRHALTGEGVKQK
                     EQTEQRCDSSSDVGDEIENTVKGKDEMEFKFSKTAEFSFDSTIKRMSAIFLDKEQNTQ
                     NVYTKGAFESVLSCCKYWYGKDNQDEMVPFTEQDVQQVKQNIDVLSLGGLRVLAFAKK
                     SWKNDEIDDKMYTRITKDRSFVEKDLCFLGLIGIYDPPRSETAGAVKKFHKAGINVRM
                     LTGDFPGTAKAIAQEVGILPTNLYHYPKEVVDIMVMTGIQFDNLSSDEIDNLPVLPLV
                     VARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKLANVGIAMGINGSDVAKDASD
                     IVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLACNVAQAIYLIVGLVFQSENGESTF
                     PLSPVEVLWVIVFTSCFPAMGLGLEKAGPDLMERPPNDSKSGIFTWEVIIDMFAYGLI
                     MAGSCMGSFTSVIYGNDNGNLGIGCNSSYNDTCTDVFRARSTAFSTMTWCALILAWEV
                     IDMRRSFFRMQPETDRPFTQFFIDVWSNQFLFWSIVIGFAGTFPVVYIPVINDKVFLH
                     KPIGYEWGLAFAFTIAFWIGAEMYKYAKRLYFRNKSMAEDPESDLEKKAARDPFEAYS
                     TSTTMMTEVQLPLKV"
     gene            complement(<728091..>729866)
                     /locus_tag="HG535_0A03630"
                     /db_xref="GeneID:59234060"
     mRNA            complement(<728091..>729866)
                     /locus_tag="HG535_0A03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286257.1"
                     /db_xref="GeneID:59234060"
     CDS             complement(728091..729866)
                     /locus_tag="HG535_0A03630"
                     /inference="similar to AA sequence:RefSeq:NP_010322.1"
                     /note="similar to Saccharomyces cerevisiae KRS1 (YDR037W);
                     ancestral locus Anc_3.275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142152.1"
                     /db_xref="GeneID:59234060"
                     /translation="MSQEEATQKATEGVANLHLDEVTGERVSKSELKKRIKQRQVEAK
                     KAAKKASGQAPVEPKKKKNDLLADLSPAQYFEARSRQILELRKTHEPNPYPHKFQVNI
                     SNPEFLSKYAYLQRGETLPEEKVAIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQ
                     DYQDPLAYEIDHDLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLP
                     ADHFGFKDQETRYRKRYLDLIMNKESRGRFITRSKIITYIRKFLDSRQFIEVETPMMN
                     VIAGGATAKPFVTHHNDLNMDMYMRIAPELFLKELVVGGLDRVYEIGRQFRNEGIDMT
                     HNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGSYVIRYHPDPTNPEKELELNF
                     ARPWKRMNMIEELEKKFNVSFPPGDQLHTAETGKFLKQILIDNKLDCSPPLTNARMLD
                     KLVGDLEDMCINPTFIFGHPQMMSPLAKYSRDIPGLCERFEVFVATKEICNAYTELND
                     PFDQRDRFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSN
                     TIREVLLFPTLKPDVMREEGKKEAN"
     gene            <730249..>732582
                     /locus_tag="HG535_0A03640"
                     /db_xref="GeneID:59234061"
     mRNA            <730249..>732582
                     /locus_tag="HG535_0A03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286258.1"
                     /db_xref="GeneID:59234061"
     CDS             730249..732582
                     /locus_tag="HG535_0A03640"
                     /inference="similar to AA sequence:RefSeq:NP_009616.1"
                     /note="similar to Saccharomyces cerevisiae ORC2 (YBR060C);
                     ancestral locus Anc_3.274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142153.1"
                     /db_xref="GeneID:59234061"
                     /translation="MNADDIIEHVDILSTPSKRRSKPMDEVLSSRASTPLHRKSRSPT
                     KSLVEYIRTVAQRGQAGGSMENKDAVKQEEEKDEAKGTALQNGSDLSAHGNGTNHSNP
                     FSDVNETVSPRKRGRPRKRKISEAPVIKEDPEKSASKKHLLDELEKKKAEDCQRDFRA
                     KVNGVDCSKEEQEGKKSVVPIIVKKELETVEETPKKAKRGRPRKIRDANLEASTIKEE
                     VLQTSIRRSPRKRRRTAKYILDLESEIDPESEIDPESEIDPESEIDPESEIDTVEVDV
                     QLNNDNSTELRETLTSTVAKNTGAQIDENEERDLTVKLTDAPVTPSKRVAQKSITTEH
                     DFTSPLKKVIMNNLNEYKDKTSSSSLKLSQNFVPTPLPVNLEKYKNTSDSSMSAFFDT
                     FEGYLDQKKLSKSSQKSKNTMAMATDLTREEFAFISNMFHSHLHKNARNKLHEIQKKM
                     FPQYWFELTQGFSLLFYGIGSKREFLEDYVFEYLVPKLVYSKMSDLEYFSTICDSEVD
                     NFNIPCVVINGYNPTCNYRDVFKDISQALLPEELNRNETKYWGNHVLLQIQKMIDLYK
                     NESLDIRLVVIVHNLDGPSLRKDAFQTMLSYLSLIRQVAVIASVDHIYAPILWDNFKA
                     QNFNFIFHDITNYEPLAVESSFKDVMKLTKNDSASGAEGARFVLQSLTVNSKRMYKLL
                     IEAQLANMEKNTASGKVAGKKRGIPALGIEFKQLLHLCAAAFIASNEISLRSMLTEFI
                     EHKMAIMSKNPAGIEHVWIPYNYSEMKKLLESYLKEF"
     gene            <732920..>736252
                     /locus_tag="HG535_0A03650"
                     /db_xref="GeneID:59234062"
     mRNA            <732920..>736252
                     /locus_tag="HG535_0A03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286259.1"
                     /db_xref="GeneID:59234062"
     CDS             732920..736252
                     /locus_tag="HG535_0A03650"
                     /inference="similar to AA sequence:RefSeq:NP_009615.1"
                     /note="similar to Saccharomyces cerevisiae AKL1 (YBR059C);
                     ancestral locus Anc_3.273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142154.1"
                     /db_xref="GeneID:59234062"
                     /translation="MSTTSGTVRTSSSVGKMGLERYPPGVIVSVGAHRVEVINYLAEG
                     GFAQIYMVKFLDYLNEFENKSSVPLKVGEVACLKRVLVQDENGLSEMRNEVEVMKSLS
                     GAKNIVQYYDSNASRRSNGTPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIM
                     YDVSLAVAQMHYLKIPLIHRDIKIENVLVDSKNNFKLCDFGSTSTCFPVVTTHQDIAI
                     LTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLFKLLFFITPFEMTGQFAI
                     LHSKYEFPRNNFSSKLINLIIIMLAENPYVRPNIFQVVTHICSIMGVDVPLEDKYGKG
                     AYNFEKYTKFQANLQNVQYQMYVLQQKRMENNGTLPPADEELLNELLLSAFEVSPKVP
                     SEMEAGSQKADYKSIRSDSDVQARKPLEFYEGATEKEVFNDELESPSRTLSESERKSI
                     KIEDLHLESPNLETISSETVAKDNNLITSEQAKIPIKKTLVQDQSEIRFEKDRDIDQD
                     EFEVKSKQKSLTPLSSEGKSLGSNSHGDGSEDNQKAENTIKSDVSGSVKQHKSNNPFP
                     KILPGYSDSSTASAVFVEEQSQNQYPQIFPEGPHDELLYRTSSNNSHYRLSQSQRVFQ
                     PQPHHVQQVISQPQPQPPPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQTQPQ
                     PQSQPQPQHVPQGANISQSVPQGFQPSAYYTAVEQVARPQQPQTLTFSNPPSIAKPTV
                     PNVTYNFPNAVPGSNANFFPPLAMQKQQEQRIDHDPPPLPRKSHKQTLSNDREGMHMS
                     DGRHVSTEMMVSGSLPNLADVEDEEKPLIEFSPPRDSKVDDPQKVTSSVTEKSPLKRG
                     NLDLSYNEMNLSQDDIHKDASLRNFLYNENLNSSISSDSISLNLEDVKQGRRSREILR
                     DRTPSTRMSSSRRQDKKSGLEHDKRHLEVSDLNTEGTEPGRKSLDLQYQEIRFSSTDF
                     SNDDMSGKSSRKVSHSSKHRKPIEKKHSNMNSSEPNVSERTDSSNNRNSSVRKHSGTA
                     KTNSQVREDLERYKRSNKKGSNSSVNISSMNSGASRRRSFQRTPNSLDLDRSRIDLTG
                     YNDSSGKRRSFFSVFRSSTDKK"
     gene            <737268..>737648
                     /locus_tag="HG535_0A03660"
                     /db_xref="GeneID:59234063"
     mRNA            <737268..>737648
                     /locus_tag="HG535_0A03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286260.1"
                     /db_xref="GeneID:59234063"
     CDS             737268..737648
                     /locus_tag="HG535_0A03660"
                     /inference="similar to AA sequence:RefSeq:NP_116327.3"
                     /note="similar to Saccharomyces cerevisiae TSC3 (YBR058C-
                     A); ancestral locus Anc_3.272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142155.1"
                     /db_xref="GeneID:59234063"
                     /translation="MPAKVDTDEMVSLDSAGETIPGISVAGSSVTSDVPFAQPLAPKL
                     NTASKTHSSMIYVETIKERQVRLGYGNGILDKIKDLLENCYWVYYVHLPFYLMTSFDA
                     FCLHSFFLTILSFSIFGVLKYCLL"
     gene            <738109..>739599
                     /locus_tag="HG535_0A03670"
                     /db_xref="GeneID:59234064"
     mRNA            <738109..>739599
                     /locus_tag="HG535_0A03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286261.1"
                     /db_xref="GeneID:59234064"
     CDS             738109..739599
                     /locus_tag="HG535_0A03670"
                     /inference="similar to AA sequence:RefSeq:NP_010321.1"
                     /note="similar to Saccharomyces cerevisiae EHD3 (YDR036C);
                     ancestral locus Anc_3.271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142156.1"
                     /db_xref="GeneID:59234064"
                     /translation="MLRNLGSASRSLKRTFMSSRITMNKPVLYSVQDTARVITLNRAN
                     KLNALNTEMCESMFHTLNEYAKSDCSQLIILKSANQPRAFCAGGDVATVAVQNTSGDV
                     VDSLKFFTSEYSLNLQLATYAKPIVAIMDGITMGGGVGLSIHTPFRIATENTKWAMPE
                     MDIGFFPDVGTTFAMPRILTMANTNSQMALYLALTGDVIDGKDAYMMGLASHYVEHER
                     LESLQARLAELKPVAGPKNDSELFFRMVNNAIEEFTSSLPEGYNFKFTKDQLDVIENC
                     FDIKKVLSIKDVFKFLDDMIADSSSSHEAINFIDEVKQKLSQKSRISSEVALRLLQEN
                     SIDNIEGAIRRDLCTAGNFCLAYSKEGSSPVQFSEATIHKLVKKQKTPYPWKSSENLS
                     SSQVTSLISPKPSIPVSLVKSFTNVTWKQYPYHLKYQLPTEQTIMKQFARMAESSTIT
                     KKDLIAYFTSVDASTRGKIGVEEICNIVIDRKCSIDDSNNLTWTHK"
     gene            <739801..>742149
                     /locus_tag="HG535_0A03680"
                     /db_xref="GeneID:59234065"
     mRNA            <739801..>742149
                     /locus_tag="HG535_0A03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286262.1"
                     /db_xref="GeneID:59234065"
     CDS             739801..742149
                     /locus_tag="HG535_0A03680"
                     /inference="similar to AA sequence:RefSeq:NP_009614.2"
                     /note="similar to Saccharomyces cerevisiae UBP14
                     (YBR058C); ancestral locus Anc_3.270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142157.1"
                     /db_xref="GeneID:59234065"
                     /translation="MSRAVLEDLIIPSVISKDECLFCYASVYNESNDSQIPTHSLYIC
                     LTTFQPVCEKHLPFHSQVIKEYASRDTLYYLNISKVKKLVPEDSNKDDDGNMNKKIKL
                     HVVEKSEDELYNTFWMLIKYDADQLTSEQMYSCSDSNVPAVTREKVEQILRTKSQEMV
                     DQTASWELSINSCIHTRNFKVPEGPSKKLVEKCFDCDLAQNLWLCLVCGNIGCGREQI
                     GIEGHSHAKKHYENNPEHGLAVKLGSLSSTSCDVYCYACDEEVKFDDQSVFIQTLIKY
                     GIDIGSKEANEKTLVELQVEQNMNWDFQMTDSKGQGLKKMMASKEYGCGLINLGNSCY
                     MNSVLQCLLNGGVKHYSLDLIGHDFPIAVVYPEKNVECQVIKLNNAMCLEPNIYPDGI
                     RPKSFKRCVAQSHQEFSSGKQQDALEFLTYLIDFLDEKLLKKMSSNPNDLLKFVFEDR
                     LECKRCGKVKYTSQQASSIQIPLMENDQPQNLLDRLRDYTSGEELEFRCPVTGEMGTA
                     VKSVGFRTFPDTLVINPIRIKLENWTPVKTNNELVMPGLEDIRDTLDISQFKSFGFNP
                     STEKLLPETDDSANSFEANPACVAQLSEMGFGANAITKALYVTGNQETEVAMNWLFQH
                     MDDPGLNEQFSPPSKTNEKDSSHQVNPELLENMMSMGLDPKLCRKALILNHGDVNASV
                     EWVFSNMDDNGELEEEPTTSENPDSEVTYGYPEAAPYELTGVVCHKGNSVQSGHYVAF
                     IRKEVEGKQTWILYNDEKIVLASEESLNEIKKNGYLYFYSRI"
     gene            <742391..>743431
                     /locus_tag="HG535_0A03690"
                     /db_xref="GeneID:59234066"
     mRNA            <742391..>743431
                     /locus_tag="HG535_0A03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286263.1"
                     /db_xref="GeneID:59234066"
     CDS             742391..743431
                     /locus_tag="HG535_0A03690"
                     /inference="similar to AA sequence:RefSeq:NP_009613.1"
                     /note="similar to Saccharomyces cerevisiae MUM2 (YBR057C);
                     ancestral locus Anc_3.269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142158.1"
                     /db_xref="GeneID:59234066"
                     /translation="MSYNLCNTMDIDNSVGGLPGSHTSQHPQQHLLRNDERRSAAEVG
                     LNQHHVFRDSAQSLVNSMNKKSSYMLSSNMGKYNFMNTNGTGPGTGNFAAKAAGKYSA
                     ADGNDSENNFWTQKFDRDNYISSRHYGLCSPAEIDSASASSNIMSMASTYENNGADMS
                     FGTNSSDSGRDLNSTANRDHDLVGTLKLQLQIKETQNECLENEIQKFKKIFNEGLSYK
                     QMEYKHDHQNAHVLSDPIEIPHNLELIFRRLSETLRQRKKELEEATQSLEAVLTALAL
                     DPTNSVTRYGRYDAENISHKMVVRLETLTNENKEMAKMLAYGRSKETQIELQLVKKEN
                     AELKAKINQMQQ"
     gene            complement(<743612..>744730)
                     /locus_tag="HG535_0A03700"
                     /db_xref="GeneID:59234067"
     mRNA            complement(<743612..>744730)
                     /locus_tag="HG535_0A03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286264.1"
                     /db_xref="GeneID:59234067"
     CDS             complement(743612..744730)
                     /locus_tag="HG535_0A03700"
                     /inference="similar to AA sequence:RefSeq:NP_010320.3"
                     /note="similar to Saccharomyces cerevisiae ARO3 (YDR035W);
                     ancestral locus Anc_3.268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142159.1"
                     /db_xref="GeneID:59234067"
                     /translation="MFIKNDHLGDRTRLEDWRIKGYDPLTPPDLLQHEFPLSERGHEI
                     IVKAREGVCDVLNGTDDRLVIVIGPCSIHDPKAAYEYADRLSKMSQKLSKDLLIIMRA
                     YLEKPRTTVGWKGLINDPEIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQF
                     LSDCFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLQVAVDAVRSAAHGHYFL
                     SVTKPGVTAIVGTEGNKDTFIILRGGKNGTNYDAENVKEAKAQLLKAKLIDENDKQRR
                     IMIDCSHGNSSKDFRNQPKVAKSIHDQLTAGENGICGVMLESNLVEGRQDVSPEGGRA
                     GLKYGCSITDACIGWETTEEVLELLAEGVRNRRNVLNK"
     gene            complement(745715..745786)
                     /locus_tag="HG535_0Atrna1Q"
                     /db_xref="GeneID:59234616"
     tRNA            complement(745715..745786)
                     /locus_tag="HG535_0Atrna1Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:59234616"
     gene            complement(<745984..>747561)
                     /locus_tag="HG535_0A03710"
                     /db_xref="GeneID:59234068"
     mRNA            complement(<745984..>747561)
                     /locus_tag="HG535_0A03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286265.1"
                     /db_xref="GeneID:59234068"
     CDS             complement(745984..747561)
                     /locus_tag="HG535_0A03710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142160.1"
                     /db_xref="GeneID:59234068"
                     /translation="MTEFSDYVPHITQELIDRGHARRMSILEDYFAVMERQRLYKNFN
                     LYGQFNQPFTKTQLATALRPILLKYPILATAIIPKQFPDYEPFYTSKKYYDRPYPICD
                     YIKPAQKVTLQDILLNEQVEHKDTVDTILTKFIEYDYQYTGEVVELIGSFFFPEFDGS
                     TPNWRILCLPLPGEKDTGKYSQLVFISNHCLSDGISAVNFLQDLAKAMANARPSKDTN
                     DTPLTIIDYSQDYKDMAKLPPPITKYVEHRSSLVDLLKLVMSNFVKNHLTYKSDAEIT
                     ARLLPLNPQRYHILLNFNPAQISSLKEVVKRNVHRTCTITPFLEACFLVALHRYGKIF
                     RKNWTEWGFDVAVAINTRKFLPEDDELKDIYKYGSSIGGFHYTHLISSFDIEYNEKEK
                     FWKLVEYYFGLLSNHHDALVGLGILMSDQVCQSQNIDNMLCNDYLNQKRGGLLLSNVG
                     YHPQNTDSSPHIRDLVFSQTAGALKFTFGMNAIATNGNGLNIDLNIAKSAISGKDEWL
                     VFCREFESVVRNFTEST"
     gene            complement(<747966..>749462)
                     /locus_tag="HG535_0A03720"
                     /db_xref="GeneID:59234069"
     mRNA            complement(<747966..>749462)
                     /locus_tag="HG535_0A03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286266.1"
                     /db_xref="GeneID:59234069"
     CDS             complement(747966..749462)
                     /locus_tag="HG535_0A03720"
                     /inference="similar to AA sequence:RefSeq:NP_009612.1"
                     /note="similar to Saccharomyces cerevisiae YBR056W;
                     ancestral locus Anc_3.266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142161.1"
                     /db_xref="GeneID:59234069"
                     /translation="MFHKIKQKFESAKEHHGGNSQTNFGISIPTAGDISKREIYRNRY
                     NHGVNLGSCFVNESWIYDTIFEKGGDNEYDAVSRQVKETSVDEAAENLSRHYKEYISK
                     IDWKWLKEEAGITALRVPVGYWHVGNGKFVKSLAFESLQNVYAKAKPWDAFKDLIKKA
                     EENDIGILVDIHGLPGGANTDSHSGESVKTASFFGSRSYVDIMVNEVIPFIVTDVCQG
                     NENIIGLQIVNEAAFDNDAKKQKKYYSRAVKSVKSIDESLPVVISDGWWPQQWSDWLE
                     KEKLDTSVVIDSHVYRCFSDDDKSKNADSICKDIPNSINFPRDKADYVVGEFSCVLDG
                     ETWSKTKETRDECVKKFGNSEIKQFSQVASWGWFFWTLQFKYGDGGEWGLKPMTEKGA
                     IPKRPKDASIPPDENKIKDIIKEHNDYWKDKGGDKMEHWRFEDAIRCAIADIEAFHKF
                     DGSRLGRWHAWSEQRKLQHIQEKGESDYIWEWKQGYQRALDEFNGYHY"
     gene            <750443..>751075
                     /locus_tag="HG535_0A03730"
                     /db_xref="GeneID:59234070"
     mRNA            <750443..>751075
                     /locus_tag="HG535_0A03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286267.1"
                     /db_xref="GeneID:59234070"
     CDS             750443..751075
                     /locus_tag="HG535_0A03730"
                     /inference="similar to AA sequence:RefSeq:NP_015201.1"
                     /note="similar to Saccharomyces cerevisiae SPC29
                     (YPL124W); ancestral locus Anc_8.622"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142162.1"
                     /db_xref="GeneID:59234070"
                     /translation="MTEGLTKEFFDKTETDDTLQNIRKQYLASKQNLRELMLKQSTNN
                     GSQNASPVRIKPSLLHPTQAPSVQKQHKLQQQQQQQQQHQHQHQPSFAHFHAPVPADD
                     IIVLNELRSLKAIVSNQQCQITRLSNDLQLTQRLNFQLQDKVSKLQTHISYIENDMIN
                     HIGESRIPAPSTSGMNTTNITTPDYAELTPYLTASVEDNTTRLIQMTKPR"
     gene            complement(<751102..>752355)
                     /locus_tag="HG535_0A03740"
                     /db_xref="GeneID:59234071"
     mRNA            complement(<751102..>752355)
                     /locus_tag="HG535_0A03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286268.1"
                     /db_xref="GeneID:59234071"
     CDS             complement(751102..752355)
                     /locus_tag="HG535_0A03740"
                     /inference="similar to AA sequence:RefSeq:NP_015202.1"
                     /note="similar to Saccharomyces cerevisiae RNY1 (YPL123C);
                     ancestral locus Anc_8.621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142163.1"
                     /db_xref="GeneID:59234071"
                     /translation="MIINNIAAPFAFMADYFARNYPLSPNCPMDLPLSCRNETVIPDT
                     CCFEYPGGVFLQTQFWDYKVSHPISDKDELERRLGPLNDFTIHGLWPDNCDGGYQQFC
                     DNSAAIDDVYYLLNSKQFNDDHSSLEISGKDLLAKLKRLWKSNTGDDESLWIHEYNKH
                     GTCIKTIKPECYKRWNPKSEQDLKKQSVYDYFRIAYNLYKSVNTSAVLKERGIVPTTT
                     DTYTRDEIERALSDGFDGKRVFFACDGFNAINEIWYYHILKGSLLGEEFVKLDSLYHG
                     RSRCPETGIKFLPKGYMPPNNRAPKFRGIIRMGGMPGELIRNGHWMIGKTAAQFSLIE
                     SEYGGYLLRSNAGYCGFQADQQLSCQKSLQQAAQFEYEDGYIGYSGAFQWGAYEYPQH
                     SSQSVVYHDPERTADYNFKLKFIKK"
     gene            complement(<752718..>754256)
                     /locus_tag="HG535_0A03750"
                     /db_xref="GeneID:59234072"
     mRNA            complement(<752718..>754256)
                     /locus_tag="HG535_0A03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286269.1"
                     /db_xref="GeneID:59234072"
     CDS             complement(752718..754256)
                     /locus_tag="HG535_0A03750"
                     /inference="similar to AA sequence:RefSeq:NP_015203.1"
                     /note="similar to Saccharomyces cerevisiae TFB2 (YPL122C);
                     ancestral locus Anc_8.620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142164.1"
                     /db_xref="GeneID:59234072"
                     /translation="MSNDSLLKSSVNQYLEELPQVIQSRLYESPATCLAIYRLLPQLA
                     KFFIMSMVFNESEISLRDLDRWVKSGGKTQFQEAIKSMKSLHLLIPVRGNGPMMINLN
                     KTFKESFKNALTGGKVNNSFGIVIEQANDIVTTEILDTYSADKWETILHFMVGTSLSN
                     IPSENVLNLLKHSRLMEESNSNRGVKITNEGFQFLLQDVNSQIWALLLQYLKMTETIQ
                     MDPVEVLNFIFMLGALEFGKSYSIDGLSGTQKIMLKDMRDYGLVFQKNSNANVFYPTR
                     LATMLTSDSKAIRSASGAMDSVLKQNKEDSVNGTSAAITDEDSSGDQIGLKTQVIHDG
                     ALIVETNFKLYSYSNSPLQIAILSLFVHLKSRFSNMVTGQLTRESIRRALTNGITADQ
                     IIAYLETHAHPQMRRLAEERLEKKLELDANCKDPLLILPPTVVDQIKLWQLELDRIIS
                     YDGSLYSDFESHQEYHLLSSYAQDIGVLIWKDDKKKKFFVSKEGNSQVLDYAKRKLKK
                     KQTP"
     gene            <754586..>758017
                     /locus_tag="HG535_0A03760"
                     /db_xref="GeneID:59234073"
     mRNA            <754586..>758017
                     /locus_tag="HG535_0A03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286270.1"
                     /db_xref="GeneID:59234073"
     CDS             754586..758017
                     /locus_tag="HG535_0A03760"
                     /inference="similar to AA sequence:RefSeq:NP_014850.1"
                     /note="similar to Saccharomyces cerevisiae RET1 (YOR207C);
                     ancestral locus Anc_8.619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142165.1"
                     /db_xref="GeneID:59234073"
                     /translation="MVAKKVNKHTHYKKDDTFEDLLKPVYKGKKLTDEVNTTEDKWNL
                     LPAFLKVKGLVKQHLDSFNYFVDVDLKKIIRANQLILSDVDPEFYLKYVDIRVGQKSN
                     SSVRYNMTPPQECRLRDMSYSAPIYVDIEYTRGRNIIMHKDVEIGRMPIMLRSNKCIL
                     YGADESLMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKGIVQASVT
                     SSTHERKSKTYVVTKNEKIYLKHNSIAEEIPIVVVLKACGIVSDLEVMQLVCGNDSSY
                     QDIFAINLEEASKLGLYTQQQALEYIGSKVKTVRRQKLTTLQEGIEAIATTVIAHLTV
                     EALDFREKALYIAMMTRRVVMATHNPKMVDDRDYVGNKRLELAGQLLSLLFEDLFKKF
                     NNDFKASIDKVLKKPNRAMEYDALLSINLHSNNITSGLNRAISTGNWSLKRFKMERAG
                     VTHVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTADTPEGEACGLV
                     KNLALMTHITTDDEEAPIKKLCYLLGVEDINLIDSASLHLNYGVYLNGTLVGATKFPI
                     KFVSQFRNLRRDSKISAFISIYTNSHQKAVHIATDGGRICRPLIIVSNGKSKVQAGHL
                     KRLMDGELVFDDFLKLGLVEYLDVNEENDSYIALYEKNIDENFTHLEIEPFTVLGAVA
                     GLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIEL
                     IDYDKLPAGQNATVAVMSYSGYDIEDALVLNKASIDKGFGRCETRRKTTAILKRYPNH
                     TQDIIGGMRVDENDEPIWQHKSLGADGLGEVGMKVENGQVYINKSIPTNASEGVLNTA
                     QAQYKETPVTYRGPEPSRIDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKG
                     VCGIIVKQEDMPFSDQGVVPDIIMNPHGFPSRMTVGKMIELVSGKAGVFNGTLEYGTC
                     FGGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMH
                     ARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDV
                     CEKCGLMGYSGWCKTCRTAEYITKMTIPYAAKLLFQELLSMNIAPRLRLEDIFQE"
     gene            complement(<758141..>758833)
                     /locus_tag="HG535_0A03770"
                     /db_xref="GeneID:59234074"
     mRNA            complement(<758141..>758833)
                     /locus_tag="HG535_0A03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286271.1"
                     /db_xref="GeneID:59234074"
     CDS             complement(758141..758833)
                     /locus_tag="HG535_0A03770"
                     /inference="similar to AA sequence:RefSeq:NP_015204.1"
                     /note="similar to Saccharomyces cerevisiae MEI5 (YPL121C);
                     ancestral locus Anc_8.618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142166.1"
                     /db_xref="GeneID:59234074"
                     /translation="MDDTTIVGSSPPRPFKIDQNKIKIFLKSPLSSERTPQVQVRKSV
                     FKKSTVSNEDRKLVAENRLLCEELNKQIGFYKKDNYQLKQAIKILKYYDEEEKVLLLI
                     EKWRTICQAGMSFIMNSTLIKIARTGGYEELLRKEFEAAKRKLEYQVDDSFQNEMDEL
                     LESEEFQRLPEEVQQEYKDKAEEKIREAEVWKEKEFAKLENALKDKQSQEMTMKELSN
                     RLKVEFELVFPE"
     gene            complement(<759112..>761379)
                     /locus_tag="HG535_0A03780"
                     /db_xref="GeneID:59234075"
     mRNA            complement(<759112..>761379)
                     /locus_tag="HG535_0A03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286272.1"
                     /db_xref="GeneID:59234075"
     CDS             complement(759112..761379)
                     /locus_tag="HG535_0A03780"
                     /inference="similar to AA sequence:RefSeq:NP_014849.3"
                     /note="similar to Saccharomyces cerevisiae NOC2 (YOR206W);
                     ancestral locus Anc_8.617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142167.1"
                     /db_xref="GeneID:59234075"
                     /translation="MSLQSDDFPRGRTENNPDSRCSPFVVDSCIMGKVSKATRKFQSK
                     HLKRTLDNRKQEKNQKQRVQGRRGNKTEQEKANAALTKSEQMLKKSAKEEVFKDMSAE
                     KFFDAGFEVPKESKKNSQARSKAQAEKSKENDGESSSEEEDMTENMADISKKDPEFYK
                     YLLENDKELLDFNGSNPLDGIENEDYAEDEGEEVMKNREEHGEEQGSKGSAKIDLTLK
                     LVKKWKSQANEKPNLKLIRNIVSAFKVAVNLNRDDKIEDYKYSITDAKAFQELLFLAL
                     KDLPKIIQQLVPYKNNKGSRTLPTGSNASKMASIVKSHASALITLINDITNTETAALV
                     LHSVDQLLPYFLSYRRILKEIIKSIVDVWASTRDIETQIAAFAFLHNAAKEFKKSSLE
                     LILKSTYSTFIKKCRSTNMRTMPLINFQKNSAAELFSIDETAGYQIGFEYIRQLAIHL
                     RNTMNATTKKTNKSNSANAYKVVYNWQFCHSLDFWSRVLSFSCNPEKENGHESQLRQL
                     IYPLVQVTIGVIRLIPTPQFFPLRFYLIRSLIRLSQNTAVFIPIFPLLSEILVSKAFT
                     KIPNKKESLAAFDFDHNIKCNKAYLGTRVYHEGLSEQFVDLLGEYFVLYCKNVAFPEL
                     VAPVIISLRRYMKTSKSIKQSKQLSNVVEKLKQNSSYIQSKRDDVDFSPTNKTEVARF
                     LHDVPWEKTPLGSYIVIQREVKEESARILRESLEEEDKEKESDENKALDVDEDDTSDE
                     NSNEESANEDVEMSD"
     gene            <761548..>763212
                     /locus_tag="HG535_0A03790"
                     /db_xref="GeneID:59234076"
     mRNA            <761548..>763212
                     /locus_tag="HG535_0A03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286273.1"
                     /db_xref="GeneID:59234076"
     CDS             761548..763212
                     /locus_tag="HG535_0A03790"
                     /inference="similar to AA sequence:RefSeq:NP_014848.1"
                     /note="similar to Saccharomyces cerevisiae YOR205C;
                     ancestral locus Anc_8.616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142168.1"
                     /db_xref="GeneID:59234076"
                     /translation="MLSPHVSRNILGRFSHVWKRLLACNACGIKLQNTENTKEGYFIV
                     PKEAKGKKLQSLEDVKYLLFSQDLQKAKGLVEAGTFEGLRRTRSPESLICKRCSDAIH
                     KNEYKLEDFRGFAYGEISRYIPSGSNVLHLVSLPEFPLGLSRDILEEPRFDTSVLLTK
                     ADQLIKDRSTLQKKSAVFFRDFMKNQLGISTNKTIATSTVKKWNVKSVYSMLRAHNFL
                     LGSANVGKSTLINALIKEYMGYKVKRGQAGDILIPKIPEKDMSNMQEILRAQFAGVSH
                     IPNMTRRRQEYKIGDKIVNDLPGFTEETAVIQYEDIIRREWLDRIRKTNLFKARKLKK
                     KTFYSILGSENGACYTLGGLFFIKPPAETINQIINFIPGEEYEFKSIEKGLEVFKTCN
                     VMQHPLEKYCGVKSAICSLDHYSRHVIPPFQGSVEIVLKDIGYFVLRTTGKYKFTGLH
                     EIWVPHGITVCVREPLEKLIDVGFKEHSESHGNLPACPKKRPIISSTYVMSHNEENTF
                     GRMREMYLERTMNDLSVRRHTHEEPLHIVRELHDERPNLYWHYQWY"
     gene            <763408..>764874
                     /locus_tag="HG535_0A03800"
                     /db_xref="GeneID:59234077"
     mRNA            <763408..>764874
                     /locus_tag="HG535_0A03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286274.1"
                     /db_xref="GeneID:59234077"
     CDS             763408..764874
                     /locus_tag="HG535_0A03800"
                     /inference="similar to AA sequence:RefSeq:NP_015205.1"
                     /note="similar to Saccharomyces cerevisiae VPS30
                     (YPL120W); ancestral locus Anc_8.615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142169.1"
                     /db_xref="GeneID:59234077"
                     /translation="MNGIEDNLIKCQNCQLPLKIDSSLLDLSLAQTDMLVSSVNEYKQ
                     ENYKIPQERLQRLNKVVYPNEVNLQKLGLGSYIFLQDDIKVEDPSTVASTNTSLSTST
                     AQREDDSGDEQTEEDRQHRYSGSTVRTLSTQVSALANVFNILSSKSNIDYPVCQDCCN
                     ILIRRIQSEYDDAIKERDLYSQFLSRIEKQKSLTSHDSSDDSHDEAEKLLNEKASLLQ
                     ELKTLELEDEELDKQIADLEQQLKEKKRLEEEDTRRNNFYELEQVDLAREVQSLKNQY
                     DFSLNYLDKLRKINIYNETFKISHDGLFGIINGLRIGGFQDVNVPWQEINAGIGQVVL
                     LLATITTRLEIKLQGYKLIPMGSYSKVSKFQDDTQEWVAYEAFNNDNFKIGKLFRKET
                     SFDKAMESLLIIIRQMAVWLSHARSQRHGSVYTAASENDELNDEEIELPYVMHKDKIN
                     GISVKLFGGRPGMDWTTAMKFLLTNTKWLFAFSSSQLG"
     gene            <765083..>767683
                     /locus_tag="HG535_0A03810"
                     /db_xref="GeneID:59234078"
     mRNA            <765083..>767683
                     /locus_tag="HG535_0A03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286275.1"
                     /db_xref="GeneID:59234078"
     CDS             765083..767683
                     /locus_tag="HG535_0A03810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142170.1"
                     /db_xref="GeneID:59234078"
                     /translation="MSNAFDPDALSKMLKKLSYGLNKDHIDIDYAMERVTKGISSAAS
                     KQEIIAFVAETLATLASIHPDHSILAARLEIHELHRSLNNVTFTENLSALLSVSRTDA
                     EAASIDDDPLRKRQKLSRVPKKGVISPQFFALAKKYQERLNNAIVSERDYEFTYFGWK
                     TLCQSYLIKKANKVHETPQFMFMRVALAIHGPYDDIDLVLSTYELMSQRYFIHASPTL
                     FNAGTVNQYLSSCFLVGMQEDSIDGIYKTLHKTALISKASGGIGIHVSNIRASGSFVS
                     GSNGISNGLVPMLRVFNNTARYVDQGGNKRPGAYCIYLEPWHSDIFDFLQLRKNHGKE
                     EMRARDLFLALWIPDLFMERVESNGDWSLFSPDEAPGLNDVYGEEFNKLYGYYEETRA
                     PMRVVKAQKLWAEILQSQTETGGPFMLYKDACNKKSNQKNLGTIKSSNLCCEIVEYSS
                     KDEIAVCNLASVALPSFVRTSNSETKLFDFDKLHSVVKVVTKNLDRVIDIGDYPVEEA
                     RNSNLKHRPEAIGVQGLADLFFILKIPFESEEASTLNKQIFETIYHAAIEASIELAEE
                     YGPYSSFESSPSSEGILQFDFWKKPNQKYDFLYKDWDDIKERIKNRGLRNSLLVGPMP
                     TASTSQILGYNESFEPMTSNVYTRRVLSGEFIVINQHMVNHFCDLGIWDEKLKNKIIM
                     HDGSVKDIEGLPEWIKDIYKTVWEIPQRRLIDLARERSPFIDQSQSLNLFMKTPTMGK
                     LTGMHFYAWRQGLKTGMYYLRTQAAAAAIQFTINSENTLASGVSLPKSKRQEKKDIVS
                     GIYPLSADKELFIHFFSEAGESLANLKKDDYNNKGNVDSCDDVFGIHDSTPLACNLGD
                     NGEVCEGCSG"
     gene            complement(<768368..>770185)
                     /locus_tag="HG535_0A03820"
                     /db_xref="GeneID:59234079"
     mRNA            complement(<768368..>770185)
                     /locus_tag="HG535_0A03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286276.1"
                     /db_xref="GeneID:59234079"
     CDS             complement(768368..770185)
                     /locus_tag="HG535_0A03820"
                     /inference="similar to AA sequence:RefSeq:NP_014847.3"
                     /note="similar to Saccharomyces cerevisiae DED1 (YOR204W)
                     and DBP1 (YPL119C); ancestral locus Anc_8.614"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142171.1"
                     /db_xref="GeneID:59234079"
                     /translation="MADLSNEVKNLDINDNNGKGGYVPPHLRRGEGRRTRNEGSGPVD
                     RGSSGGNRGGFFGFDRRGGGRGDFSRGRGGFRNDGGPRPAGTGRWVDGKHVPAPKNER
                     MEIQLFGVAEDPQFQSSGINFDNYDDIPVEASGENVPEPITEFTSPPLDELLLENIKM
                     ARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSETPESAR
                     GSYMRKALPTAVVLAPTRELATQIFDEAKKFTYRSWVRPTVVYGGADVYSQMKDLDRG
                     CDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRHIVDGCDMPSVE
                     NRQTLMFSATFPVDIQHLARDFLNDYIFLSVGRVGSTSENITQRILYVEDEDKKSALL
                     DLLSASNDGLTLIFVETKRMADQLTDFLIMQDFAATAIHGDRTQGERERALAAFKSGR
                     ANLLVATAVAARGLDIPNVTHVINYDLPGDVDDYVHRIGRTGRAGNTGISTAFFNRGN
                     KNIAKGLIELLTEANQDLPEFLNDVSRESFGPKGGRGFSNRSSGSRDYRKQGNGNGSW
                     GASRSGGTSGGWGNSRSTSGWGSSAGAGSGSGSGNSSWW"
     gene            <770585..>771646
                     /locus_tag="HG535_0A03830"
                     /db_xref="GeneID:59234080"
     mRNA            <770585..>771646
                     /locus_tag="HG535_0A03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286277.1"
                     /db_xref="GeneID:59234080"
     CDS             770585..771646
                     /locus_tag="HG535_0A03830"
                     /inference="similar to AA sequence:RefSeq:NP_015207.1"
                     /note="similar to Saccharomyces cerevisiae MRP51
                     (YPL118W); ancestral locus Anc_8.613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142172.1"
                     /db_xref="GeneID:59234080"
                     /translation="MSSSQLAQLLRGSRLSHVPRSSKPFVSSEPKYYPTHQVVETKPS
                     TLNRQEWGLKAPIPRKVKSRYLIYNDLDTLERITTFETNAGSQWNRLRFQEMRLAPSY
                     NPGKANPLFEGTSSPADKQAPLSSLMGVSEEKVDSSTKKLSQKSSALQALRKDFKLWM
                     LNRDPEALKNKTFTAKDMNENAMQFLNERFGSHSQLEIRKDAFKGVIGSGGLTYTLGG
                     KLLNSPNGVIQKTIVPGRFLNLDGNDRLAAIGGFVANASSSTPMTSQVAYNMGDFVRE
                     LTFPFDVQKVSVDENGKIMMKAQVISGLSQRMRGKIQGRSYQQRPIKTNKSSSPAVSP
                     IDPKMQADELLNILLSNFN"
     gene            complement(<771718..>772398)
                     /locus_tag="HG535_0A03840"
                     /db_xref="GeneID:59234081"
     mRNA            complement(<771718..>772398)
                     /locus_tag="HG535_0A03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286278.1"
                     /db_xref="GeneID:59234081"
     CDS             complement(771718..772398)
                     /locus_tag="HG535_0A03840"
                     /inference="similar to AA sequence:RefSeq:NP_014845.1"
                     /note="similar to Saccharomyces cerevisiae HIS3 (YOR202W);
                     ancestral locus Anc_8.612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142173.1"
                     /db_xref="GeneID:59234081"
                     /translation="MGSRKALVNRITNETKIQVLISIDGGHIALENSILNNESNQAKT
                     NAKDVAAQNTNSQVINIQTGVGFLDHMIHALAKHSGWSLLVECVGDLHIDDHHTTEDC
                     GIALGEAFKQALGQVRGVKRFGTGFAPLDEALSRAVVDLSNRPYAVVSLGLKREKIGD
                     LSCEMIPHFLESFIEAARLTVHIDCLRGFNDHHRSESAFKALAVALREALAPNGTNDV
                     PSTKGVLM"
     gene            <772629..>773843
                     /locus_tag="HG535_0A03850"
                     /db_xref="GeneID:59234082"
     mRNA            <772629..>773843
                     /locus_tag="HG535_0A03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286279.1"
                     /db_xref="GeneID:59234082"
     CDS             772629..773843
                     /locus_tag="HG535_0A03850"
                     /inference="similar to AA sequence:RefSeq:NP_014844.3"
                     /note="similar to Saccharomyces cerevisiae MRM1 (YOR201C);
                     ancestral locus Anc_8.611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142174.1"
                     /db_xref="GeneID:59234082"
                     /translation="MLHQKCGSAISFKRLLAVRSTSRRPNNQTSFDKKMPVMGREKAW
                     EKAGEDKEAWFKRKYAHVHAKEKVLEKQDPFGKKKAHMEKLNRIQNDMKSDQKEHKSR
                     FVKRSATQGLQVNPLLEYVCGTNAVLAALLGNKREYFTRLLYFGTLPPEIQKLAKEKT
                     IRTEPTDKHRLNLLTNYSVHNNVALETKPLQPTEISHLQLCNPESAEFHFSELLFEGE
                     LKARQSSYISNAQKKFPLGVYLDEVMDPHNIGAIIRSAYFLGADFIVMSRKNCAPLSP
                     TVSKTSSGALELMPIYYVDRPLSFFSKSQEEGGWMFVTSCLTSANAKDQKYMGGKTLS
                     LDDLRGMCNKLPVVLVVGNECNGVRTNLRMRSDFFVEIPYGRATDEITSPVDSLNVSV
                     ATALLLNSLLTN"
     gene            complement(<773973..>774803)
                     /locus_tag="HG535_0A03860"
                     /db_xref="GeneID:59234083"
     mRNA            complement(<773973..>774803)
                     /locus_tag="HG535_0A03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286280.1"
                     /db_xref="GeneID:59234083"
     CDS             complement(773973..774803)
                     /locus_tag="HG535_0A03860"
                     /inference="similar to AA sequence:RefSeq:NP_015208.1"
                     /note="similar to Saccharomyces cerevisiae IDI1 (YPL117C);
                     ancestral locus Anc_8.610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142175.1"
                     /db_xref="GeneID:59234083"
                     /translation="MSKYAKLVEGLTGTEILEKFPDVIPLQKRPNTKSSESSSDDVSD
                     KVFSGHDEEQIRLMNENCIVLDWNDEAIGAGTKKLCHLMSNIEKGLLHRAFSAFVFNN
                     EKKLLLQQRASEKITFPDLWTNTCCSHPLCVDDEIGLEGSLEVKVEGAITAAVRKLDH
                     ELGIPQEETLKNGKFHFLNRIHYMAPSNDPWGEHEIDYILFYKLNDAQQLTVDPNLNE
                     VRDFEWVDAETLKAMFKDPSLKFTPWFKLICESYLFKWWDQLDNLTSVENDTKIHRML
                     "
     gene            <775255..>776658
                     /locus_tag="HG535_0A03870"
                     /db_xref="GeneID:59234084"
     mRNA            <775255..>776658
                     /locus_tag="HG535_0A03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286281.1"
                     /db_xref="GeneID:59234084"
     CDS             775255..776658
                     /locus_tag="HG535_0A03870"
                     /inference="similar to AA sequence:RefSeq:NP_014841.1"
                     /note="similar to Saccharomyces cerevisiae BFR1 (YOR198C);
                     ancestral locus Anc_8.609"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142176.1"
                     /db_xref="GeneID:59234084"
                     /translation="MSSQQQHHKYKRPDVSVRDKKLEVLNAQLKKVDTEISSLRKQID
                     QNQVNDATQQERKKLQDQTKEIIKTQAELKTRRNAIHDSIKQLDSQMKRKTNEINEKL
                     GRKAKFSTPQEVKQRLAEIEDSISSGNLSLVDEKMLVKEMQSLNKLNKDLVAIEPIKK
                     SVDQDKAKIVALKEELNQLNPREVAAKFETTQEKLNTLVSKSQTVYDKRQTLYNKRSA
                     LYNKRDEIYSQIKQIRADFDNEFQAFKQKLEKERLKREEDQKLSKLLEEKDGQLGKLQ
                     EKLSHAKQPAFTFEIEAIENALLSLDPTYEKPKKNVFGELEETKKPESQPVKAVVADD
                     LVLVSNEKEQSNYSNTAPSKSKKHKKKQKSAASATSITDNGRFSLEPTLIAMLAELDV
                     IVPISKEEVPKAIEQLKHKHENFLAKQDEQTDKNISEVEKEIEKLELGYSKKEEQIKK
                     ELEAKRVQEKQDDKENN"
     gene            complement(<776745..>778031)
                     /locus_tag="HG535_0A03880"
                     /db_xref="GeneID:59234085"
     mRNA            complement(<776745..>778031)
                     /locus_tag="HG535_0A03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286282.1"
                     /db_xref="GeneID:59234085"
     CDS             complement(776745..778031)
                     /locus_tag="HG535_0A03880"
                     /inference="similar to AA sequence:RefSeq:NP_014840.4"
                     /note="similar to Saccharomyces cerevisiae MCA1 (YOR197W);
                     ancestral locus Anc_8.608"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142177.1"
                     /db_xref="GeneID:59234085"
                     /translation="MFPGKGSYTYNNGQSDFRPENSGYERPQGAPPGNFGNLDHPRYS
                     RPSYPPPSPEDGYERPNVAPPSFSSQQGEYTRPSAPPPQMANSRNNGFVDGPDKYQQP
                     SANMSLPPQSTQSIQGAPVTYQYSQCNGRRKALLIGINYFNSQNQLRGCINDAHNMFN
                     FLTTRYGYRREDIVMLTDDQQDPIRIPTRDNIIRAMQWLVKNAQPNDSLFFHYSGHGG
                     QTKDLDGDEEDGMDDVIYPVDFERAGDLVDDIMHDIMVKPLQPGVRLTALFDSCHSGT
                     VLDLPYTYSTKGVVKEPNVWKDLGSGGLQAAMAYATGNRSALFSSLGSLASTVKNKVG
                     TNVDRERIVQTKFSPADIIMFSGSKDNQTSADAVENGQATGAMSYAFVKVLGLQSEQS
                     YLSLLQNMRQEMASKYSQKPQLSSSHPIDVNLKFIL"
     gene            <779252..>781396
                     /locus_tag="HG535_0A03890"
                     /db_xref="GeneID:59234086"
     mRNA            <779252..>781396
                     /locus_tag="HG535_0A03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286283.1"
                     /db_xref="GeneID:59234086"
     CDS             779252..781396
                     /locus_tag="HG535_0A03890"
                     /inference="similar to AA sequence:RefSeq:NP_015209.1"
                     /note="similar to Saccharomyces cerevisiae HOS3 (YPL116W);
                     ancestral locus Anc_8.607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142178.1"
                     /db_xref="GeneID:59234086"
                     /translation="MPEKDPLESFYRQFQVFVQNNPNVISAARAASQIPESAKAVVVL
                     SPYSLRHTFPRDWVSKSYRKTIVERPERLLAGSMGISAAVTMYPALFTLKSSHERKGS
                     LLSAHVLKIHGKDWPPTLLHLCKEADRKLAKQAIEVPDSWNSGDNYLSSKTIEALEGS
                     IGALETGVDSIFSGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVSIEYAAD
                     RYGVTHAVILDFDLHHGDGTQDICWKRAGFRPEEEEKDSDGYDEFGKKFSEFPQVGYF
                     SMHDINSFPTESGYATKDNIKNASTCIMNAHDVNIWNIHLSEWKTEEEFNKLYQSKYR
                     TLFAKADDFFRSAKLQMEELGKPYKALVVISAGFDASEFEQTTMQRHGVNVPTNFYTM
                     FTKDALKLAQMHSDGKVLSVLEGGYSDKAITSGTFAHLIGLQNQNWIKEWGSEQVVKE
                     IVRGCKSNWKPYKSKKSKDVIRIWAEEVIKLGRAMIPEFEEYLFNASLTNMNSVEESK
                     TTSLVTQRLTRAQAQQLEEQERKHQQKQEASQETKTERRTATTEKPSEQVPFAKQELL
                     SEDENENEDEDYVYDEELNKTFNRTVEDITIDDISRHLETLEIIEAREPGTRGQSANV
                     LTSTNSKQSRDKASAQYKVPTGTTTKHLRNSYRNSNILEQNEVNNQKHGYGSARDQPH
                     DSAADQEHDETDISMVSHVSTRKHTTRSGSRW"
     gene            <782170..>783297
                     /locus_tag="HG535_0A03900"
                     /db_xref="GeneID:59234087"
     mRNA            <782170..>783297
                     /locus_tag="HG535_0A03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286284.1"
                     /db_xref="GeneID:59234087"
     CDS             782170..783297
                     /locus_tag="HG535_0A03900"
                     /inference="similar to AA sequence:RefSeq:NP_014839.1"
                     /note="similar to Saccharomyces cerevisiae LIP5 (YOR196C);
                     ancestral locus Anc_8.606"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142179.1"
                     /db_xref="GeneID:59234087"
                     /translation="MLISRSACAKRLGSNGAKLISTTRANPSRPTEPKKRKITEFKDS
                     LNKGPAFEDFLAGRAAQFSMDPLEKARQNAEEARRLPKWLKVPIPKGTSFHKVKKDVN
                     ELKLSTVCEEARCPNIGECWGGGDKSKATATIMLLGDTCTRGCRFCSVKTNRTPSKPD
                     PMEPENTAEAIKRWGLGYVVLTTVDRDDLLDGGSHHLAETVRKIKEKAPKTLVETLSG
                     DFRGDLNMVDVMARSGLDVYAHNIETVEDLTPHVRDRRATYKQSLRVLKRAKETVPTL
                     ITKTSMMLGLGETDEQVLQAMKDLREIKCDVITFGQYMRPTKRHMKVVDYVLPEKFEH
                     WKKVAEDLGFLYCASGPLVRSSYKAGESFIENVLKKRVAAT"
     gene            complement(<783435..>786536)
                     /locus_tag="HG535_0A03910"
                     /db_xref="GeneID:59234088"
     mRNA            complement(<783435..>786536)
                     /locus_tag="HG535_0A03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286285.1"
                     /db_xref="GeneID:59234088"
     CDS             complement(783435..786536)
                     /locus_tag="HG535_0A03910"
                     /inference="similar to AA sequence:RefSeq:NP_015210.1"
                     /note="similar to Saccharomyces cerevisiae BEM3 (YPL115C);
                     ancestral locus Anc_8.605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142180.1"
                     /db_xref="GeneID:59234088"
                     /translation="MENASQKTLELLAQYDNHTSERDKAIEHIERRVVNEDMPTYDDL
                     FKENVKLKLQLKEQETEIEALKSLVQGMRSSKLNANVVTVGDRSGESAQYVTAKKELL
                     LPPRSADREKNSKNLSIPIPGVDSSNAVGRVILSSTESSSGHTLTPQESLEKSVERNI
                     KSPMKVKGNMHASKSDVSPAASVTYKTSRITIASPNSPGRSVASSRVRSPQSANRVTA
                     VINNHVHSPLRSNNESEIFSTDKDSNDTVDLSPLGDEINLKSPLAHINALKLEDKAVE
                     FSPSSKQNLNSFADFLEDTFKKSESDLTENLKGQQASYISSPTPTPVPPSLPFPSITR
                     EREIPTSMKLGSPVILNRKEQDHVTNSSTRKSSLNTSLSKVQLANAVATSPKQTLPSE
                     SPQNRSTETAALFTGSLPPSNSNAAWPHAGSFNSTRSPNEKSTIPLFVQPEDFGTIKM
                     RVLSTLYHETESNFDEPQVLFSVIDRKSQKEMFKFSKTIRKIYELDVYLKPRLSSLSL
                     PALPDKQLLESLAPSKVDERREVLAQYFFSIFSIPNYPPNAALRIAQFMSTDTVMNPV
                     LLGDTVKEGSLLMRRPKTLGSAGNWRARYGILGGDVLTLFDKGQVSERIRLKQSTIEL
                     LPNLPEDKHGTKNGFVINEHRKSGLSNTTKYFLCAETSKEREIWVSAISEFIFSASIP
                     PTSTITSTNAEGNAVRTKIDNGSVDQIYVTDLTVDSGSQSNEDNASSVSHEVDNMEEY
                     EDSKESKEIKRLKMRSFFPFKKITSNALNMMYDDADTIASQDSDPKFSDNSIAKSLEN
                     MNLSPEKHQSKVFGSPLEDCLKLSSHTYLGKYEIPSVVYRCLEFLYKNRGIQEEGLFR
                     LSGSSALIKSLQEQFDTRYDVDLFNYNKHIPETNVSSSGTFIDVNTVSGLLKLYLRRL
                     PHSIFGDEEYASFKYITDQYNNDTSQIAYKFRDLIRSGGIPEANVSLMYCLFELLLRI
                     QENQRYNKMSAKNLCIVFSPTLNVPVTILRPLIIDFACIFQDGSPVEQEINQDVDVHI
                     PQI"
     gene            complement(<786977..>789430)
                     /locus_tag="HG535_0A03920"
                     /db_xref="GeneID:59234089"
     mRNA            complement(<786977..>789430)
                     /locus_tag="HG535_0A03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286286.1"
                     /db_xref="GeneID:59234089"
     CDS             complement(786977..789430)
                     /locus_tag="HG535_0A03920"
                     /inference="similar to AA sequence:RefSeq:NP_014838.3"
                     /note="similar to Saccharomyces cerevisiae SLK19
                     (YOR195W); ancestral locus Anc_8.604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142181.1"
                     /db_xref="GeneID:59234089"
                     /translation="MRDYHRPSPLLTMDQIPTTPEGRSPPKKLPCSASSVVLHCPSTQ
                     LKVHPHGISAKKHAEETVSHEGSLFANSFDPNVSLDNIRRGRYGKTEQNAEVQSDDHS
                     NALDQIDINKMFPHAGHCGNDEPKQESRLMLMNQSPIHIDMSSPVKQRDDDDAGVEDG
                     ENEPVSKKVKLELESVPNLTQGVANEQFNDINLSSPEAIEMIETKSSPIKDFSEINEE
                     QEQQQGPGQHSPHQDVKGSEFQKSNERDPIETPPKNRSENILSLPQLIPVFNHNDTES
                     SLNNRLQKSFYLVDNTDLKNSYEFQGLSKRNQELIEEIHSMNERVNDLTADNDLAFHE
                     YKNIKMKLENSSSTYEAEIKKLNTAVNSISSDRDKYQERLNKLKQMLNESRDEIKMLN
                     QNQSILQKKYETATKEADRWKKLSNEIEGNFLEMRSVAMERNDKSKEMEDKVNALTEK
                     IASYETENTELEALNNEIKEKYNALEELLSKNDDELKRLKAQHNESLAAQKGASDEIS
                     NQLNDLVAAKHALELQLKVLQDDSKEKIALLNESVVEKKSLLESATKNFNNVQNSLQT
                     LQNELTEKNQQLKSMQTKHESLDDESEIRKAEIVELNEKNEELKELNLTLENSVSQLE
                     GKLKELRENLDRERGSPERETEYLKNMNIEAEHLAELEDLHANMSTLQECLKKNSDTI
                     SRLRIENESLKNNQQTGHIEHEKEPKEALISNLRKEVEDWKEKYSSKEQESNKSLKLL
                     AEDLYIQYSSKHEQKVKLLKRGYETKYQSKLDKLNLKNEGLAEELQHLRNQLASERKE
                     KQKLLSLIDENRRHKNLED"
     gene            <789970..>790827
                     /locus_tag="HG535_0A03930"
                     /db_xref="GeneID:59234090"
     mRNA            <789970..>790827
                     /locus_tag="HG535_0A03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286287.1"
                     /db_xref="GeneID:59234090"
     CDS             789970..790827
                     /locus_tag="HG535_0A03930"
                     /inference="similar to AA sequence:RefSeq:NP_014837.1"
                     /note="similar to Saccharomyces cerevisiae TOA1 (YOR194C);
                     ancestral locus Anc_8.603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142182.1"
                     /db_xref="GeneID:59234090"
                     /translation="MSNTEASRVYELIVESVVNEVREDFENAGIDEQTLQDLKQVWQT
                     KLSETKVTKFSWDPQENEGQLGTDGMDNDGTNAFNGLNESSNTGSKTNAVPSEYSLNE
                     SQGLVLPGFPNEEANKTESSATINETPNGQENKVEEPVANQQQEQAQEARNEGNEEDI
                     RDREDQKVKTEQDRDNNLDDSQQIELTISYGDSEKADALKQESKKAKRSALLDADEVG
                     SELDDSDDDYLISEGEEDGPDENLMLCLYDKVTRAKARWKCSLKDGIVTINRKDFTFQ
                     KSQVEAEWV"
     gene            complement(<790934..>792145)
                     /locus_tag="HG535_0A03940"
                     /db_xref="GeneID:59234091"
     mRNA            complement(<790934..>792145)
                     /locus_tag="HG535_0A03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286288.1"
                     /db_xref="GeneID:59234091"
     CDS             complement(790934..792145)
                     /locus_tag="HG535_0A03940"
                     /inference="similar to AA sequence:RefSeq:NP_015212.1"
                     /note="similar to Saccharomyces cerevisiae YPL113C;
                     ancestral locus Anc_8.602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142183.1"
                     /db_xref="GeneID:59234091"
                     /translation="MTSNIPMTNTEITKKPRVLIPYLNQWDVADHTQEWQKLSKEVSL
                     IKYKIEDVRVFEQFLQGSEIDCLWVTDDFVEHLGGPAAFWDFYPSSLKAVVVPWVGCD
                     FIDGRRLRKEKNIILCNIGPNASNCVADMAMFLVISCFRLTSFWEHCFRFFTNGSVPD
                     TRRYIGGEGKTTFGIKALPSDGSISSALHSSYELPKAAHPDEIATLNLSKNFSIGGKS
                     VDSPADKNALILGFGSIGRTIGKRLSAGLGMNIHYFKRSGPIPECNLGYNAKFWHDIN
                     APETWAIADIIIISLPKDPSTDNIINEKTLKMCKDGVRIVNVGRGSCIDEDALIKALD
                     SGKVTSCGLDVFKNESTAIRQDLLSRWDVTLLPHIGSTVSDMMISQTLITLENIKSIL
                     LNGKEGVYPIN"
     gene            complement(793784..793855)
                     /locus_tag="HG535_0Atrna1M"
                     /db_xref="GeneID:59234615"
     tRNA            complement(793784..793855)
                     /locus_tag="HG535_0Atrna1M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:59234615"
     gene            <795099..>796067
                     /locus_tag="HG535_0A03960"
                     /db_xref="GeneID:59234092"
     mRNA            <795099..>796067
                     /locus_tag="HG535_0A03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286289.1"
                     /db_xref="GeneID:59234092"
     CDS             795099..796067
                     /locus_tag="HG535_0A03960"
                     /inference="similar to AA sequence:RefSeq:NP_015214.1"
                     /note="similar to Saccharomyces cerevisiae CAR1 (YPL111W);
                     ancestral locus Anc_8.600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142184.1"
                     /db_xref="GeneID:59234092"
                     /translation="MTCDPVFDYLPEKKLSLVLAPFSGGQPRGGVENGPQFLLKHGLE
                     NDLQELGWKTKVERPLDEEDISKRMKESTVTDSFGIIKRPNLVGEVAEKIYKKVSQCL
                     GETSFPVTLGGDHSIAMGTVSAVVDKYPDVGVLWIDAHADINTVKSTESGNLHGCPVS
                     FLMGLNEESEMPESLKWIPGNLRPEKIVYIGLRDVDSGEKKILRDLGIKAFSMYHVDR
                     YGINSVIDMALKAIDPEGNCPIMCSYDVDALDPLYVPATGTPVRGGLTLREGLFIVER
                     LAETGKLVALDVVECNPDLGLSDGHIVDTVSAGCAIARCALGETLL"
     gene            <796381..>797253
                     /locus_tag="HG535_0A03970"
                     /db_xref="GeneID:59234093"
     mRNA            <796381..>797253
                     /locus_tag="HG535_0A03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286290.1"
                     /db_xref="GeneID:59234093"
     CDS             796381..797253
                     /locus_tag="HG535_0A03970"
                     /inference="similar to AA sequence:RefSeq:NP_010599.1"
                     /note="similar to Saccharomyces cerevisiae PIB1 (YDR313C);
                     ancestral locus Anc_5.339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142185.1"
                     /db_xref="GeneID:59234093"
                     /translation="MTSGTDYVNSFAQWQPDDEMHHCLNCQAPFSFLVRKHHCRCCGG
                     IFCASCADKFARYDKTRVKVVKRSEDEEEFPPFRTCQSCYDNLLHLKLLLTAWGRRME
                     PQVRVGRSDDSRPESSSRCDSLVTVLGMNEVSKDNNETEHTHEISGSDRGSVRRGRNE
                     DERCCPICNVDLTKFEAEEDAQTHVQDCINRAVSIQQHKYGDDDETLSPSFQNRMLVY
                     KIAEGDGDNHYQECPICFEEMLPGEKVGRLECLCVFHYKCIKGWFNKKLQKMKTKDVK
                     YVGKNFCPLHDAVF"
     gene            complement(<797401..>798747)
                     /locus_tag="HG535_0A03980"
                     /db_xref="GeneID:59234094"
     mRNA            complement(<797401..>798747)
                     /locus_tag="HG535_0A03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286291.1"
                     /db_xref="GeneID:59234094"
     CDS             complement(797401..798747)
                     /locus_tag="HG535_0A03980"
                     /inference="similar to AA sequence:RefSeq:NP_010598.3"
                     /note="similar to Saccharomyces cerevisiae SSF2 (YDR312W)
                     and SSF1 (YHR066W); ancestral locus Anc_5.338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142186.1"
                     /db_xref="GeneID:59234094"
                     /translation="MAKRRVKKRTHVQATVEEEKSIPKSMVIRVGQTSLSNHSLNQLV
                     KDFRQIMQPHTAVRLKERKSNKLKDFVVMCGPLGVSHLFIFTQSEKTGNVALKIARTP
                     HGPTITFQVADYSLDKDVKKYLKRPKSLGKEDVMSPPLLVLNGFNTMGSKSQDDQNIG
                     EEANVEKVVVSMFQNVFPPLNPARTQLNSIKRVFMINKDAETGEITMRHYFIDIREVE
                     ISKNLKKLYKAKQNLSKPVPNLHRKEDISSLVLDHDIGAYTSESEIDDEAVVQILDRK
                     DVKTTSKKSQRPSTPDGDKEGNIALDESQDNQTMPRKKAIKLTELGPRLKLKLVKIEE
                     GICSGRVLHHEYVKKTSAEIKALEKRHAEKMRVKEQRRKEQEENISRKKATKEAKKQR
                     KLERRKQRQLEDGNTNENAAQSDNSAASDESASEDEDQHYSDIPEDLDSDLYSDID"
     gene            <799073..>800599
                     /locus_tag="HG535_0A03990"
                     /db_xref="GeneID:59234095"
     mRNA            <799073..>800599
                     /locus_tag="HG535_0A03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286292.1"
                     /db_xref="GeneID:59234095"
     CDS             799073..800599
                     /locus_tag="HG535_0A03990"
                     /inference="similar to AA sequence:RefSeq:NP_011932.2"
                     /note="similar to Saccharomyces cerevisiae RRP3 (YHR065C);
                     ancestral locus Anc_5.337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142187.1"
                     /db_xref="GeneID:59234095"
                     /translation="MSAKTGNKTKGITKKASSTDASKELTSLAAKIKAKALENQRKMK
                     EVDSSSEEGDEKRKPVTEKKSGKNARPLDLDSQVDEETTEEVLESFDDLDLVPEITQA
                     CKNLNFTKMTPIQAKSIPPALAGSDIIGLAQTGSGKTAAFAIPILNSLWHDQQPYYAC
                     ILAPTRELAQQIKETFDSLGSLMGLRTTCIVGGMNMMDQARDLMRKPHVIIATPGRLM
                     DHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSK
                     IDKLQRASLTNPVKCAVSNKYQTVDTLVQSLMVVPSGLKNAFLIYLLNEYYGKSTIIF
                     TRTKANAERISALCNLLEFNATALHGDLNQNQRTGALDLFKAGKKSILVATDVAARGL
                     DIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLGKK
                     LPKEDADKNSIMALRDTVDKANGEVIMELNRRNKEKIAKGKGRRGRMAAKMDMDREER
                     "
     gene            complement(<800688..>802502)
                     /locus_tag="HG535_0A04000"
                     /db_xref="GeneID:59234096"
     mRNA            complement(<800688..>802502)
                     /locus_tag="HG535_0A04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286293.1"
                     /db_xref="GeneID:59234096"
     CDS             complement(800688..802502)
                     /locus_tag="HG535_0A04000"
                     /inference="similar to AA sequence:RefSeq:NP_010597.3"
                     /note="similar to Saccharomyces cerevisiae TFB1 (YDR311W);
                     ancestral locus Anc_5.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142188.1"
                     /db_xref="GeneID:59234096"
                     /translation="MSHSGAATFKKVSGIITIEEEISPAKLSWRATDGSKSQVITLNT
                     IDRLQATHATSDKMKLRLIGKVDESKKVKDNEGNEKPADPITFTFIFNNRTVMDNIKV
                     TLQHIISRYKDDEVYEEKRRKEGDRDVGHTQIPTQLINTNTLDDSLSKIKLLSNLKLQ
                     QSLLKESKELMATFKETVINAGLPADEFWSTRIPTLRAYALSISQKVGPYNVLSTIKP
                     VASSDNKVNVNISREKILSIFQNYPIVKKAYTDNVPKNFKEPEFWARFFSSKLFRKLR
                     GERIMQNDRGDVIIDRYLTLDQEYDRKDDIALLHPVKKLIDLEGNTQDDPVLKGNKPD
                     FTMQPGVDFNGNSDGTIGILRGMNRLSEKMIMSLENEYSRSQLQQEDNDLEERDELQF
                     SDLKEAFHEDYAVFNLKNKSAEGSSEAKDFIKKTKSKEQSIDKARVTQQISLVLDSLS
                     NKLDLSQVAQSNKNNNDINQRVIAAVKINAKQAKHNNVDSILGSFVGVNAGESEAESK
                     LPPDLLESCRMLHSTCCEFLKHFYLHFHSTESKKQVMAKKLQKNLKECSEKITELLDD
                     VQKGDGEIMAGLCKTYLHPVMDSITLAIHKFNESRKKE"
     gene            <803753..>805384
                     /locus_tag="HG535_0A04010"
                     /db_xref="GeneID:59234097"
     mRNA            <803753..>805384
                     /locus_tag="HG535_0A04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286294.1"
                     /db_xref="GeneID:59234097"
     CDS             803753..805384
                     /locus_tag="HG535_0A04010"
                     /inference="similar to AA sequence:RefSeq:NP_011931.2"
                     /note="similar to Saccharomyces cerevisiae SSZ1 (YHR064C);
                     ancestral locus Anc_5.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142189.1"
                     /db_xref="GeneID:59234097"
                     /translation="MSSPIIGITFGNTSSSIAYINPKNDVDVIANPDGERSIPSVLSY
                     VGADEYHGGQALQQLVRNSANTIINFRDLIGLPFAQADVSKCAAGAPAIEIDGKVGFA
                     IKRGEDKEEKITVDEVISRHLNKLKLAAEDYIGSKVRQVVLTVPTNFNDNQKEALKNA
                     ASKAGLEVVQFINEPSAALLAHVEQYPFEKDVNVVVADFGGVRSDAAVIAIRNGIYTI
                     LATKHDTSLGGDNLDTELIEYFAKDFQKKTSTNPTKNVRSLAKLRANAIITKKTLSNA
                     TTATISIDSLADGYDYHTSINRMRFELVTNKVFSQFSAFVEDVIAKAELDPLDIHAVI
                     LSGGVAFTPKLANNFEFLFPESVKILGPNAKESSNQPNELTASGAALQARLVSSYDAD
                     ELSEALKPVIINTPHIPKAIGLIGSQGEFCPVFLAETSFPAQKKLTLKNAKGDLLVGV
                     YEGDHHIEEKTLEPTPKEEKKDDDEEEEEWSDSEDDEPEIIREKLYTFSTKLMELGIK
                     GVTKGVEIVFNLNKEGVLKVSARDLKSGNVVKGEL"
     gene            <805615..>806736
                     /locus_tag="HG535_0A04020"
                     /db_xref="GeneID:59234098"
     mRNA            <805615..>806736
                     /locus_tag="HG535_0A04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286295.1"
                     /db_xref="GeneID:59234098"
     CDS             805615..806736
                     /locus_tag="HG535_0A04020"
                     /inference="similar to AA sequence:RefSeq:NP_011930.1"
                     /note="similar to Saccharomyces cerevisiae PAN5 (YHR063C);
                     ancestral locus Anc_5.334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142190.1"
                     /db_xref="GeneID:59234098"
                     /translation="MTAMARAPKVHLLGLGSMGTVLAVNLLRFTNAAVIPLFRSKEKV
                     DRFQTEGNSTIGIREIYDKKSPLFTCKLEECECPETYQGGPIKNLVVTTKTYQTKDAL
                     QPYLPYINSSTNLILVQNGLGVLELLRDEIFTGKSSRPQLFQGVISHGVYLEKGYIYN
                     HAGWAPMKIARIPWEETGIIQRKKDAQADRAENELVALLMEQPFAQFFGTQHMTYQEL
                     LVGQLYKFLVNACINPVTSIMDSLNGEIVDDCSDIFTLIVDECLQVLELSYSRIFNYE
                     DVYQNQKEYPDMKVKSVLNTEHMVRQIIEIGCVINAKNSSSMRQDTLYLRDTEIEYIN
                     GYIVKLASRFKIEAKTNRAIVSLVNLRLGLNRRRANVGD"
     gene            <807394..>809931
                     /locus_tag="HG535_0A04030"
                     /db_xref="GeneID:59234099"
     mRNA            <807394..>809931
                     /locus_tag="HG535_0A04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286296.1"
                     /db_xref="GeneID:59234099"
     CDS             807394..809931
                     /locus_tag="HG535_0A04030"
                     /inference="similar to AA sequence:RefSeq:NP_010596.1"
                     /note="similar to Saccharomyces cerevisiae SUM1 (YDR310C);
                     ancestral locus Anc_5.333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142191.1"
                     /db_xref="GeneID:59234099"
                     /translation="MAKNSEEASNGVDMKKEVNDVDESQSNGGLSLPMIQQELNATSE
                     KFHELEDLLLSRDTTVTATIQDLFNTVKTLSYNQSILENKLDDALKNQINSDVLVNSI
                     NERLNKLSSSMGTITKSFQSSEASNNLSSLASMVPVDNGGDQLMSRPPTVRRGPGRPR
                     KESNLNRTSEYSNHNIQQVKVMLPTGGVQLAKSKRYFTDPSVDSDYSASVKEEPISHG
                     KQVLSSTTSTNNSNVANPIKRKRGRPPKKRTVETVIINENHINEEEDEEEKATTNLTN
                     TNANTASLSNSNLPHIMNADGMLPVEAPSTVNSPAPTTRSSSSSSLPSHEIPSTVATV
                     DSTNYQENHDANHINSENGIVTTRIITPLARKKLLGANIDNDNIVVEISPSNGDGDNE
                     SNINLNRQQRELEKRRDSREKMLVNMKYNDREKAKSFMESNKKLLKAMRDEERRKRMT
                     ALIYDTKSPYPARVLNRLPNSSPSSAQPAKPTEVQPQVPKVEENNQLTKKIGISSILN
                     TEESYAKEESPNEVIGPLKRTRTNEFEEEEEEEDLEDVDESQSGRSIRRRRLSIQMAS
                     PTDETGSNNEMSDGALGKKNESHVSLLLASPIELLCRDGFFYRRNMPNVPITTGAYLE
                     FKFKPKQDELINLRLNQKDFSDKTKQNRMNAHFLKPEIEMETEHAFSILSNTTLTEKY
                     VNSLEYFLMEFRWENKLVGLGLKLRESKRTWQRRKALFALFEFWRDQSREKRNFAGFT
                     ILHAVKEMENYRIFINRSVSWFYNHITLLKMILYDLCDNVDTQWREWMFHKGETIPVL
                     GINDVNEENINEAIDNVLTLDFLDDGSENNQVKSSKVIPPSSHESSV"
     gene            <810116..>810985
                     /locus_tag="HG535_0A04040"
                     /db_xref="GeneID:59234100"
     mRNA            <810116..>810985
                     /locus_tag="HG535_0A04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286297.1"
                     /db_xref="GeneID:59234100"
     CDS             810116..810985
                     /locus_tag="HG535_0A04040"
                     /inference="similar to AA sequence:RefSeq:NP_011929.1"
                     /note="similar to Saccharomyces cerevisiae RPP1 (YHR062C);
                     ancestral locus Anc_5.332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142192.1"
                     /db_xref="GeneID:59234100"
                     /translation="MLVDLNVCWPQKSYQETVTERDVWNVRKTLETLNVLGYTHVAIN
                     FTVNHSEKLPSDPKEVNPIRIEERFGHLMKTTGLKIYSRITLIIDDPSKGQSLTKISK
                     FFDIVSALPISERGVTLATTSLEIDILTFNYGERLPVFLKHKSICSCVKRGVKIEIVY
                     SYALRDIQLRRQFVSNVRSVIRSSRSRGLVISSGAQTPLECRNVLGVVSLIKFLGLPS
                     DKCNRAMGELAALVLLNGRLRNKSYKQTVVVGGGSDSDIVNDITPSTNTENIKIIKRK
                     RQDEQPHVKKVKL"
     gene            <811669..>812793
                     /locus_tag="HG535_0A04050"
                     /db_xref="GeneID:59234101"
     mRNA            <811669..>812793
                     /locus_tag="HG535_0A04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286298.1"
                     /db_xref="GeneID:59234101"
     CDS             811669..812793
                     /locus_tag="HG535_0A04050"
                     /inference="similar to AA sequence:RefSeq:NP_010595.1"
                     /note="similar to Saccharomyces cerevisiae GIC2 (YDR309C)
                     and GIC1 (YHR061C); ancestral locus Anc_5.331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142193.1"
                     /db_xref="GeneID:59234101"
                     /translation="MATGFELPQMRSIWLDEDQDAEKLYAQQFMGSDEEDSVAIKMVN
                     SDKPLLNNKKRIELPPLSKNSMMKCFETSPSVTPMKKKKRKGLLGFFKGKEIVQAKRI
                     STPFAFQHISHANTKAGFESDQDDGEKEDNSPTVPIETSDKQGPLHKAFVTQSIPEEY
                     KDTNKISDRKRASMISRRSLSGSISTHSSNNSRSSAGRIVSSSTMATSIHHESSSSPS
                     RLTLLNIMEKSNGKFNATTSDKESNVSLDFLKNYNFPTLLDPKTANQGPHDSNSNITP
                     IIEVAVSEMNSIKIDDLNNDDDGDSDEEEEDLRSIHSLPVVNKTNSYLKSSRTPDIEN
                     EWFGENTRKSVDDILLCYHTPSESGSFVQSPFTSPKKSIV"
     gene            complement(<813093..>813599)
                     /locus_tag="HG535_0A04060"
                     /db_xref="GeneID:59234102"
     mRNA            complement(<813093..>813599)
                     /locus_tag="HG535_0A04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286299.1"
                     /db_xref="GeneID:59234102"
     CDS             complement(813093..813599)
                     /locus_tag="HG535_0A04060"
                     /inference="similar to AA sequence:RefSeq:NP_011927.1"
                     /note="similar to Saccharomyces cerevisiae VMA22
                     (YHR060W); ancestral locus Anc_5.330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142194.1"
                     /db_xref="GeneID:59234102"
                     /translation="MTKDMMNDDSYIGLLKLLAKYDLLLEQFQKSMADGFYNLGRANY
                     HNKDSLRGRYGMDYWDRSYEGQLVADIDGRGDVNITKREIIDTENEEKSEASNSQIRR
                     RNRGDNEEKKKKFKQTDPLSMFGGSLTAPMSLRQSQSNFKSGIPLMVELINCKNSIHQ
                     LVKTIGED"
     gene            <813743..>814210
                     /locus_tag="HG535_0A04070"
                     /db_xref="GeneID:59234103"
     mRNA            <813743..>814210
                     /locus_tag="HG535_0A04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286300.1"
                     /db_xref="GeneID:59234103"
     CDS             813743..814210
                     /locus_tag="HG535_0A04070"
                     /inference="similar to AA sequence:RefSeq:NP_010594.3"
                     /note="similar to Saccharomyces cerevisiae SRB7 (YDR308C);
                     ancestral locus Anc_5.329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142195.1"
                     /db_xref="GeneID:59234103"
                     /translation="MTDRLTQLQICLDQMMEQFCATLNYIDKNHDFMPVDESEAKMAD
                     KHAVVAPPEEFSNTIDELSTDIILKTRQIMKLIDSLPGVDVSAEEQMHKIDVLQKELV
                     KVEDQKIEAIKEKDKLQKDVSEMIKFFAGGIAESREALVSTATKDSLQIGGNA"
     gene            complement(<814258..>816243)
                     /locus_tag="HG535_0A04080"
                     /db_xref="GeneID:59234104"
     mRNA            complement(<814258..>816243)
                     /locus_tag="HG535_0A04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286301.1"
                     /db_xref="GeneID:59234104"
     CDS             complement(814258..816243)
                     /locus_tag="HG535_0A04080"
                     /inference="similar to AA sequence:RefSeq:NP_010593.3"
                     /note="similar to Saccharomyces cerevisiae YDR307W;
                     ancestral locus Anc_5.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142196.1"
                     /db_xref="GeneID:59234104"
                     /translation="MSKHYSGEAQELDKRSSELDGPFRKYEPANIYWIKRVGRLDVVD
                     IALGLSIAVGFSAYVISYHSDLQRQGLTDRETELYDAIGYYKQNKFYLGPLPPFGFLL
                     YSFFSYEVQDMRMISLYFASATLSLFYWVLRRTNTSRILALFGVFSIAYLPLFRSEAS
                     SVTLETLQWLFFAMSFLFWQNVKCSKNLSRSWICHLAGLGISLGLAMSTKFIGLFTWI
                     WIITLVLINFWNVMGDVNMTTCQLACYAVYKFFFLGLIPFAIFTSCYVYELNSWRNDS
                     PEFSSYMSREFKTFLRGPHDYPKHLYYGSVITLRHLDSLGGYLHSHNFTYKGGSQEQQ
                     VTLIQLEYDHENEWIIEHSNPALNIGPRFRIVHDMAKIKLRHRSTGLLLRASSAKPPV
                     TEQEYDLEVSCTGGYDYVGDSDETWLINAINGAVRDPIEPLNAILRFTNEGHKCQMIA
                     HDIRLPDWGFNQQEVLCLEHATMNRALFQIDQVKPDPSRSTECTTYFGETKELFKYFK
                     LIVELLKKQYKYNYYEKNYKQEGPIKPETWPVYISRDRYVDSIWCSSLISLLVFGIFE
                     IIQAWRYNPWKDSSNNQESMNRKIYQDFGITCSIGWFLHFYPLLKSPHDNVEIVQYMP
                     SLFMGLLSVFQTFTMSYHLHPLIFLCICCYIIFVIYY"
     gene            817189..817261
                     /locus_tag="HG535_0Atrna3V"
                     /db_xref="GeneID:59234632"
     tRNA            817189..817261
                     /locus_tag="HG535_0Atrna3V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUG"
                     /db_xref="GeneID:59234632"
     gene            <817995..>818861
                     /locus_tag="HG535_0A04090"
                     /db_xref="GeneID:59234105"
     mRNA            <817995..>818861
                     /locus_tag="HG535_0A04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286302.1"
                     /db_xref="GeneID:59234105"
     CDS             817995..818861
                     /locus_tag="HG535_0A04090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142197.1"
                     /db_xref="GeneID:59234105"
                     /translation="MSSKPVVAIVGPNGLLGKPVIDAFTSEKFSKNFELPIRVVSRKA
                     SGEATNLIKHYQAADVESYKKAFEGADVVISLLGGPSDEILEAVIAAKPGLYIPSQFG
                     TDLTKPMYLPLLDGKVKHSEAARKAGLKVVDVYTGLFSAKGSFLHEIVGHVGADPKTG
                     KVTYISDPEAKFNYTTLEDAGNTLAVLASMKPSSIPDTVRVYSGLTTQKAVVKVYEET
                     HGVIFEPSIISLEEGVAKLHEDFKKNDPNMFFLFLQVIAAAGDGKGLVFLTDNDREFV
                     NPHESLFKWGKF"
     gene            complement(<819793..>821646)
                     /locus_tag="HG535_0A04100"
                     /db_xref="GeneID:59234106"
     mRNA            complement(<819793..>821646)
                     /locus_tag="HG535_0A04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286303.1"
                     /db_xref="GeneID:59234106"
     CDS             complement(819793..821646)
                     /locus_tag="HG535_0A04100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142198.1"
                     /db_xref="GeneID:59234106"
                     /translation="MNINDITSMLSNGPVRSKNQKLEGQTYEITEITHQEDDTPPDKW
                     WEKVCRFLEVKQHHEGSTTRAEGIIESYLFNDDLAPVEEKRRVWSWKEFVLFRISGGF
                     NVNTWQISATGLQLGLNWWQTWLCVWFGYVFVACFLVLASRVGSSYHISFPISSRMSF
                     GVYFSSWIILNRVVMACVWYSTIAWIGGDCVQLMLESIFGTNLSTRIRDTINTSNLTT
                     YEFMCFMLFWGASLPVLSMPPHTLRYLFRVKSSITPVAAFAFMIWTLKKSNGQLALGS
                     LNRRTLEGSELAWAVIRAIMSALDNFATLILNVPDLSRFAKTAKSATYSQFFVLPLCY
                     SVISLLGILATSAAYTMYGVNYWSILDIMQRFLEHFTAGNRAGVFLISFAFAIGQLGT
                     NVSSNSISAGTDMTALLPKFINIRRGSYICAIISLVICPWNLMASSSKFTSALSAYAV
                     FLSSIAGVVAADYFVVRKGLVDLQHCYSNHPNSFYMYGNRYGTNWRAVVAYLLGMVPN
                     FPGFIGSVGGGYVPVGAMNLFRLNYFVGWLVSFIIYSILCYYWPVPGMPEGVSYFDFS
                     HFYEHWVEVDDFAAERRFYLSKLEAESSDCSGGSASETSVAPVELHSVEKV"
     gene            <822399..>824357
                     /locus_tag="HG535_0A04110"
                     /db_xref="GeneID:59234107"
     mRNA            <822399..>824357
                     /locus_tag="HG535_0A04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286304.1"
                     /db_xref="GeneID:59234107"
     CDS             822399..824357
                     /locus_tag="HG535_0A04110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142199.1"
                     /db_xref="GeneID:59234107"
                     /translation="MISLSTITALLCANSVVLASAIPKGGKRALERILDSSLMLSDSS
                     IVESIVATLEDASNSNDTCGSCINRLAIGKSLALVRPDLIPESFENWCVKTAYASNET
                     CNTNFARNTIHSGTTGSNFADMLQLMDPFGYDGTLYCHYKEVRLCPKPVTPNITLSHL
                     WPPKQPRHFVAPEPSANDTFNVLHISDFHVELDYKVGAEANCSRSMCCSPHSVNRIKK
                     ESEGSYRGVWNSFYEGSYYDDRNMSYVKGKYVDIFQNSSIWAPATTFGNYQCDSPEVL
                     INSSLNSISEYSNANNVDFEFAIFTGDLVDHDETRYTDYRLTVESEEIVLRDLKSRLK
                     SIPVYTVLGNHDNYPYGELGQEGYGFSNKFTWNAELLADIYEDYNWLDAPTARYARKH
                     YTGFAVDTKMGLKVISLNSNCFYRRNHYAYWNATNPDSFGQWEFLINELVQSEALDQR
                     VWIIAHIPPATDGLPLPSKIFTEIIERFSPYTIAGVFFGHTHYDQFNLLYAGNGSHTI
                     ENVVNFAWISQSVAPFIGNNPSWRYYKIDKKTFSVMNGFNFYTKLNETYNNDGNEPIW
                     EFEYSSREGYNISWPAESPLNGSYWHLVAEKVRDDLSYRQLYENYSKRWTPAVPNCSV
                     VGNCLTDYCTLSNFNLDDFEACVAEVHQ"
     gene            <825496..>826824
                     /locus_tag="HG535_0A04120"
                     /db_xref="GeneID:59234108"
     mRNA            <825496..>826824
                     /locus_tag="HG535_0A04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286305.1"
                     /db_xref="GeneID:59234108"
     CDS             825496..826824
                     /locus_tag="HG535_0A04120"
                     /inference="similar to AA sequence:RefSeq:NP_010592.1"
                     /note="similar to Saccharomyces cerevisiae YDR306C;
                     ancestral locus Anc_5.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142200.1"
                     /db_xref="GeneID:59234108"
                     /translation="MANKSRPKKVLAPYRKYVAGQGFEHTRGFASPSIDKDEEVEHKL
                     PEDKSIEIINTPQGQYYYRTSTDTVVHIRGPSRTKQIAQDDESIIQIETRSMRLPWEI
                     QSKILHILKEEIDLRYLLVCKRWYFICLSFVYGHPHLSSRNFSKFVDTVISNRKKKFG
                     EYVMELDLSTILQSGKNSYVSKLLRRCSSKLEKFTAPQTSFGYAPLISLKSCHQLKYL
                     DLGLVSETVKLKELFVAIQNFKHLTHLSFPRSSINCDGFREFQWPANLQYLKLSGGIT
                     NEFLRGTQWPKTISTLEFSFCPQVDEIAVYTVLSQIGDVLQHLYFHYPMPSLNENSLD
                     HVFRYSSHLISVQFMVDYTTKWAFSEHLLTELVYPRPLKTIYLDCSGSLGLASKIHPD
                     DFTIALMESRLPCLKAISVSSKLGWDMKSDEVTDLVSVIEDQGGSIYLTY"
     gene            <827012..>827572
                     /locus_tag="HG535_0A04130"
                     /db_xref="GeneID:59234109"
     mRNA            <827012..>827572
                     /locus_tag="HG535_0A04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286306.1"
                     /db_xref="GeneID:59234109"
     CDS             827012..827572
                     /locus_tag="HG535_0A04130"
                     /inference="similar to AA sequence:RefSeq:NP_010591.1"
                     /note="similar to Saccharomyces cerevisiae HNT2 (YDR305C);
                     ancestral locus Anc_5.326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142201.1"
                     /db_xref="GeneID:59234109"
                     /translation="MTKAVYFSKFQVTSQVFLKTHYSYALVNLKPLVPGHVLVVPLRT
                     QAIRLSDLSTEESIDFFQTVQLVQKFIYWQYKADSMNIAIQDGPEAGQTVPQLHAHII
                     PRYKANNIGDKIYDKINGWRFQEWENDRREYLKTSATAENSLAKPDCDRKPRTLEDMS
                     KESQDLKARLDLFLEEHSEISFKNFI"
     gene            complement(<827651..>828028)
                     /locus_tag="HG535_0A04140"
                     /db_xref="GeneID:59234110"
     mRNA            complement(<827651..>828028)
                     /locus_tag="HG535_0A04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286307.1"
                     /db_xref="GeneID:59234110"
     CDS             complement(827651..828028)
                     /locus_tag="HG535_0A04140"
                     /inference="similar to AA sequence:RefSeq:NP_011926.1"
                     /note="similar to Saccharomyces cerevisiae FYV4 (YHR059W);
                     ancestral locus Anc_5.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142202.1"
                     /db_xref="GeneID:59234110"
                     /translation="MIGHRFLSVGSPVLRSSIVKLRTVPKQSSEIPDVNTFLAKIGRK
                     CEEASEVYQNNWQNLFEWDSRTLKEKGVSVQQRKYILHQVEKLRKGEPIREIKKGEKS
                     FFGGERKRKETIAKWRAQQDSQK"
     gene            <828223..>829113
                     /locus_tag="HG535_0A04150"
                     /db_xref="GeneID:59234111"
     mRNA            <828223..>829113
                     /locus_tag="HG535_0A04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286308.1"
                     /db_xref="GeneID:59234111"
     CDS             828223..829113
                     /locus_tag="HG535_0A04150"
                     /inference="similar to AA sequence:RefSeq:NP_011925.1"
                     /note="similar to Saccharomyces cerevisiae MED6 (YHR058C);
                     ancestral locus Anc_5.324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142203.1"
                     /db_xref="GeneID:59234111"
                     /translation="MNTQLDELQWKSPEWIQAFGLRTDNVLDYFSESPFFSKTSNNQV
                     IKMQKQFSQMPLQPDTKQDLQNKSTQEGQNQINGVITSTTSQQLEQSEFTHLDAMRRD
                     ILNRYPAYAMLERELMKMTGVEYVVGCIREPDFWIIKKQNRLAPTQIQVLQDYYIIGA
                     NVYQSPTVLKIVQSRLMSTTLHLSKTLQQLQTLTEFQPAQGVQFKRSKNLAVSPSSNA
                     NAPGSLSSNNSAAATMAANNNMPSSTAATAQTGYTVGTGTVGTSQLDQNGQNQTNNVI
                     TQEMMQKLMFISVKSQPEFI"
     gene            <829289..>829888
                     /locus_tag="HG535_0A04160"
                     /db_xref="GeneID:59234112"
     mRNA            <829289..>829888
                     /locus_tag="HG535_0A04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286309.1"
                     /db_xref="GeneID:59234112"
     CDS             829289..829888
                     /locus_tag="HG535_0A04160"
                     /inference="similar to AA sequence:RefSeq:NP_010590.3"
                     /note="similar to Saccharomyces cerevisiae CPR5 (YDR304C)
                     and CPR2 (YHR057C); ancestral locus Anc_5.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142204.1"
                     /db_xref="GeneID:59234112"
                     /translation="MKVFSFIFSAIAVFSAVVLATSDPKVTHKVYFDIEHGGKDVGRI
                     VIGLYGETTPKTAENFYELTISRDPEMGYLGSSFHRVIPQFMIQGGDFTQGTGTGGQS
                     IYGATFEDENFDIKHDKPGRLSMANRGKNTNGSQFFITTVPTPWLDGRHVVFGEVLEG
                     MDTVKYIESVPTSRGDSPVEKVTIAACGELETVPVRDEL"
     gene            <830491..>832995
                     /locus_tag="HG535_0A04170"
                     /db_xref="GeneID:59234113"
     mRNA            <830491..>832995
                     /locus_tag="HG535_0A04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286310.1"
                     /db_xref="GeneID:59234113"
     CDS             830491..832995
                     /locus_tag="HG535_0A04170"
                     /inference="similar to AA sequence:RefSeq:NP_010589.3"
                     /note="similar to Saccharomyces cerevisiae RSC3 (YDR303C)
                     and RSC30 (YHR056C); ancestral locus Anc_5.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142205.1"
                     /db_xref="GeneID:59234113"
                     /translation="MDIRGRKMKKPPACVQCRRRKIGCDRAKPICGNCLKNGKMDCFY
                     PDVPGQYVQSNTSSSATSNNHTQTHPHSHTHNHNHSHARESSGAELHHNPELASMEQI
                     REYNTRLQLLNAQQHRATPGPMENAQFIPRTMPNFENKPVTSANGSGLHLNWVQGPAI
                     FDIMTSPYTQEEVLLKEMDFLRSRMLELQELTGKKCGLNLSWNSDLDGDFNSDMSKET
                     HDKQIDHEDHQNESDEPSLKRLKFAMDEFRDLDPEFLDARQVFTVFNNFKSYDHINQL
                     NPMTDSPNSIFNIRFMIARDEFLNQFYKKFNKVSKENFSDEINILLKNKTPQPPRNDQ
                     SIRFPMRSVTQEAITKYISVVPDTNALIPILKPRELIVSIEQLFGRDPIFSSNKLELS
                     QLVTVGQITICLLLAYEALSSSVLIPLRDEQQIMFLQLKDFVPILKNNLLLVKSELDR
                     RGNLTSTIDVLKYIALWKYYQSVSDVCDNDSYDGDEDVHLARQLSINHETNNQLWILL
                     WNFIFKNYCWRHLFKGEMPALVAGTELNSATVIDPLLNNDFSLLNFQIGMVKYLQSKD
                     MMISMLKVLALKDMFRVKINDQNKKCFTTASIINSVVDSIIYRNSMLFLTYYLLLQYE
                     QLRDTEKFNDHYKEFLQLVQETLFYVFSNLANLKFAGYEFIFAKKSFITLDNICHMIL
                     GIYQRSDQLLKTQSLTDDNPKQESQQSEALVLLLRKILMLLQDYAKNRKVDSPLLTKL
                     VRKLTTILEYIALSEKNPATVAFNSSDKKNSVPNALQSLDSSNLTKAVAKLRGISESL
                     IKSDFYNQRKPFEVTNPQTLGLTKENFADIYNSFYS"
     gene            <834329..>835141
                     /locus_tag="HG535_0A04180"
                     /db_xref="GeneID:59234114"
     mRNA            <834329..>835141
                     /locus_tag="HG535_0A04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286311.1"
                     /db_xref="GeneID:59234114"
     CDS             834329..835141
                     /locus_tag="HG535_0A04180"
                     /note="ancestral locus Anc_5.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142206.1"
                     /db_xref="GeneID:59234114"
                     /translation="MNKLVGVCSKKNPIKRLFVQSIRSYSNEGVVVSDFATKKKGTGK
                     GPFIELPELKSLQDSILIKLPSSCTIYGNLKNFNAISPDPRANGQTVLERAYDKQTGL
                     SKLSTGQYPLNMIMLSPASMSSTAIIKIDSYTKGLFVPNFFKSTLCYGGDLSLDNQSG
                     EVKGLGIVALAGEGPVYKMILSKIDTIMVSKETILAYDSNIKVHSVTLGSYYSFPIRL
                     KTFFKKLPSPYSEYLTSLCDKIFNRDKSFCKINGPGILFLQTQSMRTPTNHA"
     gene            complement(<835217..>835864)
                     /locus_tag="HG535_0A04190"
                     /db_xref="GeneID:59234115"
     mRNA            complement(<835217..>835864)
                     /locus_tag="HG535_0A04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286312.1"
                     /db_xref="GeneID:59234115"
     CDS             complement(835217..835864)
                     /locus_tag="HG535_0A04190"
                     /inference="similar to AA sequence:RefSeq:NP_010588.1"
                     /note="similar to Saccharomyces cerevisiae GPI11
                     (YDR302W); ancestral locus Anc_5.320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142207.1"
                     /db_xref="GeneID:59234115"
                     /translation="MPVKKRRTVKKTVSFSDDNTFATKSSKKKHIDHDSPPVYVRKTI
                     STIPAHLPALLFYYLYTTESYNTWKLLHLVIPLQVFYLVFQFNKAAVYGNKRLKINVT
                     LVLLSLIAAFLLSLPTMLIIILFGAPSIQKLKETWLLSLHCCYLAYPVVYQVFNCDFK
                     VGLWKRYFILIAVGAWSSCVVIPLDWDRDWQEWPIPIVVGAYLGAFFGYGFGSYI"
     gene            complement(<836070..>840038)
                     /locus_tag="HG535_0A04200"
                     /db_xref="GeneID:59234116"
     mRNA            complement(<836070..>840038)
                     /locus_tag="HG535_0A04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286313.1"
                     /db_xref="GeneID:59234116"
     CDS             complement(836070..840038)
                     /locus_tag="HG535_0A04200"
                     /inference="similar to AA sequence:RefSeq:NP_010587.1"
                     /note="similar to Saccharomyces cerevisiae CFT1 (YDR301W);
                     ancestral locus Anc_5.319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142208.1"
                     /db_xref="GeneID:59234116"
                     /translation="MNIYDDVLDATVVSQSVTGHFTTREYEELLAVRTNILCIYRYTD
                     EGKLFLTKEFRFHGKITDIGLVPLPNSNLDCLLLGTTTAKLSIVRYDDALGSIETLSL
                     HFYEDKFKDISLFEMAKESQLRIDPGKNCIMLFNNDAIAILPFRTSNADEDEDEDDDD
                     YDEIRKPKKAKTNKDRITEASSIFLAKELHKEIQNVIDIQFLAGFTNPAVAVLYEPKL
                     GWAGNSKLVPHPVSYIILTLEMVLNELNTNVDGTVIGKVEELNWDFHTLIPISNGCII
                     AGTNELAYVDNTGVLQSMILLNSYSNTEFKKGRIIDKTKSEILFNKPIRFSWSLSDKD
                     NNVNQILLLIDHQTNFYYVQLESEGRLLTKFDIFKLPIVNETLKWNTNCTCISPLRDL
                     SDGQTMVLFMGFLSGDSQVVKLNNVKSAVETRDEHKPFLETVDDDDDDLYADENSISE
                     DNKEVVVETVQPFDIEILSSLRNIGPITSLTTGKVCSVEKWVKGLANPNKDEFSVVGT
                     SGNGSGSHLTEIQESVRPEVELALKFISITQIWTLKIKGVDKYLVTTDSNTKKSDIYR
                     IADNFAIHKEGRFRKDDTTVYISMFGEKRIVQVTSSNLYLYDSNFRRLTTMKFDYEVV
                     HVSVMDAYILITVSRGDIKIYELDSKHKKKLSKVELPEVLKEMVITSGVILKSNMCNE
                     FLTYLQDCEEEQLLFTFVTADNQIIFFGKEHNDRIFQFNGVDQLNEMLYISTYQLPEE
                     VIPDPSIKQVMINKLGHNNREEYLTILTFGGEIYQYKKSASRHSRFHKNANANDIKIT
                     GAPDNAYAKGVSSIERIMHYVPEYNDFSVIFVTGSVPYVIIKEDDSNPKIFKFANIPL
                     VSMTRWGKKSVMCVDDIKNARVYTLDCHDIYYGNRLPIKRIRISDVLEDYETLTNVTY
                     HEKTELFIVSYAKRIDYDALGEDGERLLGYQENAPHASGFQAGILLVNPKTWNVIDKK
                     EFGANTIINDARTMLIQLDSKTRRKREYLVLGVAIVGTEDLPPSGSFAVYDITEVVPE
                     PGKPDTNFKLSEIFHEEVRGSVSTVCEISGRFLINQSQKVLVRDVQEDNSVVPVAFLD
                     IPVFVSDAKSFGNLLIIGDAMHGFQFVGFDAEPYRMIPLGRSITKLETVSIEFLVNGG
                     EIYFAVTDTDCILHVFKYSPDEPNSLSGQRLIHCTSFNLHSSNTALCLIPKSEAFPAT
                     AKNPSTFQVVGAQTDGSIFKILPLKEDAYRRLYVVQQQFNEKDIQFGGLNPRMERLSN
                     VHYIHTHVLRPMLDNNIIKKFSMVCIDRRKQIAQRAGRRAYLEIWRDLIDIEFSLRSL
                     CE"
     gene            <840524..>841792
                     /locus_tag="HG535_0A04210"
                     /db_xref="GeneID:59234117"
     mRNA            <840524..>841792
                     /locus_tag="HG535_0A04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286314.1"
                     /db_xref="GeneID:59234117"
     CDS             840524..841792
                     /locus_tag="HG535_0A04210"
                     /inference="similar to AA sequence:RefSeq:NP_010586.3"
                     /note="similar to Saccharomyces cerevisiae PRO1 (YDR300C)
                     and YHR033W; ancestral locus Anc_5.318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142209.1"
                     /db_xref="GeneID:59234117"
                     /translation="MMSNSYTIVIKLGSSSLVDETTKEPKLSIMSLIVETVVRLKRLG
                     HRVIIVSSGGIAVGLKILNLEKRPKRLSEVQAIAAVGQGRLIGRWDRLFAEFDQRIAQ
                     ILITRNDIADWSQYKNAQNTIDELLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITAA
                     LIGADYLFLLTDVDCLYTDNPRTNPDAKKILIVPELARGLPGVNTSSGSGSDVGTGGM
                     QTKIIAADLATNAGVHTIVMKSDAPANILKVVNYIQSLDLDKESPPDYTEDLQELQGH
                     ELKRLEELNVPLHTKFIANDHQKHLKNKEFWLLHGLVSGGAIIIDKGAYAAITRKNKA
                     GLLPAGVIDVEGHFHEMECVDIKLGKRSQDGTLDPTVPLKTVGRARPNYTSTDLSKIK
                     GFQSEKIEDILGYSDSEYVAHRQNLAFPPH"
     gene            complement(<841860..>842897)
                     /locus_tag="HG535_0A04220"
                     /db_xref="GeneID:59234118"
     mRNA            complement(<841860..>842897)
                     /locus_tag="HG535_0A04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286315.1"
                     /db_xref="GeneID:59234118"
     CDS             complement(841860..842897)
                     /locus_tag="HG535_0A04220"
                     /inference="similar to AA sequence:RefSeq:NP_011899.1"
                     /note="similar to Saccharomyces cerevisiae PIH1 (YHR034C);
                     ancestral locus Anc_5.317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142210.1"
                     /db_xref="GeneID:59234118"
                     /translation="MDFLLRPTDNTGADSIITILPSPGFVIKSKLVSTQNRQSNLTHL
                     EPNVKIFINVCHEASVPKPDIDFDPNVVYPLIMENQWEIPIVTSAIRDDKDKKGSPCY
                     VWDCCINTICMNWISVNIQLRDILVEWCLESCEISDTVEISRDALSFPKMKKKGEIIP
                     PLEILSDVLKKDYRMDLISFAEDEKNDPASILKLKRDLFTEETNNSLDDSDGKSLPSL
                     FPNTSNYTSEKPLIQEIDDLTLNEIKNKKSIISQETPEIHFEVNIRKTNNRKDYKLRI
                     EVLSEIESASSLLVRYQQEDNSLFIKNTNLDFYKEKKLEIPLPSIFSKADAASMRCFF
                     IIGEKKLIIFI"
     gene            complement(<843120..>844715)
                     /locus_tag="HG535_0A04230"
                     /db_xref="GeneID:59234119"
     mRNA            complement(<843120..>844715)
                     /locus_tag="HG535_0A04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286316.1"
                     /db_xref="GeneID:59234119"
     CDS             complement(843120..844715)
                     /locus_tag="HG535_0A04230"
                     /inference="similar to AA sequence:RefSeq:NP_010585.3"
                     /note="similar to Saccharomyces cerevisiae BFR2 (YDR299W);
                     ancestral locus Anc_5.316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142211.1"
                     /db_xref="GeneID:59234119"
                     /translation="MGNLLADQIIEISNRPVNADYDIEDNDVGVFEHRDDRSSGDESD
                     GSADDAGSKNQKDHYVSVGNSKLRDDGMELDGGKYHGAKGSRHELFDDGLEEGIPTEE
                     ESAQESDAVSWRTDSEDEADSDRESSSGEEVEAEQDEEVEEESEVKRDRLAEMVEQET
                     RKAVKKLSETTQRDAAKGLCIIEQSQLFDSILDVRMKLQKGIAAANNLPLSENSWSYY
                     ESQSPETEKLLKKTSKLLEKLLGQMVDFRKEFQINDNISPSSEEKHGKSQKKRSISQL
                     TKDTAGLDDELMEYRSAVLNKWSTKVNAASGKSALNSSKFKAINQPSDVQVENQLSDM
                     DRLIKRTCLSRRNTRPLRFQEDLKCGRLSLLEPPEDKEDSKNDPGEDIDIPKNYDPRR
                     KDDTSIDTSENPYIFDDEDFYRVLLNDLVDKKILNAKNSQGSSATIAITSRSNNKLKK
                     NIDTKASKGRKLNYSIQEAIANFEAPRDLGYKWSDEQIDEFFAGLLGQKVSFDEVEDH
                     SGNENEDAQESSAFKNDDIQIFG"
     gene            <845275..>845898
                     /locus_tag="HG535_0A04240"
                     /db_xref="GeneID:59234120"
     mRNA            <845275..>845898
                     /locus_tag="HG535_0A04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286317.1"
                     /db_xref="GeneID:59234120"
     CDS             845275..845898
                     /locus_tag="HG535_0A04240"
                     /inference="similar to AA sequence:RefSeq:NP_010584.1"
                     /note="similar to Saccharomyces cerevisiae ATP5 (YDR298C);
                     ancestral locus Anc_5.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142212.1"
                     /db_xref="GeneID:59234120"
                     /translation="MIFGRVFSRSLAASAKAGIKPPVQLFGLDGTYATALFTAASKSS
                     SVESAAKSLATLTQTVEKDPKLKEILLNPALSAQDRNLVVKTLSQQARIDSTVANLLS
                     VLAENNRLDLFTKVGTQFATLTDAYNGLVKATVITAQPLDVKSLKRIEKAVGQSSLVG
                     QSKTLKLENSVRPEIQGGLIVEIADKTVDLSISSKIQKLNKVLEESI"
     gene            complement(<846088..>847074)
                     /locus_tag="HG535_0A04250"
                     /db_xref="GeneID:59234121"
     mRNA            complement(<846088..>847074)
                     /locus_tag="HG535_0A04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286318.1"
                     /db_xref="GeneID:59234121"
     CDS             complement(846088..847074)
                     /locus_tag="HG535_0A04250"
                     /inference="similar to AA sequence:RefSeq:NP_010583.1"
                     /note="similar to Saccharomyces cerevisiae SUR2 (YDR297W);
                     ancestral locus Anc_5.314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142213.1"
                     /db_xref="GeneID:59234121"
                     /translation="MNVSSGFDEAYKVKGMFGYMHSDVAPEVILRPKADILSFIPDNV
                     LTLALPVVAYWALSLIFHSIDVLHLAEKYRIHPSAEVAARNRVGRIEVLCEVLFQHIV
                     QSVVGFVTQIWDTPPMTGYEERALWKWRQYLPSSIPDAAIYVGYMYGFSAVKLLVGFT
                     FIDTWQYWLHRLMHTNSTLYRMFHSRHHRLYVPYAYGALYNAPVEGFLLDTLGTGIAM
                     IITSLSYREQMVLYTFATLKTVDDHCGYALPWDPFQFFFPNNAVYHDIHHQNFGIKTN
                     YAQPFFTFWDTLFGTYFKGFEDYQKAQRRVTIDQYKKFLDERKKKSQPGKTE"
     gene            complement(<847650..>848315)
                     /locus_tag="HG535_0A04260"
                     /db_xref="GeneID:59234122"
     mRNA            complement(<847650..>848315)
                     /locus_tag="HG535_0A04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286319.1"
                     /db_xref="GeneID:59234122"
     CDS             complement(847650..848315)
                     /locus_tag="HG535_0A04260"
                     /inference="similar to AA sequence:RefSeq:NP_010582.3"
                     /note="similar to Saccharomyces cerevisiae MHR1 (YDR296W);
                     ancestral locus Anc_5.313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142214.1"
                     /db_xref="GeneID:59234122"
                     /translation="MSYRGNWAISKFRPASWLEKCGYAPQIFVFRNLESGQVIYSQFP
                     NFSQRQIERLFQRPNWENKMPSARRDIWRCMCVVDMPNYESSVQLYQNLRRLRYLRDV
                     SNAKEANLLRKKNEDGNVWYSMQYRPTYTQEAVADLRECLLKSGQGANGIKVHWEDPW
                     RMGDKAKWWTPFLPNVKHVTMNRLGNTAREESALLRELGDKAKEEFAKHKEQKTLAAS
                     ISL"
     gene            <849408..>851345
                     /locus_tag="HG535_0A04270"
                     /db_xref="GeneID:59234123"
     mRNA            <849408..>851345
                     /locus_tag="HG535_0A04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286320.1"
                     /db_xref="GeneID:59234123"
     CDS             849408..851345
                     /locus_tag="HG535_0A04270"
                     /inference="similar to AA sequence:RefSeq:NP_010581.3"
                     /note="similar to Saccharomyces cerevisiae HDA2 (YDR295C);
                     ancestral locus Anc_5.311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142215.1"
                     /db_xref="GeneID:59234123"
                     /translation="MNRSSRNTHVYYLPVGLTNFQQDLIEILISLHAKYFIREISAVD
                     EHDNDNGVEETTMYPKLSSKKMTYVFDHNIRAVANHPCLLVDHYMPRQFLRMEPNEKL
                     INSSDKFQKFQQLLYHIIHRDRVKYPGILKIALISHSVRELDLLEGLILGETVRIKRL
                     SGTSLYDEKHVYFEENQNRGQDMNDSKDGTPSVESSSNSYTGYPRDDYDYSAKRKLRK
                     QKPVAEDWLFLTTTTHLINDSSLLKDYDCDYIISFDPLLDPSLPALTPLNMKASKRIP
                     IIKILVVDSPDHYILANTSTDDSVEYELLKNSIDYFLRSRHLSESNNETKAPIDYKQL
                     VRLLLSDQPITSALPDIDLSGTDEGAEPYQPRLSSLTYGNSQLSIDETDFDMKSYQSE
                     LMKKTVDRLMEIQKETKENTRVLVGKRGRETERQNLLDELKHEIGVKFKTLEDRKKTQ
                     NDTEKKLERFQTEADKLDRRLKTLQEMQRELKAIVNLSQEDAQKKVDEYKEETVRLKG
                     EVDHWEKSNNEKSDQNDNLRLEYQQKSSRAVEVAQQLTASKTAVEQSQKDLKGPAAEL
                     ELKSLLAKKRALADQEKLTKNKNKFLKSYINKMSSHYGFKLSANGDWNPHSNSGTPSN
                     SRSSTLASRHKSTRSNTPTYT"
     gene            <851581..>853311
                     /locus_tag="HG535_0A04280"
                     /db_xref="GeneID:59234124"
     mRNA            <851581..>853311
                     /locus_tag="HG535_0A04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286321.1"
                     /db_xref="GeneID:59234124"
     CDS             851581..853311
                     /locus_tag="HG535_0A04280"
                     /inference="similar to AA sequence:RefSeq:NP_010580.1"
                     /note="similar to Saccharomyces cerevisiae DPL1 (YDR294C);
                     ancestral locus Anc_5.310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142216.1"
                     /db_xref="GeneID:59234124"
                     /translation="MLQDNAALDGYRSYLPNNLWQIQWQQVPTAIYDKCPVYVKTHTW
                     IELLKDYLLFLLFYKIIKKVLYELKWYGIIGSASRIYRTCIAGVFRWLLNTTILKSSV
                     EKELKKVTIAMERELIKNDESLADYETIPLKGLSEEEILEELDKLDTIIPHTEWKEGK
                     VSGAVYHGGDELIHLQSEAFEKYCVANQLHPDVFPAVRKMEAEVVSMVLNMFHAPADA
                     GCATTSSGGTESLLLACLSAKMYAYHERGIIKPEMIVPVTAHAGFEKASYYFGIKIHH
                     VEVDPNTYQVNLKKVKSFINRNTVLLVGSAPNFPHGIVDDIVGLGNLATRYNIPLHVD
                     CCLGSFIVAFMQKAGFNDLPPFDFRVPGVTSISCDTHKYGFAPKGSSIIMYRNSDLRK
                     HQYYVSTDWTGGLYGSPTLAGSRPGALVVGCWATMVHIGEAGYIDSCRSIINAARKLK
                     NCIMQEVPDLEIIGDPVCSVIAFTSHTIDMYELGDRLAKEGWHLSALQKPPALHLAVT
                     KLSVNSVDQLITLLKDITKELRDDPNSKPSSDGTSALYGVAGSVKSTGIADKIVVGFL
                     DTLYKLKPSE"
     gene            <853545..>854951
                     /locus_tag="HG535_0A04290"
                     /db_xref="GeneID:59234125"
     mRNA            <853545..>854951
                     /locus_tag="HG535_0A04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286322.1"
                     /db_xref="GeneID:59234125"
     CDS             853545..854951
                     /locus_tag="HG535_0A04290"
                     /inference="similar to AA sequence:RefSeq:NP_011901.1"
                     /note="similar to Saccharomyces cerevisiae BRL1 (YHR036W);
                     ancestral locus Anc_5.309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142217.1"
                     /db_xref="GeneID:59234125"
                     /translation="MDQFGSLSIEDEFESKLTEDELLSISTLSISDASQRLSANILNK
                     YMQHFPTSPSPLRNSTNFLEAFSDEMDVDEEFVEQDKETITESIHTIEEALPKVTFEL
                     PDIGRKRIEKEKVVEKKGHKEKARVKSKSDKEDNAEEINVNSKQVFKALLSPTSLGIA
                     AATKIEGLPVEYAPHEENESKLAETHNCFTTQTASTGWDSAEIKEELRLRNKTQPIQV
                     SINNHHHYYPSTGGYYTESESAPFIYKQQTGYDRQQDVSMHEYDKLKLPVPWSENSRP
                     FSKHSYDIMSYLQLFLNCITITTIFSFITSFIRTLRKDIKSTWEHRKLELNYESSLCK
                     NHYLANECHIQVRPALKEQCQQWDLCMNRNNDIFFRARSTLSAKLFGEIINSFIEPIG
                     WKALSVVIISIVVWSFCSNFLLGFARAKSYYGAPSRQLLALQQEQQLLQDQSHHQRQA
                     QNRNHEHHHENASRELQH"
     gene            <855274..>857016
                     /locus_tag="HG535_0A04300"
                     /db_xref="GeneID:59234126"
     mRNA            <855274..>857016
                     /locus_tag="HG535_0A04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286323.1"
                     /db_xref="GeneID:59234126"
     CDS             855274..857016
                     /locus_tag="HG535_0A04300"
                     /inference="similar to AA sequence:RefSeq:NP_011902.1"
                     /note="similar to Saccharomyces cerevisiae PUT2 (YHR037W);
                     ancestral locus Anc_5.308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142218.1"
                     /db_xref="GeneID:59234126"
                     /translation="MMLSRTKFLQRSSQSIRCIAQLSQVRVPKQITNEPIKAFGVADT
                     KDWDLLRASLMKFKSSSLDVPLVINGERVYYNDKKSRPYFEQTNPANHKHVLANVTQA
                     NEEDILRAIQASKDAKAKWASMPFYDRAAIFLKAADLLSTKYRYDMLAATMLGQGKNV
                     YQAEIDCITELADFFRFNVKYASELYSQQPVESSAGVWNKAEYRPLEGFVYAVTPFNF
                     TAIAGNLVGAPALMGNTVVWKPSQTASLSNYLLLTVLEEAGLPKGVVNFIPGNAIEVT
                     QHVLNDKDFAALHFTGSTNVFKQLYGKIQEGVVNNVYRDYPRIVGETGGKNFHLIHPS
                     ASIPHAVLSTIRGAFEYQGQKCSAASRVYLPNSKSEEFFKDIAGSLQQHKIQPVNTSA
                     GSISGGDLHGFMGPVIHEQSYNKLVGAIEEAKKDPELEIVYGGQYDKSSAWFVGPTII
                     KTTNPNHKFLSTEFFGPILTVYEYPDNEFSQVCDLINNTSMYALTGSIFAKDRDAILE
                     ASEKLRYSAGNFYINDKCTGAVVAQQWFGGARMSGTNDKAGSGNILNRFVSVRSVKEN
                     FYELTDFRYPSNYE"
     gene            <858491..>862258
                     /locus_tag="HG535_0A04310"
                     /db_xref="GeneID:59234127"
     mRNA            <858491..>862258
                     /locus_tag="HG535_0A04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286324.1"
                     /db_xref="GeneID:59234127"
     CDS             858491..862258
                     /locus_tag="HG535_0A04310"
                     /inference="similar to AA sequence:RefSeq:NP_010579.1"
                     /note="similar to Saccharomyces cerevisiae SSD1 (YDR293C);
                     ancestral locus Anc_5.307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142219.1"
                     /db_xref="GeneID:59234127"
                     /translation="MSNHNQGMSNKSQDNSIVVPTTGGKNNPKHIHVAHRRSQSELTN
                     LMIEQFTLQKQLEMVQAQQQQLLAQQQQLAHQTGQMFANNQPSANNSPINPNFLPPHP
                     HYNNNNSTNNPSGYRSRSHSRNNSGYYDNNMSNSGNANNNNSNNSYTHKKTGSQSSGF
                     GHARRHSLGLNEAKRAAAEEQAKRVAGGITVRVENVSSPLSSSESKGDSEGFSEPQSN
                     FKFPASTSNQQGHRRTNSTNNSGAFKFPPTPQTQLNQKENDNDDFIQVPSGHRRSRSK
                     NTEFSSGINSNWRNQSQTQNQSSPFRHKSSNSRDFNYNSFTNLEPPPVFQAGHKHRSS
                     NSSVHSFNSSNNNNVNNPNARKSLFAPYLPQANIPELVQEGRLVAGILRVNKKNRSDA
                     WVSTEGVLDADIYICGSKDRNRALEGDLVAVELLVVDDVWDSKKEKEEKKRRKDASNQ
                     TDIISLNSSDDYHNDASATANLTAGMPSSTTDDEEQAPSSSNENAEHSPSKVGVRRKN
                     SLKQRPTQKKNDDVEVEGQSLLLVEEEEINDDFKPLYAGHVIAVLDRIPGQLFSGTLG
                     LLRPSQQAHNDNNKPQQVPKIVWFKPTDKKVPLIAIPTELAPKDFVENADKYSDKLFV
                     ASIKRWPITSLHPFGILVSELGEINDPNTEIDSILRDNNFLSNEYLDPKDPTVEKAVF
                     QALPLSEDNVKSRRQFVNKEEYEIIAIGETMNLSELALHIKKQPNGTIELGCHVLDVT
                     AHVEGDSSLDRRARKRSTSVFMPQKSVDLLPQALNKSLTLEKDKASATISIVYTLDVN
                     TFKVKSTWVGESIVRPSSLITIDEVTARCNSRNLDSFLITLKKVATAFYAERLNYPEA
                     TLDSTLSLFESLDDEKVTVDLNILDRSIGSAIMREISLKLERSVAEKIYTKHGDLAFL
                     RRQAQPIHTKMTSFKKKLQKFGYDVDISSPDALIQSILKIKDDDVRRGVEILLYKSMS
                     RARYFIAGKVDPDQFGHFALNLPLYTHFSAPLRRYADHVVHRQLKAVINDQPYNEDLE
                     SLKITSEYCNFRKDCSFEAQEQAIHLLLCKTINDMGNATGQLLTMATVLQVYESSFDV
                     FIPEFGIEKRVHGDQLPLIKAEYDPSNRVLELHWQPGVDSATFVPADERNPKSYRTSI
                     RNKFRSTTAEISSTEFQKSNNNEPIISEKLAQELSNLHLNVPQLRLPEMNKDSDPLGS
                     IIDTTITSQKNDMFIQEIHELQKVPILLRAEVGMALPCLSVRAVNPFLKRE"
     gene            <862799..>863497
                     /locus_tag="HG535_0A04320"
                     /db_xref="GeneID:59234128"
     mRNA            <862799..>863497
                     /locus_tag="HG535_0A04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286325.1"
                     /db_xref="GeneID:59234128"
     CDS             862799..863497
                     /locus_tag="HG535_0A04320"
                     /inference="similar to AA sequence:RefSeq:NP_011903.1"
                     /note="similar to Saccharomyces cerevisiae RRF1 (YHR038W);
                     ancestral locus Anc_5.306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142220.1"
                     /db_xref="GeneID:59234128"
                     /translation="MLVSPSFTRSYALRRCFTTTRSLFKKHSGSKKNGRQSQLEEDET
                     AVVDITEYAKRAQTGFQNSLEVFKKKLNEAKQGVTNPRIFDSLKMPNGIIFTNVASTS
                     LKGKNSLLVTVYDPKDTKNVVSTIMAAGLNLNPEKIPNNDQQLKISLPPPTTESRIKL
                     CKTLKVVFEEYKNSSSKHSLDHVRGEILKELKSLLKKDDSVKKVIQDIEKTHKGYVEK
                     FQNQLKQAEKSIMN"
     gene            complement(<863578..>865521)
                     /locus_tag="HG535_0A04330"
                     /db_xref="GeneID:59234129"
     mRNA            complement(<863578..>865521)
                     /locus_tag="HG535_0A04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286326.1"
                     /db_xref="GeneID:59234129"
     CDS             complement(863578..865521)
                     /locus_tag="HG535_0A04330"
                     /inference="similar to AA sequence:RefSeq:NP_011904.1"
                     /note="similar to Saccharomyces cerevisiae MSC7 (YHR039C);
                     ancestral locus Anc_5.305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142221.1"
                     /db_xref="GeneID:59234129"
                     /translation="MSDIYLNSEMVKQFNMTVQNCLTQWLKREQKFLNYQLQNVVDHT
                     QRNPRVAILTTILAGIFTLYVFYKLVWSSSGRSVVKPVKFSLQIPEAAQVHWKGKRLF
                     PTTVFDSEKPGLIQSYCPATSQYLGSFQSKNIQDVDNMIQRAKKAQEEWRNASIERRL
                     RVLISLQSYILDNQDLIARVACRDSGKTMLDASMGEILVTLEKLQWTIQYGPRVLQPS
                     RRPGPTNFFMKLYKGAEIRYEPLGVISSIVSWNYPFHNLMGPIIAGLFTGNAIVVKCS
                     EQVVWSSEFFIEMMRKCLTACGEDPDLVQLFYSLPPSKNDDTANYFTSHPEFKHITFI
                     GSQPVAHHILQCAAKSLTPVVVELGGKDAFIVLDSVKDLMALSSIIMRGTFQSSGQNC
                     IGIERVIVSDKNYDKLVEILNDRMSKNPLRLGSDIDHLEDVDMGAMISDNRFSELENL
                     VNDAVSKGARLLQGGTPYSHPNYPQGHYFKPTLLIDVTPQMEIAQNEVFGPILVVMRA
                     KDTQDCIEIANSAPFGLGGSVFGASIKECNYVANNLKTGNVAINDFATFYVCQLPFGG
                     INGSGYGKFGGEEGLLGLCNAKSICFDTLPFISTQIPKPLDYPIRSNRKAWSFTKSFI
                     TASYAISLWQRIKSIISLAKSST"
     gene            complement(<865840..>866337)
                     /locus_tag="HG535_0A04340"
                     /db_xref="GeneID:59234130"
     mRNA            complement(join(<865840..866181,866335..>866337))
                     /locus_tag="HG535_0A04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286327.1"
                     /db_xref="GeneID:59234130"
     CDS             complement(join(865840..866181,866335..866337))
                     /locus_tag="HG535_0A04340"
                     /inference="similar to AA sequence:RefSeq:NP_011905.1"
                     /note="similar to Saccharomyces cerevisiae VMA10 (YHR039C-
                     A); ancestral locus Anc_5.304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142222.1"
                     /db_xref="GeneID:59234130"
                     /translation="MSQQNGIATLLKAEKEAHEIVSKARKYRQDKLKQAKSDAAKEIE
                     AYKAQKDKDLKEFESKNAGGVGKLEEEASAQVQGDLKEIEDVVAKKQQDIVRLLVEAV
                     IKPTAEMHVNAA"
     gene            <866624..>867829
                     /locus_tag="HG535_0A04350"
                     /db_xref="GeneID:59234131"
     mRNA            <866624..>867829
                     /locus_tag="HG535_0A04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286328.1"
                     /db_xref="GeneID:59234131"
     CDS             866624..867829
                     /locus_tag="HG535_0A04350"
                     /inference="similar to AA sequence:RefSeq:NP_011906.1"
                     /note="similar to Saccharomyces cerevisiae BCD1 (YHR040W);
                     ancestral locus Anc_5.303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142223.1"
                     /db_xref="GeneID:59234131"
                     /translation="MGTMCEVCGEFEAKYKCPRCFKRTCSLKCSKLHKTQSGCDGKSH
                     DPTVYIESRSLKEADDEAHESNVLVQRDFNFLTNIKREVELKRRDGKTRNKRTLQDSF
                     GSHNNASNKRGRFSSEDCPRIIRRGVNCLVLPRGMQRSMANKSKWDKALDRFVWTIEW
                     VLFPPILDAAPSEVVGNNFSHTSHRIKEDDTLVEAMGKIIYDKCREFYNLRIEEDGTN
                     TETKSTRSQALVKSRLKFYTKWFPYNTMQALDSKKLIELDSSKPICELFRNKTVLEFP
                     TIFTAIDETDLPSEYSVVDGQDFEHAIKGEETTTAHNGGESLSDSDSDSVPLEESYKL
                     VPSKRQTTQIADAAPALEVPQKNELKQASPIKAVPTQSARYSEKEEEDDDSDSDGYDP
                     GITMDFLAG"
     gene            complement(<867915..>869546)
                     /locus_tag="HG535_0A04360"
                     /db_xref="GeneID:59234132"
     mRNA            complement(<867915..>869546)
                     /locus_tag="HG535_0A04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286329.1"
                     /db_xref="GeneID:59234132"
     CDS             complement(867915..869546)
                     /locus_tag="HG535_0A04360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142224.1"
                     /db_xref="GeneID:59234132"
                     /translation="MNDGIPEFDFSDLVARTNYGKNDDAEELHIVETKDEEALDDIQM
                     GQAVVSAGENEEVVKELPEIQVSSSTLKKRDPHIVHLLKRMSLQSTILCIILPLFSLF
                     KIVLSRPQGVTPLFMYFFGFYMIISQISLFGGYHRFFTHQSFQTHIVVQLAYAIFGGS
                     CGLGSVLQFTSQHLAHHRHQDTERDPHSYSVYGWLFSMWGHRFFLGNRKSRRAIQECR
                     NTFVSTSMMVHNKRLKHDGEKEVLLQPPNHEILKVQDENYVSLLLLTLIVIPCLVALY
                     CQVPYWTSVYYLGFVRMSIIQQQWLLLGSLGHIKNLPFATQPFSNIRSAINFPVTFFW
                     QFILFGEANHNFHHEFPSDYTAGSRWYHWDPSKWSIWILYQFGLVNHLHATNSQQVEK
                     CALQQQQKLLDQEKSKLKWGISIEKLPIISPEQFSELARQQYANNKRALVVIEGIVHD
                     VTPFIHNHPGGTALVQLSIGKDATQAFNGAVYSHSQAARNLLATMRIAMLSSNEQVKQ
                     TVWEKRMLQQSQDNQRRNNRQVTYTQKNHYAAGAA"
     gene            <870156..>871955
                     /locus_tag="HG535_0A04370"
                     /db_xref="GeneID:59234133"
     mRNA            <870156..>871955
                     /locus_tag="HG535_0A04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286330.1"
                     /db_xref="GeneID:59234133"
     CDS             870156..871955
                     /locus_tag="HG535_0A04370"
                     /inference="similar to AA sequence:RefSeq:NP_010578.3"
                     /note="similar to Saccharomyces cerevisiae SRP101
                     (YDR292C); ancestral locus Anc_5.302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142225.1"
                     /db_xref="GeneID:59234133"
                     /translation="MLEQFGIITPQGQVLYQYNISGKRFAEVQINKFIAHLIASPGAK
                     GAEHNGKFSIVNINSGGPTKNARGFCTMYHITKQPELYYFATYSDASLQLNDEAEEIL
                     TLALSLWDSLKLNLGIIDNLNGKGDKNEHNYVDILQGLDDAVRKFDQYLKVKYEASIK
                     KSHVLKEKTSTESYQKKRNNDSKGSKKKIAQSNASGRKWGQNGMMEEINSKDASLLDF
                     SAEGDEENSYSINATIEKDSFGNRTENGEFLIKEIDELLSKEKVTSQQPAKETTLDNA
                     FGFLKKHVLGNKTITEQDLNSILEQMKQQLITKNVAPEAAAFLMDQVSKDLVGSKTAG
                     WTSVEITAREALTKALTQVLTPGVSVDLLHEIQKKAEEKQPYVFSIVGVNGVGKSTNL
                     SKLAFWLLQNNFKVLIVACDTFRSGAIEQLRVHVENLAQLTDESHIRGSKNKRGKSGN
                     DHVELFEAGYGGSDLVTKIAKQAIKYAKDQDFDVVLMDTAGRRHNDATLMSPLKSFAE
                     QANPDKIIMVGEALVGTDSVQQAKNFNNAFGKARDIDFFIVSKCDTVGQMLGTMVNMV
                     YATDIPILFVGVGQTYTDLRTLSVNWAVNILMS"
     gene            complement(<872047..>875265)
                     /locus_tag="HG535_0A04380"
                     /db_xref="GeneID:59234134"
     mRNA            complement(<872047..>875265)
                     /locus_tag="HG535_0A04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286331.1"
                     /db_xref="GeneID:59234134"
     CDS             complement(872047..875265)
                     /locus_tag="HG535_0A04380"
                     /inference="similar to AA sequence:RefSeq:NP_010577.3"
                     /note="similar to Saccharomyces cerevisiae YDR291W;
                     ancestral locus Anc_5.301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142226.1"
                     /db_xref="GeneID:59234134"
                     /translation="MEADSRSIKRVKLATQDEFDELKQFFFRLNTLYTFLLCRKHVIP
                     TFDTLQKPIQSSLKKEVSELDFAKVVALLPRDCLFKYIDENQIYTESKVFDFKGGGFQ
                     QKENDIYELKDVESEYSQGKSTQVLIFEFTDGTMRYSWLNSDGNGARVKLPTYDGDQM
                     KKMIAKRAETFNRALSEFLAKCTSQGLDPKTELNRLAESVLPRKKEYEDPIDAMMNAK
                     DKKHKGVVVDKESGLVRPSVEELIRQLKDSDLYNSQIKEHHLIPERTAEYKDLDFSIS
                     PDVFQALTHKNFYSHQADALNAVHDGENVIITTSTSSGKSLIYQLSAIDLLLKEPESS
                     FMYIFPTKALAQDQKRSFETLASKIPRLKDLVVDTYDGDTEQNRRMFIRKNARVIFTN
                     PDMVHTSILPNHPNWRHFLYNLRLVVVDELHVYKGLFGSHVALVMRRLLRLCQHFYEN
                     NKLQFISCSATLKEPILHMRNMFGIKDVRLIHEDGSPRGTKHLVVWNPPVLSQHQRRR
                     ENFIRESAKILVQLVLKNVRTIAFCFVRRVCELLMKEVRIIFEEMGRQDLLTEVMSYR
                     GGYAASDRRKIEREMFHGGLKAVIATNALELGVDIGGLDAVLMCGFPLSMANFHQQSG
                     RAGRRNQDSLTLVVASDAPLDQHYVAHPEILLDGENTDSFQELILDFHNVLILEGHIQ
                     CAAFELPITIERDSLYFEKSSLEKICAERLHYNSEGYHTHNRFLPWPSKLVSLRGGEE
                     DQFAVVDITNGRNTIIEEVESSRTSFTLYDGGIFIHQGYPYLVKEFNPDERYAAVQRV
                     DVDWVTNQRDYTDVDPEEIELVRSMESSDIPVYFGKIKITIIVFGFFKVDKYKRIIDA
                     IETHNPPVMINSKGLWIDIPKRALDLCQRKNLSVAGGIHSAQHGIMALLPRFIVAGVD
                     EIQTECKAPEKEFAERQTKRKRPARLILYDSKGGKYGSGLSEKAFEHVDSILEGALQR
                     IEECPCEDGCPNCVIASFCKENNLVSSKRAAQIILHCILGHQDSTFIDKIQDGPEAHM
                     PEIKVETVEPVSSHVNFSQGFQIIEAKQLKAAVDPHFIKKED"
     gene            <875465..>876580
                     /locus_tag="HG535_0A04390"
                     /db_xref="GeneID:59234135"
     mRNA            <875465..>876580
                     /locus_tag="HG535_0A04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286332.1"
                     /db_xref="GeneID:59234135"
     CDS             875465..876580
                     /locus_tag="HG535_0A04390"
                     /inference="similar to AA sequence:RefSeq:NP_010575.1"
                     /note="similar to Saccharomyces cerevisiae RTT103
                     (YDR289C); ancestral locus Anc_5.300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142227.1"
                     /db_xref="GeneID:59234135"
                     /translation="MSFSAEQFVSRLNNLEDSQESIGNASKWLLSQYRDASKVAEFWK
                     NYMLRKDINTRRKLLAIYLVNHVVQQAKAKKIGQFQTALGHVTAEVLREVYPVLPRDL
                     KKKVRRVCDIWRDRCIFSEDVLSGIKSCLDSEETVSASTPIPPKLTPLVESFDKLDRM
                     EQNAKAMKLRFDNAIGALDPSSVVYEENFGIVAKIGQTAIDTANQSIQLREHALSRLK
                     SLLELEKKLLDEERNTIGEMDIAIASRNSASVNQGAEYEEDILPTYEAGNEDDEDDEQ
                     NNSSSSNSSDSDDGDSGKDISELDNNIVSTNKRQHELSSDNSQAKKPKSSSEDIDGRS
                     VQEYEPESLPNNSNSPRESGTSGVTSNIQDLLSKLAN"
     gene            complement(<876635..>877347)
                     /locus_tag="HG535_0A04400"
                     /db_xref="GeneID:59234136"
     mRNA            complement(join(<876635..877262,877334..>877347))
                     /locus_tag="HG535_0A04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286333.1"
                     /db_xref="GeneID:59234136"
     CDS             complement(join(876635..877262,877334..877347))
                     /locus_tag="HG535_0A04400"
                     /inference="similar to AA sequence:RefSeq:NP_011907.1"
                     /note="similar to Saccharomyces cerevisiae SRB2 (YHR041C);
                     ancestral locus Anc_5.299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142228.1"
                     /db_xref="GeneID:59234136"
                     /translation="MRRTAVIFAERATTSTLIEFKDALSSTLLSVLDSWNVDFKTYRY
                     QVKNIPPGESKLMCSITFSHHDKKTVLIKNNVCMVTTATLNDKSSSLLSNGCCGDTPE
                     PIDAILSTKLSNIWSQRQSIKGEAGETFQTTDLIVRAINLFSSTGFKGLLIEITSNED
                     ATEEEFAEKLVSLQSLLKDIEVKDMRISDERLYFSGNDYICDLAHQYVRVLNF"
     gene            complement(<877975..>882945)
                     /locus_tag="HG535_0A04410"
                     /db_xref="GeneID:59234137"
     mRNA            complement(<877975..>882945)
                     /locus_tag="HG535_0A04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286334.1"
                     /db_xref="GeneID:59234137"
     CDS             complement(877975..882945)
                     /locus_tag="HG535_0A04410"
                     /inference="similar to AA sequence:RefSeq:NP_010569.3"
                     /note="similar to Saccharomyces cerevisiae GCN2 (YDR283C);
                     ancestral locus Anc_5.298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142229.1"
                     /db_xref="GeneID:59234137"
                     /translation="MSGSRLTLEEYYEIQKNEVEAIESIYMHDFTNLTKKKSKWDKLP
                     QFVFEISLSSSNKDAVVSSLTLHIALAPLYPYTAADISFKNVNNVLDSQLKNLKAEFG
                     KIQKESSNQECIFDITSLVQEKLDEFQNISNNQSLEDDRMQRIKENKERQQREEEERM
                     HELEARKLSEQRIIDEIVKRELEKRQDDDSTFLNHSSSVDLLPPQEWIASGEAIVFTK
                     TVRAKLPNNSLYKFRAVVNPKPITLSSDPFGFAKQFLVKPYIPPESPLADALMSSEMM
                     ENFYYLLTEVELDNSYFNTSNGKKEISHLEKELESLLKVDHANINRLYAYTVERLGRN
                     NSTFVWHIKLLTQYSSYIPMTEIIQSVGFVNLATARIWMIRILEGLEALHKLGLVHKN
                     ISLQTVMLIKDCDFGITIPRLAHPAYGYTILHMVSCHPNKKGAAVELPSCSWPAPELV
                     KFSNCKPQRMTDIWQAGVLFLQTINGMDTVLNYSSAQDFLENSNMDDGLYDLLDRMLR
                     QDPKKRFTPLELLPMKFLRTNIDPGANKLTINKESSVNSSRKSFSDSLGANSRTLSQS
                     SGRRRSFNVGSRFSSANPATRSRYGSDFEEVAVLGKGAFGQVVKARNALDSRYYAIKK
                     IKHTEGKLSTILSEVMLLASLNHQYVVRYYAAWLEEDVDNDGSVFESSDEESETLEND
                     TDETLSKLSLLKSQSELDATNNAWDFISGSGYPEIVFASSTAEKSQCSEMSEESSSDE
                     EPESSSDEESESNGLVIKTPARNRRKTSTYRKTGHNDKSTLFIQMEYCENRTLFDLIH
                     TENINKEPDEYWRLFRQILEALSYIHSLGIIHRDLKPMNIFIDESRNVKIGDFGLAKN
                     VHKSLDLLRQDSSSQAGSIDDLTSAIGTTLYVATEVLHGNGQYNEKIDMYSLGIIFFE
                     MVYAFSTGMERVNILKQLRLADIEFPQDFDSDKMKTEKKIIKLLLDHDPNKRFGAQKL
                     LDSGLLPVKHQDEIINETLKTLADPASPWQKQVRETLFSQAYSLTNDILYDNTQSTST
                     PFTQILRSKMTEEVVKIFRKHGGIENNEPPIIFPKAPVYSTQNVYEILDEGGTVLQLQ
                     YDLTYPMARYLSKNPNCVSKHFRFQHVYRPPAHSNSSLEPKKFGEIDFDITSSNSTDS
                     AFYESESLKIIDEILTVFPVFEKTNTLFVINHEDILDSVLNYANIDKARRPFVSRLLS
                     QLGFGKSFKEIKVELKSQFNISSTSLNDLELFDFRLDFDAAKRRLHKAMVDSPYLRKI
                     DESLLHISKVINFFKPLDMTRNIVIAPFSNYNSGFYKGGIMFQAVYDDGTSRSLVAAG
                     GRYDKLISYFARPSGERGSNTQRAVGFNLAWETIFGIAQNFFKLNKSSRVKRKNKFLK
                     GTSLEWKPSRCDVLISCFSNSILNSVGVEILNQLWKRGISADILRNCYTVDDVVSGAQ
                     RDSVEWIILVKQQTYTLPNNKRKYKPLRVKKLDSDVDIDLDLDEFLNLYQQEAGIQTS
                     LVNSQLSLEDNTDDFSKWNENSSADSSIDGDIDEAVPTPSAQKVLYVPNPATRSKKAS
                     KREKWVYEDAARSASSAIVNSLMAAPVIIVDGIRDETLEMISTISLGQKEEWLRKILG
                     SVNNSAPRSFALNIYNTLSKEASKGTKWAVIHCQKTGKSCVADLQR"
     gene            complement(<883485..>884354)
                     /locus_tag="HG535_0A04420"
                     /db_xref="GeneID:59234138"
     mRNA            complement(<883485..>884354)
                     /locus_tag="HG535_0A04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286335.1"
                     /db_xref="GeneID:59234138"
     CDS             complement(883485..884354)
                     /locus_tag="HG535_0A04420"
                     /inference="similar to AA sequence:RefSeq:NP_010570.1"
                     /note="similar to Saccharomyces cerevisiae DPP1 (YDR284C);
                     ancestral locus Anc_5.297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142230.1"
                     /db_xref="GeneID:59234138"
                     /translation="MAINRINLAGGTSQSFWKSPKWRFTDIVVLVIVAIISYPIYYQK
                     PFERQFYINDLTISHPYAETQRVGNKMLFVYSLIVPLVVILVVVALLADPKHRWYLLY
                     ISVLGLLLSVSLNNLFTDFIKNWIGRLRPDFLARCQPKKGLPLDTLLNASEVCTTHHK
                     ERLMDGFRTTPSGHSSESFAGLGYLYLWLCGQLLTESPQSGIWRKVVALHPLLGALVI
                     ALSRTQDYRHHFIDVILGSALGYTVASFTYKRFFPPIKSELPFKPLFDDSDVSLEGYR
                     LPVEGAEIDVLAA"
     gene            <885335..>887797
                     /locus_tag="HG535_0A04430"
                     /db_xref="GeneID:59234139"
     mRNA            <885335..>887797
                     /locus_tag="HG535_0A04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286336.1"
                     /db_xref="GeneID:59234139"
     CDS             885335..887797
                     /locus_tag="HG535_0A04430"
                     /inference="similar to AA sequence:RefSeq:NP_010571.1"
                     /note="similar to Saccharomyces cerevisiae ZIP1 (YDR285W);
                     ancestral locus Anc_5.296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142231.1"
                     /db_xref="GeneID:59234139"
                     /translation="MSNFFRDNSLGFKPRSNIFSKLRVKEPDLSCDSSFGEDAGSSLM
                     RDVFMKSHQKNVENTTSDTTVAPGDQFKPEEHFQLGSSTPKAFKSFGRVKGHVDEDDL
                     EITEVRDVLGPNDSSASTLQTTSDEQKGKLIDDSFIHNEHLQPVDTSSNDVLLEAFTN
                     TQKICSNLKQELQRQQTQNSKLKEQVSNSQNENKKLVERFEEYKQLLTNLEDQSKSLQ
                     DQKSAGDTTLKELKESHCIFEKKIDEYKKLINGFKLDISNFKLFKKDVDLEASKKLKE
                     IEYLKRELNDCSGHLSEEKLKNISLLQELSKSREEIRETIIAEVTKGEHKLQDALTSF
                     NESLNATLQEELRIKLCPGNKNFLDRIFGEITKLEGFLKSKMEDSTNLTSRHVQDKFA
                     SLNEQLLNKISEENERRNKKASESSEEFIRGQNKYLKECLGKYMEQIQAEMSSMGSVS
                     LSSIESLTQSFEKYQAEMKNCQQYKSKISELQSEVQTLQLHKSQVLSSLGTKEAQHEQ
                     LVKKLNSKNIEISKYVELRNQLRQKVDVITTELEYHKNRLVKLNEENITIKANSENKI
                     IVQGELLKALQTENDIVKQRTVELDTVREQNEKENINRIAQVQSLNEKLQRLNVEMVQ
                     LKAHELELEEENRNLKNSIEDDKASYDETTGELNLLQQRLIVLQADKQDVVTEKLDLQ
                     DKIDELRSSLKNMKQKIKTMENDNVTSLEDQKKKLGQGSTFNPRVRVSSIRSEQVEDV
                     SPDAAQKEVADKGDEFDLSSSLNDDLELTNPSPIEIKTINLKKPSGSMMKPPNFSKKK
                     LLLLDDDDSATHLKHRWKKRRA"
     gene            complement(<887886..>888218)
                     /locus_tag="HG535_0A04440"
                     /db_xref="GeneID:59234140"
     mRNA            complement(<887886..>888218)
                     /locus_tag="HG535_0A04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286337.1"
                     /db_xref="GeneID:59234140"
     CDS             complement(887886..888218)
                     /locus_tag="HG535_0A04440"
                     /inference="similar to AA sequence:RefSeq:NP_010572.3"
                     /note="similar to Saccharomyces cerevisiae YDR286C;
                     ancestral locus Anc_5.295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142232.1"
                     /db_xref="GeneID:59234140"
                     /translation="MLKLFYRGFSSSARAFDRHVVYLTLFSKNQCGLCDNFKNSMRTL
                     LAKEEFVDRLHYRIVDIDEPRNKEWWDNYCFDVPVLHIEDANSESLYKVFHRFNDKDV
                     SNKIKLLL"
     gene            <888434..>889330
                     /locus_tag="HG535_0A04450"
                     /db_xref="GeneID:59234141"
     mRNA            <888434..>889330
                     /locus_tag="HG535_0A04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286338.1"
                     /db_xref="GeneID:59234141"
     CDS             888434..889330
                     /locus_tag="HG535_0A04450"
                     /inference="similar to AA sequence:RefSeq:NP_010573.3"
                     /note="similar to Saccharomyces cerevisiae YDR287W;
                     ancestral locus Anc_5.294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142233.1"
                     /db_xref="GeneID:59234141"
                     /translation="MSSPKSLPLTKEELKDIESTLINIVKGEVNYLIKNRAGAYFDSY
                     NNKANDVDLVTEIDKKVENIIRDALTFKYPAYGFIGEESYVKGESQLGTDKFWCVDPI
                     DGTTNFVHGYPMSCCSIALVENGFPVVGVVSNPSLGQIFHASKGNGAFLNSEAINILP
                     RQLILQKSLVAFEGGAERTEGPDGNFDAKMATLKSLLSDKGAHIHGVRCTGSAALNMC
                     YVSMGLFDAYWECGVNSWDVAAGACILVEAGGILVGGMPQDWRIPLDNRCYLAVRGGS
                     NPEEQRWFVEAFWSHVKGRISY"
     gene            <889771..>890574
                     /locus_tag="HG535_0A04460"
                     /db_xref="GeneID:59234142"
     mRNA            <889771..>890574
                     /locus_tag="HG535_0A04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286339.1"
                     /db_xref="GeneID:59234142"
     CDS             889771..890574
                     /locus_tag="HG535_0A04460"
                     /inference="similar to AA sequence:RefSeq:NP_010574.1"
                     /note="similar to Saccharomyces cerevisiae NSE3 (YDR288W);
                     ancestral locus Anc_5.293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142234.1"
                     /db_xref="GeneID:59234142"
                     /translation="MTAISGDDSDVDPKTAAVVRRTVRFILASIESQLTVISKNRLQN
                     VVRDISQQENSSRIPFNDLVRSASELLEDVFGYELRRLGTRSEKFIVLNTLKPLPRLN
                     EFIIKLCENTKTDSFAHDSEHISPKTNCLNSTFHDQDLAFKGVLTVTLCTVLFSKNHI
                     LQQELLEHLSSFGIPTDGSKIPVINCTIDELLKTLDRREYLYRVQDSADIQGETVFYR
                     IGRRTQLEFDLDSLVLLVRSVMGLAEDQHSTLREDIARNIADSYKSNTL"
     gene            <890887..>892941
                     /locus_tag="HG535_0A04470"
                     /db_xref="GeneID:59234143"
     mRNA            <890887..>892941
                     /locus_tag="HG535_0A04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286340.1"
                     /db_xref="GeneID:59234143"
     CDS             890887..892941
                     /locus_tag="HG535_0A04470"
                     /inference="similar to AA sequence:RefSeq:NP_011908.1"
                     /note="similar to Saccharomyces cerevisiae NCP1 (YHR042W);
                     ancestral locus Anc_5.292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142235.1"
                     /db_xref="GeneID:59234143"
                     /translation="MILGLDNTDFYVLCGLALAIGLYLKRDTLKELFMSNDDDITISG
                     GSRDIVEVLRENGKNYLVLFGSQTGTAEDYAKKFAKELAAKFELNVMCADIEKYDYHN
                     LNELPSNVVVSFFISTYGEGDFPDGAVQFEEFLQNAESSDLENLKYTIFGLGNSTYEF
                     YNGAAKKAVKYLDQAGSKIIGKFGQGDDGAGTTDEDFLSWKSDVLEVLKDQLHLDEHE
                     QRYIPSFKFEKLGSIEEKVSLGEPSLQYLPCNKLSFNDENIQLGPYDLHQPFVAPVVK
                     SFELCKGKERSCIHTEIDISGSNMKYSTGDHAGVWPSNADEKVKDFLDIFNLDPETIF
                     DLSPLDSTIKVPFPTPTTIGAAARHYMEITGPVSRQTFGLFEQFAPNEDIKAKIAELA
                     NDKSAFAKEIHGKYYNLADALKELSGENKWDKVSFVFLIETIPRLQPRYYSISSSSLC
                     EKQTIHVTSIVEDFPNPEGGKPVVGVTTNLLRNIEYAFNGKDNKDLPVHYDLNGPRSL
                     FKNFKIPIHVRRSTFKLPSNPSTPVLMFGPGTGVAPFRGFIRERVKFIENQENVKLGK
                     HLLFYGSRNKDDFLYQNEWPEYAKKLDGSFEMIVCHSRLPNEKKVYIQDKLIEREADV
                     LGMINNGAFIYVCGDAKGMAQGVSAALVDILSRGKSIEKAEASEMIKMLKTSGRYQED
                     VW"
     gene            <893208..>894422
                     /locus_tag="HG535_0A04480"
                     /db_xref="GeneID:59234144"
     mRNA            <893208..>894422
                     /locus_tag="HG535_0A04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286341.1"
                     /db_xref="GeneID:59234144"
     CDS             893208..894422
                     /locus_tag="HG535_0A04480"
                     /inference="similar to AA sequence:RefSeq:NP_010568.3"
                     /note="similar to Saccharomyces cerevisiae YDR282C;
                     ancestral locus Anc_5.291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142236.1"
                     /db_xref="GeneID:59234144"
                     /translation="MSLRCLVNLQSVSVRRGFKRTQFSRYLNTKFGAIQKDHDKIELK
                     ELKVKTGKTPKTLQDPSRFLRRTSVLNVPNTSVSGNNALEQALASCLKVRPCTTITTA
                     ERYDLRECIKLLNSNDLQPTSLIPDEIITFRYQRDGKDGDIMILGQNASITCWGFDEA
                     FVTQNILGLVEKARVNPLPREAFESEDMDYVEIENKDDFQRNQTELTKISNNAASLLT
                     NSEASFLAGDLIVINSGDTKSRLLNKAAFSSGLARSTKLAVLEGSMESHIFNTRITTE
                     KISRGVKLNLKESDALRSIGRLFLIRGKLNLYSELIETPDLYWSEPQLEKIFKQTSKY
                     LDIGPRIAILNTKLDYSTDECRAIIGVLNERKSAFLEWIIIYLITLEIFFELYHFYER
                     YWLVKKEIKKEI"
     gene            complement(<894470..>895207)
                     /locus_tag="HG535_0A04490"
                     /db_xref="GeneID:59234145"
     mRNA            complement(<894470..>895207)
                     /locus_tag="HG535_0A04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286342.1"
                     /db_xref="GeneID:59234145"
     CDS             complement(894470..895207)
                     /locus_tag="HG535_0A04490"
                     /inference="similar to AA sequence:RefSeq:NP_011910.1"
                     /note="similar to Saccharomyces cerevisiae DOG1 (YHR044C);
                     ancestral locus Anc_5.290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142237.1"
                     /db_xref="GeneID:59234145"
                     /translation="MPSIEVDLCLFDLDGTIINTTIAAESAWKRLCHTHRVDPQELFK
                     HSHGSRTEDMFKKFFPLLDNRDGKAVKEFELSLGADYLDTVRVVPGAESLLLSLDVDT
                     STKAKIVDRKWAIITSGSPYLAFSWFDTLLKKVGKPNVFITGFDVKRGKPDPEGYFAA
                     KVELCKIHGLDLKTSRTVVFEDAPVGIKAGKAIGSLVIGITTTYPKDVLFEAGADYVV
                     EDLSAVTVTRNDNIHGITIDIEKAMSR"
     gene            <895791..>896321
                     /locus_tag="HG535_0A04500"
                     /db_xref="GeneID:59234146"
     mRNA            <895791..>896321
                     /locus_tag="HG535_0A04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286343.1"
                     /db_xref="GeneID:59234146"
     CDS             895791..896321
                     /locus_tag="HG535_0A04500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142238.1"
                     /db_xref="GeneID:59234146"
                     /translation="MVPKLLPSIDNNELYYDENNINEAIEREERHDQWMILLESIQYL
                     IMGLLISLILEGLIVAIILYVRSGISAKNKESDCSSNAEGLSAAVLDSSNLYPILNLA
                     GENRNMYLKPLNSDKLLQLNDNGDIVKSDNRTRYSMADEELAKNTTDLIHVSAGHIRS
                     RELSLDYMALQNTSKC"
     gene            complement(<896408..>897325)
                     /locus_tag="HG535_0A04510"
                     /db_xref="GeneID:59234147"
     mRNA            complement(<896408..>897325)
                     /locus_tag="HG535_0A04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286344.1"
                     /db_xref="GeneID:59234147"
     CDS             complement(896408..897325)
                     /locus_tag="HG535_0A04510"
                     /inference="similar to AA sequence:RefSeq:NP_010566.1"
                     /note="similar to Saccharomyces cerevisiae RRP45
                     (YDR280W); ancestral locus Anc_5.289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142239.1"
                     /db_xref="GeneID:59234147"
                     /translation="MAKDIQISASESKFILEALRQNYRLDGRSFDQFRNVDISFGKEY
                     GDVTVVMGGTKVQCRISSSITHPYEDRPFEGLFLISTESSPMAGPQFENGNNTGDEEV
                     LCARIIEKAVRRSGALDIEGLCIVAGSKCWAIRADVHFLDCDGGFIDASCIAVMTALL
                     HYKKPDITVLGDRITVHPVDEREPVSLGILHIPICVTFSFFNPQDTEENIKGDSNAEI
                     AIIDATLREELLRDGTLTVTLNKNREVVQVSKAGGLPMDALSLMENCHKAYTIAEKTT
                     DQILEELKKDEKKRNKYAEILSSENNRES"
     gene            complement(<897527..>898591)
                     /locus_tag="HG535_0A04520"
                     /db_xref="GeneID:59234148"
     mRNA            complement(<897527..>898591)
                     /locus_tag="HG535_0A04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286345.1"
                     /db_xref="GeneID:59234148"
     CDS             complement(897527..898591)
                     /locus_tag="HG535_0A04520"
                     /inference="similar to AA sequence:RefSeq:NP_010565.3"
                     /note="similar to Saccharomyces cerevisiae RNH202
                     (YDR279W); ancestral locus Anc_5.288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142240.1"
                     /db_xref="GeneID:59234148"
                     /translation="MTVDKTTLSSIVALPSALAKYEQHITVFSLPHPSNTSSKQRVRL
                     MLGSNGQLFELRSHVFSKSCKYNAKSDLADDKYHYTTDDQPIKSVFLTNKEDRSDSYV
                     IESGCFQFAAKYDLTFNLIGYYHRNSIVAEERDYTRGTTEPQTCGQPAAHPPCLTARD
                     YHDLLVDSHDPAWSGVPLETLQSHLSNIAEPIEEAGEIFYKITSNKITAYLILKVQKI
                     LARLPKSLPMPNNLPQELSEALKVVMSVNLLISLIPKAAYSNLVHFSPEQQSVDSIQL
                     NISKAFDTYHNHQKSKLISEKEQELQLNAAMTVGLSVNSAKQPKKKVVKKSAINKKVN
                     VASGKGSIDGFFKKSKQSKI"
     gene            <899111..>900790
                     /locus_tag="HG535_0A04530"
                     /db_xref="GeneID:59234149"
     mRNA            <899111..>900790
                     /locus_tag="HG535_0A04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286346.1"
                     /db_xref="GeneID:59234149"
     CDS             899111..900790
                     /locus_tag="HG535_0A04530"
                     /inference="similar to AA sequence:RefSeq:NP_011911.1"
                     /note="similar to Saccharomyces cerevisiae YHR045W;
                     ancestral locus Anc_5.287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142241.1"
                     /db_xref="GeneID:59234149"
                     /translation="MDYMYMLKLIFTTFIGVFGVNWLFHKFYISSKRDFTSVAYNQQA
                     NISSVRKENETAHYRNFLVPLGFPLITGLSLSLKYKIRNGNFADVWKAIMELAGNNTI
                     TFKNGAESVNLKEVNGMASHLLQLCDQYRNVGIAVPQSSLQGFVMSIAAMIGSVKGSL
                     KPHFLASIPRQKFEDMDVLLISSWSAYKMLNGSEKWYKLVIVCEPMKDDIDVPDHVQS
                     WDSILQGYVINASFQYTPAEDNSDDTKIAVYATSSWNATTSFTQGCLVSGIASFIQGF
                     PSGHQLTCVDSLAVAGRLGDVDLSIHFWHKALAVLLHGGCLSFVSEPGAELKNLRGST
                     LLFCEPKFLSHILDEIKTRNCSLWRKLRFAWATALLSEGVFTNSGQSPFAALDELRCV
                     FVAEHIQNTQLVSSFPERIPTRQPSFAALSRELLTSEKLNSIRAQLGSRVVVELYCPY
                     VVMGPLFQTSFYDYRVLPSSVDSDFLCCGAISTNLEGKLVKTDENPELDVTKRQGMLC
                     VRGFTIGKPLDHDRLEAAMKLSAKFSGGEGWMPMVGIFGLWGKDGCLYIYK"
     gene            complement(<900846..>901733)
                     /locus_tag="HG535_0A04540"
                     /db_xref="GeneID:59234150"
     mRNA            complement(<900846..>901733)
                     /locus_tag="HG535_0A04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286347.1"
                     /db_xref="GeneID:59234150"
     CDS             complement(900846..901733)
                     /locus_tag="HG535_0A04540"
                     /inference="similar to AA sequence:RefSeq:NP_011912.1"
                     /note="similar to Saccharomyces cerevisiae INM1 (YHR046C);
                     ancestral locus Anc_5.286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142242.1"
                     /db_xref="GeneID:59234150"
                     /translation="MDIDFLSVEQFLCDLAVHKVGSLIKSKAGTQQNYDLKTGSRAVD
                     IVTKIDRQVEDIIKSEISSKYPDCGFIGEESYVKGDPRPDNKAFFCVDPIDGTTNFVH
                     DFPFSCTSLALCVDMIPVVGVIYNPHLDLLISASKGSGVRVNGEKYDYGKKIESMGPL
                     LLNKSIVALQPGSAREGDNFKTKMATYENLLSCDGGFVHGFRNLGSSAMSLAYIALGY
                     LDSYWDGGCYIWDVAAGVCIVNETGGRLVGANPDEWNIDIDNRAYLVVRGTEPSAEDE
                     QETYIKEFWKSVKGHLKYD"
     gene            complement(<902050..>904632)
                     /locus_tag="HG535_0A04550"
                     /db_xref="GeneID:59234151"
     mRNA            complement(<902050..>904632)
                     /locus_tag="HG535_0A04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286348.1"
                     /db_xref="GeneID:59234151"
     CDS             complement(902050..904632)
                     /locus_tag="HG535_0A04550"
                     /inference="similar to AA sequence:RefSeq:NP_011913.1"
                     /note="similar to Saccharomyces cerevisiae AAP1 (YHR047C)
                     and APE2 (YKL157W); ancestral locus Anc_5.285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142243.1"
                     /db_xref="GeneID:59234151"
                     /translation="MSSAAPSDKREVLPSNVTPLHYDLEVEPNFETFKFDGSVKIDLK
                     VNEKDVDTVQLNLIDIEIHSAKIGSADAEVSFDKENQIAEFKFAEGTLSQENVRLDIV
                     FTGILNDNMAGFYRAKYEDKLTGETKYMATTQMEPTDARRAFPCFDEPNLKATFDVTL
                     ISNDSLTHLSNMDVKTESVKDGKKITKFNTTPKMSTYLVAFIVAELKFVENKDFRIPV
                     RVYATPGNEKDGQYAADLTAKTLAFFEKSFGIKYPLPKMDNVAVHEFSAGAMENWGLV
                     TYRVVDLLLDEENSTLDRIQRVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFATWMS
                     WYSCNAFQPEWKVWEQYVTDTLQHALALDSLRSSHPIEVPVKRADEINQIFDAISYSK
                     GASLLRMISKWLGEDTFVKGVSEYLNKFKYGNAKTEDLWDSLSKASGKDVRKVMDIWT
                     KKVGYPVITVTENGNEITFKQNRYLSTGDVKDDEDKTLYPVFLALASKDGIDSSLVLD
                     EREKTIQLKDSRFFKVNGAQSGIYITSYSDDRWAKFGEQSNLLSVEDRTGLVADVKAL
                     SASGYTSTTNFLQLISKWNKEESFVVWDQIVNSISSLKSTWVFEPQDVKDALDNFTRE
                     LVSKKAHSLGWEFNASDSFATQRLKVTMFGTAAGAKDPKVEKVALDMFEKYISGNKKA
                     IPALIKPIVFNIVARRGGVENYEKIFNIYNNPISNDEKLAALRTLGRFKESELLERTL
                     GYLFDGTVLNQDIYIPMQGMRAHKEGIEALWKWVQTNWDEIAKRLPPGLSMLGSVVVI
                     STSGFTSLKAVEEVKAFFEKKSTKGFDQSLAQSLDTITSKAQWINRDREIVEKYLEDN
                     GYFE"
     gene            <905930..>907531
                     /locus_tag="HG535_0A04560"
                     /db_xref="GeneID:59234152"
     mRNA            <905930..>907531
                     /locus_tag="HG535_0A04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286349.1"
                     /db_xref="GeneID:59234152"
     CDS             905930..907531
                     /locus_tag="HG535_0A04560"
                     /inference="similar to AA sequence:RefSeq:NP_011914.1"
                     /note="similar to Saccharomyces cerevisiae YHR048W;
                     ancestral locus Anc_5.284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142244.1"
                     /db_xref="GeneID:59234152"
                     /translation="MGEKSSKHETPVEISSEQNSNTSRNSSAQCDNRRDAEIERAYSL
                     MPDEDDLERMNTLASQMRVDEKDYEVRFDDTLDDPENVARRISKVRKYYISISITAAS
                     LNITMISSCWALVAEKFMAKFHISREVAVLGISFYIFGLGVGPLLLGPLSELAGRRLT
                     FIFSLSLSIVWQCLVIWSTTIEGVFFGRFLSGFFGSALLSVAGGAISDIFSKDEVGIP
                     MTIYTLSVFFGPSLAPIIAGAFAHDDYRWSFIVLLISCAVTLLLIIFTVPETYAPLLL
                     IEKAKRLRRETGNERFFAPMEVTRKNASVAKLVLTSVRKPFGLLFRDKMMAVLCFYTG
                     LVLAIIYLYFVAFPYIFPTLYNFTVFETGLSYLGLMIGMIIVSPASIIFQKRYERKVI
                     ANNGQRTPEMRFEALFYGAFLTPAGLMIFAWTCYPSVHWIAPLIGSAVFGAGVFFVFV
                     GVFNYTVDAYRRFAATAMACNSFVRSTMSAVFPLFGLQMYQGMGINWAGFLLAMVAIT
                     MIPVPFLFSKYGAYLRSKSPYAWDD"
     gene            <907717..>908439
                     /locus_tag="HG535_0A04570"
                     /db_xref="GeneID:59234153"
     mRNA            <907717..>908439
                     /locus_tag="HG535_0A04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286350.1"
                     /db_xref="GeneID:59234153"
     CDS             907717..908439
                     /locus_tag="HG535_0A04570"
                     /inference="similar to AA sequence:RefSeq:NP_011915.1"
                     /note="similar to Saccharomyces cerevisiae FSH1 (YHR049W);
                     ancestral locus Anc_5.283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142245.1"
                     /db_xref="GeneID:59234153"
                     /translation="MTVTAPRLLFLHGFLQNAKVFSEKSSGIRKLLKKSNVECDYLDG
                     PVVLDRKDLPFEMDDEKWQQALDAQVNKAWFYHSDVSSELDLSDSIKYVSDYIKQNGP
                     YDGIVGFSQGAALASIVTNKITELNPEHPEFKVSVLISSYSFTEPDPSKPGQLRIAEK
                     FQSGFTPKKDSKTRVIFIYGASDQAVPAVRAKYLAQIYKDAWTQDPEQVQEYEHPGGH
                     MVPNKKDIIRPIVDQINSAMNA"
     gene            <909629..>911251
                     /locus_tag="HG535_0A04580"
                     /db_xref="GeneID:59234154"
     mRNA            <909629..>911251
                     /locus_tag="HG535_0A04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286351.1"
                     /db_xref="GeneID:59234154"
     CDS             909629..911251
                     /locus_tag="HG535_0A04580"
                     /inference="similar to AA sequence:RefSeq:NP_011917.1"
                     /note="similar to Saccharomyces cerevisiae SMF2 (YHR050W);
                     ancestral locus Anc_5.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142246.1"
                     /db_xref="GeneID:59234154"
                     /translation="MAVQEFEPLRSEETSGSHSRPLRRSKTVTYNTVVRVLRKYAKFI
                     GPGLMVSVSYMDPGNYSTAVAAGSAHRYKLLFSVLVSNFMAGFWQCLCAKLGAVTGLD
                     LAQNCRVHLPHGLNIALYILAEIAIIATDLAEVIGTAISLNILFGIPLALGVVLTVVD
                     VLVVLMAYKSNGSLRVIRWFEMFVSALVVATVICFAIELVYADLGSAKDLFSGFLPSR
                     AVFEGDGLYLTLAILGATVMPHSLYLGSGVVQPRLRDFDIKNGLYRPTEDDIANNHED
                     YKPSINAIDDTLHYTVAELLVSLFTVALFVNCSILIVSGAALYGNSPSDGSQEADLFS
                     IYNLLCTSLSKSAGTIFVLALLFSGQSAGIVCTLSGQIVSEGFLNWTISPSIRRSLTR
                     GVAITPCLILVLVAGRNGLSGALNASQVVLSLLLPFVSAPLLYFTSSKKIMRVRLHPR
                     ERIELTDMPLDEATERQSVDDESVQKPPREPLQESLLETYENTCQDEAVLYKDMSNSL
                     LTTIASAALWLLISGLNFYMLCSFSTGQDVHL"
     gene            <911334..>911921
                     /locus_tag="HG535_0A04590"
                     /db_xref="GeneID:59234155"
     mRNA            <911334..>911921
                     /locus_tag="HG535_0A04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286352.1"
                     /db_xref="GeneID:59234155"
     CDS             911334..911921
                     /locus_tag="HG535_0A04590"
                     /inference="similar to AA sequence:RefSeq:NP_012763.1"
                     /note="similar to Saccharomyces cerevisiae RCN1 (YKL159C);
                     ancestral locus Anc_5.281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142247.1"
                     /db_xref="GeneID:59234155"
                     /translation="MNAVTNTIIITSKDENVLDLLEYLQSWLLEHILRRIEITAQHPM
                     QLIVLRKFKRVLIVSPNLQVSQQVMSVPMQHSLCRAYSPLDTNESTDYLKVPKAQKMF
                     LVSPPSSPPPEFDYSRCEQSPSESTPPVSRDQSNQGPVTILNSSVANITVFPCADETS
                     QEVLRKTYRDADMGTYQPTSMPPKSIFDDSDDDLE"
     gene            <912146..>912607
                     /locus_tag="HG535_0A04600"
                     /db_xref="GeneID:59234156"
     mRNA            <912146..>912607
                     /locus_tag="HG535_0A04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286353.1"
                     /db_xref="GeneID:59234156"
     CDS             912146..912607
                     /locus_tag="HG535_0A04600"
                     /inference="similar to AA sequence:RefSeq:NP_011918.1"
                     /note="similar to Saccharomyces cerevisiae COX6 (YHR051W);
                     ancestral locus Anc_5.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142248.1"
                     /db_xref="GeneID:59234156"
                     /translation="MLSRTLFRSVTPSIISRNALRTSVRSSPVVSARLTSFAQIRKYS
                     SEHEDETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPVVVEKALRAARRVN
                     DLPTAIRVFEALKYKVENDGQYNAYLDELKDVREELGIPLKEELFDAPAAH"
     gene            complement(<912770..>913201)
                     /locus_tag="HG535_0A04610"
                     /db_xref="GeneID:59234157"
     mRNA            complement(<912770..>913201)
                     /locus_tag="HG535_0A04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286354.1"
                     /db_xref="GeneID:59234157"
     CDS             complement(912770..913201)
                     /locus_tag="HG535_0A04610"
                     /inference="similar to AA sequence:RefSeq:NP_012762.1"
                     /note="similar to Saccharomyces cerevisiae ELF1 (YKL160W);
                     ancestral locus Anc_5.279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142249.1"
                     /db_xref="GeneID:59234157"
                     /translation="MGKRKKSTRTPAKKLVLKLDTKFNCLFCNHEKSVSCTLDKKNCI
                     GSLQCKICGQSFQTRINALSQPVDVYSDWFDAVEEVNTGRGSESDDDDDDSASDYESD
                     SDDADAVRQETLDSDEEEIDDDDRIGHKRTGRAVVDSDDED"
     gene            <913484..>914716
                     /locus_tag="HG535_0A04620"
                     /db_xref="GeneID:59234158"
     mRNA            <913484..>914716
                     /locus_tag="HG535_0A04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286355.1"
                     /db_xref="GeneID:59234158"
     CDS             913484..914716
                     /locus_tag="HG535_0A04620"
                     /inference="similar to AA sequence:RefSeq:NP_011919.1"
                     /note="similar to Saccharomyces cerevisiae CIC1 (YHR052W);
                     ancestral locus Anc_5.278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142250.1"
                     /db_xref="GeneID:59234158"
                     /translation="MAKKSRSGSQKSTPRGTPQKATPKGTPRSNSKASPKTTANATSK
                     ATAKATSNGTPVGTPTKKSKPVKAVKPILAKSKDLGPVPRARILHSVEQLNKYTTTKQ
                     ENAKESLLGDDVEEKDVQLIVVNNRSFTESRKNFKIKLLKIKHSIFKPWKEASVTSTK
                     DFKVLLILKDSDIGKISVDDFVNEELNFPDVEIICGHDLKTKYKAFEKRRALVSEFSL
                     ILADDSIITTLPKLLGSKAYEKVETTPVGVRTHSDKEFSKKTTLNQFQKIYYEQLPIR
                     LPRGTTMNVHLGSLEWFNSQELADNVEMIVKDLVAKYKIRSIFIKTTKSPVLPLYYNQ
                     DVLNELVEVTKVNETEEPQGIVEIDKIKVQLSTFDQSLMEIIDPEEWPTAFAKQIASA
                     KRKGTDDQEPSASKKAKN"
     gene            <915074..>916054
                     /locus_tag="HG535_0A04630"
                     /db_xref="GeneID:59234159"
     mRNA            <915074..>916054
                     /locus_tag="HG535_0A04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286356.1"
                     /db_xref="GeneID:59234159"
     CDS             915074..916054
                     /locus_tag="HG535_0A04630"
                     /note="ancestral locus Anc_5.277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142251.1"
                     /db_xref="GeneID:59234159"
                     /translation="MSLEEIVSFFEIQMDDLFQECISLRETASQFNEQKFDTVSVHST
                     SFHVLEKRFEMVQNRHIALYNDLSSLRLILNRMSSNDVSTTDHKWNKNVSWEMQSLTS
                     GNTCNDENSDGTRNSYLNGSSDSLRSQLNRFSNDIHIHPLLLNQDEEPSHNQIMLINY
                     RTQEAPRIDLKLSGYLQSRLNTHCTKSNENDASDISDLYSGNAFDGSICDAKIDNGIT
                     KSPIPDLQMDQSPNTVAELYEQLITISLPRLRSFQKKFGKVQVNKIPSIRTFQRRKAL
                     LVEINNFSLIHNRTIIDSIKFFEKYRLDREKTVAWLYSNIDELQGHFFMK"
     gene            complement(<916288..>918162)
                     /locus_tag="HG535_0A04640"
                     /db_xref="GeneID:59234160"
     mRNA            complement(<916288..>918162)
                     /locus_tag="HG535_0A04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286357.1"
                     /db_xref="GeneID:59234160"
     CDS             complement(916288..918162)
                     /locus_tag="HG535_0A04640"
                     /inference="similar to AA sequence:RefSeq:NP_011897.1"
                     /note="similar to Saccharomyces cerevisiae YHR032W;
                     ancestral locus Anc_5.276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142252.1"
                     /db_xref="GeneID:59234160"
                     /translation="MTKQFTHTTMDRRSSIVYSTSVGKGGLFTPADYIPSEIGNSALE
                     EESDDAGEGTATRKGKALHGRPEEYQSLLDANNSRTLQREAEVNGTVTEHSSSTEDGT
                     LSAASLPKKLIDEERDLLIDNHILQGRETLDTTSSAANNYGSTEPEVVVDTWEEALEN
                     GKIITTTYRREGEVLACNALPLIFTFILQNSLSLASIFSVSHLGTKELGGVTLGSMTA
                     NITGLAAIQGLCTCLDTLCSQAYGAKNYHVVGLFVQRCAVITMLAFLPIMYIWVQWSE
                     TILSWLVPEPELCRLAANYLKVAAFGVPGFVLFECGKRFLQCQGIFHASTIVLFVCAP
                     LNALMNYFLVWDKRIGIGYLGAPLSVSINYWFMAIGLFVYTIFTKQAVKPLKCWNGVI
                     KPHQVFRNWRKMINLALPGILMVETEFLGFEILTIFASHLGPSALGAQSIISTIASLA
                     YQVPFSISVSTSTRVANFIGASLYQSCIKTCTLSLLLSFACSSMNMLIIFLFRKQIAG
                     LFSTEPEVVDLVTSALPILAFMQIFDAFNASTAGCLRGQGRQKIGGFINMFAFYAIGI
                     PMAVLLTFNFNLGVGGLWYGITCALIVMSVCQGYAVFHCDWNEIIDAAKSRNSETVRV
                     "
     gene            <918596..>920710
                     /locus_tag="HG535_0A04650"
                     /db_xref="GeneID:59234161"
     mRNA            <918596..>920710
                     /locus_tag="HG535_0A04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286358.1"
                     /db_xref="GeneID:59234161"
     CDS             918596..920710
                     /locus_tag="HG535_0A04650"
                     /inference="similar to AA sequence:RefSeq:NP_011896.1"
                     /note="similar to Saccharomyces cerevisiae RRM3 (YHR031C);
                     ancestral locus Anc_5.275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142253.1"
                     /db_xref="GeneID:59234161"
                     /translation="MVFHTGTSINTKTNGKHAKKKPAVLRQKTLSSYFFQPKKGSELA
                     TKRQAAVSDVNEVMQVIDLEKPDKKEKGCVSKAGSLFDSQGSFDECDPDEEFSLLTNA
                     PQIQNFKRATITRTPSFQKSNSSIHFDNFDLSESPKEFSSFPSTTRQQIAFGNNPNLS
                     FNESARPAKRATSPTAFAGLRLTAPKRIKPISRKSSNLLSKTESFKLTKEQDNVIDMV
                     VKRKFSIFYTGSAGTGKSVLLKSLIERLRGLYGRDAVAITASTGLAGTTIGGITLHKW
                     SGVGLGLKTVDQLATAIQKQHQIMSVWRNTKVLIIDEISMIDGALLDKLETLARKLRK
                     NEKPFGGIQLILTGDFFQLPPVKKSVDHQHEPSKLPIFCFESKMWHKCIQKTILLTKV
                     FRQQDDELVNMLNSIRFGEVTPELVRTIKGLSRDIEYKDGITPTELYATRREVEMSNA
                     RQLNFLPGKSYQFESVDAAPKHYMSLLDSSVMVEKILTLKNDAQVMMLKNKPESELVN
                     GSLGRVLFFITERLERLMREHYGGKVDEDVVLDMRIVSEAIANPIVADSLELQQNLLS
                     RPLSRHATIRTLLNHAVKCSPKTPVYPYVRWALPDRFHHELMLQERFPVDIPGDNAGV
                     ERNQLPLMLCWALSIHKAQGQTIQRLKVDLRNIFEAGQVYVALSRAVSRDNLQVLNFN
                     PNRIRANEKVKLFYKKLEVLTP"
     gene            <921219..>922721
                     /locus_tag="HG535_0A04660"
                     /db_xref="GeneID:59234162"
     mRNA            <921219..>922721
                     /locus_tag="HG535_0A04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286359.1"
                     /db_xref="GeneID:59234162"
     CDS             921219..922721
                     /locus_tag="HG535_0A04660"
                     /inference="similar to AA sequence:RefSeq:NP_011895.1"
                     /note="similar to Saccharomyces cerevisiae SLT2 (YHR030C)
                     and YKL161C; ancestral locus Anc_5.274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142254.1"
                     /db_xref="GeneID:59234162"
                     /translation="MCDKIERHTFKVFNQDFTVDKRFQLIKEIGHGAYGVVCSARFTE
                     AAEDTTVAIKKVTNIFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGTFA
                     GLYLYEELMECDMHQIIKSEQPLTDAHYQSFVYQILCGLKYIHSADVLHRDLKPGNLL
                     VNADCQLKICDFGLARGFSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWS
                     TGCILAEFLGGKPIFKGKDYVNQLNRILQVLGIPPDETLKRIGSKNVQDYIHQLGFIP
                     KVPFSDIYPQANPQALDLLEKMLAFDPQNRITVEQALQHPYLSIWHDPADEPVCNEKF
                     EFSFESVNEMEELKRMVIEEVQDFRQYVRQPLLEEQEMQQQEQLQQLEQHDLQQQEQD
                     LQPAHNQLQKNESAGSAELTDGDFTQQMMSLQPSSGFSSQLPDSFVGIDSRDLPGHDT
                     DFPPRPQENLLASPIAFKADGTMASASQGEYGDFLDLEKELEFGLDRKYL"
     gene            <922996..>923874
                     /locus_tag="HG535_0A04670"
                     /db_xref="GeneID:59234163"
     mRNA            <922996..>923874
                     /locus_tag="HG535_0A04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286360.1"
                     /db_xref="GeneID:59234163"
     CDS             922996..923874
                     /locus_tag="HG535_0A04670"
                     /inference="similar to AA sequence:RefSeq:NP_011894.1"
                     /note="similar to Saccharomyces cerevisiae YHI9 (YHR029C);
                     ancestral locus Anc_5.273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142255.1"
                     /db_xref="GeneID:59234163"
                     /translation="MAFILPFKQVDVFTNVPFKGNPVAVINCLNITEDQISSKQMQAV
                     ANWTNLSETTFIFKSSHPECHYKIRIFTPLNELPLAGHPMIGTCKAFLEFTETKNVSK
                     MYCESKLGVIELSIASTGEISFKAPPADIEGIAAEASAGYQKSLGCEPVASPKLVRVG
                     PKWVVFLVSDAEKCYGVNPDFAKLKHISNIFEHTGLILAGSKSGSMTNFEMRAFAPAE
                     GVDEDPVCGSGSLALTRYLHDHFKYSETTQINITEGGRLGRDGHIKTCVSIIESETSY
                     STGGDAITIINGTISI"
     gene            <924045..>926558
                     /locus_tag="HG535_0A04680"
                     /db_xref="GeneID:59234164"
     mRNA            <924045..>926558
                     /locus_tag="HG535_0A04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286361.1"
                     /db_xref="GeneID:59234164"
     CDS             924045..926558
                     /locus_tag="HG535_0A04680"
                     /inference="similar to AA sequence:RefSeq:NP_011893.1"
                     /note="similar to Saccharomyces cerevisiae DAP2 (YHR028C);
                     ancestral locus Anc_5.272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142256.1"
                     /db_xref="GeneID:59234164"
                     /translation="MESDGATGSINNGDAEVERVPMESFKQRKRDTIDRFARPGAIVL
                     LLVWGTVLLLRSILALRGNSSGDDNVPVYHLPNSSHTDEGCLKVSFANVRNSTFQPVV
                     KSLQWISTPDSAYHDKGLFVTIADDTYVVRSVFDEDFSKVLLNASTFQYGDVKYNVDS
                     LVASPDLSKLLIRTNTISNWRHSSFGTYFVYEHESSSFHLIGDNLAIAEWSPNSIDIS
                     YVQDNDIYIYSTKHSKTTNRITFDGSELIFNGKPDWVYEEEVLEGDKALWWSPKGEYL
                     VYYRIDETDVGEFSIPYYVQEQDDIYSKIRKIKYPKSGTPNPIVELWVYDLANDYAYS
                     ADIQGGREEPAFPLLLTEVAWVGNSKLIAKTTDRSSDILSVFLVDAEKQVSKLVRENS
                     SDGGWWEISHDILHIPKNETNGRRYDGYLDVMPVDGFNHLVYFAPVESSVPIQLTHGK
                     WEVVNGPAAFDYQSNIVYFIATRESSTERHLYSVNLDTPKELKAITNTQDNAVYDVSF
                     SAGSRFALLSYKGPDIPYQKIIDFQSYKHDKKIKGNVIGETLYYLEKNDALAARLSLY
                     DIPPKTFQTLNLGKDENGYDIVANSFEILPNGFDPSLKDYYPVFFYAYGGPNSQQVLQ
                     SFSVGFNEVVASQLDAIVVVVDGRGTGFKGKEFRSLVRDNLGDYEARDQIAAAALYGS
                     KSYVDSNKISLFGWSYGGYLTLKTLEKDAGQHFKFGLSVAPVTDWRFYDSVYTERYMH
                     TPQENGHGYNQSAVRNVTAIAEATRFLLMHGTGDDNVHFQNSLKFLDLLDLAGVENYD
                     VHVFPDSDHSIRYHNANIIVYDKLLTWTKLAFTSSFINN"
     gene            <926786..>929734
                     /locus_tag="HG535_0A04690"
                     /db_xref="GeneID:59234165"
     mRNA            <926786..>929734
                     /locus_tag="HG535_0A04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286362.1"
                     /db_xref="GeneID:59234165"
     CDS             926786..929734
                     /locus_tag="HG535_0A04690"
                     /inference="similar to AA sequence:RefSeq:NP_011892.1"
                     /note="similar to Saccharomyces cerevisiae RPN1 (YHR027C);
                     ancestral locus Anc_5.271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142257.1"
                     /db_xref="GeneID:59234165"
                     /translation="MSDNVEKQTEEVHDEKVVAAKEQSAKKKGNSVEEEQLSEEDQKL
                     KTDLELLVDRLKENDSELYELSLNQLKEFIKKSTSSMTAVPKPLKFLRPSYPSLCGIY
                     DSWTDDSLKASLAEILSVLAMTYSDNNKHDSLRFALLSGAKNIESWGHEYIRHLALEI
                     GETYNDQIEKEGSGSNSEEDFSERTGSKEDFEFSKGSILRLCLDIVPYFLKHNGETEA
                     VDLLLEIEAIDKLPQYVDENTFERVCQYMVACVPLLPPPEDVSFLQTAYSIYLSESQL
                     TEALSLAIRLDDESLVRSVFDATSDPIVQKQLAYNLSFQKSSFEYESVQDIIGNTKLS
                     EHFLYLAKELNLTVPKVPEDVYKSHLDSSKSVFSGTGLDSAQQNLAAAFVNGFLNLGY
                     CNDKMVVDNDNWIYKTKGDGMTSSVASIGSIYQWNLDGLQQLDKYLYVEEPEVKAGAL
                     LGIGISTCGVHDGDVEPALLLLQDYVTNPNTKISSAAILGLGIAFAGSKNDEVLGLLL
                     PIAADTSLPIETSAITSLVLAQTFVGTCNGDITAVIMDNFLERSGADLKTEWVRFLTL
                     ALGVLYMGQGEQVDDVLETISAIEHPITSAIEVLVSACAYAGTGDVLLIQDLLHRLTP
                     KATKKEGEDDENEEEEQEAQANAISEFLAGHENATEEDPVASTSDSRNIDGENDSAGN
                     VESETITEEKKEEELVNENGIDGEGEDVKDDNEDDSSVVVDELSYAVLGIAMIALGEN
                     IGKEMSLRHFGHLMHYGNEHIRSMVPLAMGLVSIADPQMKVFDTLSRFSHDADLNVSM
                     NSIFAMGMCGAGTNNARLAQLLRQLASYYSREQDALFVTRFAQGLVHLGKGTMTIDVF
                     NDADVLNKVSLASILTVLVGLVSPSFMLKNHQLFYMLNSAVRPKFILTLNEEGEPIKV
                     NVRVGQAVDTVGQAGKPKTITGWITQSTPVLLNHGERAELETDEYLSYASHIEGVVIL
                     KKNPNYEKEE"
     gene            complement(<929949..>930593)
                     /locus_tag="HG535_0A04700"
                     /db_xref="GeneID:59234166"
     mRNA            complement(<929949..>930593)
                     /locus_tag="HG535_0A04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286363.1"
                     /db_xref="GeneID:59234166"
     CDS             complement(929949..930593)
                     /locus_tag="HG535_0A04700"
                     /inference="similar to AA sequence:RefSeq:NP_011891.1"
                     /note="similar to Saccharomyces cerevisiae PPA1 (YHR026W);
                     ancestral locus Anc_5.270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142258.1"
                     /db_xref="GeneID:59234166"
                     /translation="MSTAKESQNDSLIGSFSFTKCLNYTVVSVATVYILYKLFTGHGT
                     DINVGKFLERSSPYMWANIGIASCIGLSVVGAAWGIFITGSSIIGAGVRAPRITTKNL
                     ISIIFCEVVAIYGLITSIIFSSKLTVAAPENLLSKSNLYTGYSLFWAGLTVGVSNLIC
                     GVAVGVTGATAAISDASDSTLFVKILVIEIFGSLLGILGLIVGLLMAAKTVEFQ"
     gene            complement(<930847..>931920)
                     /locus_tag="HG535_0A04710"
                     /db_xref="GeneID:59234167"
     mRNA            complement(<930847..>931920)
                     /locus_tag="HG535_0A04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286364.1"
                     /db_xref="GeneID:59234167"
     CDS             complement(930847..931920)
                     /locus_tag="HG535_0A04710"
                     /inference="similar to AA sequence:RefSeq:NP_011890.1"
                     /note="similar to Saccharomyces cerevisiae THR1 (YHR025W);
                     ancestral locus Anc_5.269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142259.1"
                     /db_xref="GeneID:59234167"
                     /translation="MPRTFKITVPASSANIGPGYDVLGIGLSLSLELEVTIDPKQAQD
                     TNDDPNNCKLSYTEDSEGFDSVPLSSDANLITRTALYVLRCNNIRNFPSGTKIQVRNP
                     IPLGRGLGSSGAAVVAGVMLGNEVGKLKFSKQRMLDYCLMIERHPDNITAAMMGGFCG
                     SFLRDLTPQEVERREIPLSEVLPEPSGGENTGLVPPLPPTDIGRHVKYQWNPKIKCIA
                     IIPQFELSTADSRGVLPKAYTTQDVVFNLQRLAVLTTALTMDPPNADLIYPAMQDRVH
                     QPYRKTLIPGLTEILSSVTPSTYPGLLGICLSGAGPTILAVATENFEEISQEIINRFA
                     KKQVHCTWKLLEPAYEGANVEEI"
     gene            <932418..>933875
                     /locus_tag="HG535_0A04720"
                     /db_xref="GeneID:59234168"
     mRNA            <932418..>933875
                     /locus_tag="HG535_0A04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286365.1"
                     /db_xref="GeneID:59234168"
     CDS             932418..933875
                     /locus_tag="HG535_0A04720"
                     /inference="similar to AA sequence:RefSeq:NP_011889.1"
                     /note="similar to Saccharomyces cerevisiae MAS2 (YHR024C);
                     ancestral locus Anc_5.268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142260.1"
                     /db_xref="GeneID:59234168"
                     /translation="MLKFAGKKYYSQFAKDSFRLSKLSNGMKVTTSGSPGHFSALGLY
                     IGAGSRYEKRSLKGCTHILDRLAFKSTEHQDARTITETLELLGGNYQCTSSRETMMYQ
                     ASVFHRDVEKMLNLMCETVRFPRITEEELEEQKLTAQYEIDETWLKPDLALPELLHTT
                     AYSGETLGSPLLCPRELVPSISRYYLMDYKNKFYTPENTVAAFVGLPHEKAVEIAEKH
                     FGDWESSHPPISKSAAVYTGGETCIPPGPVFGGLPELYHIQIGFEGLPIDHPDIYALA
                     TLQTLLGGGGSFSAGGPGKGMYSRLYTHVLNQFYFIENCVAFNHSYSDSGIFGISVSC
                     VPEAASQVVEVIASQFHNTFANDNLQLTEDEVSRAKNQLKSSLLMNLESKLVELEDMG
                     RQVQIHGTKIPVSEMISKIEKLTPSDIKRVAEMVFTGKVRNSANSSGKATIVMQGTRE
                     AFGDVEGVLRNYGLGNYPKSTSHSSQSISKKAKWF"
     gene            complement(<934080..>939686)
                     /locus_tag="HG535_0A04730"
                     /db_xref="GeneID:59234169"
     mRNA            complement(<934080..>939686)
                     /locus_tag="HG535_0A04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286366.1"
                     /db_xref="GeneID:59234169"
     CDS             complement(934080..939686)
                     /locus_tag="HG535_0A04730"
                     /inference="similar to AA sequence:RefSeq:NP_011888.1"
                     /note="similar to Saccharomyces cerevisiae MYO1 (YHR023W);
                     ancestral locus Anc_5.267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142261.1"
                     /db_xref="GeneID:59234169"
                     /translation="MSADNASSNRAVWVPDPIEVFVQGELSETKVIKDAANKDQKIGL
                     VKLKGTHETKQFAISQIYPTNPSTFDKVDDMSELTHLNEPSVLHNLENRYRDDLIYTY
                     SGLFLVAINPYCDVKLYSQEYVKLYHGSPKEDNKPHIFAIAEEAYRKLLTDKQNQSIL
                     VTGESGAGKTENTKKILQYLASITSDDKDISDDSDDEKSFELKILQSNPILESFGNSQ
                     TVKNNNSSRFGKFIKIEFDERGKINGAHIEWYLLEKSRVIHQTSFERNYHIFYQLLVG
                     LSDQELRKLELNSKSIKDYGYLKNSNRSIPGVDDSKNFQELLSAFKTVGFSQDDITEI
                     FKVISIILHIGNIEFVSERSEQASIKSDISLLCKLLGVPTQDFKMAILKPKSKAGKEW
                     VSQSKNSTQARFILNSLARTLYENLFTHIVSKINKSLDHGSMTANYIGLLDIAGFEIF
                     EHNSFEQLCINYTNEKLQQFFNHYMFVLEQKEYLKENIQWDYIDYGKDLQSTIDIIEQ
                     KSPLTGFLPLLDEESILPKSSDDSFFSKLISTWDSKSSKFKRSKHSSCFILTHYAGNV
                     EYNVDGWLSKNKDPLNENLSSVLNSSSNRLIYSFFAESEKKPKGSSFRTTSSRHREQL
                     NSLLDQLSSTNPHFARCIIPNNNKKAKDFDRRLILDQLRCNGVLEGIRIAREGYPNRV
                     FFKEFFERYRLLSDDNESSNSSKKNCEFLLSSLHLDPSLFKVGSSKLFFKAGVLANLE
                     NKKEQKLSEIMLRFTSIAYGVQVRSKINERLRKLRAARSLGNTFKAYNKAMEDPWYNL
                     YIKIKPLLSSSQDIMKSKKFAEKVKSLEAKIVEINSQNDVVTKEKDIMAKDLEDVRSL
                     LATETEKLKNHLQTLNEVNKKHSQLENKLNETTELKKKIQQENDKMVKEHESALADIL
                     KYKNISNEEDKKLQQLEETNQQLTEQLNSESKSISAKEDLIKQLSHEKNKLTEAMEEV
                     KKQEHAKHLEIVALKGKLNSSEEDLQLKLESIEKNCNSAMNRLQNLIQENSDLRNEIS
                     SAEQKKANINAELEARERELQRMKERTELHQSELASISNQRDDTLAAHSQIVKELKET
                     RATVIQYKKDIQSLERTNEKLTLELSKKNEITNKSESDDSKITELETRLAEEMALNAY
                     LNKQISVQSEKKRFTKELDITMGSSNDSKEDIVKSYQNLKVKLHDTKRQLESEIEDKK
                     DLISRLRFTEARLASSSFDSQIAHSQVKKLKEIINASNLTIDLDKEFALLKPSEVNIE
                     KLVLEVDHLKRQLELETRARCDAEHLVSALHGKFSQIQRSESSSDIFRLKYEASEERA
                     KSLETKLRSAPLKDKTNLAGDIFTNRESISKYADEIRFHKLENYKLQEVLADSNKKIA
                     GLNHEIKQSSTKAALLTEQLEGLQKDLEATERQNELMSATINQQKQQYEACLKDLHLN
                     EFQSKEFSNTLRQAEEDVKSMAGIIEKLKTQNKQKDKIIWENETKKNDIDMQLQETIL
                     EVKRAQEMNKILNADLGHLKERLANQKDNSKFVNEIESLKADVNSYIKSESDLRKEIS
                     TLKYNLETSSNDYEARVSELLKQITHYENIVQTLSSERDMADAGEKELMKKLEALNLR
                     ASNLSGTVDSLLREKSQLQTDLDLLNEAFQSTAKKLEQSLQERHDMTNNVKYLEETVK
                     LQKEQNERNEEFVKQLHSEVDTVKFKLKEEKEKNINLFEENQSQKVHKQQQAKQINNL
                     ELQLADTTEKDAWLEKIHELEKLVAEESSFKYEEMKKTKNLERMVSELQQKNESQVEL
                     INSANSGQQNYNEIILKCNEQIGLMEKQITKQELDLKKCVRDNAFFQNRNEDLEKELA
                     FWKERYNALTSTRGGARNPQTEEVYI"
     gene            <940437..>941417
                     /locus_tag="HG535_0A04740"
                     /db_xref="GeneID:59234170"
     mRNA            <940437..>941417
                     /locus_tag="HG535_0A04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286367.1"
                     /db_xref="GeneID:59234170"
     CDS             940437..941417
                     /locus_tag="HG535_0A04740"
                     /inference="similar to AA sequence:RefSeq:NP_011887.1"
                     /note="similar to Saccharomyces cerevisiae YHR022C;
                     ancestral locus Anc_5.266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142262.1"
                     /db_xref="GeneID:59234170"
                     /translation="MYIFKLSYLLEERESFCCSRPISAAHFLVAMNTALFDTDVSKIP
                     ANKKNLAIAYIIVMGDAQSGKTSLIFRWLNGTYNRIAPGAYMEDIYSKSYKQEFMAEN
                     PYGKNGKNGNNGNTRFGTELKRHAVTHVSFLDMESVEKTYNSEMRNIQLKESDAFVIA
                     FDPTCENPIESIRTQYKLIEDATDLQDKPPIVVICSTKCDLEADYRVGLDQILEFMDR
                     AGLPTSNFFQVSAKSGEHTTRLLYYVLQQIKKRKIAANEEAKTYSDTADTADTATAVA
                     ITRELETDAVKRDTELTQEMHTVPNKEPAFLCGTKKIKTKLKRAKRCVIC"
     gene            <942050..>942691
                     /locus_tag="HG535_0A04750"
                     /db_xref="GeneID:59234171"
     mRNA            join(<942050..942052,942446..>942691)
                     /locus_tag="HG535_0A04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286368.1"
                     /db_xref="GeneID:59234171"
     CDS             join(942050..942052,942446..942691)
                     /locus_tag="HG535_0A04750"
                     /inference="similar to AA sequence:RefSeq:NP_011885.1"
                     /note="similar to Saccharomyces cerevisiae RPS27B
                     (YHR021C) and RPS27A (YKL156W); ancestral locus Anc_5.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142263.1"
                     /db_xref="GeneID:59234171"
                     /translation="MVLVQDLLHPTAASEARKHKLKTLVQSPRSYFLDVKCPGCLNIT
                     TVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK"
     gene            complement(<942821..>944878)
                     /locus_tag="HG535_0A04760"
                     /db_xref="GeneID:59234172"
     mRNA            complement(<942821..>944878)
                     /locus_tag="HG535_0A04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286369.1"
                     /db_xref="GeneID:59234172"
     CDS             complement(942821..944878)
                     /locus_tag="HG535_0A04760"
                     /inference="similar to AA sequence:RefSeq:NP_012767.1"
                     /note="similar to Saccharomyces cerevisiae RSM22
                     (YKL155C); ancestral locus Anc_5.264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142264.1"
                     /db_xref="GeneID:59234172"
                     /translation="MLRSISLKYSAVRRSLSSFSRASLEGLDFENSKYPSNNDLSFGV
                     TVDSEDDIRVIERNDILSQNATSPFRKKDGEPLQGRNSQEARVLPETLQAMSFRDQIE
                     LNPLVSQVIKNNILSVQIPNNLRRSASNYYVELYRDKLHRPMKSTMEVDSHIAAIFQQ
                     NYAAIYQTLTELRKRLGNRVFNPQNVLDVGYGPATGIVALNDLMGKDYRPKNKEAVII
                     GHIDMQKRAKLMLSRQLNEVRDETVTVDTAENSDDIVEGEDLVGEVMTKKININTRLT
                     KNVPGSGQYDLIIITHQLLKNEEKFPIQIDDNLEHYLNLLAPGGNLVIVERGNPLGFE
                     TISRARQIMIRPENFPDEHGKIPRPWTRGSIKKTKIESKKDEESRANFEDAKRLLKEI
                     DENHGPINEKELEFEPELLRELEKREEENEKASNINFYLKIIAPCPHHRKCPLQVGNP
                     KLYEHDKDNKLKFCNFQKNVLRSKFSMELKKGKILATPWQTPEDGIGMPGMANAGTGR
                     KNGQNYELINYSYLIVERSPCDKESIERIEHERENATNRFEIGSLGDKTQNTWPRIIN
                     QPKKRKGHVTLELCGSSGQLEKWTVPKSFDKQIYHDARKSMKSDLWPLEAKTKLKGSV
                     NFNIAKLEMLEKARIKRLKKDAKERDRRIDELFPHAHETMDIGTLAEVYGHDYAKMDK
                     KKT"
     gene            <945053..>945847
                     /locus_tag="HG535_0A04770"
                     /db_xref="GeneID:59234173"
     mRNA            <945053..>945847
                     /locus_tag="HG535_0A04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286370.1"
                     /db_xref="GeneID:59234173"
     CDS             945053..945847
                     /locus_tag="HG535_0A04770"
                     /inference="similar to AA sequence:RefSeq:NP_012768.1"
                     /note="similar to Saccharomyces cerevisiae SRP102
                     (YKL154W); ancestral locus Anc_5.263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142265.1"
                     /db_xref="GeneID:59234173"
                     /translation="MLNNTVLIALVFVLITSSLLLITQRHKGSRLVLNGESITKNKEP
                     TIIIAGPSNSGKTAFYTFLTSGKLTNTVTSQKTSVAHDFKLSKANTFRLMEFPGHNKL
                     RKQLIDTLESSNNIKGLLFMVDSTTDPKDLTEVAEFLFQILQVTERQPDGCDILLACN
                     KCESFTSRPPAKIKDALEKEMDKIIARKRKSLDSVQNTLNGSLKKTDDADNEDDQEEK
                     SALLDIQVAGGFKFSSLEGNVDALEGSVTKNNVDKWECWIEERLIN"
     gene            complement(<945867..>946115)
                     /locus_tag="HG535_0A04780"
                     /db_xref="GeneID:59234174"
     mRNA            complement(<945867..>946115)
                     /locus_tag="HG535_0A04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286371.1"
                     /db_xref="GeneID:59234174"
     CDS             complement(945867..946115)
                     /locus_tag="HG535_0A04780"
                     /inference="similar to AA sequence:RefSeq:NP_001032579.1"
                     /note="similar to Saccharomyces cerevisiae YIL102C-A;
                     ancestral locus Anc_5.262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142266.1"
                     /db_xref="GeneID:59234174"
                     /translation="MNRFALLTVAMLYYTVWLLLPVFELDNKLSMFPLPSIYAVYLPI
                     SLLLLGFAMVGTFLGVLLLLDSKDDESRSHLLEIDIAI"
     gene            946321..946392
                     /locus_tag="HG535_0Atrna2R"
                     /db_xref="GeneID:59234626"
     tRNA            946321..946392
                     /locus_tag="HG535_0Atrna2R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:59234626"
     gene            946587..946658
                     /locus_tag="HG535_0Atrna2D"
                     /db_xref="GeneID:59234621"
     tRNA            946587..946658
                     /locus_tag="HG535_0Atrna2D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:59234621"
     gene            <946967..>951997
                     /locus_tag="HG535_0A04800"
                     /db_xref="GeneID:59234175"
     mRNA            <946967..>951997
                     /locus_tag="HG535_0A04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286372.1"
                     /db_xref="GeneID:59234175"
     CDS             946967..951997
                     /locus_tag="HG535_0A04800"
                     /inference="similar to AA sequence:RefSeq:NP_012495.1"
                     /note="similar to Saccharomyces cerevisiae NUP192
                     (YJL039C); ancestral locus Anc_5.261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142267.1"
                     /db_xref="GeneID:59234175"
                     /translation="MRWCSSSFQWLYDTIEVEQFNKDLFDELLPDLQNLNLYNDKFKN
                     AQSRATLEKGEITLENGSSYNVNQEFMIAAILLSDELNLDELVACEFILSDPNISKGS
                     NSVNLELVNAGKVQFFLRRQYILQIVAYLTNCLNRNHHLYHSLTSNGVLANNILKCFS
                     SIDEQLLEIKQSVGKAQLLDNYSLLAQQNVKFKRDFLLREYDTLSQILYGLVINGTLM
                     EKNHLLKLINHVTEMQSNNFFIIYYLPSIFAAFAKLEDLPDKEVQSIHSQFLQELKSD
                     SMYEKPIRVSLIFVFLSYFIKWCKSKPEKRANSMDFQSTVDEPMTKSVEFGALEQLLI
                     FAADTSISEKDKSIELFYDIRSLLERHIPRLAPINLLDTNPNDSSQKQQQQQHQQQQQ
                     LQIQNQQGHHDLHNLNDQFTKVSLSEQTNFSFLSTFHDVLRTIIADCAFLLTKIKDAE
                     EDSLLSGEDLDLDDIALRADLERFFLTIYYFYASRPQYSKLFWQDKESNAYGFVEWSS
                     KCNDSLMRSCFYLMISSLSYGSENALSVYHYFSGENNVSWNIIAQCISDYVLKITNLN
                     LRVQQKQQKQESEEVDSTAVALEEGLNEEAIIFISSLFTLIGSVASDVEEKIKNSLSD
                     LFIDTLFEFAKLDTPLIGACLQTLSHLVPKIESKRSNFWYALDSLIFRGAPLSSLASS
                     YQVAFTSVFTNFSEVVGFLQLFHKLVLIETKEVDSDYLFFGRLAFPAKLGQGYRKMGI
                     WPYFDYIFQEVLVHSNRLPDNKRACAIQLPILNIIEQALFSFDYRYIINSIPAQANFD
                     KLVCTGDFFTYVQECPAPVVFNYLFMEKVYNCIFSIASIGVDNLTIDLEGGAEQLQLI
                     DMAVKVMSLVLNFQDPYVEEFVSILRKNDENNYFIPKDFGLHGLRSFFDAILFNLPVV
                     AHLGLYVGLDKYSLGSNSLQILKMLSGRYSGDKFFTVGNKLLTIFESVDESARIKDAF
                     ISQLERPVESMENLTLKLELLEFISENLSFTDQTPTVAHLLLGFQISNVISTGPDLAT
                     FINSETSLLHSLINVLASSLQSLSSENIYYAPMRLAARILEIIVKLCRNPATSRIMLD
                     HFVTVQLFEQLVELDPQANSQTLWDGVLFQPKRISGWKSFVTSESNGALLSYLHYKSL
                     LLQYFSLAIHRLALAGSQSQVKAQVNLLISTKLCSAKIFSFLDTLTYGDIPTDHQTIK
                     KLSLFDNLPLNLETVTLKNDSRGNIYDFSSIKSLMELSVRVRSNGITDGASSSLGSSM
                     TEQLTQESNTVFQALSEFLSRNTYMDDQLSILHSWVQVVQILISDGQLSALERSNFIL
                     EIFSAIVPKINDYIELNISFSEELVSLAVALFDVYQKDRYEIDKFQSVDSRLYNLFKA
                     CIHGINSPLTNISIRSDFYVLANSYLVRILMDKNLAKPVLQDLKMNNEGLVEVICNDA
                     IYGQGSNRITGIFLLDSLIRLGDLNKENTILHSLMKNTHLLLIIRSIKNTDALLSSPT
                     ENITIDDLLYELTAFKTIAYLLIRIAESRNGAHALIQNKLFNVIGNCSFLGIDPDLGL
                     ELFFDEIAIKNSNFVSVNVSLDKPLFFGKDANGISLSEIIVPIFQLLSAVLLSMGSAN
                     TTVIREVKGLLIKSRRLTLGIIKRDALKDNETHRIDSSNTDGLEQMVKLVVLLCTLTG
                     YRGEETLS"
     gene            complement(<952112..>953992)
                     /locus_tag="HG535_0A04810"
                     /db_xref="GeneID:59234176"
     mRNA            complement(<952112..>953992)
                     /locus_tag="HG535_0A04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286373.1"
                     /db_xref="GeneID:59234176"
     CDS             complement(952112..953992)
                     /locus_tag="HG535_0A04810"
                     /inference="similar to AA sequence:RefSeq:NP_012494.3"
                     /note="similar to Saccharomyces cerevisiae NSP1 (YJL041W);
                     ancestral locus Anc_5.260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142268.1"
                     /db_xref="GeneID:59234176"
                     /translation="MSFGANSSGQDNKSLFQGQEKKSNNSDNTSVFSFGGAAQGTTSN
                     PGLFGAKVEQKGVPSKPTLLNLGGAQKATAPVNSDNKSQPATSSFNLGPTSNDSVKAP
                     SNTLFSSKTTNNAAPISFGGAAKTDNSNTSAKPLFSFSTTGTTDASSKKEAEIAKPAS
                     QAASSNDKKQDDKPIPFSFGATNGNENSSESKPAFSFGVNANTNTKPSLFSTEKKDDT
                     SQFSLGSKVQDNKPTPGFSFGSKDSSDKKEGSETANPAPFSFGSKAQDNKSTPGFSFG
                     AKNSLNKNEGTETGKPAFSFNSKVENNIANPSVPSLGTAKPNDEKRDSLASSGFSFGA
                     TKPSVEKQAATSKTETKGFSFSGDKSTTQKADSAPDGSQGGFSFGTQKPNEKEKLSST
                     GAFSFGTKKNEVKKESVESNLAEHKSNGQSLNPKTIEPVPISLDNKTLDDLITRWTEQ
                     LSGAGAHFNEFSKRINEWDQVLVKGGQQINQLYSDTLLAEQTQNRIDQSLQYVERQQD
                     ELEAFLDNYESKTEALLSDVLSTSGNGAANNNDQKRQQAYHTAETLDENLNSLSLNLS
                     SLISEINEVSNTFNKATAINLRNKDENTQLIKILNSHLDALKLLENNSSTLEQKIKLI
                     GK"
     gene            complement(<954945..>959198)
                     /locus_tag="HG535_0A04820"
                     /db_xref="GeneID:59234177"
     mRNA            complement(<954945..>959198)
                     /locus_tag="HG535_0A04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286374.1"
                     /db_xref="GeneID:59234177"
     CDS             complement(954945..959198)
                     /locus_tag="HG535_0A04820"
                     /inference="similar to AA sequence:RefSeq:NP_012493.1"
                     /note="similar to Saccharomyces cerevisiae MHP1 (YJL042W);
                     ancestral locus Anc_5.259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142269.1"
                     /db_xref="GeneID:59234177"
                     /translation="MSSNGSQDMLKKQQLPDLDVDWLVGARNLDLTNGNITNVPSNAT
                     GGNVRSRSGSLGSGERSGGLMSPQPVDLSKRYARRNSVASPPSNSASSEKSNTQHSKD
                     KDSNLSLRRTKSLSAAAAEDKARDGEFHSRRRGASISRASLSSSGSSSSLSHGGEKKM
                     GFFKSLFGRMKSKPEVSSDTQVPQSNQRPKSRASSISTPALPDKRRSSLVNESVSHDK
                     NQEQEEDIGNGVPLTRSKTESLIQDHNRHHHDSNKNIFNDDMNQQNEKRSSDGGNVSN
                     EQEDWDPRLMEFLQYYKSKGYSVSAFQKNSNPSTISSKKIYPRRSGRSTSFSLDVNTS
                     DLRKPNALKVKYDARGQPLPPHPSKSKLSPALKTHSNCKTYSGGSSDSDSDSESSSPS
                     TATPSSSHKFGAFLRRVTSYGASNSNNNVKDEVSSLRSTQTSKDPFDPGKADVVPGLE
                     DIKPLKYVSFAVNTYFNDPPQQICSKHPRQGEVEVKPNGSVVIHRLTPEEKRIILESS
                     STGVVVGGSGQLKLLIETDSHQGDDVRKKEEMAPSVRSETDDKVVSPSGEMREAEQKR
                     NIGRAAVETAETARERGLKDDSSSSKNEEDVTVSNIASRVTIDKPMISRRTGGEQSQT
                     SLSSMISQESEEEVFPPKKMKIPYDIVYTRCCHLREILPIPATMKQLKKGSTDPIPLL
                     QLRNPRPSMIEIWSFSDFLSIAPVLCLSLDGVSLSVDMLRTILSALTFKKNFEKLSLR
                     NTPLDHEGWKILCYFVSKSKSLVALDLTMVPSIKTNVQKPSKSSLKNNMPRMECDTKS
                     RRDMNWNLLAASVATKGGLEEVIISGAQMPSDQFSNFIEVACIATTRLGLAYNRLTKA
                     QCDKLANWIVQSKVTGLDIGFNDLNGKLSGFIDAIVDKIHNKGKSNVFKYISFNCTGL
                     EVGPNDTSETNEVLKLISILCYFENLKFLDISNNPKMFPHCMKTLINCLPVFVNLVRL
                     HLDYENLSSTLVVMLAEVLPLCSRLNYLSILGTKFDLASCKALADAVRKSSSLITLDI
                     DYTYMPANIREKVSLYTMRNVDSELNKVKSESGKPSDDKDQLSTLQDELSVLLTDDFK
                     DKELYDKLVERYIERVTIARSKIRKVVKDLFDTRVKGQLSTEGKETLIRLCFIEASFE
                     KGLRLLKDRHKAKLSSAYTDAYDSVKTDGPFPTIFESITEGGRSLANKAPKTDEDSSV
                     PASTVLSSSTFEQSGHSMLLPFSKADVEEFNPHADDTIELHEDDRESSNKISMQGREE
                     GSIFRSGTALTKKVHDNRSNNGNIVDLNYLENAGDSLKTDQIKDLLLKTDMSSVVNVI
                     DELHSKGYHLHDIFKKHDSETHKKLVDLSPQTSLNDGDDTSSSNTETDEKIKTGKDSS
                     ISSVGKSTTATADNSEADEAIDAAYDQVLDSIQRDRKPE"
     gene            <959676..>960971
                     /locus_tag="HG535_0A04830"
                     /db_xref="GeneID:59234178"
     mRNA            <959676..>960971
                     /locus_tag="HG535_0A04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286375.1"
                     /db_xref="GeneID:59234178"
     CDS             959676..960971
                     /locus_tag="HG535_0A04830"
                     /inference="similar to AA sequence:RefSeq:NP_012491.3"
                     /note="similar to Saccharomyces cerevisiae GYP6 (YJL044C);
                     ancestral locus Anc_5.258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142270.1"
                     /db_xref="GeneID:59234178"
                     /translation="MDLRQVAVDQYESRESLIRRGVWKGDLYKTVDVNKGSRGWLWKT
                     LVLDDDQEVKELMPVPILTEGSEDPTSAIVQSANRPRDNLIRRLTPVATKAHPLSQKQ
                     IGDMRDKGELEGQKVVEGDEDDEDGMSVSEKLEIIDLDLSRLMLDKIFQEPLVHARMK
                     QIMYNFLMRKGASSPSSYKQGYHEILGIIFLQLDEARRNNEGGNNDNSNNNNDDDDGD
                     AVMMNQVLCIFEKIMKQMVGVFYNETRLIKWDSDVFQPILNNSCPELYKLIYSNQHHH
                     TNIIWLIRWTRLLFIRELPRDYTLIIWDHILTFTYPLDTLIACIIVTLLVNNYQNLME
                     KIEDHNDIVEFMLHYSLNSSSMIDCVELCKMSGNLCELWYLQDFTAMKLVADSFLKIR
                     FNVENKTTPKAVKIDPNRKRLEDRLRKRVKQTLLTKETK"
     gene            complement(<960996..>961742)
                     /locus_tag="HG535_0A04840"
                     /db_xref="GeneID:59234179"
     mRNA            complement(<960996..>961742)
                     /locus_tag="HG535_0A04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286376.1"
                     /db_xref="GeneID:59234179"
     CDS             complement(960996..961742)
                     /locus_tag="HG535_0A04840"
                     /inference="similar to AA sequence:RefSeq:NP_012770.1"
                     /note="similar to Saccharomyces cerevisiae GPM1 (YKL152C);
                     ancestral locus Anc_5.257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142271.1"
                     /db_xref="GeneID:59234179"
                     /translation="MPKLILIRHGQSEWNEKNLFTGWVDVKLSAVGEKEAARAGQLLK
                     EKKVYPDVLYTSKLTRAIQTANIALANADRLWIPVERSWRLNERHYGALQGKDKAETL
                     EKYGEEKFTTWRRSFDIPPPEIEADSPYSQKGDERYSDVDPNVLPQTESLALVIDRML
                     PYWQDVIARDLLAGKTVLVTAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDD
                     NLKPTKPSYYLDPEAAAAGAAAVAAQGKKK"
     gene            complement(<962348..>963325)
                     /locus_tag="HG535_0A04850"
                     /db_xref="GeneID:59234180"
     mRNA            complement(<962348..>963325)
                     /locus_tag="HG535_0A04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286377.1"
                     /db_xref="GeneID:59234180"
     CDS             complement(962348..963325)
                     /locus_tag="HG535_0A04850"
                     /inference="similar to AA sequence:RefSeq:NP_012771.1"
                     /note="similar to Saccharomyces cerevisiae YKL151C;
                     ancestral locus Anc_5.256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142272.1"
                     /db_xref="GeneID:59234180"
                     /translation="MLFKKLSHGQLLKLARQKCIPPLSPKFHKGQSGRVCVIGGCEDY
                     TGAPFFSANACALMGCDMTHVICEKEAAPVIKSYSPNLMVHPYLRTGHLGEMDKIKTL
                     LEKMHVLVIGPGLGRDSGMLGSVKEIIKYVLEEHQGQIPIVLDADGLYLVTYDESVRD
                     MLVRFPQGRIILTPNVVEFQRLRKLYHDEIPEGEETGAYIARKLHCVLVEKGGKDHIF
                     AENHMLVNECEGSNKRVGGQGDTLSGATACMLAFSRAIFDFKLCGEPDKNLDWLDYSL
                     LSCYTASTVTRECAKQAFAAKKRAMQTTDLNERVGQVYDELFAEYNNEI"
     gene            <963663..>964559
                     /locus_tag="HG535_0A04860"
                     /db_xref="GeneID:59234181"
     mRNA            <963663..>964559
                     /locus_tag="HG535_0A04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286378.1"
                     /db_xref="GeneID:59234181"
     CDS             963663..964559
                     /locus_tag="HG535_0A04860"
                     /inference="similar to AA sequence:RefSeq:NP_012772.1"
                     /note="similar to Saccharomyces cerevisiae MCR1 (YKL150W);
                     ancestral locus Anc_5.255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142273.1"
                     /db_xref="GeneID:59234181"
                     /translation="MLTRLTRTNNKILPIVIGSAAVACSAYYASRFYHPILNESSKTV
                     FKGDDQWIDLKLSHIEDVSHDTRRFTFQLPEADSELGLTLCSALLAKYVTPKGSNVIR
                     PYTPVGDLAEKGSFQLVIKHYGDGKMTNHLFGLHPPETVSFKGPIKKFPWKENAFDSI
                     TLLGAGTGINPLFQLIHHIAKNPNDKTKVNVFYGNKTPADILLKKEMDALQKEHPDKV
                     KITYFVDQKEGEYDGEIGFITKDFIEAQAAKPDENTHIFICGPPPFMKAYSGPKVSPS
                     DQGELVGILKDLGYTKEQVFKF"
     gene            complement(<964621..>965790)
                     /locus_tag="HG535_0A04870"
                     /db_xref="GeneID:59234182"
     mRNA            complement(<964621..>965790)
                     /locus_tag="HG535_0A04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286379.1"
                     /db_xref="GeneID:59234182"
     CDS             complement(964621..965790)
                     /locus_tag="HG535_0A04870"
                     /inference="similar to AA sequence:RefSeq:NP_012773.1"
                     /note="similar to Saccharomyces cerevisiae DBR1 (YKL149C);
                     ancestral locus Anc_5.254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142274.1"
                     /db_xref="GeneID:59234182"
                     /translation="MMVKIRIAVQGCCHGELRQVFDKVRQLNGSSPIDLLIILGDFQS
                     IRDEDDFQSISIPPKYRKYGDFNNYYHDDSLKPPVMTLFIGGNHESMRHLMLLPHGGY
                     VANNIYYMGYSNVIWYRGVRIGGISGIWKKWDFYKKRPNWNYLEENCRWNDKVRELYH
                     TRESDILPLFMMCNSINKFDIMLSHDWPNGAVYEGNVQDILKKKPFFSRDIESRQLGS
                     PRSWELLRQLKPRWWLSAHLHVKFEAEIKHISKRPIKKNDDELELQLSSDEDEKDDRK
                     EKGDGDVLQSEQTTNFLALDKCLPRRKWLEIIEVESDESHKSYQDQDSFFYDPHFIAC
                     LQLLRKNQPISLNNMQYGKIPTDVDWQHYIVPRYVNGLQRQERLQTNEFEKKFFL"
     gene            complement(<966021..>967952)
                     /locus_tag="HG535_0A04880"
                     /db_xref="GeneID:59234183"
     mRNA            complement(<966021..>967952)
                     /locus_tag="HG535_0A04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286380.1"
                     /db_xref="GeneID:59234183"
     CDS             complement(966021..967952)
                     /locus_tag="HG535_0A04880"
                     /inference="similar to AA sequence:RefSeq:NP_012490.1"
                     /note="similar to Saccharomyces cerevisiae YJL045W and
                     SDH1 (YKL148C); ancestral locus Anc_5.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142275.1"
                     /db_xref="GeneID:59234183"
                     /translation="MLSVRSKSRSVISAVSALKRSFQTSAYLNQVQGSVDGNSSSSPL
                     EGSKYHIVDHEYDCVVVGAGGAGLRAAFGLAEAGYKTACLSKLFPTRSHTVAAQGGIN
                     AALGNMHKDNWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHFGVPFSRNDEG
                     RIYQRAFGGQTKDSGKGGQAYRTCAVADRTGHALLHTLYGQALRHNTHFFIEFFAMDL
                     LTHNGEVVGVMAYNQEDGTIHRFRAHKTIIATGGYGRTYFSCTSAHTCTGDGNAMVSR
                     AGFPLQDLEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACR
                     DVVSRAITMEIKEGRGVGKSKDHMYLQLSHLPPEVLKERLPGISETASIFAGVDVTKQ
                     PIPIIPTVHYNMGGIPTKWNGEALTIDSETGEDKLIPGLLACGEAACVSVHGANRLGA
                     NSLLDLVVFGRAVAHTIADTLQPGLPHKPLPNDLGKESIANLDKLRNANGSKSTAEIR
                     LSMQKAMQDDVSVFRTQETLDAGVKNIAEIDESFDDVRVTDRSMIWNSDLVETLELQN
                     LLTCAAQTAVSASARKESRGAHAREDYPERDDEHWMKHTLSWQKNTSDPVTLKYRRVI
                     ANTLDEKECPPVPPAVRAY"
     gene            <968628..>970568
                     /locus_tag="HG535_0A04890"
                     /db_xref="GeneID:59234184"
     mRNA            <968628..>970568
                     /locus_tag="HG535_0A04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286381.1"
                     /db_xref="GeneID:59234184"
     CDS             968628..970568
                     /locus_tag="HG535_0A04890"
                     /inference="similar to AA sequence:RefSeq:NP_012776.1"
                     /note="similar to Saccharomyces cerevisiae AVT3 (YKL146W);
                     ancestral locus Anc_5.252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142276.1"
                     /db_xref="GeneID:59234184"
                     /translation="MTSVSNESAVSGTSSSNGGQNGQKITTALLKKRPSDSDGNYNTL
                     SNDNQIDMNKPDPQVVDIVSRHLVKDSDNLQLKSGDMTRDIYKWTSEHPISSSSPGDT
                     MMNSPQMQQDAQPISMAQRRRSISFSGASAHSSGIYSSTRNSEFELPPHVAMTHEEIR
                     APGGFRRSFIVRKHERKYGNNAPPPNFLTRNFIEFLTLYGHFAGEDLEEEEDEDEEGT
                     EQEGRIHERTDLLERGQVSETDTAEVSDHRHKTSTFKAVLLLLKSFVGTGVLFLPKGF
                     ENGGWGFSVLCLLFCAIASFYCFVILISAKDKVGVSGYGDLGAKLYGSKVKFAILFSI
                     AISQIGFAAAYIVFTSTNLKVFAEHVFGVKKDSLGLAFYIALQTVIFIPLAFTRNISK
                     LSGTTLIADLFILLGLLYVYYYPVYYIIENGLASDSMVFLNKNDWSLFVGTAIFTFEG
                     IGLLIPIQESMAHREKFQPCLSGVLCLVAFIFISTGLICYSAFGSDVETVVLLNFPQN
                     SPFTKSVQLLYATAILLSTPLQLFPAIRILENWSFPTNASGKHNPRIKWLKNYFRSGV
                     VIITALVAWAGANDLDKFVSIVGSSACIPLIYIYPPLLHHRAFKNDSRFNVSRSFDIL
                     IAVFGTLVMLYITYQTIVLWGS"
     gene            <970834..>972243
                     /locus_tag="HG535_0A04900"
                     /db_xref="GeneID:59234185"
     mRNA            <970834..>972243
                     /locus_tag="HG535_0A04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286382.1"
                     /db_xref="GeneID:59234185"
     CDS             970834..972243
                     /locus_tag="HG535_0A04900"
                     /inference="similar to AA sequence:RefSeq:NP_012777.1"
                     /note="similar to Saccharomyces cerevisiae RPT1 (YKL145W);
                     ancestral locus Anc_5.251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142277.1"
                     /db_xref="GeneID:59234185"
                     /translation="MPPKDDWEKYKAPVESGEEKKDTEDKSVPLTEGDIQVLKTYGAA
                     PYAGKLKETEKDLKEIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVAR
                     CTKIIRSNGNGVESSEAAPLGGSSSGDNAQAGNNEDVDEDEDAKYVINLKQIAKFVVG
                     LGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKE
                     QIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV
                     IGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRT
                     MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFR
                     IHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVE
                     KVINGYKKFSSTSRYMQYN"
     gene            complement(<972395..>973042)
                     /locus_tag="HG535_0A04910"
                     /db_xref="GeneID:59234186"
     mRNA            complement(<972395..>973042)
                     /locus_tag="HG535_0A04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286383.1"
                     /db_xref="GeneID:59234186"
     CDS             complement(972395..973042)
                     /locus_tag="HG535_0A04910"
                     /inference="similar to AA sequence:RefSeq:NP_012778.1"
                     /note="similar to Saccharomyces cerevisiae RPC25
                     (YKL144C); ancestral locus Anc_5.250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142278.1"
                     /db_xref="GeneID:59234186"
                     /translation="MFILSKLKDLVRIPPDQFHRDTISAVTHQLNIKYSDKIIPHLGL
                     CVTIYDLLEVDEGQLKPGDGASYINVTFRALVFKPFVGEVITGWISKCTAEGIQISLL
                     GLFDVIFIPQKMLFEGSYYSPADNAWVWPMDEETKLYFDINEKIRFRVEQEIFVDVKP
                     KSPKERELEEQQGLKQQEKKEEGDGNDEKPLNKPPAYALLGSCQTDGMGLVGWWE"
     gene            <973318..>974712
                     /locus_tag="HG535_0A04920"
                     /db_xref="GeneID:59234187"
     mRNA            <973318..>974712
                     /locus_tag="HG535_0A04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286384.1"
                     /db_xref="GeneID:59234187"
     CDS             973318..974712
                     /locus_tag="HG535_0A04920"
                     /inference="similar to AA sequence:RefSeq:NP_012779.1"
                     /note="similar to Saccharomyces cerevisiae LTV1 (YKL143W);
                     ancestral locus Anc_5.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142279.1"
                     /db_xref="GeneID:59234187"
                     /translation="MSKRFSKKNAQKYVVVHRPHDDPQFYDEGASAHVLVPVDEHGKV
                     TSTSSQKIDISSEKRRQPKERIGEAVLYGIEFDDSKYDYTQHLKPIGEDPSNSIFIPA
                     KGANAEDAKAKKNNIEDLFVEPTYQAAEPVTSVFQRGVAKPEYLIHQQDVTDDIKGFK
                     PDMNPALREVLEALENEAYVVNDDIVVEKTKIAKPSSENVEDDDIFAELLGSGEVEDE
                     EQFEAKLDEWDIDNLAEYEDDHYHEELQNIDNVENLEDLKDIDYQADVKRFQKEQKQW
                     QQKSVDGESNNEFDNESDQQTSDLELDDLGDLPTFDSNNKSKTGSKRRKERKKKGAMS
                     DISGFSMSSSAIARTETMTILDDKYDQVIAGYDNYREEQEEDFEENYQLFDMKKERSD
                     FEFLLDDFLDNYELDKGGRKLCKKSEELDKLKRAADEVSKGKLSQRRNRERLAKQNKE
                     SVGKVTNSLSNLKL"
     gene            <974933..>975586
                     /locus_tag="HG535_0A04930"
                     /db_xref="GeneID:59234188"
     mRNA            <974933..>975586
                     /locus_tag="HG535_0A04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286385.1"
                     /db_xref="GeneID:59234188"
     CDS             974933..975586
                     /locus_tag="HG535_0A04930"
                     /inference="similar to AA sequence:RefSeq:NP_012780.1"
                     /note="similar to Saccharomyces cerevisiae MRP8 (YKL142W);
                     ancestral locus Anc_5.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142280.1"
                     /db_xref="GeneID:59234188"
                     /translation="MSGELELLKTQVAELQELVKRQTLLISKTGQNVLELQVSKQRSD
                     VNSFGSSKQSSGSKVSNPQVESADLATNEDLVQLVGELQGQLDTIEERSIRRLANSAK
                     VDAHEFLSPLPNADGEIPLAEGNLFPRTLKEFKAITNISLFKLAKFYELLPPSLKEQE
                     AFEDFLEGKVQDFHIDEIPDEEVEKELKKYSADQLEDVFNDLARYLGLKQRRGTATW"
     gene            complement(<975662..>977713)
                     /locus_tag="HG535_0A04940"
                     /db_xref="GeneID:59234189"
     mRNA            complement(<975662..>977713)
                     /locus_tag="HG535_0A04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286386.1"
                     /db_xref="GeneID:59234189"
     CDS             complement(975662..977713)
                     /locus_tag="HG535_0A04940"
                     /inference="similar to AA sequence:RefSeq:NP_012524.3"
                     /note="similar to Saccharomyces cerevisiae YJL010C;
                     ancestral locus Anc_5.247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142281.1"
                     /db_xref="GeneID:59234189"
                     /translation="MAKVRGRKHLKKAQKDEFTPVSDVSLTQNGNEVPEQQIENDGSD
                     PQMFFGILDREELEYFKQAEATLAMDAFESVEEKQRFVTNIVEEMQGKELKLVTSQIC
                     SKLMERVILICNDSQLKHIFKSFNGFFYNLSCHKYGSHVIETLLVRATALVEKELLTP
                     SFDSIDTEGDDNGEGFGTMENMFLFMINEYKPHIKVMINHNYSSHVLRLIILILSSKK
                     LPKTNQNNSALRSKRSKIARKMIDIKDNDDFDKMYQTPESFKLELRELIASLFKEFTG
                     EEIKAHPDVSISIVTKFRALCVDKVASPVIQLIIQVEGIFDRDRSFWKLAFNTNDEKN
                     PKEESFMEYLLSDPVGSHFLQSVIGFGRVKNVERLYYLYIRDRIVKLAKRDSTGAFVV
                     QALLEILKAKEVKQILDAIVPELSMLLNSNMNFGTAIIDASIKQDNYKREEVIEQLIE
                     KYYRRESTEKNILESCLQLSSSTLGNTRDDWPTAEERRRSLFLEKLIDFDGKFLDITI
                     DTMLSLPEERFLQMCFHGVFSHVVEHVLQPQRVNTVKRKRLLNVLCKDVVNLACNAYG
                     SHILDKLWSFTAKLTLYKERIAGAMNQESEKVKNSVYGRQVWKNWNMELYVRKMWDWK
                     MLVKEQETEIFPDSKPLQPTDHKRNSNKRFRNNTESNPYNSSSKRANQNKNNVPLGKQ
                     I"
     gene            complement(<977907..>979628)
                     /locus_tag="HG535_0A04950"
                     /db_xref="GeneID:59234190"
     mRNA            complement(<977907..>979628)
                     /locus_tag="HG535_0A04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286387.1"
                     /db_xref="GeneID:59234190"
     CDS             complement(977907..979628)
                     /locus_tag="HG535_0A04950"
                     /inference="similar to AA sequence:RefSeq:NP_012526.1"
                     /note="similar to Saccharomyces cerevisiae CCT8 (YJL008C);
                     ancestral locus Anc_5.246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142282.1"
                     /db_xref="GeneID:59234190"
                     /translation="MSLKLPQNPNSGLFKQGYKSYSNADGQINKSINAVREIHQMCLT
                     SMGPCGRNKIIVNHLGKIFITNDAATMLRELEIVHPAVKVLVMATEQQKIDMGDNTNL
                     VMVLAGELLILSEKLIALGLSAVEIIQGFNMAKNFTLEELDKIVVDQITDKTSTEELI
                     KVIKPVIASKKYGSEDLLSRLVGEAVSHVLPRSNNTSVPFFNVDSIRVVKIMGGSLSN
                     STVIKGMVFNREPEGHIKSLPEGGKYKVAVFTCPIDIATTETKGTVLLRNAEEMLDFS
                     KGEEEQIDKMIKEIANMGIKCVIAGAGIGELALYYLSRYDILVLKVPSKFELRRICRV
                     CGATPLPRLGAPTPEEIGIVETIKTMEIGGDRVTIFKQESDEVTRTSTIILRGATQNN
                     LDDIERAIDDGVAAIKGLLKPNGGNLLPGAGATEIELVSRITKYGERTPGLLQLAIKQ
                     FALAFEVVPRTLAETAGLDVNEVLPNLYAAHTILPSSVEAEEQQNNDYLYKGIDIQDE
                     SPEGVIDVKEEGIYDMLAPKKFAINVATEAATTILSIDQIIMAKRAGGPAPPPQGPRP
                     GNWDQAD"
     gene            981581..981653
                     /locus_tag="HG535_0Atrna2M"
                     /db_xref="GeneID:59234625"
     tRNA            981581..981653
                     /locus_tag="HG535_0Atrna2M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:59234625"
     gene            <981828..>984281
                     /locus_tag="HG535_0A04960"
                     /db_xref="GeneID:59234191"
     mRNA            <981828..>984281
                     /locus_tag="HG535_0A04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286388.1"
                     /db_xref="GeneID:59234191"
     CDS             981828..984281
                     /locus_tag="HG535_0A04960"
                     /inference="similar to AA sequence:RefSeq:NP_012505.1"
                     /note="similar to Saccharomyces cerevisiae VPS53
                     (YJL029C); ancestral locus Anc_5.245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142283.1"
                     /db_xref="GeneID:59234191"
                     /translation="MISSGLEYDPTLDITTILSAKGSIEDIDKLINATRGYKLLLEEE
                     IASDRKQEAAANEELSSKTFEFDKIFQDIEATRTFASTTQSTISHLTQGISHLDNAKR
                     NLTLCMTVFQNLKILTDSYTRCKSLLAKDKFKESTSSYEIMCSLAENTFRPYKSVDEI
                     NRLLMSIARLRKDTFERIKQTYHKVIIGKAADAGQLESQLREGACVLLECDPSDKSQI
                     IDWCIDKLLYEINEIFKLDDEAGSLENLSRRYIFFKKILNNFNSNFSRYFPQEWGMQL
                     KLTNRFYEMTQRDLSILLDREFNGKGSSIDLFMGSLQTTLDFEKYIDVRFSNKLKGSK
                     LSSCFKPYLSLWIAHQDKMMKDKLLTYMGSNTLDFTMSDSWIISSSADLFRTYRSVLS
                     QTFELIENNADERVPILLANFFAKWLKAYLDKILKPLLLPPSVEIQNKEETIKYTVSL
                     VNTSDYCSTTVEQLVVKLTEFSAETGKISQIFDEVKSDYDEVLAAGISILLNRIIQLD
                     LSFVWKEFNNTDWSNVAVEDSSRYMVSMKNILSFATGQYVTDESSTLELILTKFNREV
                     YTWNFLDKIIDLVTHDYSKYIILLLQRQPPFANLNAPRKFSPSTVTNIAEQFLLDLEL
                     LKNILNSILQGVSSSNQNSEGPAYKRVQKHIDANLELLLKFLKLLLAPLDSVDDYYET
                     YKELTISNSNTSVWAFMLTLKGLEWDLALWKQYWTPFNLDSDDSTDEISKKNVLIFKW
                     NPRLLQQFEYNMARVSEPAWSKFIRNELKISASRVNASRNQVDPHQQQQQQQSRSPVS
                     PVLNVKNLVAGTRFFNRGV"
     gene            complement(<984303..>984899)
                     /locus_tag="HG535_0A04970"
                     /db_xref="GeneID:59234192"
     mRNA            complement(<984303..>984899)
                     /locus_tag="HG535_0A04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286389.1"
                     /db_xref="GeneID:59234192"
     CDS             complement(984303..984899)
                     /locus_tag="HG535_0A04970"
                     /inference="similar to AA sequence:RefSeq:NP_012504.3"
                     /note="similar to Saccharomyces cerevisiae MAD2 (YJL030W);
                     ancestral locus Anc_5.244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142284.1"
                     /db_xref="GeneID:59234192"
                     /translation="MSQSISLRGSTRTVTEFFECSINSILYQRGVYSQDDFTTVKKYG
                     LTLLKTQDDDLKAYIRVILLQVHKWLIGQKCNKLVLCIVDKDECEVIEKWAFDVVHLK
                     NEKFIEEDHEPLDPSETQNQIRALIRQITASVTFLPELTNEGNYTFNVLAYTDANAKV
                     PLEWSDSDSKEVTNAETVKFKTFATNDHKVSAQVSYKH"
     gene            <985355..>986119
                     /locus_tag="HG535_0A04980"
                     /db_xref="GeneID:59234193"
     mRNA            <985355..>986119
                     /locus_tag="HG535_0A04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286390.1"
                     /db_xref="GeneID:59234193"
     CDS             985355..986119
                     /locus_tag="HG535_0A04980"
                     /inference="similar to AA sequence:RefSeq:NP_012503.2"
                     /note="similar to Saccharomyces cerevisiae BET4 (YJL031C);
                     ancestral locus Anc_5.243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142285.1"
                     /db_xref="GeneID:59234193"
                     /translation="MQLKNELDLLFWSSELLFTLAQLRQFPKVYWIWNHRIWVLENHL
                     DSSVNIWKEELVMVSKLLKIDARNFHGWLYRRIIVRKIEQLTGEKKLFEELAYTTENI
                     NNNISNFSAWHQRTVLLSKIFGENENESNAKMIHDEFAYITNAMFTDAEDQSVWFYIK
                     WFIKNKVVRETLEPSEYARLLQELHSNVVMINQDDLEFSGKENNWCLKILIVLDDVLK
                     NIGIETCIEKKKCLEQLINADPLRKNRYLCLLNDGQ"
     gene            complement(<986125..>987096)
                     /locus_tag="HG535_0A04990"
                     /db_xref="GeneID:59234194"
     mRNA            complement(<986125..>987096)
                     /locus_tag="HG535_0A04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286391.1"
                     /db_xref="GeneID:59234194"
     CDS             complement(986125..987096)
                     /locus_tag="HG535_0A04990"
                     /inference="similar to AA sequence:RefSeq:NP_012528.1"
                     /note="similar to Saccharomyces cerevisiae CTK2 (YJL006C);
                     ancestral locus Anc_5.242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142286.1"
                     /db_xref="GeneID:59234194"
                     /translation="MSSKSDTLLFLSRPFLTKKQILKAQSNNIQDHRAYNQKKLAIIK
                     FLSDICVQLRFPRKTLEAALYFYQRFYLFNKFETELCYTIATSAILLSCKQVETIKKS
                     NEICSISLRLRSVAKVTPEILDNFKKRVCQHELRLLEAISFDYRINNYVHIDEYVIKL
                     GKELAFSQETCYLAWIIAYDVLKTEIILVVPQHTISLAVLKIAHELPNAKSTWPTIRY
                     TTFESDEKSFSEAYFDLLNFYINSFDLCDLKDNMPSGLQSISIDTFIELKKRAGREYG
                     LKNPTDKEVDTDLYLSTQYDTSNVRERRYVLSAKSINSEVASMNQKP"
     gene            complement(<987274..>989589)
                     /locus_tag="HG535_0A05000"
                     /db_xref="GeneID:59234195"
     mRNA            complement(<987274..>989589)
                     /locus_tag="HG535_0A05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286392.1"
                     /db_xref="GeneID:59234195"
     CDS             complement(987274..989589)
                     /locus_tag="HG535_0A05000"
                     /inference="similar to AA sequence:RefSeq:NP_012501.1"
                     /note="similar to Saccharomyces cerevisiae HCA4 (YJL033W);
                     ancestral locus Anc_5.241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142287.1"
                     /db_xref="GeneID:59234195"
                     /translation="MAKGHRSTTSQRKESRKNEIQYIKELETRTQEFDLKNNKTNFFR
                     DLPISNATLKGLQEASFIKLTEIQKDSIPVSLKGDDVLGAAKTGSGKTLAFLVPILEK
                     LYRERWTEFDGLGALVISPTRELAMQIYEVLTKIGAHTTFSAGLVIGGKDVKFELERI
                     SRINILIGTPGRILQHMDQAVGLNTNNLQMLVLDEADRCLDMGFKKTLDAIVGNLPPS
                     RQTLLFSATQSQSLADLARLSLTNYKTVGNSEAKNGTNGLENEISTPETLQQCYIEVE
                     LAEKLDTLFSFIKTHLKNKMIVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKAR
                     TETLDKFSRAQQVCLIATDVVARGIDFPAVDWVIQVDCPEDVDTYIHRVGRCARYGKE
                     GKSLIMLTTQEQEGFLKRLKSKNIEPNKLTIKQSKKKSIRQQLQSLLFQDPELKYLGQ
                     KAFISYIRSIYIQKDKEVFKFDEIPTEEFANSLGLPGAPKIKIKGMKAIERAKTLKNS
                     SRQLLSLSKVEDDGETLKEEPKKVRTKYDKMFERKNQTILSEHYMTVTKAAADENEDE
                     DFMVIKRHGHQLDEKDLPELIAPTSRRAQRKALSKKASLSSKNNPSKMVFDDDGNAHP
                     IYELEDEEDFEKRGSAQRQKKEFLSKESATMAEVDTEDKNLAKQKKQEKKRRQLELMR
                     REMEASMAEEHSEDDNIGEPVAYVGTGHLSDDMDEDNYESDNDPHPRKRQRVDYKHDS
                     ESHTDTNDIIEVEEPQTLEDLESLTSRLISN"
     gene            <989878..>990492
                     /locus_tag="HG535_0A05010"
                     /db_xref="GeneID:59234196"
     mRNA            <989878..>990492
                     /locus_tag="HG535_0A05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286393.1"
                     /db_xref="GeneID:59234196"
     CDS             989878..990492
                     /locus_tag="HG535_0A05010"
                     /inference="similar to AA sequence:RefSeq:NP_013116.1"
                     /note="similar to Saccharomyces cerevisiae PML1 (YLR016C);
                     ancestral locus Anc_5.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142288.1"
                     /db_xref="GeneID:59234196"
                     /translation="MDKIQKISYHDRNSGFKRSRFEGKPLKVVLPIFEPSGLLELESH
                     NKEGVQLKHVEPSDAQSPADYWKEMKVPARNRSLYQLMVYKRGQEKVVNEYNLDSKSN
                     YIVGRALGRSINPENSENGSKEVVIADVQIPEETCSKQHCVIQFRKKNRELKIYVIDL
                     DSSNGTLLNGVVLPRARYVELRSGDVLILSSEGDSEYELVFVSI"
     gene            complement(<990663..>992708)
                     /locus_tag="HG535_0A05020"
                     /db_xref="GeneID:59234197"
     mRNA            complement(<990663..>992708)
                     /locus_tag="HG535_0A05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286394.1"
                     /db_xref="GeneID:59234197"
     CDS             complement(990663..992708)
                     /locus_tag="HG535_0A05020"
                     /inference="similar to AA sequence:RefSeq:NP_012500.3"
                     /note="similar to Saccharomyces cerevisiae KAR2 (YJL034W);
                     ancestral locus Anc_5.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142289.1"
                     /db_xref="GeneID:59234197"
                     /translation="MAFGSSNSSRWLVPLAVIFYALFVVVLPFQNSGHGSRALARAEE
                     AEQYGTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDEERLIGDAAKN
                     QVAANPTNTIFDIKRLIGLKFDDRSVQKDMEHLPFKVINKNGKPAVEVEVKGEKKVFT
                     PEEVSGMILGKMKQIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIV
                     NEPTAAAIAYGLDKTKDEHQIIVYDLGGGTFDVSLLSIENGVFEVQATAGDTHLGGED
                     FDYKIVRQLIKTFNKKHGIDVSNNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDG
                     IDLSETLTRAKFEELNLSLFKKTLKPVEKVLEDAGLEKTDIDDIVLVGGSTRIPKVQQ
                     LLESFFDGKKASKGINPDEAVAFGAAVQAGVLSGEEGAEDIVLLDVNPLTLGIETTGG
                     VMTSLIKRNTAIPTKKSQIFSTAVDNQQTVMIKVFEGERAMVKDNNLLGNFELTSIPP
                     APRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLSQDDIDRMIEEAEK
                     FASEDASFKKKIESRNKLENYAHSLKNQVNAELGEKLDDEDKETLLDAASDVLEWLDD
                     NFETAMSEDFDEKFDELSKIAYPITSKLYENAGGEGASDDYFDDEEDDEDYFEHDEL"
     gene            <993042..>993782
                     /locus_tag="HG535_0A05030"
                     /db_xref="GeneID:59234198"
     mRNA            <993042..>993782
                     /locus_tag="HG535_0A05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286395.1"
                     /db_xref="GeneID:59234198"
     CDS             993042..993782
                     /locus_tag="HG535_0A05030"
                     /inference="similar to AA sequence:RefSeq:NP_012499.1"
                     /note="similar to Saccharomyces cerevisiae TAD2 (YJL035C);
                     ancestral locus Anc_5.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142290.1"
                     /db_xref="GeneID:59234198"
                     /translation="MVGHCDWMGLAVRLARYALDQGETPVACVFVYEPMGEVIAYGTN
                     DTNGSLTGIAHAEFMAINHLQSAVGTGAEMLRLARSITVYVTVEPCIMCASALRQLGI
                     GKVVFGCANERFGGNGTVLHCNKDASAGLNGTYRSVPGIMRREAIMLLRYFYVRSNER
                     SPKPRNKSERHLDKTSFPLLNWGRYLEESEFVEEFGEEQTNHYANHTDVAEKINWSLV
                     DEGCDDIINELERRCSRFVEHRNKRVKQ"
     gene            complement(<993822..>995084)
                     /locus_tag="HG535_0A05040"
                     /db_xref="GeneID:59234199"
     mRNA            complement(<993822..>995084)
                     /locus_tag="HG535_0A05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286396.1"
                     /db_xref="GeneID:59234199"
     CDS             complement(993822..995084)
                     /locus_tag="HG535_0A05040"
                     /inference="similar to AA sequence:RefSeq:NP_012498.1"
                     /note="similar to Saccharomyces cerevisiae SNX4 (YJL036W);
                     ancestral locus Anc_5.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142291.1"
                     /db_xref="GeneID:59234199"
                     /translation="MGRTDPKGNLVPNHDRSKKPEHKLEILVSDPQKRSGDQSTTSSY
                     VSYQISTKTDNPAYQKYHDDAGGIIVVHRRYSDLLLLHNILSNDHPTCIIPPLPDKKV
                     FQYIAGDRFSQSFTQKRCHSLQNFLRRVANHPILAVSNSLMMFLVSPDWDAYRKSLAG
                     HLQQNNKDEVTDVFMNAFKTVHKQSDEFVEIKEKSDKLDHNVAKIDKIFHRVVKKYDA
                     ISEDYSKFGSNIQDLQELCTGENEMLSQNLKNFNEGITQLSFGIRDLSKYLDYEYIVD
                     LKDLEHYIDSMNQLIKLKEQKQIDYEELSEYLTKSVNEKNNLISGYGGSNFFTNKLEE
                     LAGINQESARREKIDKLETKINCLTGELESSKKIADAFEQETLKEVSLFEELKTKELK
                     TSLGSLADHHIEFYEKLLETWVKVDENL"
     gene            complement(<995293..>996735)
                     /locus_tag="HG535_0A05050"
                     /db_xref="GeneID:59234200"
     mRNA            complement(<995293..>996735)
                     /locus_tag="HG535_0A05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286397.1"
                     /db_xref="GeneID:59234200"
     CDS             complement(995293..996735)
                     /locus_tag="HG535_0A05050"
                     /inference="similar to AA sequence:RefSeq:NP_013115.1"
                     /note="similar to Saccharomyces cerevisiae BRE2 (YLR015W);
                     ancestral locus Anc_5.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142292.1"
                     /db_xref="GeneID:59234200"
                     /translation="MKIGVIPYQKDDIVNNNSGHSGTRPRWPSMQDTHEVNAGHGDVL
                     KFKKLEEVPLNRRNFIYIPCAANPSFTELGYCCTEYAFDKPGMSLMDRSDGISVAERR
                     NDLVSVKENLGWRSSRCDVCIKEGKHYWEVEVLQGGLSDDYLIDSDTTLQRKKDMTNV
                     MPHLRMGISRREASLEAPVGFNSYGYGIRDHSLESIHGGKINQVLKARTLKHGDRLGF
                     LLNLPPLKVQIEQAKEFTQRRIDALNNVQDATAQDLSFATHEDHVHLRKKMKKNAANK
                     EFQKALLHDIDHNNIIRDHIAIRYKNQLIFEATDYVKTTKPEYYSSDKRERHDYYKLE
                     GSSLAITLNGEPLGKAFEGLKPFLPPFSELQYKEKFYLDCWKNGANSSVDSNSPTTSN
                     QRQGTILRNKYVNNNKLGYYPTISCFNGGTARIITDRSNLKYFDESEKATLLDTLYDE
                     QIAEDIVWDIIDEIEEESLVQLEKPLVNKI"
     gene            <997066..>999834
                     /locus_tag="HG535_0A05060"
                     /db_xref="GeneID:59234201"
     mRNA            <997066..>999834
                     /locus_tag="HG535_0A05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286398.1"
                     /db_xref="GeneID:59234201"
     CDS             997066..999834
                     /locus_tag="HG535_0A05060"
                     /inference="similar to AA sequence:RefSeq:NP_013114.1"
                     /note="similar to Saccharomyces cerevisiae PPR1 (YLR014C);
                     ancestral locus Anc_5.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142293.1"
                     /db_xref="GeneID:59234201"
                     /translation="MKREAIHDDMHSEDESGTSTSTASDSRKRRPILAMAGITKSISA
                     CKRCRLKKIKCDQEFPSCRKCAKAGVPCVSLDPATGRDVPRSYVMFLEDRLSAMMSKL
                     KDCGVDPTTVQGNIPATSEDVPCNLELYEEKMRGEHQVPYDNVLAGFLINKGTSMQRG
                     VSNPGSAQLHGEKEAELKDAKGESVQHSSPAARFSTDSITRSIELDESSKNVAAIGSM
                     KNNASNSYLGDSSGISFAKLVFTAVNFRPDFINEESDEEIGKREEKYEQYADTESTTD
                     FEPLWLPPPETADLLISQYFVDSNSQLPILHREVFLKKYYEPIYGPWNSDLSLASDNT
                     EINSSFQLPKSDDGMEERSSNTRSKALEEQPWYFILSKLSEDELKEFKLPNKFKIPYF
                     FLNMVFTIGHSVQVLKSDIQFLVSLKRRAVQFSNSLYGSPDRMEALAGTLLLATYSLM
                     RPNIPGVWYTMGSALRLTIDLGLHAEKLNRNYDPFTRELRRRLFWCVYSLDRQICSYF
                     GRPFGIPEENISASYPSLLDDALITTFNDNINDYSKVQTSMATSKVIALAMFKVRRIQ
                     ANIVTVLYAYHGEVPRKYANLHVWREAMDQALDNWYHKEIPKTYKKMNCKFNTEYFKL
                     NYYNTKTMLYGLSPKSLSLSDKAFEVVYENTKGTIDSYFTLCHKKKLNYTWVTVHNLF
                     MAGMTYLYVIYYSDRGVTDGRLMAEDYTARLLFVLRELIGTCEAAKNCFIFYKVLSAA
                     VLKLKFTMQHDDPKDQEENNKNTQTHNDTPAPVSVTGNVIAMSTNNSPTDSLRATMME
                     DPFEILRAKRELQQIGDVPLDEFFDELEKNTAMSDPESSKSHFSNMTSPERVIHSGVG
                     STTAMSNNENRHSRKSFPAKDGQKVMDILSQITTESIWDEFFGKSGMLNGNELPENFN
                     FNNNGNFS"
     gene            1000824..1000905
                     /locus_tag="HG535_0Atrna2S"
                     /db_xref="GeneID:59234627"
     tRNA            1000824..1000905
                     /locus_tag="HG535_0Atrna2S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:59234627"
     gene            complement(<1002145..>1003167)
                     /locus_tag="HG535_0A05070"
                     /db_xref="GeneID:59234202"
     mRNA            complement(<1002145..>1003167)
                     /locus_tag="HG535_0A05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286399.1"
                     /db_xref="GeneID:59234202"
     CDS             complement(1002145..1003167)
                     /locus_tag="HG535_0A05070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142294.1"
                     /db_xref="GeneID:59234202"
                     /translation="MSTNKISFLLNWQPAPYHIPIYLAQTKGYFKEQNLDMAILEPTN
                     PSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGLLYLQGSGITED
                     FKSLKGKKIGYVGEFGKIQLDELTKHYGMVPEDYTAIRCGMNVAKYIIDGKVDAGIGI
                     ECMQQVQLEEYCKQRGRPATDAKMLRIDKLACLGCCCFCTILYICNDEFLKKNPEKVK
                     RFLKAIKKATDYVLANPEEAWNEYIDFKPELKNDLSFKQFQRCYAYFSSSLYNVHRDW
                     KKVTGYGKRLEILPPDYVANYTNEYLSWAEPEEVSDPLEAQRLMAIHQESCRDCGGFK
                     RLALPA"
     gene            <1003705..>1004100
                     /locus_tag="HG535_0A05080"
                     /db_xref="GeneID:59234203"
     mRNA            <1003705..>1004100
                     /locus_tag="HG535_0A05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286400.1"
                     /db_xref="GeneID:59234203"
     CDS             1003705..1004100
                     /locus_tag="HG535_0A05080"
                     /inference="similar to AA sequence:RefSeq:NP_013110.1"
                     /note="similar to Saccharomyces cerevisiae TEN1 (YLR010C);
                     ancestral locus Anc_5.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142295.1"
                     /db_xref="GeneID:59234203"
                     /translation="MSRIIYKLNELKELPPSTSVRYRVFGKLLEIEEILNDTHYVCQL
                     VIGCLEELYDDHSYEVEKCSIDAIVGYDVYKQLSTPLQDGCAIDAYIGIVTFKEIRMF
                     EVLNVQLLTLEELRSLRLFTSSQAGRELF"
     gene            <1004102..>1005235
                     /locus_tag="HG535_0A05090"
                     /db_xref="GeneID:59234204"
     mRNA            <1004102..>1005235
                     /locus_tag="HG535_0A05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286401.1"
                     /db_xref="GeneID:59234204"
     CDS             1004102..1005235
                     /locus_tag="HG535_0A05090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142296.1"
                     /db_xref="GeneID:59234204"
                     /translation="MKFAFEKFDIVLARSLSKPGHIFHLSKPLQSSLQLNCGNGTIAH
                     DDIIGKNYRSLVVSSNDHKYIIVKPTLEEYIVNRRREAQPIYSLDAALIVQLSDILVH
                     HPQIKQTGSNWCGLESLQAPSRYKRLNLGDPFDNFLNDKLQQNGSSVHSISLVERPKQ
                     FLECGTGHGSLTLNILKAVHGANCYYDGVNDLTRGAILHSLDKNAKHLNVGMQNVKHY
                     EKGILWPDVEFHLTNSPNDWLEGEDAKYYRERLAQSANRFLSGVFLDMPSPELQLSKL
                     SEALYLDCPLIVFVPSITQIWDCLSFVKTNGVKLTLTKTYELTPGSGGGGMREWDLRR
                     SLIRESGAEGIVMRPKVGTRVVGGGFVGVFRKLPNDAIVKTWD"
     gene            complement(<1005364..>1005957)
                     /locus_tag="HG535_0A05100"
                     /db_xref="GeneID:59234205"
     mRNA            complement(<1005364..>1005957)
                     /locus_tag="HG535_0A05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286402.1"
                     /db_xref="GeneID:59234205"
     CDS             complement(1005364..1005957)
                     /locus_tag="HG535_0A05100"
                     /inference="similar to AA sequence:RefSeq:NP_013109.1"
                     /note="similar to Saccharomyces cerevisiae RLP24
                     (YLR009W); ancestral locus Anc_5.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142297.1"
                     /db_xref="GeneID:59234205"
                     /translation="MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRR
                     NPRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVQTTLSAMERVEEIRQK
                     RERAFYKNRMKGNEEKDFLRDKALVEANPELLRIREVEMAHKLAQREQQEIEEGEAGE
                     EEEEDMEVDSEEEEEQESQKQKVLLKNKRRASKKIAF"
     gene            <1006243..>1006740
                     /locus_tag="HG535_0A05110"
                     /db_xref="GeneID:59234206"
     mRNA            <1006243..>1006740
                     /locus_tag="HG535_0A05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286403.1"
                     /db_xref="GeneID:59234206"
     CDS             1006243..1006740
                     /locus_tag="HG535_0A05110"
                     /inference="similar to AA sequence:RefSeq:NP_013108.1"
                     /note="similar to Saccharomyces cerevisiae PAM18
                     (YLR008C); ancestral locus Anc_5.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142298.1"
                     /db_xref="GeneID:59234206"
                     /translation="MSNGNNNAGSIEIPQLPIPGETKSDFNTTNGVSMPQQQPIAAEK
                     SGMDLYFDQALDSMGRHPIWTGVGAFFTLYVAAGAYKSISTRLNGGKTGTTFLKGGFD
                     PKMNAKEAMQILNLTENNLTQKKLKEVHRKIMLTNHPDKGGSPYLATKINEAKDFLEK
                     KVLRK"
     gene            complement(<1006781..>1007707)
                     /locus_tag="HG535_0A05120"
                     /db_xref="GeneID:59234207"
     mRNA            complement(<1006781..>1007707)
                     /locus_tag="HG535_0A05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286404.1"
                     /db_xref="GeneID:59234207"
     CDS             complement(1006781..1007707)
                     /locus_tag="HG535_0A05120"
                     /inference="similar to AA sequence:RefSeq:NP_013107.1"
                     /note="similar to Saccharomyces cerevisiae NSE1 (YLR007W);
                     ancestral locus Anc_5.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142299.1"
                     /db_xref="GeneID:59234207"
                     /translation="MSEDTLDVSDSLDILSEEQLCRYLLQFIFECRGICHENLLLSAL
                     MKVQERCVNGAESSSWSVEQWQSRLAELINKWNVKLSLLDYKIIRVNHGIGKKCASNM
                     IRNLDNFSFPDSNRFYVYVNSKTSDEMKLATRFSAREIEFIKWSLERIISAGLKIHEG
                     ILDDDDALVKEIDLIRRSVTGSDVPRWDNSCSFTVGSMELSQYGPMNALEIEGLIEKL
                     IHLKWFYKNRRGEVGMDLKAIVELEDNLIESFQLVRCPVCDTLTLHGVMINGQENQSA
                     TYWHADCYQHYITHVGHDYLGTSLITNGIYVI"
     gene            <1008065..>1010167
                     /locus_tag="HG535_0A05130"
                     /db_xref="GeneID:59234208"
     mRNA            <1008065..>1010167
                     /locus_tag="HG535_0A05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286405.1"
                     /db_xref="GeneID:59234208"
     CDS             1008065..1010167
                     /locus_tag="HG535_0A05130"
                     /inference="similar to AA sequence:RefSeq:NP_013106.1"
                     /note="similar to Saccharomyces cerevisiae SSK1 (YLR006C);
                     ancestral locus Anc_5.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142300.1"
                     /db_xref="GeneID:59234208"
                     /translation="MNEIASGAKIKQRSPTDASRPLSSALPWKVWVKIEGNPYNINQP
                     ISIQFNEMDTIDDLKTKLLERLNPSRWSQFVDNTSIAIGIYGTSTELDETPISATSPI
                     ETDSFLNRSRRFLPPESTPSPPFSFDKPSNMNPTNTASTIGSPHRSRSNSSGIAAVIP
                     RSPLVRYSSILPYCNLHSYQQSRSEFSNVPMPLSTSLNTARGRHISIYKKPFKMITER
                     DALDPNTEQQQIIFEPDALVVNIYADLFGYMGSQRSSEALSVIANNYEDSYIPATPLE
                     TINVATFIPTNEEIARQILESDEPNGKDDEFSLHTPPPPDLNIVDEPEAPQLLNSQSE
                     QEETGREFKFITDEEQLLKESQSFKDTEQSSEHPKPAILLLPKGYTGDVDFSENSPKD
                     DSAPFPASQVSTPKASAKPELTLTIPPYAPLDENEVGLIHPLLESERHKMEASPVSFK
                     ELGNEKSRPPTSEFGPHTQIPDRTTNSTSTNTKVFPNITVLIVEDNVINQTILCSFLR
                     KHKISYKVAKNGQEAVEKWQEGDIDLIFMDLQLPILSGTEAAKQIRDLEKKKGSSKVE
                     SDKPTKKAPVIIVAFTASDSQSVKSNALLSGCNDYLTKPVNLHWLSKKINEWGCMQAL
                     IDFDAWKEGQSRMTERLSMKKSPKIPVKPEMKHSSSSHRIRSSSNGSSQSKLSETKNR
                     PKLHSRKPTGTGITCEKC"
     gene            complement(<1010361..>1011740)
                     /locus_tag="HG535_0A05140"
                     /db_xref="GeneID:59234209"
     mRNA            complement(<1010361..>1011740)
                     /locus_tag="HG535_0A05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286406.1"
                     /db_xref="GeneID:59234209"
     CDS             complement(1010361..1011740)
                     /locus_tag="HG535_0A05140"
                     /inference="similar to AA sequence:RefSeq:NP_013105.1"
                     /note="similar to Saccharomyces cerevisiae SSL1 (YLR005W);
                     ancestral locus Anc_5.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142301.1"
                     /db_xref="GeneID:59234209"
                     /translation="MTTVADLDSDEGESIKVSSRDVRRQRKQIIEDDNDQSGGQTSED
                     KRRRRERRSHGKRKKLSNKNLQGANGGYAWEDEIKRSWDLVKVDDDGDMSLLAASIIE
                     SRKKRTAQKNITPYQRGIIRTMVLVLDCSEAMLEKDMRPNRHVMMVQYAIDFVHEFFD
                     QNPISQIGIVSMRNGLAQLITAVSGNPQDHIDALKLMRKQEPKGNPSLQNALEMSRGL
                     LLPVPAHCTKEVLIVFGSLSSADPGDIHQTIASLVQESIRVKVIGLAAQVAICKELCK
                     QTNYGDENFYKVPLDETHCKELFDEAVVPLPVNKINKGFTLVKMGFPTRIFEESPTFC
                     SCHSKLTYGGYICPNCHSKVCSLPTVCPCCNLMLILSTHLARSYHHLMPLKTFKEVAA
                     DKDFPTENCFSCQLKFPTIKNYKTGELLTSSRYRCENCHKDFCIDCDVFIHETLHNCP
                     GCESEPVIM"
     gene            <1012323..>1013948
                     /locus_tag="HG535_0A05150"
                     /db_xref="GeneID:59234210"
     mRNA            <1012323..>1013948
                     /locus_tag="HG535_0A05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286407.1"
                     /db_xref="GeneID:59234210"
     CDS             1012323..1013948
                     /locus_tag="HG535_0A05150"
                     /inference="similar to AA sequence:RefSeq:NP_013104.1"
                     /note="similar to Saccharomyces cerevisiae THI73
                     (YLR004C); ancestral locus Anc_5.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142302.1"
                     /db_xref="GeneID:59234210"
                     /translation="MTSPDLEKVYSKTSSEENTKGATNISSSSVDDTSSNEENIDVAL
                     RFLKDTNAKDFVLDDDQDTLITDVSEDAKKSRRDRAIFYGACDLPKNVLRRLDTFILP
                     FLCVTYLLMFLDKALLNYAAAMGINDHLKGNEFSNLSTIFSASYIFMEPFVTFLIQRF
                     PISKVMAVFITCWGISLTCHAACKSYASLMIVRTLLGMFESSSAVGCIAISGMYYTKA
                     EQSARIGFWATQAGTGYVVGGLISFGFQHYHGKSFTSWQIMFLVVGLVTVAFGILTYL
                     YLPDNVTNAWFLNQEEKVLVVKHIRDNQTGLENKKFKKAQVKELLLHDKLTWPMLFIT
                     AASQISTGAIGTFSVTITRTFGFDSKETALLQLPIGVITAMIIIITTQMIARWGQITL
                     VTTSMYIPAIIGSIVMLCLPLSNKIGNLLALYLIYSGSCTITNIYIWNSCNTSGYSKR
                     IFRNAITIIAYNVAAIVAPQMFRANSAPRYVPAKIALLVTQAVCVPVQLYIGYISKKE
                     NEKRDKEQEGQSVEKYQFLDLTDIENRNFRYIY"
     gene            <1014101..>1014967
                     /locus_tag="HG535_0A05160"
                     /db_xref="GeneID:59234211"
     mRNA            <1014101..>1014967
                     /locus_tag="HG535_0A05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286408.1"
                     /db_xref="GeneID:59234211"
     CDS             1014101..1014967
                     /locus_tag="HG535_0A05160"
                     /inference="similar to AA sequence:RefSeq:NP_013103.1"
                     /note="similar to Saccharomyces cerevisiae YLR003C;
                     ancestral locus Anc_5.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142303.1"
                     /db_xref="GeneID:59234211"
                     /translation="MSNSDDLDGNVDYDYESEPEIQIERERKAEVVLKNVKNTSEEEE
                     EDVQNKLKRSIEADDTKSISKRKKKLMNSKFHDRKREQIEYDIEQKKSIPKSSPEAIT
                     EYFAKSIRENNPDLSPLELNEMYLKRTDFLSTEKFDQDRDVLNFTVFMTQFSKAPKCI
                     ILSMSNIRVADLFRGLGGSKNCLKLFAKNKFKDDLASVEECFNVHTKVKSKDTPQAVK
                     YFIATPTRMAKLLEATDVFFQGKDKLDIILDASYLDPKNNTLLKCENTKELCKVLRTV
                     LNKKSSVKVLLY"
     gene            complement(<1015020..>1017131)
                     /locus_tag="HG535_0A05170"
                     /db_xref="GeneID:59234212"
     mRNA            complement(<1015020..>1017131)
                     /locus_tag="HG535_0A05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286409.1"
                     /db_xref="GeneID:59234212"
     CDS             complement(1015020..1017131)
                     /locus_tag="HG535_0A05170"
                     /inference="similar to AA sequence:RefSeq:NP_012538.3"
                     /note="similar to Saccharomyces cerevisiae APL1 (YJR005W);
                     ancestral locus Anc_5.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142304.1"
                     /db_xref="GeneID:59234212"
                     /translation="MSDHKIFTRYKANEIRAELQSFEVKKSKVSANKRKDGLKKIIAN
                     LTLGNYNEMAYLAPEILKFWKIEDDLEVKRICHEYVRSFGIVNPKNTVEALPFILNDL
                     KNRNEKIQIMALKTLVAVPSAEFIDEASRIIPSFVNRRSVPPDVTRTAIYALKRLDEV
                     NHDRVVECLPFLLELIQRENVDPIIHVAALNTLNSIHESNPNLQPLKLSMETAFNSLD
                     LLQTLNEWDKALVLDALTISAVPGSHEDAYEMIDIVLPQLQHVNTFVALNAFKFIAYL
                     LNYVDSVNESLIKRFSNSIISLLNKPPELQFLVLRNVILLLLSRDVPLLNLDVSYFFI
                     EFTDPIFIKDTKLECLYLLANEETLPRILEELEQYATDIDIQMSRKAIRAIGNLAVKL
                     KHHSASECVTALLDLLEFGVEYVVQEIISVFRNILRKHPSEFKSCIKDLVKYTDSVQE
                     PESKNAMIWIITNYSDNMSNYLQIFQIFSSKFLEETLDVQFSILNSSVKFFVRDPNPK
                     TEKICMQMLKSCTEDSNNPDLRNRAFMYWSLLSLAQTDKAHLLSNESLKNILDGELPV
                     IELNTKLDPVILEELELNIGTIASIYLKPVSQIFRNTRPRYLLPSPALNKSRGQLKIL
                     HDTKNWNNLESLDTLHEDFSNNRSDKSAHKKSMMNDYDKPAETVNQLKGKRKSSSTSP
                     SKLSRKPSMLVRKLSIRKPFS"
     gene            <1018714..>1021557
                     /locus_tag="HG535_0A05180"
                     /db_xref="GeneID:59234213"
     mRNA            <1018714..>1021557
                     /locus_tag="HG535_0A05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286410.1"
                     /db_xref="GeneID:59234213"
     CDS             1018714..1021557
                     /locus_tag="HG535_0A05180"
                     /inference="similar to AA sequence:RefSeq:NP_012537.1"
                     /note="similar to Saccharomyces cerevisiae SAG1 (YJR004C);
                     ancestral locus Anc_5.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142305.1"
                     /db_xref="GeneID:59234213"
                     /translation="MFSTSIRSAICLLWLAGIALAKTIDSISFSGLQYSPLTSYKFPH
                     QGWTASFDFDISENVHQDDHFTMNFPLIYRIKFDGNDPSTIVSLNDGTKAFECYVSQQ
                     AAFLYNSTNFRCNAITDLSSYSSVSGSITFSFSFSSGGSIYPFELEDATQFHSGTMNV
                     PLTEDLSAEITFDRGSFDGDIYTIGRTTTYDSLETYYLGMKCPNGYLLEGSQTINYDH
                     NDGNYNLDCSSVQGYMAASFNDWLLPLEHKDSNAEVSCSSNTLAVKVHEADSGEMFWI
                     NALQSVSEGVNTVQHDVQMQYTCSDTIHNTIYSTQFHTIVEYVIYQGKAYATASVTSE
                     APTISPGSISATASQSSLFESLGPTSSSNPSKTISTVSSSISSTITSTISSVSPLSSS
                     TPVDSFSNTTIFTTTTTSWTGNFTTTYSTFTGTSGSGNVFTEEIVYHVRIPTTSSSVF
                     TQSTTTSTVLCSLCSRSSALSSTASPSDSTSTENLSAPKSTSMSSGTSTSKMVSLYTR
                     SLSTSMVYPSSSSSSPSFVISSVLSSRKSLTPNSTLTKLTSTFTTSSTGSTSTFNSLV
                     ISSIPASSPGFPVVSTPSNSVLNSTSIGLPSILTSFSATVSTSSASTSNLLSSESEYS
                     PFASTSSSSTYMHTSDTESVFSDTQASFVMSTSTAVATVSNSTVETTTLHGNSYSLSQ
                     SESIDRTFTEISSSILAYTEQSSTTIAGFTATYGVFSITNSLSSVITDSTGRVGSVSR
                     APLSSGTALSISQFLIGIETGKFVTTSTNLTNAESMKPLPSYTEIITITGQLSSSMST
                     TNTIVTGSPMSPTTVPVTENTRLTEASSPLVSMEELKSSSSPTLGTSEGWFSHISSVT
                     ASASSLTSHSSLSTTHSNSPSAITNGITDSLATAVTVTETTNSIRPFSLAHIPVSSQG
                     PSPIYQGGASVQTAGKLFVLVYSFCSIFSYLLV"
     gene            <1021771..>1023312
                     /locus_tag="HG535_0A05190"
                     /db_xref="GeneID:59234214"
     mRNA            <1021771..>1023312
                     /locus_tag="HG535_0A05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286411.1"
                     /db_xref="GeneID:59234214"
     CDS             1021771..1023312
                     /locus_tag="HG535_0A05190"
                     /inference="similar to AA sequence:RefSeq:NP_012536.2"
                     /note="similar to Saccharomyces cerevisiae YJR003C;
                     ancestral locus Anc_5.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142306.1"
                     /db_xref="GeneID:59234214"
                     /translation="MSINRRFLSQSLRILHSKRPNLSEVYVDLFEQQCFKSLRSQLPQ
                     HLDDLEPHQLSQSLNEIISKSGMSKKEASLIHNSLIQKLSKFEYGISTLHSKELQKIG
                     ESPNYNSIKEIIRNNPGRVLDSWELLFKYAPKLSDELLATALESIVSLNAVDKSEKRD
                     FSTLAAAQCIILLDNISQKEVVKPELIEKLLIYALDNDLSYVLPSILSFGLSSLKVFE
                     SRYENVTPLQIFLLNKFCPFDLLKQSKSLLYKTIDILGRKATIEGNENELLHAEILIQ
                     DVSRLKLGIPSSWRVPDVVARPQDSSLAFLKLFDQIHTDKQDRNDFTVAQKLMRIFGT
                     YRDNTKISLELYHSYLTSYPGFSHELMFETCLALAFQSYRTSNQTLLRYSEAFIPPDA
                     HPSMLANIYCALILANSKFTVDESLEIYNNCIDQFSNENDPKTSISPQGMITESLILA
                     YLSKAEIQFARVVFEGAVREGVIKGPTAIRRVKKLLSLYGDAIEKDELLNNMEQKVLS
                     TLQTM"
     gene            complement(<1023504..>1024418)
                     /locus_tag="HG535_0A05200"
                     /db_xref="GeneID:59234215"
     mRNA            complement(<1023504..>1024418)
                     /locus_tag="HG535_0A05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286412.1"
                     /db_xref="GeneID:59234215"
     CDS             complement(1023504..1024418)
                     /locus_tag="HG535_0A05200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142307.1"
                     /db_xref="GeneID:59234215"
                     /translation="MTIKMMKLIKVDPSTSKSTKPAPSYTCFRMETGIGKSAKVDDRL
                     FCSAQKTESPIIFHNVHPNCIGERIQSNEHQSLSYAFSNKFGKEAGHSLQGVDDKLLL
                     TKNANNIPLRIKIDPKYQNTNLTSNRSFVGASDNNRRITFIPSSSNGSLVPIFISDNL
                     RSSTFASKNSMNNSDTARSLSSSSTSSSSSSSGCILKEDSVSKTTKISYKRQNRRRMR
                     DPMNSKDFTSKTTSEVKRQLVAFNRVRCKYGTLKAINEPQSIAKRNSSLGKFTSDARI
                     KLRKNGLRTATDFSTGTFRVKMREKEKL"
     gene            <1024648..>1026672
                     /locus_tag="HG535_0A05210"
                     /db_xref="GeneID:59234216"
     mRNA            <1024648..>1026672
                     /locus_tag="HG535_0A05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286413.1"
                     /db_xref="GeneID:59234216"
     CDS             1024648..1026672
                     /locus_tag="HG535_0A05210"
                     /inference="similar to AA sequence:RefSeq:NP_013102.1"
                     /note="similar to Saccharomyces cerevisiae NOC3 (YLR002C);
                     ancestral locus Anc_5.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142308.1"
                     /db_xref="GeneID:59234216"
                     /translation="MSRRKRSQEAARERAAKRIKEQDALLDNHLFQNAMDIPEDNTTE
                     YYEENPQNPQNPIDKLWDDEEQDYEMKPRKLQGYEEDVVEGLPIKINGKVERKMLKKN
                     SPKNEEDNMESDEASDDATSDNSGSDIDGGDEPNEEVDTEEKIVQLKEEIAELVENIM
                     EEPEENVSSLSRLCRMSESRNPNTCKFSMLALVPVFKSIIPGYRIRPLTETEKRERVS
                     RDVAKLRNFEQTLVSCYKNYIENLKKLSKVPNSEVKVKVSLGILATQAANELASNGAH
                     FNFRKEVFSILIRRVSKPNLSADPIAAKTIKTLELLLSEDDDGLISFDIVQILCKTVK
                     LRKYNVEESVLNILLSLDILQDYDPNTKAEKEASQVKLKKKDRVHLSKKQKKARKEMK
                     QIEEEMEKAEQAVTAEEREKNQGEILKLVLSLYLNTLKFEISSLVAPVLEGLVKFGNM
                     ANFELLGDFLEVMKELLLDAKKDALSPSEIRKTVLLIVGAFSIVSNQNQMKVHIDLSV
                     FVDGLYALLPYISLDADIELSHKSLRLADPLNNEILKPLVNHSTTAELLLKALDHIFF
                     RSRSGTKLRALAFTKRIYTCVAQTPEKTSIALLKFLEKLINRYPEVGALYSTDDRVGN
                     GNFNMEADNVFRSNAEGAILWENNILVHHYCPVVAQGLRSLANRSKEFAK"
     gene            complement(<1026837..>1028693)
                     /locus_tag="HG535_0A05220"
                     /db_xref="GeneID:59234217"
     mRNA            complement(<1026837..>1028693)
                     /locus_tag="HG535_0A05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286414.1"
                     /db_xref="GeneID:59234217"
     CDS             complement(1026837..1028693)
                     /locus_tag="HG535_0A05220"
                     /inference="similar to AA sequence:RefSeq:NP_012535.3"
                     /note="similar to Saccharomyces cerevisiae MPP10
                     (YJR002W); ancestral locus Anc_5.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142309.1"
                     /db_xref="GeneID:59234217"
                     /translation="MSNFFKTLQASPADVISLDSFEALQSVKSHVDEVINLYKKSEPT
                     KKTDFEEITITGLDARQVWWQTKMVLDDVEADLLEKIDDLRNVIDSTSSDEDEELKEV
                     LEGREGYESTNSRSEDAYESDRSSEILESSGEEQKEELQEENEVTSEEAVADKLQFEQ
                     QEPYEDEGKHTFRLSQDLKEGAAMESGQEAVGEKEPEAKTDKYGLNDDFFNFNEFNRQ
                     TLEAEENSGSTDGTDESIDYFEDVPSDEDEEAIYYEDFFDKPASKNVSTKSQRGSEEM
                     QEDLTNADYQSALKFAKLDLFAEDEDVSDEEDNSKEYEEKHSSHQKQQSRIQMQIEEL
                     EKEAVAEKKWALKGEVKAQDRPEDALLTEEIEFDRTAKPVPVITAEVTESLEDMIRRR
                     IKDENFDDLQRRVLVDLTARSRKPQFELSDQKSSKSLADIYEDDYKHVSQDATITEEL
                     KKSHDEISELFTNLNYKLDALSSAHFIPKPPQKSLEVRVETDAITMEDAQPLSMSSAS
                     ALAPQEIYSVGKSDNSNEIRLKDGTTMAKDEMSRENKSRLRRAIKRKRSKAIKDHQSK
                     PNKQSKKESAIETLSRAKNVTVIDKKGGKSDVRGNIKSSSTSLNNHGHQIKL"
     gene            complement(<1028889..>1030733)
                     /locus_tag="HG535_0A05230"
                     /db_xref="GeneID:59234218"
     mRNA            complement(<1028889..>1030733)
                     /locus_tag="HG535_0A05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286415.1"
                     /db_xref="GeneID:59234218"
     CDS             complement(1028889..1030733)
                     /locus_tag="HG535_0A05230"
                     /inference="similar to AA sequence:RefSeq:NP_012534.1"
                     /note="similar to Saccharomyces cerevisiae AVT1 (YJR001W);
                     ancestral locus Anc_5.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142310.1"
                     /db_xref="GeneID:59234218"
                     /translation="MAQSSEQRPLNGSSSNGNNDGMTSSHPHVTYVSIPIHRNSDYGE
                     EIDQPGSFGTFHTRRQSILDQPIGSFRGVNSLSRFATSLRRANSFRHIDVRPDVERNY
                     FEDSNDELYDPETMAPSHDGRRLSVAISKAGNISVRPSITNFDNSIRQSGTRETEDYG
                     STGFLHQHDNSSLYRPAFSISDSIGGIGSNVGGGQVGDVESIMVKRVNRGDGEVVTIL
                     AGQSTGPQTIFNSINVLIGIGLFALPLGLKHAGWIPGTFLLVLLALGTFCSAELLSRC
                     LDTDPTMISYADLGYAAFGSKGRALISCLFTLDLLGCGVSLIILFGDSLNALFPKYSS
                     NFYKIIGFFAVTPPVFIPLSILSNISFLGIMSTVGTVLLVTFCGIWKKSAPGSLIEPM
                     PTHLWPSNLKDFCLSIGLLSACWGGHAVFPNLKSDMRHPEKFKDCLKQTYKITTFVDI
                     GTAIVGFLMFGGTVFDEITRNILLTEGYPQFVYVLLSVLMSIIPIAKTPLNARPIISV
                     LDIITGVQGMQNKPDKPFAKKFLVIFNRIFINALFVLIAILFPKFDKLIAFLGAGLCF
                     AICLILPCMFYIRICKATIRPWEKVLCHVTIGVSAALAILGVGAAIIS"
     gene            <1031301..>1033895
                     /locus_tag="HG535_0A05240"
                     /db_xref="GeneID:59234219"
     mRNA            <1031301..>1033895
                     /locus_tag="HG535_0A05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286416.1"
                     /db_xref="GeneID:59234219"
     CDS             1031301..1033895
                     /locus_tag="HG535_0A05240"
                     /inference="similar to AA sequence:RefSeq:NP_013101.1"
                     /note="similar to Saccharomyces cerevisiae YLR001C;
                     ancestral locus Anc_5.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142311.1"
                     /db_xref="GeneID:59234219"
                     /translation="MIFGLYNGLWNQSAMFLSSLLLWGILAHGGSDFPFTTVVDILSE
                     NVEFSTFLRILQRQGCVPILNELQNYTLLAPVNSAFINMGTNESSTPFVLDNFILRNN
                     VLSTSLIDDGITVIDCDVRFPLVLQKSVSSGSTLIKINEATIVDPDLAPSFQSATVHG
                     ISDLINDPPLLIDFLQDLEGQTGEFSLFEKFVESLTSDNIITDMEFYNNTILIPSNIN
                     FHRYFNQLEINYILDNFSKLDSVTGNIRKAWEKNRLNFFRNLILRGVHGGVHSQPEST
                     ENLNNDKISFESNDFGSSISVNDSELSIDSNIVFDRGIIHSFNDIPFLSKATHFNAET
                     YLHGMNSSDFVQELYFRNLQKMLEDESLDVPLTIFVPETSLNEKFGYTKSNLLYHFIE
                     NQLWLEEEFLGIKSSTKMFESAFCSSNKRLGGNCQRLRIKKNLNGYIINDKYKILHNK
                     PFEIGKTLIYTISEVLQLPGDFVPSLNPFYHCSKSLELLRKINLLDLPPNQEGYTILL
                     PCFESWSTNGLDLEYLRRNLTAIELMMKNMILEGLIYTDSEDINLNTKNMFDQEISIS
                     VRTESSADSEKVFLNLSSVRESIETELNMDVFFNQGVIHPISKSYFPNDLSITLGDLI
                     ETTGTTAFIDFLNFFDDFNAVLSNNDSYSLLVPTKNSLRIDGIDKNFTSLHQWLELHV
                     IPGNATSDLLECGNQINTTSGEPLTCRESSPGNYLLKLKNGNDNEVRILKKGCTSFDM
                     NSCVFLIDRPISLQWLSPNKYHLKLPGVAIGIGIVLGAISVLALLFCILVVFVGRNHG
                     TKVGEQPTDTEDNAAARPLLSANNAEPNSLAGSNDYQRRRFESAYSSNSSRKPIDVST
                     VRTSVNPV"
     gene            complement(<1034344..>1036692)
                     /locus_tag="HG535_0A05250"
                     /db_xref="GeneID:59234220"
     mRNA            complement(<1034344..>1036692)
                     /locus_tag="HG535_0A05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286417.1"
                     /db_xref="GeneID:59234220"
     CDS             complement(1034344..1036692)
                     /locus_tag="HG535_0A05250"
                     /inference="similar to AA sequence:RefSeq:NP_013100.1"
                     /note="similar to Saccharomyces cerevisiae DNM1 (YLL001W);
                     ancestral locus Anc_5.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142312.1"
                     /db_xref="GeneID:59234220"
                     /translation="MASLEDLIPTVNKLQDVMYDAGIDTFDLPILAVVGSQSSGKSSI
                     LETLVGKDFLPRGTGIVTRRPLVLQLNNIPHDSPLIKSPSSSSDSVANENSHSLREKV
                     STEEMTLEEHLRKGAPEYQKPNDEEWGEFLHLPGRRFYDFSDIRKEIENETARIAGKN
                     KGISKIPINLKVYSPKVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILEYVATPSCI
                     ILAVSPANVDLVNSESLKLAREVDPHGKRSIGVITKLDLMDSGTNALDILSGKTYPLK
                     LGFVGVVNRSQQDIQLNKTVEEALDNEEEYFNRHPVYRTIATRCGTRYLAKLLNQTLM
                     SHIRDKLPDIKARLNTLIGQTEQELEAFGGMGIITSENRAGLVLQLMNKFATNFISSI
                     DGTSSDISTKELCGGARIYYIYNTIFGNSLKSISPTANLSMSDIRTAVRNSTGPRPSL
                     FVPELAFDLLVKPQIKLLLDPSQRCIELVYEELMKICHNCGTPELSRYPKLQSKLIEV
                     VSELLRERLGPTRSYVESLIEIHRSYINTNHPNFLSATEAMSDIIAKRKSNNSMVAFN
                     KKSSIKSSSPDVGSMKETSSRASQSPSNSPKLESNRSLESEPEDRMDEADAKSKDSFL
                     KYFFGKDNIEHPENGPLHGRINGITRLNKDINGQTHLDMNNLQISNDAKQDHIDNDEE
                     MAPALTEREQLECELIRRLIVSYFNIVREMIQDQVPKAAMCLLVNFSKETLQNRLVTK
                     LYKESMFEILLQEDQTLAQDREKCVKLLDTYKKASNIIGGIL"
     gene            complement(<1037040..>1038338)
                     /locus_tag="HG535_0A05260"
                     /db_xref="GeneID:59234221"
     mRNA            complement(<1037040..>1038338)
                     /locus_tag="HG535_0A05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286418.1"
                     /db_xref="GeneID:59234221"
     CDS             complement(1037040..1038338)
                     /locus_tag="HG535_0A05260"
                     /inference="similar to AA sequence:RefSeq:NP_013099.1"
                     /note="similar to Saccharomyces cerevisiae RTT109
                     (YLL002W); ancestral locus Anc_5.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142313.1"
                     /db_xref="GeneID:59234221"
                     /translation="MALREYLAQALPDQEQFEILHLQNPSKESHPVITPQSSNKSGLI
                     TVKNQHFFALFHKEKAIYALEIYVYITLTPEVQDTIAERIVFVSKADTNGYCDCEVSF
                     KKITQQLLRYVLSINPNYYLQKVIPRHREYHKFDKHLITKKTKPTDALRLLAKRQGDV
                     SLMSSINLNVGIYHSFQCQPNIITKICLFTKPSPQYLFAESSKNPKKHQLDGASLLKW
                     WLDILDELIVECFDQNTTANLRIPGEDETVVNRYLRGLKHNGWEAGDLFTKKSNEKHD
                     LAAFRIPLFPDDPKSRFLHQLADEGRILSMYLKAYWAELQERQEFRLSVTVSVIGIQG
                     HQAEEPIYVPNNKHDVFLTSSKKQFNSIKNYITGEAYDTIEGAFEAYLNVKYFLGDRF
                     GRRLIKVEGVAKYRWIKKESIEKRRQDIINTLSVRKKPKK"
     gene            complement(<1038553..>1039134)
                     /locus_tag="HG535_0A05270"
                     /db_xref="GeneID:59234222"
     mRNA            complement(<1038553..>1039134)
                     /locus_tag="HG535_0A05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286419.1"
                     /db_xref="GeneID:59234222"
     CDS             complement(1038553..1039134)
                     /locus_tag="HG535_0A05270"
                     /inference="similar to AA sequence:RefSeq:NP_012533.1"
                     /note="similar to Saccharomyces cerevisiae PRE3 (YJL001W);
                     ancestral locus Anc_5.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142314.1"
                     /db_xref="GeneID:59234222"
                     /translation="MAVTFADGVILGADSRTTTGAYIANRVTDKLTRVHDSIWCCRSG
                     SAADTQAVADVVQHHLELYTVQYGAPSTKTAASIFREICYENKDALSAGIIVAGYDER
                     SKGEVYSIPLGGSLHKQPFAIAGSGSTFIYGYCDKNFKENMTKEETITFMKNSLSQAI
                     KWDGSSGGVIRMVVLTKEGVERLIFYPEDYEKL"
     gene            complement(<1039514..>1042441)
                     /locus_tag="HG535_0A05280"
                     /db_xref="GeneID:59234223"
     mRNA            complement(<1039514..>1042441)
                     /locus_tag="HG535_0A05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286420.1"
                     /db_xref="GeneID:59234223"
     CDS             complement(1039514..1042441)
                     /locus_tag="HG535_0A05280"
                     /inference="similar to AA sequence:RefSeq:NP_013098.1"
                     /note="similar to Saccharomyces cerevisiae SFI1 (YLL003W);
                     ancestral locus Anc_5.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142315.1"
                     /db_xref="GeneID:59234223"
                     /translation="MAGDGSKEFLLKNFELSDGTDSSVSTQLLINENVVSDSTDSLVN
                     ERIQELLDRVHITEYLPVNSDLSENTQEPFSFLPKRLHHEEAEAALNAEEFQGYRYTN
                     NNVVKRKDLSMNQEYYPILAILYNRIQVFLLNNKMSLDFLKIFKSYMNHIIESGLNVL
                     EDRYFLELQNELSDGFHFGPVMEEILNKFLLRPENLIMKLALFEHKMMLGNLQRFFSA
                     WQLKCDMKLSLVKLENVWKQYIQRKYTAIWSRKYQYLESNLVTQANEFRVFTSLSSGF
                     DKWMGKLDTNHAKDGLADHFFLDHIFRKIKKYVKTMNFMETEANGKYVRERQRYALRF
                     MRLRFAETQFTCYKNDLKRILLRKLQSKLDHYKLLKARAEFTDSIFVLSSYLKKWYEK
                     TESSIAHSNHLASLETRFRNKRTLNTLKDILNRNNQELQLMARLDRLLLEYTFKNIWQ
                     KRFQEHISMYSFWNKQNQQIVTLFLDAWRERLYFNSQAYQFRRKQQLLNAMLAWRIAS
                     KVKSHMYRNDRRRLAITFEQWLVKARLRKKHAHFLHGIIARMMFLRWKSTYLKKCDAL
                     SFSTHHYDECCLRRQMSKWVGKLGVLDEINERLLIYEKFCALETMRHGIKHGEEVNEI
                     SRQFNPVEISKGNLIRYLVLWKEMAISKKIKNLQDMLDDYQFENNNIVQHSYLQVWFK
                     RMVFYQSECFQKSELKYGRSLKKRLFATIKAKEANIARLLQISDDLRRKSLMLNMIFS
                     WEAHLGSLRGLHKKSEREINKRNLSLLLSYLKVWSMQILKSRRNDETVQIFRKRWDRA
                     AVRGILLLWKNRTEHSPKKLRWKKSGKVVDALQFAPSSNLVTPVRNTSSNNNTIPGSE
                     GVKKYRLEAMKSHYSKVRRAIPSPVKSSTTLDSIAKKKFSRENENTHWVAQPLPPPRI
                     SIERINKNLASKIDNINFERIPEVKLDPFVEQNDEKDPVLDRSLLELDEDISFDDSPT
                     RRT"
     gene            <1042652..>1044061
                     /locus_tag="HG535_0A05290"
                     /db_xref="GeneID:59234224"
     mRNA            <1042652..>1044061
                     /locus_tag="HG535_0A05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286421.1"
                     /db_xref="GeneID:59234224"
     CDS             1042652..1044061
                     /locus_tag="HG535_0A05290"
                     /inference="similar to AA sequence:RefSeq:NP_012532.3"
                     /note="similar to Saccharomyces cerevisiae OST1 (YJL002C);
                     ancestral locus Anc_5.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142316.1"
                     /db_xref="GeneID:59234224"
                     /translation="MVNCWSWYVAAICIFLRFGLCESFIPNSSWENIEYQKLVDVKHA
                     YINEAFLITIKNIASEPQSEYFLALTEEIFEKISLFEVQLANKNVYVNASLYQSKCLL
                     DDGSVVGYGLISLPSPIEPGKQVSLTIKLSHTAHGLPHPEHILLKDAQNLRFKTARLP
                     FSAYYTRKANLQLLGSSKFTELSAPNDQSLRGTQRDDSYEFQSWDDIPPFETKNQLDV
                     IYVHDLPLIEVLKLKRDVWVSHWASTLQFEEYYELINRSAKLKNGFSRLELMQDQKNM
                     RLSHYCSVLEMNLPEESSEHYYTDLVGMVSTSRVLGDNLYIKPRYPLFGEWKYNFTVG
                     WTNKLSTFLRQSSKESFILVVPLLNGPTDAFYGKSEISVFLPEGSVLQALDSSVPMKS
                     AEVHTQKSYLDLNKGHIKVTCEFDNMIDANRDGQIVVKYSYPSQAAYKKPLSVACYIF
                     AALMSFFLLKSVNLNLDKK"
     gene            complement(<1044154..>1046151)
                     /locus_tag="HG535_0A05300"
                     /db_xref="GeneID:59234225"
     mRNA            complement(<1044154..>1046151)
                     /locus_tag="HG535_0A05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286422.1"
                     /db_xref="GeneID:59234225"
     CDS             complement(1044154..1046151)
                     /locus_tag="HG535_0A05300"
                     /inference="similar to AA sequence:RefSeq:NP_013097.1"
                     /note="similar to Saccharomyces cerevisiae ORC3 (YLL004W);
                     ancestral locus Anc_5.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142317.1"
                     /db_xref="GeneID:59234225"
                     /translation="MDVKEFANAQKTHYTVYPKVKKRKTAKNDIPFVKLLEGKESSTN
                     VQIRWHLYHQLHSHFHSQVNAITENIEKDLKREISDILFPKCETTHTDAQAASFTTLL
                     LLGSDSTTKIELPRDSQDTLNVLIELTPKESPNVRMMLRRSMFKLYSYADAILNIGSC
                     QSRKIIAKLEDNARSDYYDQDDQDDQDDQDDQDDQDDQDGQEADHSDGDDIDNIRVNK
                     GEQGDVSYDLTLVENFKMIFGKNLSLVFNFKDVDSINSHTLDSFIILLRSALKHSHVK
                     LSLVFNINTNISNIEKNLTQSTIRLLKKNYNKLDVSSNKGFKYGNQIFQSFLDTVDGK
                     LNLSIRFVQFLLDKMANNMNHNLQLLTKILDYSLMSYFFHNPFSVFIDPVNADYLNKD
                     YLRMLVKCPTFMFFIEGLLKEGSPPEEIRSLINNENSTLSSFFMEFLVRENPVNGYAK
                     YVANFLENELGIKNYNLIELYHKLLKGELQSYLQKWPICQEYTNELNFDPIDTIFQEL
                     FTLDNSNGLLTQALFPYYRSNLEDNLLHWERILPISLTKWQVKDITESESLDKSLAPV
                     VGHFFKLYREANSFINVYDFYTTFRDTLPKAEIMAFVKKTSNNDNYCSFLESDNEKET
                     FDKISLALFMQALFDFDHIGMIKTQTNKDSDIIEKYIWRGI"
     gene            complement(<1046513..>1046869)
                     /locus_tag="HG535_0A05310"
                     /db_xref="GeneID:59234226"
     mRNA            complement(<1046513..>1046869)
                     /locus_tag="HG535_0A05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286423.1"
                     /db_xref="GeneID:59234226"
     CDS             complement(1046513..1046869)
                     /locus_tag="HG535_0A05310"
                     /inference="similar to AA sequence:RefSeq:NP_012531.1"
                     /note="similar to Saccharomyces cerevisiae COX16
                     (YJL003W); ancestral locus Anc_5.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142318.1"
                     /db_xref="GeneID:59234226"
                     /translation="MSFSGKKFRSRRQQLAYDLSFAGRYQKRMNKNPFLYFGLPFCGL
                     ITLASFWLSSFTAVKYEQQDRKIQEMNEEDLVKMKNNQRQFDMKEEYYRLQGLADQDW
                     EQVRVPRRKGESENVW"
     gene            <1047084..>1049789
                     /locus_tag="HG535_0A05320"
                     /db_xref="GeneID:59234227"
     mRNA            <1047084..>1049789
                     /locus_tag="HG535_0A05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286424.1"
                     /db_xref="GeneID:59234227"
     CDS             1047084..1049789
                     /locus_tag="HG535_0A05320"
                     /inference="similar to AA sequence:RefSeq:NP_013096.1"
                     /note="similar to Saccharomyces cerevisiae SPO75
                     (YLL005C); ancestral locus Anc_5.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142319.1"
                     /db_xref="GeneID:59234227"
                     /translation="MPDVQRESSFITNYLSDYIFTYFDIDNNTALLILRFDEPSNVDS
                     NLSNLTSSIFSKFLNTTRTGSAHKHSGISVQTFLSTILVSTAYFGCQVLLFSSLRLKF
                     TNVYQARSRSDTMGTRHLAESRKQEGQRNRRMLWKFFKTGFGWIYPVLVRPTEDYYER
                     VGLDAYFFLRFVRVLSILFLLLSIIHIPILIPIHYFSNHFENVNEVSGTLRWLDRINI
                     STVVRSKSKKLIFHLILSLSVVAWYHLMLISELKHVRAISVGSKKAKTQTLIYLENIP
                     EGLRGDKSKIVEYFNLLFPETAIEARFLPKHCKELKKQYNVLKKIQRKMEIVAVQIVL
                     DKFFTKLSKKVTQNNGTELSWKTKIHVTIRATFFHLKTCQRYFKFKTKLKWKSQKCVG
                     NRLLPFVKIQLDSFTRERYECFGMTAKQYRMKSKIWRTKCTTIKKWSNLDYFFAHKNP
                     KTQVYYDKAFIRFKSANIAQAVGQLLLYSNTHHFDNVLIVPDVSDIIWRNMVISNSVI
                     KFLRAALANILSVFIIVGYIIPVAFVALMSQIPYFTSLVPLLSKMTTESKLLNDVMAG
                     IIPVITLVWLTEFAPYIFRCFSYLRCKRTGAEIEIDTQRWFFAFLFVHVFLVVTISSG
                     VSFLIERIVNNPVTIPTLLAHDLPKSSNFFCSFIVMRCLAYAGGNFLQLKELLFEIFY
                     YRLTTYSPRTRIYRMKYIPSFQWGSIYPIFSVLGSIGIIYSIISPIILPLCCIGFYLV
                     FFSFKYICEFQYNGSNISETYGRLYPHALMQLYSGIYFMEFCMIGLFALSSSLMLCSC
                     MVIGLLMTIVAHYKFSESYLKKLHKFSILDYWKDLLSESEYHNDCEISIPFADGKLDT
                     VINLPQDNEEIAKKEHSYIEQNYGVECCLDKFSLTDSGEMTCNYL"
     gene            complement(<1049810..>1051180)
                     /locus_tag="HG535_0A05330"
                     /db_xref="GeneID:59234228"
     mRNA            complement(<1049810..>1051180)
                     /locus_tag="HG535_0A05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286425.1"
                     /db_xref="GeneID:59234228"
     CDS             complement(1049810..1051180)
                     /locus_tag="HG535_0A05330"
                     /inference="similar to AA sequence:RefSeq:NP_013095.1"
                     /note="similar to Saccharomyces cerevisiae MMM1 (YLL006W);
                     ancestral locus Anc_5.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142320.1"
                     /db_xref="GeneID:59234228"
                     /translation="MKMSTATDENYCHECVNSEVNRNDSSTMINDKDIPNTAANNDTL
                     ISFGDYINKALPLHLQKLLQEHYENFDPAPHFLSESSKDDIENHSSFILNDIPMLQTT
                     LVQYLQRQQDQGIAASISNSQSFSSWSFAQGLIVGQISVVVALVFFIKFFIFGDSFKQ
                     NNPKNPSTSTSSSRQFISSQFFSSIMKRGGKDQLDLADDIEGERSRQIDTILEKTYYN
                     VDTHPSESLDWFNVLIAQTIQQFREEAWQKDNIMHSLNSFIERKAPELPSYLDDIKIT
                     ELDIGDDFPIFSNCRIQYTPNSNKKKLEAKIDIDLNDRLAVGVETKLLLNYPKPSIAS
                     LPINLTVAIIRFQACLTVSLTKAEEFVSIASSDDDSDTGYFLIFSFAPEYRMEFETDS
                     LIGARSKLENIPKIGRVIEYQIKKWFVERCVEPRFQFVKLPSMWPRSRNTRKAEFDDT
                     ESPKDN"
     gene            <1051430..>1053403
                     /locus_tag="HG535_0A05340"
                     /db_xref="GeneID:59234229"
     mRNA            <1051430..>1053403
                     /locus_tag="HG535_0A05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286426.1"
                     /db_xref="GeneID:59234229"
     CDS             1051430..1053403
                     /locus_tag="HG535_0A05340"
                     /inference="similar to AA sequence:RefSeq:NP_013094.1"
                     /note="similar to Saccharomyces cerevisiae YLL007C;
                     ancestral locus Anc_5.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142321.1"
                     /db_xref="GeneID:59234229"
                     /translation="MTSHYKDELEELNLLLSARQDTLSRQDSLRCYKILYSGTMEYIN
                     NDAYADMMCAFILNCESSVLCEKAVINRKFWEVFKSLIEALRPEPFSKCLNTIFSAVL
                     EQQRIFVKALDSLCEHILSDGTILSAIAAILASREAELETNIAFFRCISQLQDLLVRI
                     SNYQPQKAATYIPLYKLISLQCRLFYVMTPHLVEEPIRNMVIQGFLPVRKDLYEYLRT
                     VAVDDYPTPLKKRFDDIMDSTFMLSAMSKAASEEINEMHEDFLHLNMLQGADITAFLE
                     NPNLSFKKTFAEQLIFNGKPFPLLKSASYVSICLNELFDSFEKDINEKPHLAGFILNK
                     NYFMYALMDRLLKSWVESKGETEKDMSSLLKLMPIILHRIKRATSDPMGLTFEELVSL
                     ALNTIRSLDYRSSRELQLNDLREGYYKKWSRHLLDFETMLSDQVNDFVLHQRLLQLQK
                     GTWVYGQNPVDPSIKTPSILFMILSVDQNNLLVREFGRITEILPAVEGNVIHANTGKS
                     TDAKKTLVVPMNSISKFEAQEVAATDNTPKDSHLISCVKKNVYTEVKFLDKNSKCILR
                     VFFDTKEAIYVWLDGLQLVASAKHRNGISEATKEQKETLVDIRRTVQMMNLNIKEAFE
                     APDTSSSDEDFYNVDTLKGLTADFYYEQDVEQK"
     gene            complement(<1053491..>1055746)
                     /locus_tag="HG535_0A05350"
                     /db_xref="GeneID:59234230"
     mRNA            complement(<1053491..>1055746)
                     /locus_tag="HG535_0A05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286427.1"
                     /db_xref="GeneID:59234230"
     CDS             complement(1053491..1055746)
                     /locus_tag="HG535_0A05350"
                     /inference="similar to AA sequence:RefSeq:NP_013093.1"
                     /note="similar to Saccharomyces cerevisiae DRS1 (YLL008W);
                     ancestral locus Anc_5.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142322.1"
                     /db_xref="GeneID:59234230"
                     /translation="MSKSDFLSGDFVPTISDSEDDIPNLDDSDEESINTSVASKKKTE
                     SRGNSNKSSKKTATANVENGKAKDDSLNPDFTFNVDSNDTTMQFQGWEFFGDSKEGDY
                     VRKEVDVDGIIRRKGGLTKMARVEGESESEEDEDAEEAEEEQGDAQSEDDDELALNGF
                     GMGAKNQDEDAELSEDIEDSDDNVESASHGLEIMESGKKEQDQREDDDEEDSPEEMAK
                     FYAPDDESEEAKSQVHTSFNTLSLSRPVLKGIADLGYTRPSPIQCAAIPIALLGKDII
                     AGAVTGSGKTAAFMIPIIERLLYKPAKIASTRVIVLAPTRELAIQGADVGKKLGKYVN
                     GLTFGLAVGGLNLRQQEQTLKARPDIVIATPGRFIDHIRNSASFNVDSVEILVIDEAD
                     RMLEEGFQDELNEIMTLLPSRRQTMLFSATMNSKIKQLVSLSLRRPVRVMIDPPKQAA
                     SKLVQEFVRIRKRDHMKPAVLFHLIKKLDGNAQKRMVVFVSRKEMAHRLRVILGLLGV
                     GVAELHGSLSQEQRLQSVNKFKSLEIPVLICTDLASRGLDIPKIEVVINYDMPKNYEV
                     YLHRVGRTARAGRDGRSVSLVGESSQDRSVVKSAIKSVDENEGGSTAVGRNIDWAQAE
                     QINKLIERNAQTVEDILAEERDEKEILQAESQLRKGENLLKHKSEIESRPKRTWFRSE
                     ADKKNLKILGALTKNKKTINSKKRKRNEAIEDAPRIFKKTQKGRSADQERAFKRQSRN
                     TGAKNKKKGKK"
     gene            <1056018..>1056623
                     /locus_tag="HG535_0A05360"
                     /db_xref="GeneID:59234231"
     mRNA            <1056018..>1056623
                     /locus_tag="HG535_0A05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286428.1"
                     /db_xref="GeneID:59234231"
     CDS             1056018..1056623
                     /locus_tag="HG535_0A05360"
                     /inference="similar to AA sequence:RefSeq:NP_012530.1"
                     /note="similar to Saccharomyces cerevisiae SYS1 (YJL004C);
                     ancestral locus Anc_5.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142323.1"
                     /db_xref="GeneID:59234231"
                     /translation="MWSARRYMRIPRELKPSEIFKQDFLSPSKIALQIVLLQIFYYIT
                     ASVLFYCWAKLVGYELQILNWLFSWEYISYATTLGISISLLWLFDSLLCVLFLTVIVG
                     RSKLAWDFAITIHAINFIVVVLFTHRFPSLSWILLQIMSSLILIFLGTWTTRWRELRD
                     TFFEGLVDSNVGTSNSIPADIGTDGDQNGTQLEMRDLEAQK"
     gene            complement(<1056743..>1063147)
                     /locus_tag="HG535_0A05370"
                     /db_xref="GeneID:59234232"
     mRNA            complement(<1056743..>1063147)
                     /locus_tag="HG535_0A05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286429.1"
                     /db_xref="GeneID:59234232"
     CDS             complement(1056743..1063147)
                     /locus_tag="HG535_0A05370"
                     /inference="similar to AA sequence:RefSeq:NP_012529.3"
                     /note="similar to Saccharomyces cerevisiae CYR1 (YJL005W);
                     ancestral locus Anc_5.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142324.1"
                     /db_xref="GeneID:59234232"
                     /translation="MQKDADTYDEQVHDESPMFKRHYELRSRNRSSSNVSQRSKDHVS
                     GKNETVAGSMSDTHNETNQLPKLSKSSSNTTKGTEPQIRRGPVILRRTLSSLSIGSSS
                     KPGNVDNRSYQDNIDEDPNDELPGLKHTSSYHSFTSKHRHHKQLKQMRDTSDSQNHNP
                     SHPPSHTQNHSHNHKHNHNYNHNHNHNHNHNQNYSHSRDHEYNSSSPVSSSSQVNDYV
                     QSEKNSKGAAAPSRKQSFAEALLKKFGGPGSHSNSTASSSHINRKKSVNTSNSNNSSS
                     NNGDNNNKATSNNDDNNATDNNYGSTNNSNKYSHSTQTSENDHGYSSVNDGNGSNTSR
                     SNDRLKGSISGDKTPNETSDIQNHHHPNYDRNHLIPPSLSSRRSSKDSISAQHIIESV
                     PHSLRRKVSTLVHGFGHDLDNNHLDNHYPIRKIGTFPDGSDKGKHSDNSDRSDRLDMR
                     PDVVRHHTSHFVTSSNSTLNSPKKDANTPGSKLNTNASHGQLSSSDSEFNPVNDSSNI
                     STFQLDTNLENLSDITKLSNNSRRGSLTGTRMKFSPDINENESNIKTGDQFEAQNLSS
                     SNVSDSDLDLKGKKKYYSNKSGTSKNSSYTKGSQQWVAPESWDVESDVEKPRVKRNIH
                     GELMTGRSRRQVHQMKRGRTPQGEMSALSNDSQIEPPSQISRSLNDSDGFKALMDSES
                     QDTDRFSSGTATSSDTESMESDSRTSATSPKPSHTVSSLNKIIGNSTECQNQSSQNKV
                     NDQNDNNISLDSEGHVLSKEISADDEKHDRVEYELERYYKDFSDLDPKRHYAIRIFNT
                     DDTFTTLSCTPTTTVRDIIPALKRKFNITSQGSYQLSLKVGKLSKILRPLAKPIIIER
                     KLLLLNGYKKSDPLHIMGIEDLSFVFKFLFHPVAPSHLTAEQEQRLMRSDFIHVDLRA
                     MDLTTPPIIFYQHTSEIESLDVSNNADIFLPLEFIESAIKLSSLRMVNIRASRFPSNV
                     TEVYKLVSLELQRNFIRKVPSSISNLKNLTILNLQCNELDKLPKGFGQLGSLQLLDLS
                     SNRFVHYPEVINSCTNLLQVNLSNNKIYTLPASVNKLKKLAKMNLSHNKLTSIADLSD
                     MKNLRTLNLKHNRITTIKTSATNLQNLFLTDNRISDFDDNLPKLRTLEIQENPMTSIS
                     YKEFYPMSMTSLSLSKAKLSSVPRELFVKLSCLEKLDLSENNLTQMPDEISLLSKLVY
                     LSVARNKLESLPAEFPHLKSLKSLDLHSNNIRDFMGGMEDIELTYLNISSNMFGNSIL
                     SAPFSQNISSTSKLAKTLLFFLAADNQFDDQMWPLFNCFTNLKILNLSYNNFQDISNL
                     KLDNLTELFFSGNNLSTLSGDIVLKWKYLKTLMLNGNNLLSLPAELSQLKHLTVFDVG
                     SNNLKYNISNYHYDWNWRDNKDLKYLNLSGNRRFDIKSSINHEIDADLSDLTVLHNLK
                     ILGLMDVTLNAAKVPDENINFRMRTTGSMINGMRYGVADTLGKRDFVSSRDVTFERFR
                     GKDDECLICLHDGKNQNASYGHNISRLVRDIYDKILIRQLEKYEDTDDGVKKALRFSF
                     LQLNKEVNSMLSSVDNGNDVANLTSADLLSGSCSTAVYIKGNKMFTANIGDCMAILSK
                     NNGDFQKLTKLHAPYKRVEYERIRISGGCVNDDKLDGVVDVSRAVGFYDLLPHIHASP
                     DISLVSLTKADEMLIVATHMLWKYMDYETACDIAREHNSEPMLAAEAMKDHAIAYGCS
                     ENLTILCLSLFKNADQQNRFNLNKNALMTRRSTFEDATLRRLQPEILPPTGNLAIVFT
                     DIKNSTFLWELFPNAMRTAIKTHNDVMRRLLRIYGGYEVKTEGDAFMVAFPTPISSLV
                     WCMSVQLKLLSAQWPEEITSIQDGCVILDKNGNKIYQGLSVRMGIHWGCPVPELDLVT
                     QRMDYLGPMVNKAARVEGVADGGQITLSSDFCSEFNKIMKLHERVVKDKESLKDVYGE
                     EFVGELIEKEIAMLESIGWVFFNHGEQKLKGLETKELLTIAYPKSLASRHHFVTEDEQ
                     TRLLNEDCLVRLRSSARKLESIVSAVSGGYIDVEDRVKGNKSYSVDDVVKNNIGLVTS
                     EKELYAFFDHLVTRVEAYAALIKLRQVVGGGLDCYRVSDSGPAQKSIAELLEDVLARM
                     EK"
     gene            <1064432..>1064626
                     /locus_tag="HG535_0A05380"
                     /db_xref="GeneID:59234233"
     mRNA            <1064432..>1064626
                     /locus_tag="HG535_0A05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286430.1"
                     /db_xref="GeneID:59234233"
     CDS             1064432..1064626
                     /locus_tag="HG535_0A05380"
                     /inference="similar to AA sequence:RefSeq:NP_013092.1"
                     /note="similar to Saccharomyces cerevisiae COX17
                     (YLL009C); ancestral locus Anc_5.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142325.1"
                     /db_xref="GeneID:59234233"
                     /translation="MPGKGAETKNNKEDGETKPKPCCVCLPEKDERDQCILFNGQDSD
                     KCEDVIQKYKTCMKTYGFDI"
     gene            <1064867..>1065814
                     /locus_tag="HG535_0A05390"
                     /db_xref="GeneID:59234234"
     mRNA            <1064867..>1065814
                     /locus_tag="HG535_0A05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286431.1"
                     /db_xref="GeneID:59234234"
     CDS             1064867..1065814
                     /locus_tag="HG535_0A05390"
                     /inference="similar to AA sequence:RefSeq:NP_013117.1"
                     /note="similar to Saccharomyces cerevisiae MEU1 (YLR017W);
                     ancestral locus Anc_5.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142326.1"
                     /db_xref="GeneID:59234234"
                     /translation="MAVPNTFDGEIDLGIIGGTGLYHLECLEKLAELPPMETPWGTTS
                     SPIVISKVAGDSGHFHVAFIARHGRHHQYPPSKVPFRANMASLKHLKCKAVLSFSAVG
                     SLQEKIKPRDFVLPQQIIDRTKGIRNSSFLNDEGLVGHVGFGDPFSYSFAQYIYQFKH
                     LLANNDAPDEPCNLHFDKETTVVCMEGPQFSTRAESKMYRMFGGDVINMSVIPEAKLA
                     RECELPYQMICMSTDYDAWRDEEEPVTVETVIGNLSNNGHNANLLASKVIEEMANELP
                     EFMKTGDGLRGSIKMSISTKPHAMSKETLAKLNFLFPDF"
     gene            complement(<1065898..>1066998)
                     /locus_tag="HG535_0A05400"
                     /db_xref="GeneID:59234235"
     mRNA            complement(<1065898..>1066998)
                     /locus_tag="HG535_0A05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286432.1"
                     /db_xref="GeneID:59234235"
     CDS             complement(1065898..1066998)
                     /locus_tag="HG535_0A05400"
                     /inference="similar to AA sequence:RefSeq:NP_013118.1"
                     /note="similar to Saccharomyces cerevisiae POM34
                     (YLR018C); ancestral locus Anc_5.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142327.1"
                     /db_xref="GeneID:59234235"
                     /translation="MESISTPSRPISSEQFQSLRQRMVKESPYLYRNKVLSDPGKKFN
                     SLLKDDSAYERECVPLEDERLNTKLSPNEIALKKNEEMTEDLGNFENPVLGKLAERTV
                     NKEYETHTIVVNLVALAIWDLLIKFYKLFIDYTRYGERLVCYLQDELIRNHLMGWRRY
                     LQMNFPFLLKWINWSNVDTIFHLIVVYNVILSLWRLFSKVRVDDLNLTEAQKELLGLD
                     TLVNPEISRRDFIIQRPSTVTKPHVILDSRANEKNGGPAEAVSSSNGSTIANTPYLFK
                     SLETPLKKKQKEQQQAQLQAQKNQQHQQLNLHRHAQSAFVSKVNAFGSLRNNIVGPNN
                     FGGVQTPEGRTGYIPSNKYAYMVNSPCPRRKM"
     gene            <1067554..>1069011
                     /locus_tag="HG535_0A05410"
                     /db_xref="GeneID:59234236"
     mRNA            <1067554..>1069011
                     /locus_tag="HG535_0A05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286433.1"
                     /db_xref="GeneID:59234236"
     CDS             1067554..1069011
                     /locus_tag="HG535_0A05410"
                     /inference="similar to AA sequence:RefSeq:NP_013091.1"
                     /note="similar to Saccharomyces cerevisiae PSR1 (YLL010C)
                     and PSR2 (YLR019W); ancestral locus Anc_5.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142328.1"
                     /db_xref="GeneID:59234236"
                     /translation="MGFISSILCCLTDSPKSKTQSQVNSGKKVSQITPINSSSKKSAI
                     HSSLSNSSQKMIHGTRPVNSKNIDKKSRSKEKELENDRIYSKSNDNVTDKGRAPTKKR
                     YNSTNTNLTKKRGQAMRAPPIHGLAEMEKDSDNEKKDSENGEVEEVNDDDNEGKETVD
                     TPNKDKEKLDVDASNEKETQAVYVYNGETDTSTGGSSYDHPQQKANQEPFQPHAVGTV
                     QPSIQTETTSPNQPRSLNEQELITTVHEGENYSSADDTDTGLQKRSSNNDEEGDYDMA
                     PPYEEDEEYFDLTELQPGQTHAMGFNTLLAPQDPKFSGKKCLVLDLDETLVHSSFKYI
                     RTADFVLPVDIDDQIHNVYVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD
                     KHKMIHHRLFRESCYNYEGNYIKNLSQIGRPLSEIIILDNSPASYIFHPQHAIPISSW
                     FSDTHDNELLDIIPLLEDLSERSVPDVGKVLDVTI"
     gene            complement(<1069369..>1070793)
                     /locus_tag="HG535_0A05420"
                     /db_xref="GeneID:59234237"
     mRNA            complement(<1069369..>1070793)
                     /locus_tag="HG535_0A05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286434.1"
                     /db_xref="GeneID:59234237"
     CDS             complement(1069369..1070793)
                     /locus_tag="HG535_0A05420"
                     /inference="similar to AA sequence:RefSeq:NP_013090.1"
                     /note="similar to Saccharomyces cerevisiae SOF1 (YLL011W);
                     ancestral locus Anc_5.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142329.1"
                     /db_xref="GeneID:59234237"
                     /translation="MKIKTINRSADDYVPVKNSQESQLPRNLNPELHPFERAREYTKA
                     LNATKLERLFAKPFVGQMGNGHRDGVYTIAKDYYDLNKIASGSGDGVIKYWNMSKREE
                     LCSFKAHYGMISGLCVSPQKLASNKNQHYMLSCGDDKTVKLWSVNSEDFANIKDDESL
                     NTADGLLKTFYGEHAFQGLDHHRSNSNFVTGGAEIQLWDSTRSKPLSNLSWGADNVTS
                     VKFNQNETDILASTGSDNSIVLYDLRINSPTQKIVQRLRTNAICWNPMEAFNFVIANE
                     DHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFKTDQGHSR
                     EIYHTKRMQHVFQVKYTMDSKYIVSGSDDSNVRVWRSKAWERSNVKTTKEKNKLEYDD
                     KLKERFKYMPEIRRIARHRHVPKVIKKAQEIKGTELASIKRREDNERRTKKDAQFVSE
                     RKKQIVGEVFKYEGKPENDQKDTE"
     gene            complement(<1071052..>1072737)
                     /locus_tag="HG535_0A05430"
                     /db_xref="GeneID:59234238"
     mRNA            complement(<1071052..>1072737)
                     /locus_tag="HG535_0A05430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286435.1"
                     /db_xref="GeneID:59234238"
     CDS             complement(1071052..1072737)
                     /locus_tag="HG535_0A05430"
                     /inference="similar to AA sequence:RefSeq:NP_013089.1"
                     /note="similar to Saccharomyces cerevisiae YEH1 (YLL012W)
                     and YEH2 (YLR020C); ancestral locus Anc_5.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142330.1"
                     /db_xref="GeneID:59234238"
                     /translation="MLEAISDFIYRVISGTILGCFLLVLSLLALWHNFVTAHFRHHHD
                     FRDTRSSKTTIIPKQEPHSPRRQKKRHQSLSVSSCSPLNVEEDEDNNIEFDHTITSTD
                     TRPDSNDSSLSDIGTANTSIDSTYNLANHQYVYDKNFTKKNRSELEDNPFQDVLAAED
                     MKLVPDLKYYYKQYNIEIEEFEVETEDGFIIDLWHLKHDTDSLEKDNERNPDLHPILM
                     LHGLLQSSGSFASSGRKSLAYFLHQSGFDIWLGNNRCGLKPKWNMSALGFDKRKKWDW
                     DMDQMVQYDLKALIETVLSKCKHEKLTLMSHSQGTTQGFMGLVNGELLYGTDFKLSEK
                     LENFVALAPAVYPGPLLDEKQFVKFMAKGIDNPWIFGNKAFLPLMLLMKKITNGVIII
                     PFMSYVMFNYLFDWNDSLWDKPLRDRHFLFSPVYISVKLMQWWLSPLDNKMSFKKGAG
                     TLFPDSKTWFPVEDGNPVAKPEGLHLNSTRQSKKDYPHFMMFIPRQDRLVDGERLINH
                     FINHESNSLYKIWYIDEYSHLDVLWAHDVIDRIGQPIVENLRLPKRSQVGRAN"
     gene            <1072945..>1073445
                     /locus_tag="HG535_0A05440"
                     /db_xref="GeneID:59234239"
     mRNA            <1072945..>1073445
                     /locus_tag="HG535_0A05440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286436.1"
                     /db_xref="GeneID:59234239"
     CDS             1072945..1073445
                     /locus_tag="HG535_0A05440"
                     /inference="similar to AA sequence:RefSeq:NP_013121.1"
                     /note="similar to Saccharomyces cerevisiae YLR021W;
                     ancestral locus Anc_5.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142331.1"
                     /db_xref="GeneID:59234239"
                     /translation="MFFREASSKFPNDPDNNELDILAVHFSNEIAVQIRFNGELDSTY
                     EISVKGLNGIGKRFLAGHSIMGDDDEDDISFVGDMANYQIATKLGNSNDTKLHVVCTQ
                     IAELYHQIILPRNVDGMGASNEDGITSRKILVTLSSKIWRDNNIGKDFDKLIYILQNI
                     KKMYNI"
     gene            complement(<1073446..>1074180)
                     /locus_tag="HG535_0A05450"
                     /db_xref="GeneID:59234240"
     mRNA            complement(<1073446..>1074180)
                     /locus_tag="HG535_0A05450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286437.1"
                     /db_xref="GeneID:59234240"
     CDS             complement(1073446..1074180)
                     /locus_tag="HG535_0A05450"
                     /inference="similar to AA sequence:RefSeq:NP_013122.1"
                     /note="similar to Saccharomyces cerevisiae SDO1 (YLR022C);
                     ancestral locus Anc_5.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142332.1"
                     /db_xref="GeneID:59234240"
                     /translation="MPINQPSGQIKLTNVSLVRLKKAKKRFEIACYQNKVQDFRKGVE
                     KDLDEVLQIHQVFTNVSKGLVAPKDDLQKCFGTTELDPIIEEIMKKGEIQLSEKERQL
                     MINKINNELLTIVSAKCINPKSKKRYPPTMIHKALNELKFSPVLNKSTKIQALDAIKL
                     LVSKQIIPIVRAKMRVKISLNVAEIETIDKIKILINDNSPQNNGEINWIFNGLIDPVT
                     YRDLVNLCDGKGTIQVLDMAVIDDSN"
     gene            complement(<1074419..>1075996)
                     /locus_tag="HG535_0A05460"
                     /db_xref="GeneID:59234241"
     mRNA            complement(<1074419..>1075996)
                     /locus_tag="HG535_0A05460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286438.1"
                     /db_xref="GeneID:59234241"
     CDS             complement(1074419..1075996)
                     /locus_tag="HG535_0A05460"
                     /inference="similar to AA sequence:RefSeq:NP_013123.1"
                     /note="similar to Saccharomyces cerevisiae IZH3 (YLR023C);
                     ancestral locus Anc_5.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142333.1"
                     /db_xref="GeneID:59234241"
                     /translation="MLMAAAQKGYNSYSNGNRLRRLKRKVVGVGEAGGSGGGSGGAGP
                     EAGGYSLLSSASRLSAAAVNNRYSQYVLSTLLRRKPAQRAAVERRAGERVPGSPGRVH
                     AKHGHLHKQDAEVGDLNSMYSDSNTLVNSAQHNAYASSSSAASSVIFEDELTLLDSPP
                     ATIEEVAEVALPTASADVKNYIKTFNHSTARELGKSQHLHYYQLPFAWRENPFIINGY
                     RFYSSHKRSFLSIVNWYGWHNETSNIWTHLLGGLYLIFLAMVDYPKSAIWNSDQVPFP
                     AKLIVFVFLLAGMKCLFASMFWHTFNGTSILNLRSRFACVDYSGITLLITASIMTTEF
                     VTMYDYKFSLYLYMSISSVLGLFGVFMNWSPKFDRPEARPLRIKFFILLALMGCLSFL
                     HLTLRTSWKFSASLVVPVTKKSLGWYLIGVFFYGSFIPERFRTDYIVDKSIPTETELS
                     SDLTILTRHKHIHFRPSPTKHPKSVKCCCHAHSFKSLWWVDYFGASHTIWHFFVVLGV
                     IGHYHAILDMFAKRWIV"
     gene            complement(<1076151..>1076726)
                     /locus_tag="HG535_0A05470"
                     /db_xref="GeneID:59234242"
     mRNA            complement(<1076151..>1076726)
                     /locus_tag="HG535_0A05470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286439.1"
                     /db_xref="GeneID:59234242"
     CDS             complement(1076151..1076726)
                     /locus_tag="HG535_0A05470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142334.1"
                     /db_xref="GeneID:59234242"
                     /translation="MYTRTHGNTRTLNHSTTQPLERPSNHSITPRATLYTDIPTWAKR
                     TQRNMVFRPCPRPVFRPGSSNPNSISPIATNPRSVPVPVPASQAVPVTMRSQCHNHAS
                     KGTARRTSARVSVPSRAGAPGLRTRGTCVPDRGPVLSGTRGAGHRVRATCPAKESTRT
                     AGQRRFFGFFRLRFFARVPHGGAKRKSVVLL"
     gene            <1076809..>1078872
                     /locus_tag="HG535_0A05480"
                     /db_xref="GeneID:59234243"
     mRNA            <1076809..>1078872
                     /locus_tag="HG535_0A05480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286440.1"
                     /db_xref="GeneID:59234243"
     CDS             1076809..1078872
                     /locus_tag="HG535_0A05480"
                     /inference="similar to AA sequence:RefSeq:NP_013088.1"
                     /note="similar to Saccharomyces cerevisiae PUF3 (YLL013C);
                     ancestral locus Anc_5.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142335.1"
                     /db_xref="GeneID:59234243"
                     /translation="MSVNGVSDKDPWAALCHSSNTSPILNQTAMNSNANNMDSELASI
                     VSSLSALSNGNNNPGSHQQQQHLPQQSQLGGYRRSSVGASSNNQELDVYAASMQPPPP
                     PHSQTRAALSVGTAPAYSKQRTRLLNNHYSASIAGPIMFTEAVGAGGGGGFFEKFGKS
                     LIEGTRELEKQPSEQDGPARRASVNSESPEGQHKTIWNVAQAPVFKPNQDTFNQFPLS
                     LASQYPATFESNLESQQRPNLEPNQQPFFYMSSDISVPPQPAPKPQSEPKHYSKPTKK
                     QQTNPYLDVSKKFTNNTKSPTRIASPSQPHQQQQHTPHNAPKHANITSRSPLLEEFRS
                     NTNEKVYSLKDIVGYVLEFCKDQHGSRFIQHELSVATNSEREVIFNEIRDFAIELSDD
                     VFGNYVIQKFFEFGSKTQKDILVHQFKGRMKFLSMKMYSCRVIQKSLEYIDLQQRIDL
                     VNELSNCVLQMIKDQNGNHVIQKSIERIQLKHLPFILDSLNGQIYHLSTHSYGCRVIQ
                     RLLEFGNESDQLKILVELMDFIPYLIQDQYGNYVIQHILQQNSKTSFDEMIKIKQKII
                     EIVSKNVVEFSKHKFASNVVEKAILFGSPDQKKLIVSQILPIDENHAVDLNDNSPLIL
                     MMKDQFANYVVQKLVGVSKGNDQKLIVIAIRSYLERLNKSDSMGNRHLASVEKLASLV
                     ENVKI"
     gene            complement(<1078996..>1079316)
                     /locus_tag="HG535_0A05490"
                     /db_xref="GeneID:59234244"
     mRNA            complement(<1078996..>1079316)
                     /locus_tag="HG535_0A05490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286441.1"
                     /db_xref="GeneID:59234244"
     CDS             complement(1078996..1079316)
                     /locus_tag="HG535_0A05490"
                     /inference="similar to AA sequence:RefSeq:NP_013087.1"
                     /note="similar to Saccharomyces cerevisiae YLL014W;
                     ancestral locus Anc_5.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142336.1"
                     /db_xref="GeneID:59234244"
                     /translation="MAIKDYGELLDSENIIRNKKKLEKLQDSTSLVIGLGAGILQFES
                     LQGFYMFIGSYILIGVLFSIWVCQCKPSQFFQSPVQEIFFQSFFRELTGFVMSWTFSY
                     ALIG"
     gene            <1079383..>1080645
                     /locus_tag="HG535_0A05500"
                     /db_xref="GeneID:59234245"
     mRNA            <1079383..>1080645
                     /locus_tag="HG535_0A05500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286442.1"
                     /db_xref="GeneID:59234245"
     CDS             1079383..1080645
                     /locus_tag="HG535_0A05500"
                     /inference="similar to AA sequence:RefSeq:NP_011703.3"
                     /note="similar to Saccharomyces cerevisiae HGH1 (YGR187C);
                     ancestral locus Anc_5.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142337.1"
                     /db_xref="GeneID:59234245"
                     /translation="MRLFAYSLFVTSNFFFNKNFQISSHRLYDVTNKEEIVNSCAMPS
                     QLEELVSFLHSPQPAVRQIALDNLVGFSTGPTASIFKYDNCQAIKDLKELTKEKSKIL
                     VQQSVTILANLCGDDQLRNLIANDPDFLLYLTWKICDLNNSSADIMCILLSNLAKEDV
                     ITIVLEFSRDGENLPPLDKSVFKSDKVMDCLMDCFVKGYDRKLNKFANFDYLAYFFAD
                     ISRFKKGRQYFIELQENDNVIPISKLLVFTEKYDSKTRREGVASTIKNSLFDSETHVR
                     ILNDEQINLLPYILLPIASAKDSEIDEEDMFNLPDELQLLPEDKERDPVTSIVCCHLE
                     SILLLCTTNSGREFLRSKSVYPLIRELHKNVDDEDIGDLCYRIVNVLMRGEPENVQLE
                     ELPAKAADGEADKDSDEESDEEGIVEVV"
     gene            complement(<1080855..>1083026)
                     /locus_tag="HG535_0A05510"
                     /db_xref="GeneID:59234246"
     mRNA            complement(<1080855..>1083026)
                     /locus_tag="HG535_0A05510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286443.1"
                     /db_xref="GeneID:59234246"
     CDS             complement(1080855..1083026)
                     /locus_tag="HG535_0A05510"
                     /inference="similar to AA sequence:RefSeq:NP_011702.1"
                     /note="similar to Saccharomyces cerevisiae TFG1 (YGR186W);
                     ancestral locus Anc_5.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142338.1"
                     /db_xref="GeneID:59234246"
                     /translation="MSGRNGNGSSVSPFIKPDRMRRNFLRSRMGKGSTPKPVVKKDDP
                     ELQEATEKLLLQNGVEGGKVKVKEETEDEYNEFPLRAVGKEELDNMRTHLLKFQSKKI
                     INPTKDFHLPIRLHRKDTRNLQFQLTRAEIVQRQKEISEYKNKQDQEGLGTRKMGNGE
                     GALDGVTANGGEKDIPTTAASTTSEMASASATFAAPTNSSASPTPAAPTGSASVMSPG
                     TAIGDVASDIGSVPGSTPAYAATSTSPPSMVDQVASVKTESDNPNQEAKSVITKLEDA
                     GPAADPTKVGMVKYDGEEVADDLEQGTADPLADVAPDGGGRAKRGNMRRKTRQLRVLD
                     ENAKKLRFEEFYPWVMEDFDGYNTWVGSYEAGNSDSYVLLSVEDDGSFTMIPADKVYK
                     FTARNKYATLTIDEAEKRMDKKSGEVPRWLMKHLDNIGTTTTRYDRTRRRLKAVSDRR
                     AAEDDEHQDNSEVELDYDEEFADDEEAPIIDGNEQENKESEQRIKKEMLQANAMGLRD
                     NAEHSEEEDDLFNEKKIDEEGERIKKALQKTELAALYSSDDEEINPYLSESDMENNEQ
                     SEQVKKEDSEDSNTKKLQPKKQSSSPSASLINKEPQIRLKSIKDCIIILKADRKILKN
                     FPEGQWNPKAAKRKREVDQVVPNAEVASKRIKVEPDSIPLITEQDIIDAIGDGQVNVK
                     EFGKSIRKTYPGPENKKLMFAIVKKLCKKVENNGGYMELKK"
     gene            <1083657..>1084850
                     /locus_tag="HG535_0A05520"
                     /db_xref="GeneID:59234247"
     mRNA            <1083657..>1084850
                     /locus_tag="HG535_0A05520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286444.1"
                     /db_xref="GeneID:59234247"
     CDS             1083657..1084850
                     /locus_tag="HG535_0A05520"
                     /inference="similar to AA sequence:RefSeq:NP_011701.3"
                     /note="similar to Saccharomyces cerevisiae TYS1 (YGR185C);
                     ancestral locus Anc_5.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142339.1"
                     /db_xref="GeneID:59234247"
                     /translation="MTSAADPKTSFELITKNLQEVLNPQIIKDVLEVEKRPLKIYWGT
                     APTGKPHCGYFVPMTKLAHFLKAGCEVTVLLADLHAFLDNMKAPLEVVQHRAKYYECA
                     IKAILRSINVPIEKLRFIVGSSYQLTPEYTMDVYRLSNIVSQNDAKRAGADVVKQVAN
                     PLLSGLIYPLMQALDEQYLECDAQFGGVDQRKIFVLAEENLKSLGYNKRAHLMNPMVP
                     GLGQGGKMSASDPNSKIDLLEEPKQVDKKIKSAYCSPGIIEDNGLLAFIKHVLLPIQE
                     LKNDSDAFEFFINRQEKFGGPITYKSFEDLQNDFKDEKLSPPDLKIGVADAINVLLAP
                     IREEYKTSTEFQEACAKGYPVETKVKKVKKVKNKGSRYPGAQSESGPIDSVDKTAEKL
                     NDTSL"
     gene            complement(<1084957..>1090572)
                     /locus_tag="HG535_0A05530"
                     /db_xref="GeneID:59234248"
     mRNA            complement(<1084957..>1090572)
                     /locus_tag="HG535_0A05530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286445.1"
                     /db_xref="GeneID:59234248"
     CDS             complement(1084957..1090572)
                     /locus_tag="HG535_0A05530"
                     /inference="similar to AA sequence:RefSeq:NP_013124.1"
                     /note="similar to Saccharomyces cerevisiae UBR2 (YLR024C);
                     ancestral locus Anc_5.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142340.1"
                     /db_xref="GeneID:59234248"
                     /translation="MSSDQCKIYSLRDFLIHLPKLVPHEYDDVVRYIVWKVLRLSLEA
                     DQDRGQAQDGRNNPQIDWDSIVSVFTSENWGRGVYKDILRDVSWKEKVQPPLSETCGD
                     HRVPAGCMCGRLCYPLETVYYCFTCTMNPLYEICEYCFDRAEHLGHVYTAKLVVRPEG
                     RVCHWGDTSIFKGTGQSGSCEADAVGTSASATPAPVVTNSNTKTCMSNTFNTILDYLI
                     DVTIYFKDRNEAPLSVVNFKKPVRKPDDNILFKIALEDSGGSVPEETDLENGIGNNRK
                     WAVQIDEEDCNIHCKDLASKIARIFNKPAEFAISLTKMLEDGHPSVILAKSPDISKIQ
                     KISTILQQEGIHSHVRNMEDVFKRELINDVVEWLYIVSTEETVDLRRRKALRLSMLDA
                     WQSGLRSAKFTPNFLSPYVAKLNLLGGFLVSYEQHDTFPWFKPWNFTNINDPKITDVM
                     SNYDKRLADTNVMNTISRFHPLHGSRFQYILAESTQFLSRFSRYRMLKVLSSLFTITD
                     DAKNCLAAQYFDIYLSVLYSTVASDSTGFKVSLMSIFSQYTFQHPDTANLAIRNCFVQ
                     RALKFAFTLMAFTSDDLLAYLPIPLSHDCKLPNETIRNRRTIMCFKDICILMSTNTIP
                     LELLQNNDILSLIVESFGAFNNILRLKRETAEHVEFESFDFSSYYFYFSSVLVMVDGF
                     IRSISIIDDKETRKDIVVKLIKMTMKKELQLLAQFRKSVSSTFLWSSFASNEDKPALL
                     PIIKEKICGHVANIINFQVGVDTQNFFNPMSYLFKFVLQWSQCGRYAPAPHDMVNYLD
                     FNEIFQDKQDSLFVCESALSTLVLLGQINVGFWVRNGSPITHQARMYTKYSMREFTYM
                     SDLFNVQFSMSHADPDEFMVTYIARWGLKHWSNGVPVGDYPQRETTVSIVYECILLLV
                     QLLTEIKSLTLVSSVDGFEKTLKAEIVHALCFRSCTYSQIMECIPEHITKHAAFDLYL
                     EKFTNFTPPSGLTDHGQYSLKKQYIADIEPYYVALSSSKRYEVEKKIRVSMASKKHIN
                     YDDTFVPAKDVIGLLKQTPYSRLYAISSVDTFGLFLKSTLELINKFNHDSLLPVVVHL
                     IHQCVVNNLNDFMKIFWHEFASVDTEFYYYNSIGSILYGLLLKECFTQVHGKIREVFR
                     YLAKTAAHVDIKSYLQEQTESFNETILWSSSEMKATKDGKFEKKKRLARSRKEKMLRE
                     LAKQQLQFIENNSLAIEKEYMRESSPESLETSKTLGWEFPGETCVFCKMTHEEDAFIF
                     FSYQENNICDHGINFDNKLSHIKLFSQAAENSNLCDEEMERMKFSCVESRVDSTREGA
                     VLRTCGHGAHISCLGNHMKTIRAAHNQTTKNVPVAYGFGLMYCPLCNGLCNSFLPQLT
                     KGISRSASDFFKAEASCISEDTRSLLLSASIKAARIFQDLVKEKSEKNKDHFNALDTL
                     FVNTISNTELATRTGSGSFAEVISSPRLLTLRLLNELILFLHHHIRQDNMSMRFEYSW
                     QQFLLRRIDTDFLLVANQAIKSVNQCESGSSNCVAGLSNLSKVKNAVKGRIIQDMLIL
                     AKEMLQVEFYNDCPEVWKMVKQPISDFPYDTTRLEVEVDLIVKMFTRVVSFFSPEVES
                     YMNGICHLRFQIHGLLTNSLGIFLRRFSIMFYAQYAVGTELEPFIKSPSSIDILLLYL
                     KLPRLSEILQEFDVEQSLKAFEATMGFPAVPPMSRICPRLKAMKFSSPLPVQLVKLPH
                     SLSHFFLSEKDNLMHKVLKDDIAFCLFCGKQCNLRKSVSLHGYALGVCTNHVRNECSI
                     SSTYGMFLMIRSNSIYLSYGERGTFYSAPYLDKHGEPDVDFKYNTPVFLDEKRYEHLC
                     NGVMLDNMIPHIVLRLTDGNSDLGGWETM"
     gene            <1091671..>1091865
                     /locus_tag="HG535_0A05540"
                     /db_xref="GeneID:59234249"
     mRNA            <1091671..>1091865
                     /locus_tag="HG535_0A05540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286446.1"
                     /db_xref="GeneID:59234249"
     CDS             1091671..1091865
                     /locus_tag="HG535_0A05540"
                     /inference="similar to AA sequence:RefSeq:NP_001032571.3"
                     /note="similar to Saccharomyces cerevisiae YBR201C-A;
                     ancestral locus Anc_8.532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142341.1"
                     /db_xref="GeneID:59234249"
                     /translation="MSLFYNALMFRNGKFPLVYVTYLTLGVTLPFILPAHITQKTINN
                     TSTLGVKGRSNPRCLFARLI"
     gene            <1092086..>1092598
                     /locus_tag="HG535_0A05550"
                     /db_xref="GeneID:59234250"
     mRNA            <1092086..>1092598
                     /locus_tag="HG535_0A05550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286447.1"
                     /db_xref="GeneID:59234250"
     CDS             1092086..1092598
                     /locus_tag="HG535_0A05550"
                     /inference="similar to AA sequence:RefSeq:NP_015258.1"
                     /note="similar to Saccharomyces cerevisiae YPL067C;
                     ancestral locus Anc_8.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142342.1"
                     /db_xref="GeneID:59234250"
                     /translation="MLEWQRVRELIRADKLEQLVRSEKVTEAYRKHKLECDVQQYVLE
                     NLNWSPSEVRRLNDEGVKFFSDRSLYTLTQNDYPYDFEPTIHHLIIWSKIYIPLYNDK
                     NEKNDKVEEELDNFVNEHIAKFALPADDYIWFMNTSPLQSIKNISHLHLLVKVPVDQE
                     NVVEQILQNF"
     gene            complement(<1092995..>1093630)
                     /locus_tag="HG535_0A05560"
                     /db_xref="GeneID:59234251"
     mRNA            complement(<1092995..>1093630)
                     /locus_tag="HG535_0A05560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286448.1"
                     /db_xref="GeneID:59234251"
     CDS             complement(1092995..1093630)
                     /locus_tag="HG535_0A05560"
                     /inference="similar to AA sequence:RefSeq:NP_009760.1"
                     /note="similar to Saccharomyces cerevisiae DER1 (YBR201W);
                     ancestral locus Anc_8.535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142343.1"
                     /db_xref="GeneID:59234251"
                     /translation="MDAALLDIVAGIPPVTKIWAIGCVGLSILTSTNAIDPTKKWYTF
                     ELAFKKGQYDRIIYSLFDHGEFNWMSIFNIFVSVNHLASLENSFAIKRRFCWMVTIAL
                     GIILLMSSIAQPVSSLGIVLYENLVYYQIRKTGNEMNIMLFGGVNVSPLILPLYMNCT
                     MLFVHHKTMLQVAMNFLPGHALYYLDDIFMKLYDVDLCKTPYDFWLDYRRR"
     gene            <1093814..>1094794
                     /locus_tag="HG535_0A05570"
                     /db_xref="GeneID:59234252"
     mRNA            <1093814..>1094794
                     /locus_tag="HG535_0A05570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286449.1"
                     /db_xref="GeneID:59234252"
     CDS             1093814..1094794
                     /locus_tag="HG535_0A05570"
                     /inference="similar to AA sequence:RefSeq:NP_015256.1"
                     /note="similar to Saccharomyces cerevisiae BTS1 (YPL069C);
                     ancestral locus Anc_8.536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142344.1"
                     /db_xref="GeneID:59234252"
                     /translation="MSDVPSIISTLVTSQPLWTEEDETVIQSPYRHLAATRGKNFRSK
                     LIEVFNVIYKLPQEQIDLVSNLVGVLHNSSLLIDDIEDSSEVRRGKTTAHLIYGIPMT
                     INTANYMYFKAMEMIQLISNGDKFVLQDLMVIFNEEMINLHRGQGLDIYWRDSLPKII
                     PDDTLYFNMVMNKTGGLFRLTVKIMERLTKVKSEISLIPLSNLLGIIYQVRDDYQNLL
                     DEKMIESKGLAEDISEGKLSFPIIHGLRHGKQNNDLFLQNALKLRTNDLEIKRDVINY
                     LQNESKSMDYTKKVLCELTTLAKNEKYIPYKSYPKEATQFAYIVDHLSVM"
     gene            complement(<1094870..>1096504)
                     /locus_tag="HG535_0A05580"
                     /db_xref="GeneID:59234253"
     mRNA            complement(<1094870..>1096504)
                     /locus_tag="HG535_0A05580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286450.1"
                     /db_xref="GeneID:59234253"
     CDS             complement(1094870..1096504)
                     /locus_tag="HG535_0A05580"
                     /inference="similar to AA sequence:RefSeq:NP_015255.1"
                     /note="similar to Saccharomyces cerevisiae MUK1 (YPL070W);
                     ancestral locus Anc_8.537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142345.1"
                     /db_xref="GeneID:59234253"
                     /translation="MSVNQEGRMLFTPPINNTKFDINQSIRESYQSNVGSLLEDLPDS
                     GSTASGSNVELTREEIEQEIGSIHELPLELSKQIDAFIYDLKQPKYMKPLTINQLASL
                     FQSFYSKFDKASFNFLMLGNSNVNGNQTTYLSAREHLSSGLSGIFARSRSSSGSSIKR
                     NRRSSSLFSSDSNTVTPMLSPEEISKQLRLNELTNLKIERYMEFCETEVFNRLLAVGT
                     SVPPPTREERSKGPNQRNGFKITDLFKNSPEYGEYDKLLYEKIKTLSRLSSQGKIDLS
                     KFLGIPETVKIESLDEIEAVLQDFINHTVSPTEKVALLLKIHEYMMYSHEMSNDEFLS
                     LLIYYVIKVCPQKIFLNTEFIRLFRYKKKLIQKELYALTNLEAALVFLEGLTMNDFSS
                     ELQDQLSLHEQTLLASSISNKINLPNGTVTDNSTSQPEAPHPEVIRSNSYDGIKNVFD
                     SSLKNIFDKIRSYTPPAPQQISRSTSQLFSDGDKKPSTKTHTGATGSTITSGCTNTVS
                     ETVVPDSWKVYQPKKFDDLTISELREIFEIYQKLIK"
     gene            <1097070..>1097555
                     /locus_tag="HG535_0A05590"
                     /db_xref="GeneID:59234254"
     mRNA            <1097070..>1097555
                     /locus_tag="HG535_0A05590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286451.1"
                     /db_xref="GeneID:59234254"
     CDS             1097070..1097555
                     /locus_tag="HG535_0A05590"
                     /inference="similar to AA sequence:RefSeq:NP_015254.1"
                     /note="similar to Saccharomyces cerevisiae YPL071C;
                     ancestral locus Anc_8.538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142346.1"
                     /db_xref="GeneID:59234254"
                     /translation="MSSQTRFKTKRPRSPDLIGIHNYKKQRLIEDLENLTIGDSSEAK
                     SRRFWQKASKGLVSEPDPVVEGIYMPHRTKVQALALLASDHVDDHSILYSKLKELLRN
                     EALQIIKRFDPRELLYSQWFTWLRRKTMSIDHTDSSCYIGSSTNTHYYQDLEGDIDMD
                     T"
     gene            complement(<1097589..>1099334)
                     /locus_tag="HG535_0A05600"
                     /db_xref="GeneID:59234255"
     mRNA            complement(join(<1097589..1099244,1099326..>1099334))
                     /locus_tag="HG535_0A05600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286452.1"
                     /db_xref="GeneID:59234255"
     CDS             complement(join(1097589..1099244,1099326..1099334))
                     /locus_tag="HG535_0A05600"
                     /inference="similar to AA sequence:RefSeq:NP_009759.3"
                     /note="similar to Saccharomyces cerevisiae BEM1 (YBR200W);
                     ancestral locus Anc_8.539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142347.1"
                     /db_xref="GeneID:59234255"
                     /translation="MLKNFKLPKREGSGSKNKITSANISSPAQNNTNAIKHIKTVPVR
                     NTSHSSQHSNSVSRSSSKNFSVPEKAIKALYSYQAQSPKELSFLGGDFFYVKNEEQDW
                     YNASNPSSGKQGMVPKSYFEVVDRSRPRSLSGSARSRHSEHDQLSKMGSLYAIVLYDF
                     QAEKSDELTAHAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFVSIVDIGSGYATG
                     NEVKDDITSVSLPTVQEWKGYIAKYKASNISLGSVEQNPPLSPNSRYTKQQQELPVPP
                     TTNNDFVTKASVEAFGLEEDKYWFEVNCEISSGKRRKLKRYYQDFYDLQVKLLDSFPA
                     ESGKLRDNNGQWTKRIMPYIPGPVPYVTDVITKKRKDDLNVYVGDLIMLPEYISRSTM
                     VRSIFMLRDNGFDHDNNIQPINQFQNNGKDDDTAVISGLPNNHLSARNNEDNTLTGED
                     LKLYEKLSELSLSSSKPHSRPPSTLPPQIKPTKIKFYYKDDIFALMLNSDITLNELYA
                     KIAPRIDSSQFRLFIKMNDSDGAEIISDPQVSNLIQSKMKISVYDL"
     gene            complement(<1100294..>1102669)
                     /locus_tag="HG535_0A05610"
                     /db_xref="GeneID:59234256"
     mRNA            complement(<1100294..>1102669)
                     /locus_tag="HG535_0A05610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286453.1"
                     /db_xref="GeneID:59234256"
     CDS             complement(1100294..1102669)
                     /locus_tag="HG535_0A05610"
                     /inference="similar to AA sequence:RefSeq:NP_015253.1"
                     /note="similar to Saccharomyces cerevisiae UBP16
                     (YPL072W); ancestral locus Anc_8.540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142348.1"
                     /db_xref="GeneID:59234256"
                     /translation="MKYYFNLILNYIVSGSRYNKANIVSGHLPYWGLTALSVYILAPT
                     FTKLLFGSDEMFSSASKRIDKNTTGLINNRNDCFANSSVQALAALPKLTQYLNELLGS
                     VSLIANMLDNEHNDADRGEGDGLHDALVDGHVSNPVDSWERDLLTPKVELNRNPIENG
                     VSIDQGLVTPKAEPKENPMENLSSLDGVVEEQIMPRTKSTTTLSTLLNGSKLSERNYA
                     LSTAGVSEEQEFNGTEETKVTKAQIPEMLMHLGLAKILAQLQETVTSSRNISVWPLLR
                     ILEIIFNAKISSGQNDAHELTQIILETLQKENTKLDEFAKKHKLAVQIPKVPFQGNVA
                     GHLVCLVCTKSSKVNVHPFNIFPLQVPQAFSAKLSDMVADNQTETIEGYSCLVCKVKA
                     ILANEEGRGYKDCLQEELNILRTLKKAVSDLLINDDISEELSSYIDSYNKNGVVAKDI
                     KSTIVKKTAVVDSADILVLHLSRSMFNGMTYSRNSCGVAFDEILECVEQVIENNRCVG
                     IKTVRYKLKAMVKHTGSHSQGHYECYRRKPDFVKDTVSKQVINRSPLINLSLLDTQNT
                     NVSDSFKNQENTFVSNGSTEGFNQQIQNSLSNFTLNADALPISVKTNGSSDDDYTISA
                     GGDSNKPSRKPSALKRITGFLSRRSSVSNAADDSNNEAIVPSSVDLSRSTNNSFDRSR
                     SSSIVGDEVPRSRAGSVSTSNTGRVRGSSISSVDSQSSYMNSSDANIGSTSASELENN
                     TTGGKRILKKIKSVSKYPFWHISDTTVKEAKANEVLAEMRYVYMLYYERID"
     gene            complement(<1103038..>1105329)
                     /locus_tag="HG535_0A05620"
                     /db_xref="GeneID:59234257"
     mRNA            complement(<1103038..>1105329)
                     /locus_tag="HG535_0A05620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286454.1"
                     /db_xref="GeneID:59234257"
     CDS             complement(1103038..1105329)
                     /locus_tag="HG535_0A05620"
                     /inference="similar to AA sequence:RefSeq:NP_015251.1"
                     /note="similar to Saccharomyces cerevisiae YTA6 (YPL074W);
                     ancestral locus Anc_8.542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142349.1"
                     /db_xref="GeneID:59234257"
                     /translation="MPNDTFNIPANFTLIQSLQLLYSIVTNHCDNFKKQKNEHATNSH
                     NLKKMFKRFDSLLYYMNDGLEKIEKHYQNEDGLNKLVGSRPELRSQLEDLQILGQDIR
                     LERRACRSQLESLERQEDGSNNGILNNIRRSGIWRNRSIIGRSKKITKQEEAEEAAAI
                     AAAEKIKLTRKLEKEKELEEIKKRELDIESRREKLLETMIKEQVENELHEKLEEAERK
                     RRKERELLEERQRKLKQDRQIMAPPSGTSKTTDSHPAKVGSDRHNMLINGRRSFDIRG
                     SRKSLDGITPLSPKRKSLDMQDIGKAAQLAWSQSNSNDGRKVHSLPNRTQNLSPTRNQ
                     QQYLSANVPGKKKYEYVKPVVHRQVIRTPKRNVVNGKKSANISKETISVDTRMTTKSL
                     NSSAKSSPDIRTSDLRSPELKSPILVSSSVSPPLTPTLNKQITDIEQTPLEAKMDKVM
                     ATLQGVDREACEQIMNEIIVMDEKILWDDIAGLKNAKSSLKETVVYPFLRPDLFKGLR
                     EPIRGMLLFGPPGTGKTMIAKAVATESHSTFFSISASSLLSKYLGESEKLVRALFYMA
                     KRLAPSIIFIDEIDSLLTARSDNENESSRRIKTELLIQWSSLSSATAKESESDSEDEP
                     DSRVLVLAATNLPWAIDEAARRRFSRRLYIPLPEYDTRLYHLRKLMSKQKNDLSDTDF
                     EVIAKMTRGFSGSDITALAKEAAMEPIRDLGDTLMNADFNKIRGVIVKDFEKAMQIIK
                     KSVSVESLQQYEDWAAGFGSTGA"
     gene            complement(<1105651..>1108206)
                     /locus_tag="HG535_0A05630"
                     /db_xref="GeneID:59234258"
     mRNA            complement(<1105651..>1108206)
                     /locus_tag="HG535_0A05630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286455.1"
                     /db_xref="GeneID:59234258"
     CDS             complement(1105651..1108206)
                     /locus_tag="HG535_0A05630"
                     /inference="similar to AA sequence:RefSeq:NP_015250.1"
                     /note="similar to Saccharomyces cerevisiae GCR1 (YPL075W);
                     ancestral locus Anc_8.543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142350.1"
                     /db_xref="GeneID:59234258"
                     /translation="MVNLHLLNQAAAKMAVAENRSNSIQNSHNATTSSSNSYINSNDN
                     PNKLQMFLKKQDQQARISNSNISSNFHIITQYILQSYFKVQVNQLSSLKIADLIVDQT
                     YPDSITLRKLNENTSITPYVYFNTISRDEDITRCPIFALAIYFVIRWSHPNPPISVEN
                     FDNISLLDFNFINHSNANIAEFNDMSMNDRKISRSQNFLPSDDLISLVFPWLSPLKQD
                     MLLIDRTNYKLNSFVELFEFLARTMIQDLKFLNQKPDLLPNIVSFVAKFIPDLFRNEQ
                     FKFTKIDLTTSTSDYKSNTGDNDYRDDNAHFLELSKRLTTENIRLSQQITQLKSDLYN
                     VHSMCDQILQLQKQLMPGSYDYALDNSRNGAADTDSNSNNGGIIILDKNSLNPSMLSN
                     LVQSIEDTRHQSAQLQQPQQPQVQQADTPSLAPINAFSSFNNSMPSIYTPQQQQLQPQ
                     QRPHQQQQSQQQHDMKRKLPLPTTATPGTVPFSPSPGSPSVGTLASVDAMYSKRFRYD
                     DKPTASQTALDSLLSKSIGSPRYSTLQQNQAAGANPTSYSSQRIASRFASPANFPVPG
                     TPSAVVNSPDPSNQLVSYVPRAQPQESEQQASSTLIDNSLIDDTTGILDKTDETNQID
                     NSSRKLAQPGPTEQPINEKSSLEANYDANDNKTSRKKGSSSDSNDEKSPRSTTNEKET
                     GSSSKKMSQSGEKVGPNRHIKYKLSRENKTIWDLYTEWYVGLNGKPSIKNLIENYGWR
                     RWKVSDDSHFFPTRRIIMDYIETECDRGIKLGRFTNPDQPREDIRKILVGDLEKFRIN
                     NGLTLNSLSMYFKNLTKENKEICIFENFENWTVRGMSEEDKTNYCKRQHIKEN"
     gene            <1109642..>1112311
                     /locus_tag="HG535_0A05640"
                     /db_xref="GeneID:59234259"
     mRNA            <1109642..>1112311
                     /locus_tag="HG535_0A05640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286456.1"
                     /db_xref="GeneID:59234259"
     CDS             1109642..1112311
                     /locus_tag="HG535_0A05640"
                     /inference="similar to AA sequence:RefSeq:NP_009757.1"
                     /note="similar to Saccharomyces cerevisiae TAF5 (YBR198C);
                     ancestral locus Anc_8.544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142351.1"
                     /db_xref="GeneID:59234259"
                     /translation="MAQQNSKQQQPRQTSPTSGPRNPVSGGANAGNANTNASTNANRG
                     NGAGAGTGAQASGGNGGAKPSGPFSASDLNRIVLEYLNKKGYHRTEAMLRAESGRTLT
                     PQNNQSPANTKTGTLPEPKTTPPNAESTARPISNPVNVPSKRDSNDTSIVSDDKLKEV
                     TAPENYIRAYSMLKNWIDSSLEIYKQELLYIVYPIFIYIFLTLVPKSPIFARRFFDRF
                     SPDFKVNHSSEINRLFSVNSIDHIKENEVASAFQENRYRITISRTPLNLLLYFLNENE
                     SVGGSLVISIVNQHIDPIVVETVTAKDKLSDGIKLIDSENGKSNVDAEINSIPVKLGP
                     FPKDEEFSKEVETELRIKDEQERKQVPQLDGTSSSNQSKKTLLEEYRSMHNEPYDEKT
                     DMNSSAAVAAASDAITASSPTPPKDMKEQLRPEEENKNNTNSDGSKAANVEDGGKNVA
                     TNLDVKTNEKENESKTKTTDDSNDKKESSVVAPVKIEEKKQQSKASNAAFIPPDAVME
                     SPSADTIPLPLKTTLDIKLEIQKVKESRDAIKLDNLQLALPSVCMYTFHNTNRDMTSL
                     EFSDDCRLAAAGFQDSQIKIYSLDGSSLSNKYTGKEIPSDALTASLTGHSGTVYSTSF
                     SPDNRYLVSGSEDKTVRLWSMDTYTPLVSYKGHNHPVWDVEYSPLGHYFATASHDHTA
                     RLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDVATGDSVRLFLG
                     LTAPVISTKVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGN
                     VLVSGGADHSVRVWDLKKATAESGAEPEDPFVGYLGDVTASINQDIKEYGRRRTVIPT
                     NDLVASFFTKKTPVFKVKFTRSNLALAGGAFRD"
     gene            complement(<1112393..>1113223)
                     /locus_tag="HG535_0A05650"
                     /db_xref="GeneID:59234260"
     mRNA            complement(<1112393..>1113223)
                     /locus_tag="HG535_0A05650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286457.1"
                     /db_xref="GeneID:59234260"
     CDS             complement(1112393..1113223)
                     /locus_tag="HG535_0A05650"
                     /inference="similar to AA sequence:RefSeq:NP_015249.1"
                     /note="similar to Saccharomyces cerevisiae GPI2 (YPL076W);
                     ancestral locus Anc_8.545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142352.1"
                     /db_xref="GeneID:59234260"
                     /translation="MVKPWKRLLWIKQEDYPDNYTDPAFIDLITRLRYKGKSAKPSNN
                     SSSVHQIRSDLFRFYNKLLNTVFVYIIFVFIYNYRVNPVSFAIFVTILVSWLLSRSNA
                     KHYAFGVKSSLVITFAMLTLSPILKSLSKTTASDSIWTLSFWLSIAYVGSLSSNVNAQ
                     TSNLSTNLLLAIVILLASRFQSTAHVFCFLLICVQLNVILPNLINLSNKYISFTINLS
                     VYGFLTCTLGWSYTFLALAMSFFYLFVLPQWFVYWQTYYRGYESSLSRVWEAQKPILD
                     "
     gene            <1113368..>1114300
                     /locus_tag="HG535_0A05660"
                     /db_xref="GeneID:59234261"
     mRNA            <1113368..>1114300
                     /locus_tag="HG535_0A05660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286458.1"
                     /db_xref="GeneID:59234261"
     CDS             1113368..1114300
                     /locus_tag="HG535_0A05660"
                     /inference="similar to AA sequence:RefSeq:NP_009756.1"
                     /note="similar to Saccharomyces cerevisiae YBR197C and
                     YPL077C; ancestral locus Anc_8.546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142353.1"
                     /db_xref="GeneID:59234261"
                     /translation="MSEIPGLSYTATNNEDEEHDGESFINIPRTIPSTNTNYNNAYLK
                     RSDATDKNGGGDAKVSETAWGANRSHIFNFEPSTPPAQSVREFAKTHPEQFYSTIEDE
                     DEEKDGNEQTGEDRQNVQGEMREDIQDNYYNDHDDEADDADDAENDDEFDSFAESKGD
                     SEIHGTDHYGKLETHPKTDNQDTLWTEIDALDDVKNLAQTIDLYEGFPLGFEDQLQKI
                     RESHAQVLRAMRDRNARIEEEKRHEITSKSDSQNSGGLPNANANTSMSRVASNATGKP
                     DRNIKHDTSGPTVLPDEDKYIQEMIDSIKALRTS"
     gene            <1115818..>1117485
                     /locus_tag="HG535_0A05670"
                     /db_xref="GeneID:59234262"
     mRNA            <1115818..>1117485
                     /locus_tag="HG535_0A05670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286459.1"
                     /db_xref="GeneID:59234262"
     CDS             1115818..1117485
                     /locus_tag="HG535_0A05670"
                     /inference="similar to AA sequence:RefSeq:NP_009755.1"
                     /note="similar to Saccharomyces cerevisiae PGI1 (YBR196C);
                     ancestral locus Anc_8.547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142354.1"
                     /db_xref="GeneID:59234262"
                     /translation="MASQNTFSDFKLATELPAWSKLQKLYDTEGKKINVKDEFSKDSK
                     RFEKLSKTFTNYDGSKILFDFSKNLVNDDVLSALIELAKEAKVTELRDDMFKGEHINF
                     TEDRAVFHVALRNRANKVMKVDGVNVAPEVDAVLAHMKEFSEQVRSGQWKGYTGKQIT
                     DVVNIGIGGSDLGPVMVTEALKHYATNIKAHFVSNIDGTHIAETLKVVNPETTLFLIA
                     SKTFTTAETITNANTAKNWFLSKTGNDTANIAKHFAALSTNEAEVAKFGIDTKNMFGF
                     DNWVGGRYSVWSAIGLSVALYIGFDNFDAFLKGAEAVDKHFTETPVEDNIPLLGGLLS
                     VWYNNFFGAQTHLVAPFDQYLHRFPAYLQQLSMESNGKSVTRGNVFSNYSTGSILFGE
                     PATNAQHSFFQLVHQGTKVIPSDFILAAQSHNPIEGNLHQRMLASNFFAQAEALMVGK
                     DEQQVKAEGATGGLVPHKVFSGNRPTTSILAQKITPATLGALIAYYEHLTFTEGAIWN
                     INSFDQWGVELGKVLAKAIGKELDDSSKTSSHDASTNSLINQFKSWA"
     gene            <1117687..>1118940
                     /locus_tag="HG535_0A05680"
                     /db_xref="GeneID:59234263"
     mRNA            <1117687..>1118940
                     /locus_tag="HG535_0A05680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286460.1"
                     /db_xref="GeneID:59234263"
     CDS             1117687..1118940
                     /locus_tag="HG535_0A05680"
                     /inference="similar to AA sequence:RefSeq:NP_009754.1"
                     /note="similar to Saccharomyces cerevisiae MSI1 (YBR195C);
                     ancestral locus Anc_8.548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142355.1"
                     /db_xref="GeneID:59234263"
                     /translation="MTDAAPELVDIDNSIPEVSQERYIHWKKNTKLLYDYLNTNATKW
                     PSLTCQFFPDLDTSTDSHRILLSSFTSSQLPEDEAIYISKISTLDHIKWSSLNNFDMD
                     EMEFKPDNSTKFPSKNLYNDLTVRFPGGDCNRARYLPQNPDVILAASSDGSIYVFNRT
                     KHGTTASQSLNSTRYAMKLSSANKSQDIVQVDETNETVSISCNGQKEGLLASCYSQGQ
                     LKVWDISAYSHADPIINQPVISLNDADPKGLNDVSWMPLHDSLIAACGESNYVALHDT
                     RSSELISQSDSNLHQGGINACKFNPHNSLLLASGDAEGTVNLWDLRKLDKAPIKSLQH
                     GSAVSTLEWSPNLEPIIATAGQNDGLVKIWDASTDRVIFTHGGHMLGVNDIAWNAHDP
                     WLLCSVANDNSVHVWRPARHLVELQ"
     gene            <1119269..>1119979
                     /locus_tag="HG535_0A05690"
                     /db_xref="GeneID:59234264"
     mRNA            <1119269..>1119979
                     /locus_tag="HG535_0A05690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286461.1"
                     /db_xref="GeneID:59234264"
     CDS             1119269..1119979
                     /locus_tag="HG535_0A05690"
                     /inference="similar to AA sequence:RefSeq:NP_015247.1"
                     /note="similar to Saccharomyces cerevisiae ATP4 (YPL078C);
                     ancestral locus Anc_8.549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142356.1"
                     /db_xref="GeneID:59234264"
                     /translation="MSIRALTLKAAARPLAGLTVRQAPSGLRYMSSPAPQEPKAKANS
                     IIDALPGNSILSKTGILGTSAAAAIYAISNELYVVNDESILLFTFLCFSGIVAKFLAP
                     GYKEWADARVKKVQDVLNASRTKHVDAVKDRIASVSELKDVQDITKVLFEVSKETVQL
                     EAKAFELKQKVDLAHEAKSVLDSWVRYEASVRQLQQRQVTESVLAKVKSELANPKFQD
                     RVLQQSITEVEQLFSKLK"
     gene            complement(<1120154..>1120640)
                     /locus_tag="HG535_0A05700"
                     /db_xref="GeneID:59234265"
     mRNA            complement(join(<1120154..1120560,1120628..>1120640))
                     /locus_tag="HG535_0A05700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286462.1"
                     /db_xref="GeneID:59234265"
     CDS             complement(join(1120154..1120560,1120628..1120640))
                     /locus_tag="HG535_0A05700"
                     /inference="similar to AA sequence:RefSeq:NP_009753.3"
                     /note="similar to Saccharomyces cerevisiae YBR194W;
                     ancestral locus Anc_8.550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142357.1"
                     /db_xref="GeneID:59234265"
                     /translation="MEEEEKLRTRAYRKASKGVRTERRISGLRDVDRKVRQTGIEKLD
                     GKNHVKAKEYKRLNVLKGDLKLADKDSADREHEHNDSQRLGTKSIFFDSDWNPDGEAP
                     QGHKNIPYNQNTFKRKEGTFHPKLAGLDDIPLPSDAK"
     gene            <1120783..>1121472
                     /locus_tag="HG535_0A05710"
                     /db_xref="GeneID:59234266"
     mRNA            <1120783..>1121472
                     /locus_tag="HG535_0A05710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286463.1"
                     /db_xref="GeneID:59234266"
     CDS             1120783..1121472
                     /locus_tag="HG535_0A05710"
                     /inference="similar to AA sequence:RefSeq:NP_009752.3"
                     /note="similar to Saccharomyces cerevisiae MED8 (YBR193C);
                     ancestral locus Anc_8.551"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142358.1"
                     /db_xref="GeneID:59234266"
                     /translation="MNTDANSNSFQEDLKPNFDGVPSQALDAVRMRAAQLTHSLKRIR
                     DELSRAELPQWHSLQSQVNVTLSQLMSLTSTLQHFQDTLDSTVVFPLPNFPTTSHEGL
                     LTTLLRKKYTPEVDEWIASAREAADLDQSILDPQAIDKLLKDEKDVTEWALQTLVKEF
                     ERYSSGADYAEQNSGATEDEQMIDVSTVNCGKPTKPFDSDQILKYTSKGEIPSEIMHE
                     MSEEGSVVITE"
     gene            complement(<1121633..>1122754)
                     /locus_tag="HG535_0A05720"
                     /db_xref="GeneID:59234267"
     mRNA            complement(<1121633..>1122754)
                     /locus_tag="HG535_0A05720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286464.1"
                     /db_xref="GeneID:59234267"
     CDS             complement(1121633..1122754)
                     /locus_tag="HG535_0A05720"
                     /inference="similar to AA sequence:RefSeq:NP_009751.1"
                     /note="similar to Saccharomyces cerevisiae RIM2 (YBR192W);
                     ancestral locus Anc_8.552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142359.1"
                     /db_xref="GeneID:59234267"
                     /translation="MPRKPLDEWEEDARESLPYLASDEKGSNFREAVQTTSVTQKSTT
                     KNHPAVRPWVHFVAGGIGGMAGAIVTCPFDLVKTRLQSDVYQSIYKSKVATHAVTGFR
                     PVSYILDGATHFKETFGIIGNIYKQEGFQSLFKGLGPNLVGVIPARSINFFTYGTTKD
                     IYSRSFNNGEEAAWIHLMAGATAGVATSTATNPIWMVKTRLQLDKAGKTRLYSNSWSC
                     LKGILNTEGIRGLYKGLSASYLGSAESILQWLLYEQMKRILHERSIQRLGHADEYKKT
                     TTEKITEWCQRSGSAGLAKFVASIITYPHEVVRTRLRQAPLENGKMKYTGLIQTFKVI
                     IKEEGFASMYSGLTPHLMRTVPNSIIMFGTWELVIKLLS"
     gene            complement(<1123161..>1123960)
                     /locus_tag="HG535_0A05730"
                     /db_xref="GeneID:59234268"
     mRNA            complement(join(<1123161..1123632,1123950..>1123960))
                     /locus_tag="HG535_0A05730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286465.1"
                     /db_xref="GeneID:59234268"
     CDS             complement(join(1123161..1123632,1123950..1123960))
                     /locus_tag="HG535_0A05730"
                     /inference="similar to AA sequence:RefSeq:NP_009750.1"
                     /note="similar to Saccharomyces cerevisiae RPL21A
                     (YBR191W) and RPL21B (YPL079W); ancestral locus Anc_8.553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142360.1"
                     /db_xref="GeneID:59234268"
                     /translation="MGKSHGYRSRTRYMFQRDFRKHGTIPLSTYLKVYKVGDIVDIKA
                     NGSIQKGMPHKVYQGKTGIVYNVTKSSVGIIINKIVGNRYLEKRLSLRVEHVKHSKCR
                     AEFLQRVKDNAARRAEGKAKGIAVQLKRQPAQPREAHSVSTENNVPQTLAPTPYETFI
                     "
     gene            complement(<1124812..>1125811)
                     /locus_tag="HG535_0A05740"
                     /db_xref="GeneID:59234269"
     mRNA            complement(join(<1124812..1125383,1125805..>1125811))
                     /locus_tag="HG535_0A05740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286466.1"
                     /db_xref="GeneID:59234269"
     CDS             complement(join(1124812..1125383,1125805..1125811))
                     /locus_tag="HG535_0A05740"
                     /inference="similar to AA sequence:RefSeq:NP_009748.3"
                     /note="similar to Saccharomyces cerevisiae RPS9B (YBR189W)
                     and RPS9A (YPL081W); ancestral locus Anc_8.554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142361.1"
                     /db_xref="GeneID:59234269"
                     /translation="MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYR
                     ITFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDRKKLDYVLALKIE
                     DFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAP
                     TSPFGGGRPGRVARRNAVKSREGGDEAAEDEE"
     gene            complement(<1126137..>1127318)
                     /locus_tag="HG535_0A05750"
                     /db_xref="GeneID:59234270"
     mRNA            complement(<1126137..>1127318)
                     /locus_tag="HG535_0A05750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286467.1"
                     /db_xref="GeneID:59234270"
     CDS             complement(1126137..1127318)
                     /locus_tag="HG535_0A05750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142362.1"
                     /db_xref="GeneID:59234270"
                     /translation="MSVSSNPYAPNVADLVSNVRNFQIIESTLREGEQFANAFFDTEK
                     KIEIAKALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDARVAV
                     ETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFVKSKGLEIRFSSEDSFRSD
                     IVDLLNIYKTVDHIGVDRVGIADTVGCANPRQVYDLVRSLKNVVSCDIECHFHDDTGC
                     AIGNAYSALEAGARLIDTCVLGIGERNGIVSLGGFMARMIVSAPEYVKSKYNLKKLRD
                     LETLVAEAVEVNLPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPEDFGISRYIH
                     FANRLTGWNAIKSRVEQLQLKLTDDEIKEVTGKIKQMGDIRPLGLDDVDSIIKDFHAE
                     L"
     gene            <1128578..>1134175
                     /locus_tag="HG535_0A05760"
                     /db_xref="GeneID:59234271"
     mRNA            <1128578..>1134175
                     /locus_tag="HG535_0A05760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286468.1"
                     /db_xref="GeneID:59234271"
     CDS             1128578..1134175
                     /locus_tag="HG535_0A05760"
                     /inference="similar to AA sequence:RefSeq:NP_015243.1"
                     /note="similar to Saccharomyces cerevisiae MOT1 (YPL082C);
                     ancestral locus Anc_8.555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142363.1"
                     /db_xref="GeneID:59234271"
                     /translation="MTSQVSRLDRQVILLETGSTQFVRNMAADQMGDLAKQHPEDILS
                     LLSRVYPFLLVKKWETRVTAARAVGAIVQHAPVWDPNTDDTDGTASVRSGNGIGEEDL
                     ECSAKIKLEKEIKIKLEEISQEDRKEIFQDDSRLLSLSDWNLHELLKSKKILLASSSN
                     NFNDSDDGISKKQLKANHGDSSPVSPMDAEVKHEVDSKKELASGASKKSARMLAMAKR
                     RKRIQAKSSFNKPVDLSESSVSKSLMNSNSNASTPNPKLEITEQSDENKIMVESMISP
                     ILEKHERVAGLVWQFQGIYELLLENLMNDTWEKRHGAALGLREILKKHASSVSRVKGK
                     SKNENDTINKKSLEDTATRLLTIFALDRFGDYVHDTVVAPVRESVAQTLAALLIHLED
                     DLSIKIFYTLEQLVLQDPKVVAVPNRIWEATHGGLLGIRYFVSIKTDLLMSSDLLPNV
                     VKIVLYGLDQSDDDVQSVAAAILSPITNDFVRLGSETIDHVLTTIWSSLTHLDDDLSS
                     SVGSVMDLLANLCKHQEVLDILKNKAIQHPSEWSFKSLVPKLYPFLRHSISSVRKSVL
                     NLLNAFLSIKDDSTKNWLNGRIFRLIFQNIILEQHEDILSLSFQVYQSLLNDYKFKHT
                     EKTLDHVLSKHLQPILHLLNTPIGENGKNYSMESQYILKPSQHYQLHPERKRSISEAN
                     HESSIPIPKGSERVNIDAPMIAGDITLLGSEIITNTRVMGAKAFGLTLSHFQDSTLES
                     FFTNVLVRCLDLTYATPRMLAFIILTEFCSSWLQDHENVPSFVAETFRPIVTDQLSHP
                     DKLPVFRELVPSLKALRTQCQSLLITFVDVGMLPQHKLPNIPVVVQGESEAGPEAFTI
                     SLAEKVYNEYYDKMFRAMSNSYKLLAKKPLEDAKYRVFLAIQAAQSSRKARNTSILAN
                     YASASLRYEGLPTKLNPIIRSLMDSVKEETNEKLQKLSGESVIYLIKQLISHEKPKVS
                     NKIVKNLCGFLCVDTTEVPEFASHSALKDSILTLQKEYSIDSNKEDILIMKMTEEAQI
                     KRRGGIFTLSRLLQVFGRDVLIKIPQLKDCLFDPLTKLDELSDQGHRDNTLGQSIVDA
                     LGIMRSTYCFMDPQLRSEEVIPKFPILLEFLKSEFSVFRYSTARLIADFAKTSPLEVM
                     SFVIREVIPLMNSAGSVIHRQGASELIYHLSNSMGTDILPYVIFLLVPLLGRMSDSNN
                     DVRNLATTTFASIIKLVPLEAGIADPEGLPDDLMVGRERERDFIQQMMDPSKAKPFKL
                     PVAIKATLRKYQQDGINWLVFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRSEDY
                     KKTKSVETRPLPSLIICPPSLTGHWENEFEVYASFLDVVVYAGGPSTRIPLREKLAGA
                     DIIVTSYDVARNDLEIFKQYDYNYCVLDEGHIIKNAQSKLAKAVKQINANHRLILTGT
                     PIQNNVVELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSREQEAGVLALEAL
                     HKQVLPFMLRRLKEDVLSDLPPKIIQDYFCELSDLQKQLYKDFSKKQKNVVEKDIDST
                     SDLDSKQHIFQALQYMRKLCNHPALVLSPDHPQLKQVQEYLKQTHLNLHDIVNAPKLL
                     ALKNLLFECGIGERDMERKQSANQFPSSENVISQHRALIFCQLKDMLDMVETDLFKKY
                     MPSVTYMRLDGSVEPRDRQNVVKKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFIEH
                     DWNPMNDLQAMDRAHRLGQKRVVNVYRIVTKGTLEEKIMGLQKFKMNIASTVVNQQNN
                     GLASMDTHQLLDLFDTDNVPSQDDEEKQAQLNNGVNGMEDIASETGLSGKAKEAVGEL
                     KELWDTSQYEEEYNLDNFIKTLR"
     gene            <1134446..>1134880
                     /locus_tag="HG535_0A05770"
                     /db_xref="GeneID:59234272"
     mRNA            <1134446..>1134880
                     /locus_tag="HG535_0A05770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286469.1"
                     /db_xref="GeneID:59234272"
     CDS             1134446..1134880
                     /locus_tag="HG535_0A05770"
                     /inference="similar to AA sequence:RefSeq:NP_009747.3"
                     /note="similar to Saccharomyces cerevisiae NTC20
                     (YBR188C); ancestral locus Anc_8.556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142364.1"
                     /db_xref="GeneID:59234272"
                     /translation="MSSLNEQVKARKRRLEELKNRSEHANTVEEASKKSKNEIEKKNH
                     NGDIGVPLEYTDYTVEQLSSKIEKEVLEELKKTADVIITNFARNQSQRSKSITAKRVN
                     DKSVGFPATFLQEKLDELDRRTDDQIKRLVRKKLMKDAKSEN"
     gene            complement(<1134989..>1135762)
                     /locus_tag="HG535_0A05780"
                     /db_xref="GeneID:59234273"
     mRNA            complement(<1134989..>1135762)
                     /locus_tag="HG535_0A05780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286470.1"
                     /db_xref="GeneID:59234273"
     CDS             complement(1134989..1135762)
                     /locus_tag="HG535_0A05780"
                     /inference="similar to AA sequence:RefSeq:NP_009746.1"
                     /note="similar to Saccharomyces cerevisiae GDT1 (YBR187W);
                     ancestral locus Anc_8.557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142365