GenomeNet

Database: RefSeq
Entry: NC_050720
LinkDB: NC_050720
Original site: NC_050720 
LOCUS       NC_050720            1411209 bp    DNA     linear   CON 10-NOV-2020
DEFINITION  Zygotorulaspora mrakii chromosome 2, complete sequence.
ACCESSION   NC_050720
VERSION     NC_050720.1
DBLINK      BioProject: PRJNA670754
            BioSample: SAMN14605243
            Assembly: GCF_013402915.1
KEYWORDS    RefSeq.
SOURCE      Zygotorulaspora mrakii
  ORGANISM  Zygotorulaspora mrakii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Zygotorulaspora.
REFERENCE   1  (bases 1 to 1411209)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     The yeast mating-type switching endonuclease HO is a domesticated
            member of an unorthodox homing genetic element family
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1411209)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1411209)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUL-2020) Conway Institute, University College Dublin
            (UCD), Wolfe Lab, Belfield, Dublin Dulin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP058605.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: HGAP v. 3
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100.0x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1411209
                     /organism="Zygotorulaspora mrakii"
                     /mol_type="genomic DNA"
                     /strain="NRRL Y-6702"
                     /isolation_source="silage"
                     /db_xref="taxon:42260"
                     /chromosome="2"
                     /country="Italy"
     gene            complement(<1..>770)
                     /locus_tag="HG535_0B00100"
                     /db_xref="GeneID:59234634"
     mRNA            complement(<1..>770)
                     /locus_tag="HG535_0B00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286806.1"
                     /db_xref="GeneID:59234634"
     CDS             complement(<1..770)
                     /locus_tag="HG535_0B00100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142701.1"
                     /db_xref="GeneID:59234634"
                     /translation="MAENKLLIGIDVGGTNTDSVLIDACSLGSKTSGVISYHKSSTTA
                     DVSVGISKAIDRLFDEDNGCDPAEILAVTIGTTHFINAVIEQDKARLEPVAVIRLCGP
                     YSQGSYPFSDFPPGLTKIIKSYTAFVNGGNRVDGSQIQALDQDMILEHARKIKALGIK
                     NVAIVGIFAIINKSHEQRAAELVRTVIPDGNIVMSHTVSAIGYLARENASILNASIMS
                     FATKIIRSFIKSVRSRGLNCPILLTQNDGTVLTVNEAL"
     gene            <1940..>3625
                     /locus_tag="HG535_0B00110"
                     /db_xref="GeneID:59234635"
     mRNA            <1940..>3625
                     /locus_tag="HG535_0B00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286807.1"
                     /db_xref="GeneID:59234635"
     CDS             1940..3625
                     /locus_tag="HG535_0B00110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142702.1"
                     /db_xref="GeneID:59234635"
                     /translation="MSFFSKIHDLIKIPPGEGIESVTYLSNKDIIPMGPKRRTWGVWS
                     LTFYWSITNVTISTWTGASSLLSLGLTVGETMGVIVIGNAIIATLALLNAAPGGYYHI
                     GYTISQRVVFGIRGSVIGIIIRIILSVVWFGSQAYLGSLCLNCVFASWSHHYLHLPNT
                     IPESVNMTTQQLIGFVVFQIISIPPLFFKPERFNKPLMVTCVLTFFAMMGITIWAVSR
                     NGGSNGPLMHESTNMSSSTRGWYWVYGISSWYGSLSSGVANQSDFTRFSKRTWSSLFG
                     TVFSLMVVGTIIPLMGLVTASAYRGRYGEEVWMPNEIIMNCLEADYSPTTRAAAFFVG
                     AVFTLSQVCFNTMGNAYAGGMDLSGLLPKYFNITRGSILTAILSWVVQPWDFYNTSST
                     FVTVMSSFSVFMSPIVGIIIADFWVVRKKHLKLSHLYSNDKTGKYWYWKGINYRNLII
                     WVIAFTPGLPGLINAVTPTIRVNRGIQNFYYGNTIFEYFITFFLTIGSSYIWPYDNVD
                     DEDEYDYFDTFTEEECAKKNIVPYSQITERDLNTDSARSTVSGENIVILPEKE"
     gene            complement(<3945..>5732)
                     /locus_tag="HG535_0B00120"
                     /db_xref="GeneID:59234636"
     mRNA            complement(<3945..>5732)
                     /locus_tag="HG535_0B00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286808.1"
                     /db_xref="GeneID:59234636"
     CDS             complement(3945..5732)
                     /locus_tag="HG535_0B00120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142703.1"
                     /db_xref="GeneID:59234636"
                     /translation="MRSLRKPRGRYSHTGCLECKRSGIKCDETSGGCLVCRRKRMECV
                     YEHKIFVYQPKEATAKKKRQFKKVKLKVHDQKNIAREKMVYNSIADSVCSFEVIDECI
                     DSFKENFDGGKQSAKSEKIEHVALETSDNIEKVNNGCKNLDDISKETALLVPQYVQYW
                     RPYNNQRYEELSNKFDPAGVEIKNVHYHEYDPEVQEFIFYAFIHSKAVYNYVLGPIDE
                     TNCIAKWFIYFGRKYAIMGFVLNFITCNLLNIRCSDGRWSCILRRNMVASLANLSARI
                     NACDSFTEMACYLFSIMFLFSEQTASRVDIWRLHLKGAFTILEQCGTFYNRIARDIDL
                     LDPEMKLALQMFSFSKNWFVCSETIACLSAPNGGVIEDIARLRYHLSYNTQYPDDGVL
                     LGGFNLMRGYSQRLVPTLIEIITFITAFRKSEGICLSGTEGILENLQPTEEQINMGEK
                     LLDSVRQIQGEELNLLSEKNYVNRAYIRACHICFCSALRIYILSVFLGDFIYGSDVQH
                     CVQTIEEQLVTIKDIHIYGLCIHWPLFIASLCAPPGEQRKRFIEALKSISNSGIFVAR
                     NTVERVERFWRVIDSGGLIEEKDYDCTVA"
     gene            complement(<7352..>8296)
                     /locus_tag="HG535_0B00130"
                     /db_xref="GeneID:59234637"
     mRNA            complement(<7352..>8296)
                     /locus_tag="HG535_0B00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286809.1"
                     /db_xref="GeneID:59234637"
     CDS             complement(7352..8296)
                     /locus_tag="HG535_0B00130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142704.1"
                     /db_xref="GeneID:59234637"
                     /translation="MSYQETTPAPCKSKPESSNSSSSLQIAIIGGGRIGSAFALYLIQ
                     IGHHDVTIVARPFSKRLKELERDGGIITSDGRYAPATITSSFDENIPYDLVLVTVLGH
                     QVGGILPSLHRSAAKSIHFLFNTFNPEYLQESVGGGRGVLGMPFIQSNIDPNGRVNAA
                     VGQGGQKTLTSDPKWAKVFQSAGLPAQYEGEMALWLRCHVPLCVAFESVCVTGERRGG
                     GAPWRSAYAVALGLRASFSLIASQGHEIYPRSKAFLRWLPVTVVASMLWILSRINSFR
                     ILLATGENECCALVDTMVASAAKKEGSADYKAILAMKP"
     gene            <10576..>11022
                     /locus_tag="HG535_0B00140"
                     /db_xref="GeneID:59234638"
     mRNA            <10576..>11022
                     /locus_tag="HG535_0B00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286810.1"
                     /db_xref="GeneID:59234638"
     CDS             10576..11022
                     /locus_tag="HG535_0B00140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142705.1"
                     /db_xref="GeneID:59234638"
                     /translation="MCLFVYAGEIRDLFTWQQGLAVGDWITHLLSIFFVIVFVPGVIV
                     IDKHTLRQILKDVSEAGVEFDDIDWRKIAHSANELSMKQSRRRCLFLRDYICKAYFVN
                     RILLLIEGDSECISFNWSEDFNIFFADENCKQLVENAANIYRQSLN"
     gene            complement(<11560..>12306)
                     /locus_tag="HG535_0B00150"
                     /db_xref="GeneID:59234639"
     mRNA            complement(<11560..>12306)
                     /locus_tag="HG535_0B00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286811.1"
                     /db_xref="GeneID:59234639"
     CDS             complement(11560..12306)
                     /locus_tag="HG535_0B00150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142706.1"
                     /db_xref="GeneID:59234639"
                     /translation="MSLIEKTALITGGTKNLGKLTAIELASKHKANLFLHYNSSQGDE
                     QEFAKELAEKYGVKVELYQGRLGSAASLTELFEAAIKKFGRVDIAINNVGKVLKKPFA
                     EVTEKEFDDMNLVNNKVAYFFISEASKKVSEGGRIISLVTSLLAVYTPFYPVYQGTKA
                     AVEYYTKAASKELLGKGITVNCVAPGPMDTPFFYGQETPEAVEFYKSNAMQNRLTKIE
                     DIAPIISFLATGRGWITGQVIYANGGLAAP"
     gene            <13490..>14509
                     /locus_tag="HG535_0B00160"
                     /db_xref="GeneID:59234640"
     mRNA            <13490..>14509
                     /locus_tag="HG535_0B00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286812.1"
                     /db_xref="GeneID:59234640"
     CDS             13490..14509
                     /locus_tag="HG535_0B00160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142707.1"
                     /db_xref="GeneID:59234640"
                     /translation="MPSLYNKTPLVQQTFTDGESDSPQFFIKSEFSQPGGSFKSRGIG
                     YLISKSAARIEEGSGKPPHVYCSSGGNAGLAAATASEILSLPCTVVVPRTTKESMISK
                     IRDRGAEVIVKGSHWKEADFHLCESIIKSAEGSKHVPIYVHPFDNSEIWDGHSSIVDE
                     IIESLKSEHIDLDRLKGIVCSVGGGGLFNGVIRGLERHNLAHQVPVVAVETKGCDVLN
                     ASLRAGHQVTLEKITSVASSLGSVYTPKETFDYATKYNTKSVVLDDIAVLETCLKYAQ
                     SNNVAVEPACGASIHLAYNPDILEHALGTSLKKYDVIVVIACGGSAVTTEEVSRTLSV
                     LKNEK"
     gene            complement(<14733..>19262)
                     /locus_tag="HG535_0B00170"
                     /db_xref="GeneID:59234641"
     mRNA            complement(<14733..>19262)
                     /locus_tag="HG535_0B00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286813.1"
                     /db_xref="GeneID:59234641"
     CDS             complement(14733..19262)
                     /locus_tag="HG535_0B00170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142708.1"
                     /db_xref="GeneID:59234641"
                     /translation="MSTKEDVESTSNDNRSYASSVQSFAAKHENANEDAEQLDSSSQL
                     SRHLSRLLSNEAGVERIASMGRELASKTKEQMEKFEVDGLDFDLRQLLNYLRTHQLEQ
                     GIEPGDSGVAFKSITAVGVDASAAYGPSVEEMLRGAAKLPFHLFSLFKKKTNVPLRNV
                     IQNCTGVVESGEMLFVVGRPGAGCSTLLKCLSGETSELVEVNGDFSYDGLDQNEMMSK
                     YKGYVIYCPELDFHFPKITVKETIDFALKCKTPRVRIDNMTRKEYVDNIRDMWCTVFG
                     LRHTYSTKVGNDFVRGVSGGERKRVSLVEAQATHASIFSWDNATRGLDASTALEFAQA
                     IRTATNMMNNSAIVAIYQAGENIYKLFDKATVLYNGRQIFFGPANKAVAYFQRMGWIK
                     PDRMTSAEFLTSVTVDFENRTLDIAPGFEDKIPKSGTEFEEYWLNSGEYQEVLKSYDD
                     YHARHPAEETRDRLEVARKQRHQVGQREKSQFVVNYWTQVWYCMIRGFQRVKGDQTYT
                     KVYLSSFLIKGLIIGSMFHRIDPKSYSTTEGAYSRGGLLFYVLLFAAVTSLAEIANSF
                     STRPVIVKQKSYSMYHISAESLQAIFTEMPTKLVAVIILSLVSYWIPYLKFTAGAFFQ
                     YLLYLFTVQQCTSFIFKLTATMTKDGETAHAVGGLFVLMLCTFAGFVLPIPEMHHWIR
                     WFHYLNPLTYGFESLMSTEFHGRQMRCSNLVPSGHGYEDVSIANQVCNAAGAIKGQFY
                     VSGDAYIKQQYHFSYNHAWRNWGVNVVWTFGYIIFNVVLSEYLKPLEGGGDLLLYKRG
                     HMPQFGTESAEAKTASREEMMEALNGPGVDLKKVIAQKDVFTWNHLNYTIPYDGATRQ
                     LLSDVFGYVKPGKMTALMGESGAGKTTLLNVLAQRINMGVITGDMLVNAQSLPASFNR
                     SCGYVAQADNHMAELSVRESLRFAAELRQAASTPIEEKYEYVEKIINLLGMQNYAEAL
                     VGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRALADSG
                     QSILCTIHQPSATLFEQFDRLLLLKKGGKMVYFGDIGDNSRTLLNYFERQSNIKCEKT
                     ENPAEYMLNCIGAGATANSSTDWHDLWLNSPECAAARNEIEELHRALPNKIVSDDPEM
                     STKFAASYGSQMKALLRRTSLQFWRSPIYIRGKFFECVSCALFVGLSYVGVNHSIGGA
                     QEAFSSVFMLLLISLAMINQLHVFAYASRELYEVREAASNTFHWSALLLSHFTVETMW
                     SSICQFMCFVCYYWPAQYNGRASHAGFFFFFYVLVFPIYFCSYGLWILYMSPDVPSAS
                     MINSNIFAAMLLFCGILQPKEKMPAFWRRLMYNVSPFTYVVQALVGPLVHGKPVICAS
                     DEFNVMDPPEGQTCGEFLSTFMDNNPGYLVNHDDTQNCRYCPYSFQDEVVARFNVRWG
                     QRWRNFGFMWAYIIFNLVAMCVCYYIARVKVWSLKSVLDIKGLFKKPRKERHEKDTTI
                     FQEKPGDSERIKNST"
     gene            complement(<21275..>22177)
                     /locus_tag="HG535_0B00180"
                     /db_xref="GeneID:59234642"
     mRNA            complement(<21275..>22177)
                     /locus_tag="HG535_0B00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286814.1"
                     /db_xref="GeneID:59234642"
     CDS             complement(21275..22177)
                     /locus_tag="HG535_0B00180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142709.1"
                     /db_xref="GeneID:59234642"
                     /translation="MSHSLEINQQTRYVLNNGKQIPVTGYGVYDVSQEETAELVFQAL
                     QAGYRHVDTAVVYGNQVEVAKGIARFLKETGSSREEIFFTTKLWNTQQGYEETKRALS
                     EINADIAPYIKYVDLLLLHSPLTSREKRLGTWKALEEAVLNPNEASLKIQSIGVSNFG
                     IEHLEELLAQATIKPAVNQLELHPWLPRLELREYLGRHNILAEAYSPLTQGYKLNEPE
                     LLELEKESGVSKIELLLKWSFLQGFVVLAKSNKSERIKQNLAVLPKSTGSISLTEREW
                     KALDKLASHDVVTWGNADPTVYKS"
     gene            complement(<22896..>24116)
                     /locus_tag="HG535_0B00190"
                     /db_xref="GeneID:59234643"
     mRNA            complement(<22896..>24116)
                     /locus_tag="HG535_0B00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286815.1"
                     /db_xref="GeneID:59234643"
     CDS             complement(22896..24116)
                     /locus_tag="HG535_0B00190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142710.1"
                     /db_xref="GeneID:59234643"
                     /translation="MSTELETISENSCIAKNIGALHLKYGESGAYGDFDTHFMPTQDE
                     VAPNGLLRIYESYRKQAKYPDFLPTWDTKEKYPPLKFHKYEDPALRADPNFPNLFPEN
                     KKHLINTRKVTPKMGTEIRGIQLTELSDSAKDELALLVAQRGVVLLRNQNMAEKGAAY
                     AANYGKHFGQLHIHPTSGHPEHIPELHITFRRPDHDEFDRVFYDSNSSIFWHTDVSYE
                     LQPPSYTFFNVLEGPDGGGDTLFGDSIEAFDRLSKPFQDFLSTLHVTHSSKEQANDSK
                     IQGGIQRRDPVTNIHPLVRVHPVLKKKCLFVNKSFSRRIIELKKPESNLLLDFLYSLA
                     DNTHDLQLRANWEPGTVAVWDNRRVQHSAVIDWEAPIRRHAFRITAQGERPVESLKHL
                     NDETYYPSSVGRGL"
     gene            complement(<25215..>26444)
                     /locus_tag="HG535_0B00200"
                     /db_xref="GeneID:59234644"
     mRNA            complement(<25215..>26444)
                     /locus_tag="HG535_0B00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286816.1"
                     /db_xref="GeneID:59234644"
     CDS             complement(25215..26444)
                     /locus_tag="HG535_0B00200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142711.1"
                     /db_xref="GeneID:59234644"
                     /translation="MSATLKTKTNSYSVASGKQTPKSSVLKLNYKTVDEGNHDTHFFE
                     GQDERSTDGILRVNAKYRATAKAPDFLPSWDPNEKYGPLTFHEYDDPALRADPTFSNL
                     FPKDKENEIAVRPITPKLGSEIKGIQLSHLSDAAKDELALLIAQRGVVVLREQDFAEK
                     GPRYVADFVSHFGKLHIHQSSGHPEDVAELHVTYRRPDEQEFERLFADRTSSIFWHSD
                     VSYELQPPSYTFFTVLEGPNGGGDTLFSDGIEAYERLSPTFQNFLSRLHVVHSGIEQA
                     EHSKRQGGIERRKASAYIHPLIRYHPVLKRKSIFADPSFSRRIVELKKQESDLLLKFL
                     FDLIGNTHDIQLRANWESNTVAIWDNRRVHHSAVVDWEKPVSRHAVRITPQGERPVED
                     PKYLNDPSYYPDPVNNV"
     gene            <27426..>29087
                     /locus_tag="HG535_0B00210"
                     /db_xref="GeneID:59234645"
     mRNA            <27426..>29087
                     /locus_tag="HG535_0B00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286817.1"
                     /db_xref="GeneID:59234645"
     CDS             27426..29087
                     /locus_tag="HG535_0B00210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142712.1"
                     /db_xref="GeneID:59234645"
                     /translation="MVTFPYNKKGTKKENVLVTEDTQSTASLTSPSDSESLGFGSVSS
                     VHIFNDSKVADYYFKIYDDCKYECRKYFDPKFQWTASEERKVVRKVDLRVAFWAMWMF
                     AALNIDRNNLSQALSDNFLDDVGLTTADYNLGNTVNLVCFILAEMPAQLISKKIGPDR
                     WVPFEMIAWSIVAMSQAAIKNRSGFLATRALLGMLEGGFIADTVLWLSYFYTGSELTI
                     RLGYFYVSGQITTIVMSLVAYGLLQIRAAGMGGWQWLFVVEGLFTFIIGVMSYFLMSP
                     SVSQTKAWFRPKGSYTEREVKIVVNKLLRDDPAKGEMNNRQAVSFKKLLTSLADYNLW
                     PMYLLSYLACMGLTSTSSYLTLILRKLGFSTVNTILLTIPKTAGAALTLLLMNYLASA
                     TNQTLLVAMLEPIWVIPCAIALRWWPGLNVNVWATFALLNVALSYPACYASLLALVSK
                     NSNSVRNRTISQTIMNIMAQLSAITCSNLYQPHDAPLYHKGNEILLGLNVATFVALGA
                     TRYYYSHQNQRREKIWNSMDSEQQELYLQNSEQLGTKRLDFRFSL"
     gene            <29705..>30163
                     /locus_tag="HG535_0B00220"
                     /db_xref="GeneID:59234646"
     mRNA            <29705..>30163
                     /locus_tag="HG535_0B00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286818.1"
                     /db_xref="GeneID:59234646"
     CDS             29705..30163
                     /locus_tag="HG535_0B00220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142713.1"
                     /db_xref="GeneID:59234646"
                     /translation="MPDSIIIRQVQEGDQREWERLWKLFQIFHNVTPTDELSKANFQR
                     FLDPQIKMWAALAIDLETGKALGMVNYFSHITTWATKDKILLNDLYVDETARVRGLGR
                     QLVQYVYDEADKMNTPHVYWCTDYFNHRAQILYTKVGYQTSRVIYRRTGH"
     gene            complement(<30403..>31542)
                     /locus_tag="HG535_0B00230"
                     /db_xref="GeneID:59234647"
     mRNA            complement(<30403..>31542)
                     /locus_tag="HG535_0B00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286819.1"
                     /db_xref="GeneID:59234647"
     CDS             complement(30403..31542)
                     /locus_tag="HG535_0B00230"
                     /inference="similar to AA sequence:RefSeq:NP_014472.1"
                     /note="similar to Saccharomyces cerevisiae AIF1 (YNR074C)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142714.1"
                     /db_xref="GeneID:59234647"
                     /translation="MEIEKKTIAVVGAGVFGVSVANHLSRELDATSYRVKLVTLSDYV
                     YFLPSAVRLTVSRDYSSSILPLKDVIDIGVETIKDKVVSFNTSNLILESEAVLDFDVL
                     ILATGSKWPDPIGSTFAFGDDYKTYLDKQASRVQEAEHIAFIGGGFVNSEIVGELLFK
                     YQDEIKSGKRRISIIHNSDKLLPANGLYGDTVRSKVTDYLSGNGIKLYLNARGTISDD
                     DPNQIILGDDASKHIRADLIYRGVGIAPNVPTNHIADFCDDRGFVQVQTNFQVNACKE
                     GNIFAIGDVTNFRYHGIMKRDNWVDVLTKNVISFMKEGANAKLASCSCYEIGETPGAV
                     SLGPKTGFGQFPVPFLGTVSIPSFVVAKAKCKSLFREKMEDMYKK"
     gene            <32787..>34307
                     /locus_tag="HG535_0B00240"
                     /db_xref="GeneID:59234648"
     mRNA            <32787..>34307
                     /locus_tag="HG535_0B00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286820.1"
                     /db_xref="GeneID:59234648"
     CDS             32787..34307
                     /locus_tag="HG535_0B00240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142715.1"
                     /db_xref="GeneID:59234648"
                     /translation="MGKENKETGDEVDEMSLDGVEKVDAEAPEGSLIREATFVGVLCS
                     AQLMTQAGLAQSIAPLHYIGESFGISNPGQLSWFASGYSLTVGTFILIAGRLGDLFGH
                     RRFFVFGFLWYALWSLLAGFSVYSNQVFFDCCRAFQGIGPALVLPNAIAILGRTYKPG
                     KRKNMAFSMFGACAPNGFTLGAVFSSILAQMAWWPWAFWIFSIVCFFLAVAGLWVIPH
                     ADMPNLDASHSIWQRVDLAGSLSGMTGLILFNFAWNQGPVVGWETPYTYALLIVGVAF
                     LCLFVFIELRAKFPLLPFKALSTDAAFVLACISAGWSSFGIWIYYIWQFMEDSRGQTP
                     LLSSAQLTPTCVSGFCAAMTTGIVLNYCRPSTVMLCAMIAFTLGNILISSAPVHQTYW
                     AQTFVSIIVMPWGMDMSFPAATLILSNTMPQEHQGLAASLVNTVVNYSISIGLGFAGT
                     IESQVNDGGSNPLKGYRGSWYMGIGLGGLGIVIAASYGLSTYVRFKREPPENEHLE"
     gene            <34564..>36255
                     /locus_tag="HG535_0B00250"
                     /db_xref="GeneID:59234649"
     mRNA            <34564..>36255
                     /locus_tag="HG535_0B00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286821.1"
                     /db_xref="GeneID:59234649"
     CDS             34564..36255
                     /locus_tag="HG535_0B00250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142716.1"
                     /db_xref="GeneID:59234649"
                     /translation="MTFSGTNLQSGKRQRVQKACIPCRKRKRKCDGKQPCGMCSDYGY
                     ECQYTYDDGPLTEFKVKRLEKRLFAGRDEVSVPVAHLTAEESKKHTANEQKAEESKKH
                     TANERKAEDTRPVNLTKSTDQHSAVGFPRTLGLELQSANPPRLHSFGWHCGVRPEEKS
                     SKHGPLSELLTVEECRRFTKVFFTVVHPFFNFIDEDKLKLEVEKCWNGTGENSDYGAV
                     IAGVISLGSFFSGTLGHPRELDIVKYAKCILDDPAFSRVPSIEQVSAWILRTIYLRTA
                     APPHVAWLASCTSLHLAEVIGLHQEIDGADFDTNTNSRSRTTIYVREYARRIFWCAWT
                     TNTILSYDYGCTSVNINKRTCKSVKESKSDYLAHLVKLAQLIPREYSSLDPTIQTTEL
                     LNALKCVYDSPDVHAFISLTKADLCLSFYRRLRLLNHVLDKGVILQITSIGNTALSAA
                     YHLAKIDQAWWSVLSTSFQYVCVLLAIDTPESLLHVTSAMSMLDSIVQTLGTTVALEA
                     QNTAKLLLQDLLKRKNRQIQQLESATHPDPLPQDNRLLDIDWDVLLDPSYTFNFL"
     gene            complement(<36912..>38687)
                     /locus_tag="HG535_0B00260"
                     /db_xref="GeneID:59234650"
     mRNA            complement(<36912..>38687)
                     /locus_tag="HG535_0B00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286822.1"
                     /db_xref="GeneID:59234650"
     CDS             complement(36912..38687)
                     /locus_tag="HG535_0B00260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142717.1"
                     /db_xref="GeneID:59234650"
                     /translation="MSHKQFKSDGNIVAPYLLGLARSNPGLTVIEHDRVVFRTASAAN
                     SGNKPKVTLVSGGGSGHEPTHAGFVGEGALDAIAAGAIFASPSTKQIFSALKAVESPK
                     GTLIIVKNYTGDIIHFGLAAERAKAAGMKVELVAVGDDVSVGKKKGSLVGRRGLGATV
                     LVHKIAGAAAAHGLELSEVAQVAQAVNDNSATIAASLDHCTVPGHKPENILGDDEYEI
                     GMGIHNESGTQKSSPLPSIPELVAQMLPLVLGEDEDRSYVKFEPKDDVVLMVNNMGGM
                     SNLELGYAAEVVSEQLIKKYNIIPKRTIVGAFITALNGPGFGITLMNASKAGPSIIKY
                     FDYPTTASGWNQTYHNAEDWKVLADGKVPTAPSLKTIKNEKPSGVKANFDTFAKILLA
                     GIERINEVEPKVTWYDTIAGDGDCGTTLVSGGKGLTEAIDDHSLRLEDAAHGIEDIAY
                     IVEDSMGGTSGGLYSIYLSALAKGINDSGDKQLTVNTFKKASQSALEALYKYTRARPG
                     YRTLIDALQPFVETLNAGKGPRAAVEAAQQGAEKTRKMDALVGRASYVAKEELRKLDS
                     EGGLPDPGAVGLAALLDGLVTAAGY"
     gene            <39777..>41813
                     /locus_tag="HG535_0B00270"
                     /db_xref="GeneID:59234651"
     mRNA            <39777..>41813
                     /locus_tag="HG535_0B00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286823.1"
                     /db_xref="GeneID:59234651"
     CDS             39777..41813
                     /locus_tag="HG535_0B00270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142718.1"
                     /db_xref="GeneID:59234651"
                     /translation="MSNRLSTSSSSSSASSASSASSASLPHSGNRSAERGNQLENAKE
                     RPPHGKVTWEGNVKGTGPVPTGVDTGLSPARGVSGVGMGTAAAAGAAKKSSELGGFSR
                     STLAPLTPLSKGAAEDVPRNRPRRPVGLAYSSPNLKGLANQPNAEQELLMDYYLSGAN
                     NRGSNGNYVDPLYRHLNPSRNLKNKPVWSLNQPLPHVLDPSLAEKMIQKNKEVKSRSR
                     PSSKSGSRDVSRSGSMTSVNDWKKLLRRPGSGRRLNDIEAQLPSSATQAAAKAKLMDG
                     HKPSHSQIEFSKKGAKSGTHNAKFSLGDESYPASVADNESTPPLKKSEDASNYTDLLK
                     EQLEEEGSTPVDLVEKSGDIIGDDDDESEEITFTNFWARIRYKMREPFAEFIGTLVLV
                     VFGVGGNLQATVTNNAGGSYESLSFAWGFGCMLGVYVAGGISGGHINPAVTISMAIFR
                     KFPWKKVPVYIVAQICGAFFGGALAYGYFWSSITEFEGGPTIRTAASGACLFTNPRSY
                     VTWRNAFFDEYIGTAMLVGCLMALLDDSNAPPANGMTAFIVGLLVAAIGMALGFQTSF
                     TINPARDLGPRIFSAMVGYGRHPFHLTHWWWTWGAWGGPIAGGISGALVYDLFIFTGC
                     ESPVNYPDNGYIEHRVEKLLHKEFHHRNGMDDSHGVKVDQTSSSKESTPKSTPT"
     gene            complement(<42287..>43792)
                     /locus_tag="HG535_0B00280"
                     /db_xref="GeneID:59234652"
     mRNA            complement(<42287..>43792)
                     /locus_tag="HG535_0B00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286824.1"
                     /db_xref="GeneID:59234652"
     CDS             complement(42287..43792)
                     /locus_tag="HG535_0B00280"
                     /inference="similar to AA sequence:RefSeq:NP_010022.1"
                     /note="similar to Saccharomyces cerevisiae GIT1 (YCR098C)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142719.1"
                     /db_xref="GeneID:59234652"
                     /translation="MSSRKLIHYDAETRKQRLNEPSKKTLIHILTIIASGFALISDGY
                     QNNAMSMLNRLFPALYGKENYTSAVSTRVSNASLVGTIIGQVVIGFACDYMGRKWSIL
                     TATILLVLGSALCAASHGITVQGMFWMLTVMRGVVGVGIGAEYPSASVSANEAANEYS
                     EKHRGGLMVLVTNLPLSLGGPFASIIFLIVYSICGPHRLEGVWRAMFALGCFWPLSVF
                     YFRWKMATSELYKKARFTSRIPLWLIIKFNWVRLVGTCGAWFMFDFVTFPNGIFSGTI
                     ISSIIGDSTDLKKICEWNLLLGIIAIPGVFVGAYLCDKIGRKYTLMFGFCGYLIFGLI
                     IGCAYDQLKNITALFIVFYGLMNCLANAGPGDMLGVTSSESFPTAVRGTLYGLSAAIG
                     KVGAVAGTESFQPIRDRLGPRFTFIIAAACGVVGILFTYFCIPHSKELDLMELDIKFH
                     NYLVQNGWEGTMGFDESEDTETGSISADSTVMEVVDVADKKDDTVTTVQLR"
     gene            complement(45172..45260)
                     /locus_tag="HG535_0Btrna3K"
                     /db_xref="GeneID:59235342"
     tRNA            complement(join(45172..45208,45223..45260))
                     /locus_tag="HG535_0Btrna3K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:59235342"
     gene            complement(<46029..>51354)
                     /locus_tag="HG535_0B00300"
                     /db_xref="GeneID:59234653"
     mRNA            complement(join(<46029..50045,50047..>51354))
                     /locus_tag="HG535_0B00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286825.1"
                     /db_xref="GeneID:59234653"
     CDS             complement(join(46029..50045,50047..51354))
                     /locus_tag="HG535_0B00300"
                     /ribosomal_slippage
                     /note="Ty-like element, ribosomal frameshifting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142720.1"
                     /db_xref="GeneID:59234653"
                     /translation="MSNQVTIDNAEENILYKYGSAAKVPFSMSREAEDSLFTSREKSN
                     SSEISNNGTDPNLSDSQRDFPSLQPSIPASVDNKQEGSPKSSAYDAGYQHTGSTQGYT
                     YPYPWPSPYPPIAPPMVPPMGNGMFNWNMNADGIKYIPATSYETFMYQQKLLNDQFKQ
                     YRKFYDQRSEDDTTSESAKESNNEQVLPDLDEISNPSEFPRWMRSFKRFLEDNKLGDI
                     IPDRLNESERDATKSEKAFIINSFKTYVKETAYPKSVKDAIKRGHDLFRIILCHVSED
                     SNLRSAIWRELTTISYDGSEDSYYYTSRVKELYSQLKATNSNIPEDIICEYLLKNLHG
                     QYAKIRENHYLEYDLNTIAGISKCVLRTYDRLIKNKKHTSETSPSVTNRHCYKCSSEG
                     HFAPQCPNVKDKLPKPSINSRKEKKSYHRKGIHKIGLTRDTELLGILQNSKKKRPSMT
                     KTPQTGELVEDNQHLLIDSGAAISVIRDPGLLHNINKHPNIGIADAQDREIPISVSGD
                     LQLSFPGTSIIHTEAVASTVPHVDILSLHELQKNGITVDFNNSQVTNNKGKMVARIKK
                     IGPYYWIPAKYIHKPHKKLNVMNVQKQPLFPMEFIHRLLGHVNIKTLRDSIKQGMLTN
                     LSMDDIDWSGYSNFQCEDCVSGKSKKHKHLVGSRLTYQKSYQPFEFLHTDIFGPVPHM
                     PTSSPSYFMAFTDEATRFRWVFGLWNKEAETVTSKFRELVNMVKTQFNTKVRSFQMDR
                     GSEYTNKTIRNFFKEYGIIPCYTSVGDSKANGVAERLNYTLLDDCRTLLRSSNLPLHL
                     WFYAVQFSTLMRNSLITSSVGTSSRAKAGLTGLDVSTILPFGQRVMVNNPPKNKLRPR
                     GIVGFALTPSAESHGYLIYIPSKHTVTDTTNYLIIRGDPHDRTDDADAVIAPLLDQLE
                     ARQDGEFDNNMSTHSGGMEMDVSIHSGGTIHQRPVSPTPTADNLSTSSGGNDPIQTGT
                     TDTTEVIPEYIPEGNNDVLGPDIHDDPPEHTNDDPPEHTSDEIADNIEEHGSNMINED
                     PRINLQSANHAVTYDNTESDDQPTQNEPTSNPINDPANDHPSSAIIDNTKTPDPIPDT
                     VSRRTINNDIDPSSAIASTVGIQASAYNDVAPTTEDERTTSSTSTAELDPLPSEEDSP
                     VPESTTVATPDSETPESISNVGGNDQSPEVNAKSLEERKNRIFQYRNGDIPRVKPPST
                     KRKSSLALGEIEDRTQRKRPKRHILYVNAVHSNPTPHVKPSLSYYEAIVNNDDKNDAK
                     GYNEAYMKEYDQLIKMKTWDPNKPINEKTIPRQQIINSMFIFNTKRDGRKKCRFVARG
                     DQQKAGTYKEDLKANTVHHYALMTSLNIALDKKMFITQLDISSAYLYAELEEDLYIRA
                     PPHMKLKGKAFKLNKSLYGLKQSGANWYKMIGSYLTNSCNMTELTGWPCVFKDENECF
                     VCLFVDDMIVLSKDIKAANKLVKTLKKKFETKVIHDGKLDENNMATYDILGLEIEYTF
                     GKKMTIGMENSLTEKLPHLGFDIEKDNKKFLVPGTPGEHIHKDNLVVEEDDYKEKVKQ
                     MQKAIGLLSYVGYKYRFDILYYVNILAQHTLYPSEQVEKLTKQLLNFVWQSKHKKLIW
                     HANKHTKTNRITAITDASFANEEGFRSQLGHYYCLNGKVIGGRSSSEKLRVISSTEAE
                     IYAVSESVPMLQGLACLVKQIDPSSSLRSKILTDSKPTISIVEDQSEDSRAFRNRFFG
                     TRAFRLRDEARRNDLKFEYIKTEDNYADILTKPTSIAIFKKLTHSWVK"
     gene            complement(53341..53412)
                     /locus_tag="HG535_0Btrna3E"
                     /db_xref="GeneID:59235340"
     tRNA            complement(53341..53412)
                     /locus_tag="HG535_0Btrna3E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:59235340"
     gene            55914..55986
                     /locus_tag="HG535_0Btrna4K"
                     /db_xref="GeneID:59235346"
     tRNA            55914..55986
                     /locus_tag="HG535_0Btrna4K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59235346"
     gene            complement(<56161..>57660)
                     /locus_tag="HG535_0B00310"
                     /db_xref="GeneID:59234654"
     mRNA            complement(<56161..>57660)
                     /locus_tag="HG535_0B00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286826.1"
                     /db_xref="GeneID:59234654"
     CDS             complement(56161..57660)
                     /locus_tag="HG535_0B00310"
                     /inference="similar to AA sequence:RefSeq:NP_011705.1"
                     /note="similar to Saccharomyces cerevisiae CRH1 (YGR189C);
                     ancestral locus Anc_5.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142721.1"
                     /db_xref="GeneID:59234654"
                     /translation="MVQKRGLLSLIGLVSQIVYADDSSSTVQAVESATAAACNPVKTS
                     GCAADKALAGSFSEDFTSESKYFFSDGNPGNISYSSDGVALTLGKRFENPGLTSNFYI
                     MFGKVEVEMKAAPGQGVISSFFLQSDDLDEIDLEWVGSDNTQWQSNYFSKGDTTTYDR
                     GAFHGVDAPVDKYHNYTLDWAMDQTTWSLDGQVARTLSNTSSEGYPQSPMQIKFGIWA
                     GGDPSNAPGTIEWAGGETDYSKAPFTMNIRRLVVTDYSTGTQYSYSDQTGSWESIEAE
                     NGSVYGRYNEAQSEYSELTGGGQIASSASVSPTSTSSSSSVSSSSVSSSASVSSSSVS
                     SSSSVSSSSVSSSSSVSSSSVSSSSSVSSSSVSSSSSVSSSSSSSSTIASSSTSGSSS
                     SEVSSSSSISVSDASSIQSAPTTPSAARSTAVPNSIPESQSVSVVSSGTATDAAAAVT
                     SSIMSIQTSTTEQQSSIASLVPSLNGGYNFVSSQNWYKFLPVMGLIFAF"
     gene            complement(58097..58197)
                     /locus_tag="HG535_0Btrna1W"
                     /db_xref="GeneID:59235332"
     tRNA            complement(join(58097..58133,58161..58197))
                     /locus_tag="HG535_0Btrna1W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:59235332"
     gene            <62262..>66467
                     /locus_tag="HG535_0B00320"
                     /db_xref="GeneID:59234655"
     mRNA            <62262..>66467
                     /locus_tag="HG535_0B00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286827.1"
                     /db_xref="GeneID:59234655"
     CDS             62262..66467
                     /locus_tag="HG535_0B00320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142722.1"
                     /db_xref="GeneID:59234655"
                     /translation="MPGPSYSRQRNANSIDLLRGISNALKRSLDNKKPSTTQQKGTES
                     TQKVGKTYLLLLLKRLGDFNSSYQERGQAAVEVRQLLDGLDQKSVPAVWYSAHDLIDS
                     TVPQHIRRAALELLYECIVRCEEDSLKVVFFPLVVNHMIELMEKNEVFELNSEVALLL
                     SCLNAIVRDASPLLKTDDISVLTAIIDEIVPLTSQKNLDNIYPEALLQLMSLIQKLIK
                     PVKEGALLGVARLDNYMLQMGEDIGNKFFCGVIDFFTWLMRNHKQHVSAELLQEIAAS
                     VIYMSGILNERKEEMVLYDMELLLKEISKTSKRVSFLEQLFSLNAIKPKETNKIFDSY
                     VIMLLSKLRSNLIDNDTNESRHEIIMVANKLYQQKKDSILLKLILEILNVNSKNMESF
                     VDDEFFLSTTKNALGLWQLIRLTLRRNSSLGRLFGHKIINKIFKNHGISSSIGINNLL
                     QFTFAEGLSADPGIIVCALEAESGIIFELETLRLLVINIMVPSTMMEVRLRVWKLFIN
                     LARDAKTSFLSPDVNKDSLLTMLYAKNESLELNSEEATLFEELIYALIQELDADQVKD
                     FIQDYIYPDIYDTLGTLRRRKSIVGAIGTFARGWQTSERLARRLEILIHGLIRSFIWS
                     ATDDSGFKCIFLYQTLIKVYGRAAGCAHADTLLDIARAMIRIRRDISGYLYFKNPSDA
                     IGISSAFGRNKNLLKEPQQRFKWTFPESTKIIDDNLLEKHNIHVMFDDINEKSTQCVD
                     IGAWLSAAIDTIEIPRDLEIYSYLLTHLCGQLSDITLFKCHHSLIDRFKRVICNHLTN
                     SIPSIVPLGDIISISDLHSAYVRNLSAVLAYHSFQSKSFADELVNALVGGLTSWEKTL
                     IPILHILTISCFEIPQSIQRYLTPILQHIQKRITSLYATASILEFFLALCESRKLISN
                     LTIEEIKRVFAIIFKLIENSVDLKIRSKQKREAEDYEVEKSAPYQRLEYEIDMSPSTE
                     SFLIKESLAEFFQNQSFRALSSWFLQVNESCKLELMPFIIKNLQSLRAIKSLKNDATA
                     YMDFFSRSRFGPQGSDNIIHGELSDSALEESSKMTRWIHDDGLISIRVHDSLKKAIVS
                     VRKPSCNRIFEVDLSVSTDTQPSYDIFNFPDEDENSESLRSSKEVPIDPEQVLFQLLY
                     IGKINASFENSFVKIPDVISFRRSINAFDRIPDVDIQKAGIVYIGPSQRTEEDVLRNT
                     DGSYQYQWFLSQMGKFIKLDEVSKFFYTGGLVPKTDGEYALVWRDEITQIAYHTVTLM
                     PNDSDSISMKKSHVGNDLVNIFYDESGLPDFNFNIIKSQFTFISIVITPQSVDCEENQ
                     AIADHYKVKMYRRSGTPGLLSCTHFKIIGKPNLSRYVRHACLTANAFAQKYCENRSSD
                     ACSIWGVRCKHLTTLRERVCAVL"
     gene            <66831..>67742
                     /locus_tag="HG535_0B00330"
                     /db_xref="GeneID:59234656"
     mRNA            <66831..>67742
                     /locus_tag="HG535_0B00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286828.1"
                     /db_xref="GeneID:59234656"
     CDS             66831..67742
                     /locus_tag="HG535_0B00330"
                     /inference="similar to AA sequence:RefSeq:NP_012540.3"
                     /note="similar to Saccharomyces cerevisiae SUI2 (YJR007W);
                     ancestral locus Anc_5.157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142723.1"
                     /db_xref="GeneID:59234656"
                     /translation="MSTTHCRFYENKYPEVDDIVMVNVQQIAEMGAYVKLLEYDNIEG
                     MILLSELSRRRIRSIQKLIRVGKNDVVVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKY
                     QKSKTVHAIMRYCAEKFQIPLEDLYKSIAWPLSRKYGHAYEAFKLSIIDETVWEGIEP
                     PSKEVFEELKLYISRRLTPQAVKIRADVEVSCFSYEGIDAIKEALKAAESLSTEQMQI
                     KVKLVAAPLYVITTQSLDKQKGIELLEQGIEKINQVIAKHNGVCNITMSPKAVTATED
                     AELQALLESKELDNRSDSDSEEDSDSE"
     gene            <68012..>69013
                     /locus_tag="HG535_0B00340"
                     /db_xref="GeneID:59234657"
     mRNA            <68012..>69013
                     /locus_tag="HG535_0B00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286829.1"
                     /db_xref="GeneID:59234657"
     CDS             68012..69013
                     /locus_tag="HG535_0B00340"
                     /inference="similar to AA sequence:RefSeq:NP_012541.1"
                     /note="similar to Saccharomyces cerevisiae YJR008W;
                     ancestral locus Anc_5.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142724.1"
                     /db_xref="GeneID:59234657"
                     /translation="MADSVRLATHAGTWYSNHASELSSTLQSYLNNTGKKSGSIPGAR
                     IVVSPHAGYRYCGPTMAHSYACLDINSDVKKVFIIGPSHHVYFKNKVLLTKFKEIETP
                     IGKVKVDQEITEDLLRGANKEIFGFMDAETDLNEHSLEMQFPMLIQTLKWRKKPPEEV
                     EVVPLLVSHNSTDVDYAIGRVLKEYLKDPTVLFILSSDFCHWGRRFGYTGYCGMESEL
                     DEAIGEETEIEMLTSRSKLSHHQLDIWQSIELIDRGAMRVLSDSKNDSKYNMWKKYLE
                     ITGDTICGAKPIAIVLSAISFSEREVVFKWPHYSQSSKVSNLNDSSVSYAAGYATLL"
     gene            complement(<69224..>70213)
                     /locus_tag="HG535_0B00350"
                     /db_xref="GeneID:59234658"
     mRNA            complement(<69224..>70213)
                     /locus_tag="HG535_0B00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286830.1"
                     /db_xref="GeneID:59234658"
     CDS             complement(69224..70213)
                     /locus_tag="HG535_0B00350"
                     /inference="similar to AA sequence:RefSeq:NP_011708.3"
                     /note="similar to Saccharomyces cerevisiae TDH3 (YGR192C)
                     and TDH2 (YJR009C); ancestral locus Anc_5.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142725.1"
                     /db_xref="GeneID:59234658"
                     /translation="MVNISINGFGRIGRLVLRIALARKNITVVAVNDPFISVEYAAYM
                     FKYDSTHGRYAGEVTHDDKHIIVDGHKIAVFQERDPAALPWGKEKIDIAVDSTGVFKE
                     LDTAQKHIDAGAKKVVITAPSSTAPMFVIGVNSDAYNGEKIVSNASCTTNCLAPLAKV
                     INDAFGIKEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVL
                     PVLQGKLTGMAFRVPTVDVSVVDLTVNLEKGTTYDEIKKVVKAASEGPLKGVLGYTED
                     SVVSSDFLGDTHSSIFDATAGIQLTPTFVKLVSWYDNEYGYSTRVVDLIEHVA"
     gene            <70811..>71281
                     /locus_tag="HG535_0B00360"
                     /db_xref="GeneID:59234659"
     mRNA            <70811..>71281
                     /locus_tag="HG535_0B00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286831.1"
                     /db_xref="GeneID:59234659"
     CDS             70811..71281
                     /locus_tag="HG535_0B00360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142726.1"
                     /db_xref="GeneID:59234659"
                     /translation="MDAEESTGFSDFSGRFPFGCCLREKWKPRTEQAGCRDSNGAIWI
                     GAGPRSAHGRRKREIKKRGLPQQDWNILESWDGEKAEVCNSPDLRPHGRPGCRTSRSS
                     TSAVSGHPRFSDILSIFTCRTAEPQLSKTVTARGIVFSRSQGFGKSHVERCRVK"
     gene            <71686..>73206
                     /locus_tag="HG535_0B00370"
                     /db_xref="GeneID:59234660"
     mRNA            <71686..>73206
                     /locus_tag="HG535_0B00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286832.1"
                     /db_xref="GeneID:59234660"
     CDS             71686..73206
                     /locus_tag="HG535_0B00370"
                     /inference="similar to AA sequence:RefSeq:NP_012543.3"
                     /note="similar to Saccharomyces cerevisiae MET3 (YJR010W);
                     ancestral locus Anc_5.154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142727.1"
                     /db_xref="GeneID:59234660"
                     /translation="MPAPHGGKLQDLVARDASKHGDLLKESHGLTRLDLSERQVCDLE
                     LILNGGFSPLDGFLTEKDYLKVVEDSRLSDGTVWTIPITLDVAEDFAKSVKADQRIAL
                     IQDGEIPLAILTVGDVYRPDKSLEAKKVFRGDPEHPAIQYLNNVAGDYYIGGKLEAIQ
                     LPQHYDYPGLRKTPAQLRLEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVL
                     IHPVVGMTKPGDIDHHTRVRVYQEIIKRYPSGIAFMSLLPLAMRMAGDREAVWHAIIR
                     KNYGATHFIVGRDHAGPGKNSKGVDFYGPYDAQELVESYKHELGINVVPFRMVTYLPD
                     EDRYAPIDEIDTSKVRTLNISGTELRKRLRTGGEIPEWFSYPEVVKILRESNPPRPQQ
                     GFAIIFENSLNISRAQLSIALLSTFLQFGGGRHYKIFDHKDNDKTLLELVPDFIRSGT
                     GLIVPNEWSSNVDAANLYRLGSSGDADIKLESNDESVFFIVQKVVLFLEDNGFIQF"
     gene            complement(<73246..>74499)
                     /locus_tag="HG535_0B00380"
                     /db_xref="GeneID:59234661"
     mRNA            complement(<73246..>74499)
                     /locus_tag="HG535_0B00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286833.1"
                     /db_xref="GeneID:59234661"
     CDS             complement(73246..74499)
                     /locus_tag="HG535_0B00380"
                     /inference="similar to AA sequence:RefSeq:NP_011709.1"
                     /note="similar to Saccharomyces cerevisiae PDX1 (YGR193C);
                     ancestral locus Anc_5.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142728.1"
                     /db_xref="GeneID:59234661"
                     /translation="MLLSAMLRLPNAALRYRLTTRCVHNTMRILNAQAFAMPAMSPTM
                     EKGGIVEWKYKVGDIFSAGDVLLEVETDKAQIDVEALDDGKIAKIIVENGAKDIPVGV
                     TIAYLADVNDDLSSLKFPKDSSSIAEKKATPKQSTPNKGTTSRKETSRVSSTDSEKST
                     GIGSTELLQKANTKQTLLPSVAQLLASRGITKDEALEKIKSSGKNGRLLKGDVLAYFG
                     LIPKESVVNIAKYIKSGEQLDLSNIEFKKESDKLVEQQKPKENAKEQTVRSEPIIITE
                     QIGLKVPSNVTYEQLSSSLDSFLDEAYHFTHEQPLTNIRSDFYDPIFEHLVTPSPTEA
                     RFDVTYQLTPVDTELNDCAQNDIFDLLSASNKSIPTQRGNESDTETSHNEYILTVNVQ
                     VNEKFSDSKGKSERFINYLKQLNTV"
     gene            complement(<74775..>76502)
                     /locus_tag="HG535_0B00390"
                     /db_xref="GeneID:59234662"
     mRNA            complement(<74775..>76502)
                     /locus_tag="HG535_0B00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286834.1"
                     /db_xref="GeneID:59234662"
     CDS             complement(74775..76502)
                     /locus_tag="HG535_0B00390"
                     /inference="similar to AA sequence:RefSeq:NP_011710.3"
                     /note="similar to Saccharomyces cerevisiae XKS1 (YGR194C);
                     ancestral locus Anc_5.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142729.1"
                     /db_xref="GeneID:59234662"
                     /translation="MDCYYLGFDLSTQQLKCLAINQDLKIVHSETIVFETELPQYETT
                     KGVYIKGDVIECPVAMWVESIDLIFYKFTKSGFDLSKVKAISGSCQQHGSVYWTEAAD
                     ELLTALDPKDGSLVEQLVPAAFSRATAPNWQDHSTGKQCKAFEEKAGGPQGLAKITGS
                     RAHFRFTGTQILKIAEEEPECYSNTQTISLVSSFVASLLSGKLTPLEEADACGMNLYE
                     IPKRDFDKNLLALIDKDATNIEKKLLSPAIKCDEPVRLSSISSYFVEKYGFSSDCSIF
                     PFTGDNLATICSLPLKKNDVLVSLGTSTTILLVTDQYHPSADYHLFIHPTISSYYMGM
                     ICYCNGSLAREEIRNELNGETTSHDWTKFNDAVSDHKLPSDDEIGVYFPLGEIVPSVN
                     AVCKRAKFDLETGNIKEFVDAFADKRHDAKNIVESQALSCRVRISPLITSEVEPLNTK
                     NADVKVRFDYDDIPLKEYFSKRPNKAFFVGGASKNDDIVKKFAQVIGATEGNYRLETP
                     NSCALGGCYKAAWSDLYYTKQTQLRYDQFLNEKFAWDDLEYVCDADNDAWQQYNNKIL
                     PLSQLEATL"
     gene            complement(<76759..>77025)
                     /locus_tag="HG535_0B00400"
                     /db_xref="GeneID:59234663"
     mRNA            complement(<76759..>77025)
                     /locus_tag="HG535_0B00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286835.1"
                     /db_xref="GeneID:59234663"
     CDS             complement(76759..77025)
                     /locus_tag="HG535_0B00400"
                     /inference="similar to AA sequence:RefSeq:NP_012544.1"
                     /note="similar to Saccharomyces cerevisiae SPC1 (YJR010C-
                     A); ancestral locus Anc_5.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142730.1"
                     /db_xref="GeneID:59234663"
                     /translation="MSEILQELGRKLVFPIDFRSQKNTERYQQLILIAGAILASLIGF
                     FAQSLLYLVVTYGLAIVVAMVVVLPAYPAYTREKLDWVKPKISM"
     gene            complement(<77366..>78202)
                     /locus_tag="HG535_0B00410"
                     /db_xref="GeneID:59234664"
     mRNA            complement(<77366..>78202)
                     /locus_tag="HG535_0B00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286836.1"
                     /db_xref="GeneID:59234664"
     CDS             complement(77366..78202)
                     /locus_tag="HG535_0B00410"
                     /inference="similar to AA sequence:RefSeq:NP_012545.1"
                     /note="similar to Saccharomyces cerevisiae YJR011C;
                     ancestral locus Anc_5.150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142731.1"
                     /db_xref="GeneID:59234664"
                     /translation="MSNTIDGSQAMSNDSANDTVFQDCISRMDEKLEEEFATCTSLEQ
                     KRNFLLSLEISSFIESTVQFIIVIIHLIQYLSWQAFSPSNNNSSNTDVGIPTAQKLDT
                     VRSLFQEHLAELKESYERLKQKQEGELSNSTSAPKYRNIISRERAQFLILPNETLASV
                     IISNAPQLAMLVHNCTIGFANIYDFLKKIPLHTQYRLTKPQVGILLKVLGQELIPSWK
                     EQLDRLNTAIFKLLAQTEPVTKKYREATGVQDADLTQNETYMSFVTWLNNEMLQELRL
                     SD"
     gene            <78422..>79339
                     /locus_tag="HG535_0B00420"
                     /db_xref="GeneID:59234665"
     mRNA            <78422..>79339
                     /locus_tag="HG535_0B00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286837.1"
                     /db_xref="GeneID:59234665"
     CDS             78422..79339
                     /locus_tag="HG535_0B00420"
                     /note="ancestral locus Anc_5.149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142732.1"
                     /db_xref="GeneID:59234665"
                     /translation="MTQEITTPKQGIISDENYSRIMGFVAGVFSGVMKNTVGHPMDSI
                     KVRLQTSQGTGRFTGPLDCVKKTFQQQGIRGFYLGFTPPLVGWVLMDSVLLGSLHNYR
                     MLLHKYVYPEHEKLPLLGCVVSGVMSGWTVSFIAAPVEYAKARLQVQYDPSTTKYSGP
                     LDVIKKTWKQKGVRGLYKGLISTLIFRSNFVFWWGSYELITQWFKKNTNMSDPAINFW
                     AGGLSATFGFWTFAYASDVVKQVVLCDDKYDGSFKSWKSAVRDIYTGHGIRGFFKGFT
                     PSFCRSFPANAAALAAFEFVLRTSGAKPS"
     gene            complement(<79430..>79741)
                     /locus_tag="HG535_0B00430"
                     /db_xref="GeneID:59234666"
     mRNA            complement(<79430..>79741)
                     /locus_tag="HG535_0B00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286838.1"
                     /db_xref="GeneID:59234666"
     CDS             complement(79430..79741)
                     /locus_tag="HG535_0B00430"
                     /inference="similar to AA sequence:RefSeq:NP_012546.3"
                     /note="similar to Saccharomyces cerevisiae YJR012C;
                     ancestral locus Anc_5.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142733.1"
                     /db_xref="GeneID:59234666"
                     /translation="MPELSYEEIIDHIVSDKPLPNVVAVPDVTLCESLRTVSEIPSRP
                     KPWEIANQSTYSLDGDGNDLATSIAFSQESSIQVQEEYDRLNTDVDSSYYLGENELDA
                     Q"
     gene            <79933..>81159
                     /locus_tag="HG535_0B00440"
                     /db_xref="GeneID:59234667"
     mRNA            <79933..>81159
                     /locus_tag="HG535_0B00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286839.1"
                     /db_xref="GeneID:59234667"
     CDS             79933..81159
                     /locus_tag="HG535_0B00440"
                     /inference="similar to AA sequence:RefSeq:NP_012547.2"
                     /note="similar to Saccharomyces cerevisiae GPI14
                     (YJR013W); ancestral locus Anc_5.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142734.1"
                     /db_xref="GeneID:59234667"
                     /translation="MADHSTGLIVVSFLVRVAFFLYGIYQDANYKVRYTDIDYFVFHD
                     AAAYVHDCIMNGGDGSPYQRDTYRYTPLLSWLLVPNHYFEWFHLGKMIFIAFDLLTGM
                     IIQKLLKKCFKPRSNFQTICLNSIWLLNPMVITISTRGNAESMISFLVMASLYQIQKG
                     NLIVSGILHGVAIHFKIYPIIYSLPIAMYLYQANKSVGWFKKLFLFGGATLFALLGSS
                     AYMYKIYGNEYLEHAYWYHLYRIDHRHNFSLWNILLYYDSARPSSASLISKLAFLPQL
                     IIVAMVSFLQYIQPTFAGLLNVLFVQTFAFVTYNKVCTSQYFVWYLIFLPFYFVDSTI
                     SWKRGICMAVAWISTQAFWLLQGYRLEFEGKNVFYPQMFCASAAFFLTNTWLLGEFIH
                     DIKRRQYVVSETKKRN"
     gene            <81319..>82059
                     /locus_tag="HG535_0B00450"
                     /db_xref="GeneID:59234668"
     mRNA            <81319..>82059
                     /locus_tag="HG535_0B00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286840.1"
                     /db_xref="GeneID:59234668"
     CDS             81319..82059
                     /locus_tag="HG535_0B00450"
                     /inference="similar to AA sequence:RefSeq:NP_011711.3"
                     /note="similar to Saccharomyces cerevisiae SKI6 (YGR195W);
                     ancestral locus Anc_5.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142735.1"
                     /db_xref="GeneID:59234668"
                     /translation="MSRLEIYSPEGLRLDGRRWNELRRFECSINTHAHAADGSSYLEQ
                     GNNKIITLVKGPQEPSNKSQVDTAKALLRVTVNLTKFSKSERSKSSHKNERRVLEMQT
                     ALVRTFNRNLMLHIYPRTLIDIEIHVLQQDGGIMGSLINGITLALIDAGIAMYDYISG
                     VSVGLYDETPLLDTNTLEENAMSTVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGI
                     AGSHRIRDLMDKELRRRAEKRVASALAR"
     gene            complement(<82142..>84862)
                     /locus_tag="HG535_0B00460"
                     /db_xref="GeneID:59234669"
     mRNA            complement(<82142..>84862)
                     /locus_tag="HG535_0B00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286841.1"
                     /db_xref="GeneID:59234669"
     CDS             complement(82142..84862)
                     /locus_tag="HG535_0B00460"
                     /inference="similar to AA sequence:RefSeq:NP_011712.1"
                     /note="similar to Saccharomyces cerevisiae FYV8 (YGR196C);
                     ancestral locus Anc_5.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142736.1"
                     /db_xref="GeneID:59234669"
                     /translation="MADHVERKKSYRWVSASQASYDGSGWDSSDENTSDEGNDRRETM
                     VSRKGTIAKLPNLPKLAYMDTDARDTLKDGNDGIVGADEAVEPKSEIVSQELKSPQLP
                     LQQQVPFEESSGSLETPRLRKTSSNTSSKGSMQTRRTPVNEGLENLMVQISKEMSPDI
                     NHSKVLGKFESVDQELDKADYENDDEIPMIKGVESGSKEDQTQDKQDDKDSNTRIFVK
                     NETGEKELSDSEANGDEADSDVVSGYEVSDDAQYEVSKSGYFSNLIEPDDGNDEEKDY
                     VVSGNTSDHMTRDSESEEQDASPSEDDSDEYKKNNQEDNSYDNTNIQDKRIVDEPYTR
                     TSVEPEESFCTPPLSAPHITQGSNDINDAENDGEEKPVIEIQQKTASDDERKYSPSIN
                     DSFSQTRQSSYDDYSSDDGGDDLSYTDSIKYRAVKSESEHELRSDAGHRNHNNSWRSE
                     TSDKESQIEDHEEGHEEGSDEDAMKVSKSGYFNKMISDEEEEEEDDDSHGKNGDDNEK
                     NGDVDTLSSSAMEQASPDNTNSRNEKHFRANSATQSDVQEITEKVTTENDVIANNITE
                     NDVAEKGISEKDIIEKSVSEKSITERDIVKKDTDKEIIEKDYDTGEETSPINTRQSVN
                     LGKWRPNTEAFRNGFLEDSSNRAAPPGYVYDENGKLIDLTPSSMKPRIPSAYSEVESS
                     WDAFPSEDTEADMETIRDTRTIYDNHTVFNVPGLIANNQSAPPLPEYAAEMSHNDSSD
                     DPKSLGTSLTTSSLEGDSGPPQTHFKEVFSLQVPDSKEIAKISQKNKVPSMDINKMLN
                     SNISHEQKIQQLRDHWKESQHYDTGIQTWLSYSLKSSSKSDKDYLFEEYKVSNHVRDA
                     YAHADELNRKHSVINTVASVNQNMTHLTKKVILQSRKSRGLFSSIGKKKL"
     gene            <85346..>85957
                     /locus_tag="HG535_0B00470"
                     /db_xref="GeneID:59234670"
     mRNA            <85346..>85957
                     /locus_tag="HG535_0B00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286842.1"
                     /db_xref="GeneID:59234670"
     CDS             85346..85957
                     /locus_tag="HG535_0B00470"
                     /inference="similar to AA sequence:RefSeq:NP_012548.1"
                     /note="similar to Saccharomyces cerevisiae TMA22
                     (YJR014W); ancestral locus Anc_5.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142737.1"
                     /db_xref="GeneID:59234670"
                     /translation="MLRSPLYCAVCSLPPEYCEFTGKLKRCKVWLRDAHPATYKILYD
                     AEDDSVDAVSGKLAESSIGEEREEKLEKDLLKLQAKQENREQRELQMKLSSKVVIKRE
                     ARTKKKSLVAISGLEVFEIDMKKLAKTFASKFATGCSVAKNVEKKEEIIVQGDVLEGV
                     EKYIHALLEEKGLKDVKVEVVDVKKKKKPDTAAAGGDQSKSSK"
     gene            complement(<86046..>87668)
                     /locus_tag="HG535_0B00480"
                     /db_xref="GeneID:59234671"
     mRNA            complement(<86046..>87668)
                     /locus_tag="HG535_0B00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286843.1"
                     /db_xref="GeneID:59234671"
     CDS             complement(86046..87668)
                     /locus_tag="HG535_0B00480"
                     /inference="similar to AA sequence:RefSeq:NP_011713.1"
                     /note="similar to Saccharomyces cerevisiae SNG1 (YGR197C)
                     and YJR015W; ancestral locus Anc_5.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142738.1"
                     /db_xref="GeneID:59234671"
                     /translation="MVPEQAMERQVPTAANGVEEMAVADIAVEMEKTEGRDSNTKCRS
                     NDSSSAESVCSFRKEYPQQQQQQQQQQDGGSDDKVSGDLENEGQLPLRRSQTGFLSPR
                     LKDHRKKILRIFLQTNLLLGAVVITVLSIYWGAAYNRDHYMFKVSVLTVIQDESEVVP
                     VTMTQELPSLISSVPCTWHVYSQSEFMDEYNVTVDEISDKVRDLVYGEQYWLALNAKP
                     NATDDLYNTLLGNTDGNRSFTPDSYFDVWFMSGRDPSSVRASILPNMQTLENLYANYY
                     RSTYLPQLISNITSRGDQDAATIDPATVINVSDMKFNYIDYRSFYDTVLLSPLQVGLI
                     YCLLLTFFQLSLFGPLHAEMAQLLKPKHMIIYRIAISWLTYFLLSLFFCTVSAIYRIN
                     FTLAFGRGGFVVYWMSTWLLMMALGGANENMISVIFVYGPQYLGFWLTTWIVLNISCS
                     FYPFVLNNQFYRYGYAMPIHNGVDIYKVIFLNLSRHKMGRNYGVLVAWVAINTACFPF
                     AMKIVGQRIKKQKEAAAQQQEQQQLLQASAKS"
     gene            complement(<88043..>88504)
                     /locus_tag="HG535_0B00490"
                     /db_xref="GeneID:59234672"
     mRNA            complement(<88043..>88504)
                     /locus_tag="HG535_0B00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286844.1"
                     /db_xref="GeneID:59234672"
     CDS             complement(88043..88504)
                     /locus_tag="HG535_0B00490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142739.1"
                     /db_xref="GeneID:59234672"
                     /translation="MLNRPYVSLTRLQGFRHTDCLMSHDAKVAREREALRTAGVSVVL
                     SGHRPACCKNRYRFGRSPNSRRRHTRQRFRRPISRENSLRETHGTRTVSEASEKRFSS
                     QKKGKRQDHDIVPHDESDGNKPSHDGNKPHTTEIKTQTCHVSRNEPGNSIY"
     gene            <88742..>90991
                     /locus_tag="HG535_0B00500"
                     /db_xref="GeneID:59234673"
     mRNA            <88742..>90991
                     /locus_tag="HG535_0B00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286845.1"
                     /db_xref="GeneID:59234673"
     CDS             88742..90991
                     /locus_tag="HG535_0B00500"
                     /inference="similar to AA sequence:RefSeq:NP_011714.3"
                     /note="similar to Saccharomyces cerevisiae YPP1 (YGR198W);
                     ancestral locus Anc_5.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142740.1"
                     /db_xref="GeneID:59234673"
                     /translation="MRSDTIVGALRSRLLGSGEFDTGYPALDTALRLQFRLHYHLLGK
                     GVNNVVAQVLKDECSKLENELRASQSKSVDANVSQLALKIVSNARGVISYHLGALNES
                     KELLVQGAQVDIVWAGFAEFLNLENLYYRGLCNNDTAVYAEELSNVVQDIPPESHGMA
                     WHYLQLIFKSMTRDQLKTLPADSALTYLGNLVNGYCDENQLLTLIDPLLKESKFPQAN
                     ESNNKKLIQFHVFLQYFFKSSDTFSPKWYPFIVSSIEKTFQSIEISKCAMIYFGHQAE
                     PVVKDSLLNFVNFVRYTERNFVINNENYDDVISLIDCFTFILNIVKNDSFNVSHVFNL
                     SDSLDRLLSLLQFFYQKNNFSIMNENDSLNWLENSSKLLLPFTVSNALSDAWTILFSH
                     KKSSLDLLLSNELTSYLANAMCVESSEGKLCDLQFQYSYLLAEKRLIPAATKILKTVI
                     LEKNPDCYKAWHLLALCESIREDKESAFKIVCSVIEAMKETLAEKKLSKIDRWQYIHL
                     KLTQLSLIEEIFGTADALEMLPEIYELYGDLFPDDKDEFASFGKEINQSKNYLLQMIW
                     IFAANMFLRAESKSESCKNAIKEAENVTNAYKNLNCNIARGYMYLTEGGIKRSLKEFE
                     SVLFYDQYNVHAVLGLAEIIFPDESNQSEPSFQNYCDLIPKEEHLATRKKVFVNELDE
                     SASCARLKFLLEYSITQSIDAYFTPEIWWYLSIIYNKFGDKSYKNALLNCIRYQETKP
                     IREFKFCNF"
     gene            complement(<91246..>92229)
                     /locus_tag="HG535_0B00510"
                     /db_xref="GeneID:59234674"
     mRNA            complement(<91246..>92229)
                     /locus_tag="HG535_0B00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286846.1"
                     /db_xref="GeneID:59234674"
     CDS             complement(91246..92229)
                     /locus_tag="HG535_0B00510"
                     /inference="similar to AA sequence:RefSeq:NP_011660.1"
                     /note="similar to Saccharomyces cerevisiae THI4 (YGR144W);
                     ancestral locus Anc_5.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142741.1"
                     /db_xref="GeneID:59234674"
                     /translation="MSATQTATQTDNATSQLQLNATPIRHALSDIVHEEDWSDFKFAP
                     IRESTVSRAMSSRYFKDLDKHAVSDVIIIGAGSSGLSAAYVIAKNRPDLTITILEANV
                     ALGGGGNLGGQLFSAMIMRKPSHLFLNELEIPYEDEGDYVVVKHAALFTATIAAKVLS
                     FPNVKLFNATAVEDLVTRPKGSNGEVTVAGVVTNWTLVTMAHGLQSCMDPNVIELSGY
                     QDDGTRDMSQKHGVVLSTTGHDGPFGAFSAKRIVAIDKNKKLGGMKGLDMNRAEAGVV
                     KNAGKYQGVDSMYFAGMEVAELHGCNRMGPTFGAMAVSGIKAAEEILKHFS"
     gene            <93264..>95399
                     /locus_tag="HG535_0B00520"
                     /db_xref="GeneID:59234675"
     mRNA            <93264..>95399
                     /locus_tag="HG535_0B00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286847.1"
                     /db_xref="GeneID:59234675"
     CDS             93264..95399
                     /locus_tag="HG535_0B00520"
                     /inference="similar to AA sequence:RefSeq:NP_011715.1"
                     /note="similar to Saccharomyces cerevisiae PMT6 (YGR199W);
                     ancestral locus Anc_5.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142742.1"
                     /db_xref="GeneID:59234675"
                     /translation="MDKGNSGDTIGDMKWKENVQSIARFLAPLIFTTLSFYVRFKDIG
                     KNDYVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLIALTEWLAGFDGQFDFDSNNAY
                     PDSVNYTRIRQLNAVFGALCSPVAYFTCLNMKFSIWTTYLITLMVTLEHSFIVLSKFI
                     LLDSMLLFFTMTTFGCMVKLYTLRGKSFTRTWSLWMLLTGVSIGCVCSVKWVGLFITI
                     VVGLFTISELYEMHCKGEKKKLKHWLIRIIDLIIIPFLIYLFCFKIHFTLLYKSGTGD
                     GSTNTLFQINLENNKIENGPRDIVFGSNVTIRSHGLSPNLLHSHVQSYPEGSQQKQVT
                     GYGFADTNNMWEIKFPRESYPKPANNGRPIKLTDKAVIRLGHINTACNLHSHEISSHV
                     SRGNFEVSGYGSEVVGDSKDNWVIEIVEQLGSSNPNFPKEDSDVVHPVSTFFRLRHQD
                     LGCYLTSTGFSYPAWGFKQSEIVCKYSWSHRDKSTWWNVEEHWNENLQISPDYVPPKS
                     KFWTDFILINFAMASSNNALVPDGDKYDNLATKAWEWPILHTGLRMCAWTNNMTKYYL
                     LGSPFNTWLSTISLFVFPFITLNLLISWKRQRINLSSHQVWLFAIQGVFPFIAWMTHY
                     LPFATMGRVTYVHHYVPALYFAMLVFGFVVEFSLRRSNRWLRQIIYNILFFGCIYIYL
                     LFSPLCQGMTGSAAKYFKLQWFKSWDIVL"
     gene            complement(<95403..>97769)
                     /locus_tag="HG535_0B00530"
                     /db_xref="GeneID:59234676"
     mRNA            complement(<95403..>97769)
                     /locus_tag="HG535_0B00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286848.1"
                     /db_xref="GeneID:59234676"
     CDS             complement(95403..97769)
                     /locus_tag="HG535_0B00530"
                     /inference="similar to AA sequence:RefSeq:NP_011716.3"
                     /note="similar to Saccharomyces cerevisiae ELP2 (YGR200C);
                     ancestral locus Anc_5.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142743.1"
                     /db_xref="GeneID:59234676"
                     /translation="MSEVTSDAIFIGCNKQTQVSDVHRHEKVVAFGAGKTIAMWRPLN
                     ESSNGVYLTLKGHDADVTCVKFMEDNNYVISVSEDHHVKIWDFSSLKCIQSVEHYKQT
                     LVALAVVKNLFVVGSADGLISIWVLQDGKFCLSTEFFVRKGIFPLTLALSEIDSNSFL
                     LAIGGTSVNLFMYSLTFEENGSLKCELAAELEGHEDWIKSLAFRTMETPGDFLLASGS
                     QDRYIRLWRIRINDRSVYVDEDQDRPNLLSNKKYKFEMRNNMKVVINFEALIMGHDDW
                     ISSLKWHQSRLQLLASTADTSLIVWEPDETSGVWICGSRLGEISTKGASTATGSSGGF
                     WSCLWFHSNGKDYILTNGKTGSWRIWSSEDTVTWEQYIGISGSTKEVTDVAWSGTGDY
                     LLATSLDQTTRLYAPWIYNASGSKRPVATWHEFSRPQIHGYDMICVEPISNGRFVSGG
                     DEKILRSFDLPKGVSEILQKFVGCNFKANDGIAASASLPALGLSNKAASSADQEDSED
                     EDPNSRETNDTKNISYDLAASLGHPPTEDQLQRHLLWPEIEKLYGHGYEISCVDVSPD
                     SSLIASACRSNTPQHAVIRMFDTATWLELKPSLAFHALTITKLRFSKNDKYLLSVSRD
                     RNWAIWQRNFEDKTFVLKYKKEKAHSRIIWDCDWAPLEAGEVFITASRDRSVKVWKND
                     IATKEFVLDGTLKLIESVTAVSIYECLIDGKILIALGLESGSVLIYTFNSGAFELLTK
                     LDDSITPAGKIMRMRWSNMKRDDKLLLAVASSDCSCRIYSVRLNSINT"
     gene            complement(<98053..>99810)
                     /locus_tag="HG535_0B00540"
                     /db_xref="GeneID:59234677"
     mRNA            complement(<98053..>99810)
                     /locus_tag="HG535_0B00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286849.1"
                     /db_xref="GeneID:59234677"
     CDS             complement(98053..99810)
                     /locus_tag="HG535_0B00540"
                     /inference="similar to AA sequence:RefSeq:NP_012550.1"
                     /note="similar to Saccharomyces cerevisiae ILV3 (YJR016C);
                     ancestral locus Anc_5.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142744.1"
                     /db_xref="GeneID:59234677"
                     /translation="MGMLGKIASGRHFSTTKNVAKKLNRYSQVITEPKDQGASQAMLY
                     ATGFKKSDFKKPQVGVGSCWWSGNPCNMHLMDLNNRCSASVEKAGMKAMQFNSIGVSD
                     GISMGTKGMRYSLQSREIIADSFETIMMAQHYDANIAIPSCDKNMPGVMMAMGRHNRP
                     SIMVYGGTIMPGHPTCGSPAIPKDIDLVAAFQSYGQYISKQFTEKEREDVVEHACPGP
                     GSCGGMYTANTMASAAEVLGITMPNSSAYPAISKEKIAECDNIGESIKKTLDLGILPS
                     DIFTKAAFENAITYVVATGGSTNAVLHLVAIAHSCGVKVTPDDFQRISNKTPLIGDFK
                     PSGKHVMADLITVGGTQAVIKYLFENGFLHGDTLTVTGETLAERAAKATSLKEGQTVI
                     KPISQPIKTSGHLQILYGSLAPGGAVGKITGKEGTYFKGKARVFEEESAFIRALERGE
                     IKKGEKTVVVIRYEGPKGGPGMPEMLKPSSALMGYGLGKDVALLTDGRFSGGSHGFLI
                     GHIVPEAAEGGPIALVKDGDEIIIDSDNNKIDLLVPEQEMTDRRSKWTAPAPRYTRGT
                     LSKYAKLVSDASHGCVLDL"
     gene            complement(<100183..>101445)
                     /locus_tag="HG535_0B00550"
                     /db_xref="GeneID:59234678"
     mRNA            complement(<100183..>101445)
                     /locus_tag="HG535_0B00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286850.1"
                     /db_xref="GeneID:59234678"
     CDS             complement(100183..101445)
                     /locus_tag="HG535_0B00550"
                     /inference="similar to AA sequence:RefSeq:NP_011718.1"
                     /note="similar to Saccharomyces cerevisiae PCT1 (YGR202C);
                     ancestral locus Anc_5.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142745.1"
                     /db_xref="GeneID:59234678"
                     /translation="MSESPKSNSLKSRLSNSSFTNLFHMNKKRKRDEDNSSDNDFNSP
                     GRGRKVKMSRSRKNRDADLQEEEKKFQVREKKYDSELPEELRKYRPKGYRFNIPPKDR
                     PLRVYADGVFDLFHLGHMKQLEQCKKALPNVKLICGIPSDRITHKLKGLTVLTDEQRC
                     ETLKHCKWVDEVIPNAPWVINPEFLKEHNIDYVAHDDIPYGSAGSDDIYRPVKETGKF
                     LVTQRTNGISTSDIITKIIRDYDQYLMRNFARGATKEELNISWLKKNELDFKKHINDF
                     RSYFKKNQVHLNNASKDLYFEVREILLRKTLGNKLYSKLVGGALDENLKKTLERGKRL
                     IREKSPASDFASEFTGETTNVSSMSTPSSPSTSNSSTTGEEESQSINRDKNSDDNDDN
                     DNENSPVPEENGTSSDDGDDDQHGAKDK"
     gene            <102011..>102466
                     /locus_tag="HG535_0B00560"
                     /db_xref="GeneID:59234679"
     mRNA            <102011..>102466
                     /locus_tag="HG535_0B00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286851.1"
                     /db_xref="GeneID:59234679"
     CDS             102011..102466
                     /locus_tag="HG535_0B00560"
                     /inference="similar to AA sequence:RefSeq:NP_011719.1"
                     /note="similar to Saccharomyces cerevisiae YGR203W;
                     ancestral locus Anc_5.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142746.1"
                     /db_xref="GeneID:59234679"
                     /translation="MSISARSISGIKYVDAAQLYQWLKSGETSLSQPFQVIDVRGSDY
                     VAGHIKGCWNYPYKRLASDDTFMRQLIERLYQACKDADSDSINVVFHCAQSQQRGPAA
                     AMKLLRELSDNELDNFNVCVLRGGFNHWQDVYGDDSTVTEDYQPDIWSW"
     gene            complement(<102494..>102994)
                     /locus_tag="HG535_0B00570"
                     /db_xref="GeneID:59234680"
     mRNA            complement(<102494..>102994)
                     /locus_tag="HG535_0B00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286852.1"
                     /db_xref="GeneID:59234680"
     CDS             complement(102494..102994)
                     /locus_tag="HG535_0B00570"
                     /inference="similar to AA sequence:RefSeq:NP_012551.2"
                     /note="similar to Saccharomyces cerevisiae ESS1 (YJR017C);
                     ancestral locus Anc_5.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142747.1"
                     /db_xref="GeneID:59234680"
                     /translation="MSEKSSAESGLPEPWNVRYSKSKKREYFFNPETKQSQWEEPEGT
                     NHEAFIKYLGEHPVRVRCLHLLIKHKDSRRPASHRSENITITKDEAIAELKKFEERLS
                     NEKFEELAKERSDCSSFKRGGDLGWFGKGEMQPSFESAAYKLKVGEVSGIVESDSGVH
                     LIKRVG"
     gene            <103910..>106753
                     /locus_tag="HG535_0B00580"
                     /db_xref="GeneID:59234681"
     mRNA            <103910..>106753
                     /locus_tag="HG535_0B00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286853.1"
                     /db_xref="GeneID:59234681"
     CDS             103910..106753
                     /locus_tag="HG535_0B00580"
                     /inference="similar to AA sequence:RefSeq:NP_011720.3"
                     /note="similar to Saccharomyces cerevisiae ADE3 (YGR204W);
                     ancestral locus Anc_5.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142748.1"
                     /db_xref="GeneID:59234681"
                     /translation="MTAQLIDGKACAQAIRHEVTKEIEQLKSQNASFRPRLAIIQVGV
                     RKDSSTYVRMKCKAAREAGIEADFISLAEKITEQELLAQIASLNEDPLIHGVLVQLPL
                     PSHIDEDKITTAVTASKDVDGFGTFNIGELNKKNGKPFFLPCTPKGIIELLKRNGVKI
                     AGSKSVVVGRSDIVGSPVAELLKSEDSTVVMTHSKTENLPAYIADADIVVVAIGKPEF
                     VKGEWFKENKKGAVVIDVGTNFVEDSTKKSGYRNVGDVEFNEALKYVKMITPVPGGVG
                     PMTVAMLMQNTLIAAKRELESGGKLCKFEALSLDLQKPVPSDFEISRAQKPKHISQVA
                     LEAGILPSELEPYGSVKAKVNLKLLDRLKDKEDGKYVLVTGITPTPLGEGKSTTTVGL
                     AQALGAHLNKTVFANVRQPSMGPTFGIKGGAAGGGYSQVIPMDEFNLHVTGDIHAISM
                     ANNLLAAAIDTRMFHESTQKDAALYKRLVPAKKGVRKFTLTMQKRLKKLGINKSNPDD
                     LTPEEASRFARLDIDPETITWRRVVDCNDRFLRGITIGEAPTEKGFTRKTGFDISVAS
                     ECMAILALCNDLNDMRERLGNIVIAASKAGEPITCEDIGCAGAMTALLKDAIKPNIMQ
                     TLEGTPVFVHAGPFANISIGANSVLADKMALKLAGVDPTLTEEVKKERVGYVVTEAGF
                     DFTMGGERFINIKCRSSGLTPDVVVIVATVRALKVHGGGPEVKAGAPLPAAYLNEDVE
                     LLRKGCANLAKHIANAKQYNLPVIVAINKMSSDSDLEHQVIKEESLKAGAEDAIVSNH
                     WEEGGAGAIDLAQGIIKVTQEDTNKDFKFLYDVEGSVEDKITKIAQNMYGAKDVHFLP
                     EAQKKIELYTKQGFSDLPICVAKTQYSLSHDANLKGVPTGFTFPIRDVRASIGAGYLY
                     ALAAEIQTIPGLPTHCGFMNVEVDEDGEIEGMF"
     gene            complement(<106830..>107831)
                     /locus_tag="HG535_0B00590"
                     /db_xref="GeneID:59234682"
     mRNA            complement(<106830..>107831)
                     /locus_tag="HG535_0B00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286854.1"
                     /db_xref="GeneID:59234682"
     CDS             complement(106830..107831)
                     /locus_tag="HG535_0B00590"
                     /inference="similar to AA sequence:RefSeq:NP_012553.3"
                     /note="similar to Saccharomyces cerevisiae TES1 (YJR019C);
                     ancestral locus Anc_5.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142749.1"
                     /db_xref="GeneID:59234682"
                     /translation="MGPSHMGLEKILELTRQSASRFVTTTLPAAPVLARGTFGGTLVA
                     QSLLASLYTVPTNFVPTSLHCYFISGGDPNNMIAYDVEDLRNGRNFIHKQITAYQGQR
                     LIFSSTILFAKEKHDHDSLHFLKTIKPSDLPDLRKFCDASSLFERKFILNDNWKRYAN
                     LQPALGNPGIIQKQLETFQFGPIAYKFPEDLFYSTADTDKLDQYISIRSSVTTTAVQY
                     GENPFRITPANDRRYNYVAFAYLSDSYLLMTVPYFHKLPMYSHKFSVSLDHSIYFHDM
                     PRVNDWIYLQVTNPRSHWDKHLMRGEYYDSETGEIVANVSQEGLVIYDSEREIRAKF"
     gene            <108303..>109187
                     /locus_tag="HG535_0B00600"
                     /db_xref="GeneID:59234683"
     mRNA            <108303..>109187
                     /locus_tag="HG535_0B00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286855.1"
                     /db_xref="GeneID:59234683"
     CDS             108303..109187
                     /locus_tag="HG535_0B00600"
                     /inference="similar to AA sequence:RefSeq:NP_011721.3"
                     /note="similar to Saccharomyces cerevisiae YGR205W;
                     ancestral locus Anc_5.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142750.1"
                     /db_xref="GeneID:59234683"
                     /translation="MLGKGSSILENSITFLEEYVPAWFEKRELKEDSSPLFIFISGPQ
                     GSGKSYTTTFLHKHLVQKYGAERRIASMSIDDFYLSHDDQITLGKRFSSNKLLQGRGL
                     PGTHDIPLLSRCLEAIWKGDESKVSLPQYDKSKFNGEGDRSKEVTVVDLPLDIVIIEG
                     WFLGFKPVSEIPESSPSEFFQGTPDMKQIDANLQLYAPLLWSNPQICSLGIVFEADEI
                     ENVYKWRQQQEWALKLKDDQGMDDEGVKTFVDRYLPAYRLYYENMVRAEDLGSMATLT
                     LGIDLERNVISCKSRCVE"
     gene            complement(<109238..>110203)
                     /locus_tag="HG535_0B00610"
                     /db_xref="GeneID:59234684"
     mRNA            complement(join(<109238..109831,109922..>110203))
                     /locus_tag="HG535_0B00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286856.1"
                     /db_xref="GeneID:59234684"
     CDS             complement(join(109238..109831,109922..110203))
                     /locus_tag="HG535_0B00610"
                     /inference="similar to AA sequence:RefSeq:NP_012555.1"
                     /note="similar to Saccharomyces cerevisiae REC107
                     (YJR021C); ancestral locus Anc_5.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142751.1"
                     /db_xref="GeneID:59234684"
                     /translation="MSCHSDDVSTDVSLSLSSPPGKGLPLRLIDTADHQAERLEEADK
                     QILEWAGKLEIESVDLREKSAELIKVLQKNSKQLCGILKRLTEAPAKDGEKSIQEIGS
                     HLEEQLGRLEKKIGSQGCCTLVSPEDQDKEIGLAALAEHMKSHLDITQERTETTLIAA
                     RGIMLNLTKQFEDTQNVLVSISKDISYLRDRQLYVEERLNTFEYKEKVEGKCTSSASD
                     LNLHGTTLLNEVEEENTDINLLKTNLINKRDGSNIIVLPKGNQSAKRIGKRRNLAQAR
                     TIIPWEEIENNVEDI"
     gene            <110384..>110704
                     /locus_tag="HG535_0B00620"
                     /db_xref="GeneID:59234685"
     mRNA            <110384..>110704
                     /locus_tag="HG535_0B00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286857.1"
                     /db_xref="GeneID:59234685"
     CDS             110384..110704
                     /locus_tag="HG535_0B00620"
                     /inference="similar to AA sequence:RefSeq:NP_012556.2"
                     /note="similar to Saccharomyces cerevisiae LSM8 (YJR022W);
                     ancestral locus Anc_5.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142752.1"
                     /db_xref="GeneID:59234685"
                     /translation="MSPLLKDYLNRRIIVVKTDGEAFYATLEGFDKNTNLLLFNSRNL
                     NDEPICMAQVLRGSEIVLCGLVEDDSNLTLKLNSASNIKDTRNKVTNEYLIWEAVWKK
                     QLKK"
     gene            complement(<110732..>111538)
                     /locus_tag="HG535_0B00630"
                     /db_xref="GeneID:59234686"
     mRNA            complement(<110732..>111538)
                     /locus_tag="HG535_0B00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286858.1"
                     /db_xref="GeneID:59234686"
     CDS             complement(110732..111538)
                     /locus_tag="HG535_0B00630"
                     /inference="similar to AA sequence:RefSeq:NP_012558.3"
                     /note="similar to Saccharomyces cerevisiae YJR024C;
                     ancestral locus Anc_5.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142753.1"
                     /db_xref="GeneID:59234686"
                     /translation="MYVKLDFLKNFPQFIYRTRSTYKYTKKMSYEPLIHSDDPKHPAN
                     VICALCKQFYDNNWCTGTGGGISIKHQTTGAYYIAPSGVQKEQMKPEDMFVMDGKSKE
                     YLRIPKQFKPSACTPLFVACFQHRNAGAIIHTHSQNAVLSSLLFDKVFKIANIEQIKA
                     IPSGKVDPETGKLIPLSFFDTLNIPIIENKAHEDQLIDSLLQTFEDYPHTCAVIVRRH
                     GIFVWGPTIEKAKVFNEAIDYLMELAVKMCQLGIPPDCGIDEEAKFIAKR"
     gene            complement(<111630..>112169)
                     /locus_tag="HG535_0B00640"
                     /db_xref="GeneID:59234687"
     mRNA            complement(<111630..>112169)
                     /locus_tag="HG535_0B00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286859.1"
                     /db_xref="GeneID:59234687"
     CDS             complement(111630..112169)
                     /locus_tag="HG535_0B00640"
                     /inference="similar to AA sequence:RefSeq:NP_012559.1"
                     /note="similar to Saccharomyces cerevisiae BNA1 (YJR025C);
                     ancestral locus Anc_5.128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142754.1"
                     /db_xref="GeneID:59234687"
                     /translation="MLNTIPLNIDAWLKENDSLLQPPVNNYCLHRGGFTVMIVGGPNE
                     RTDYHVNPTPEWFYQKKGAMTLKVVDESKKSDDRFIDITIKEGDSYLLPGNVPHSPVR
                     YADTVGLVLEQDRPAGAHDRMRWYCSNCREIVCELSFQMIDLGTQVKEGILEFENDVE
                     KRTCSNCGTLNFSRPQGAN"
     gene            <113453..>113758
                     /locus_tag="HG535_0B00650"
                     /db_xref="GeneID:59234688"
     mRNA            <113453..>113758
                     /locus_tag="HG535_0B00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286860.1"
                     /db_xref="GeneID:59234688"
     CDS             113453..113758
                     /locus_tag="HG535_0B00650"
                     /inference="similar to AA sequence:RefSeq:NP_011722.3"
                     /note="similar to Saccharomyces cerevisiae MVB12
                     (YGR206W); ancestral locus Anc_5.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142755.1"
                     /db_xref="GeneID:59234688"
                     /translation="MGELNTNIDDILLKSPLYNAHGSAFPHMDLKKLEAPQIRLQPLQ
                     PSSQVFESWHKECENLINLCNVHDQGPKQFDQWYTEKFMSSKPPGMIENVMLSPSRR"
     gene            complement(<113800..>114576)
                     /locus_tag="HG535_0B00660"
                     /db_xref="GeneID:59234689"
     mRNA            complement(<113800..>114576)
                     /locus_tag="HG535_0B00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286861.1"
                     /db_xref="GeneID:59234689"
     CDS             complement(113800..114576)
                     /locus_tag="HG535_0B00660"
                     /inference="similar to AA sequence:RefSeq:NP_011723.1"
                     /note="similar to Saccharomyces cerevisiae YGR207C;
                     ancestral locus Anc_5.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142756.1"
                     /db_xref="GeneID:59234689"
                     /translation="MASKQLRILVPVKRVVDYQIRPRVNKAGNAIETNGVKFSINPFD
                     DIAVEEAVRIKEKNKSLVENIHAVSIGPAKAQDILRNCLAKGADTSTLIDSKDVQLEP
                     LAVAKVLKEIVDKQKTNLIIMGKQAIDDDCNNTGQMLAGLLNWPQATNAAKVEFVDSD
                     TVKVTREIDGGEETISGTLPMVITTDLRLNTPRYVGLQNLMKAKKKPMEKLSLKDFSN
                     VDVQPRLKVISMEEPKPRAPGVAVKSVDELIEKLKDVKAI"
     gene            <115264..>116256
                     /locus_tag="HG535_0B00670"
                     /db_xref="GeneID:59234690"
     mRNA            <115264..>116256
                     /locus_tag="HG535_0B00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286862.1"
                     /db_xref="GeneID:59234690"
     CDS             115264..116256
                     /locus_tag="HG535_0B00670"
                     /inference="similar to AA sequence:RefSeq:NP_011724.1"
                     /note="similar to Saccharomyces cerevisiae SER2 (YGR208W);
                     ancestral locus Anc_5.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142757.1"
                     /db_xref="GeneID:59234690"
                     /translation="MYTPLMKKKKIVSSMLQLLETSSHQPEMSSFVITCISHEDVLNL
                     EKRAEISKKINAVLSSDGYEVESEQQSSENAFDIYVENSNTISLKEFHLLLKEVIDSV
                     KDADLIVQLNNKYRQKKLIVFDMDSTLIYQEVIELIAAYANVEDKVREITERAMNNEL
                     DFKQSLQERVKLLKGLKIDDLYDQIKSKLEITKGVPELCQALHNNGCKLAVLSGGFIP
                     FAKFIKEQLNLDYAEANILETDSDGLLTGFTKGTVVDGQYKAETLLRLCKEFDIPVEA
                     SCMVGDGGNDLPAMNVAGFGVAWNAKPRVQELAPSKLNTKSMINLLHVFGYLEI"
     gene            complement(<116314..>116625)
                     /locus_tag="HG535_0B00680"
                     /db_xref="GeneID:59234691"
     mRNA            complement(<116314..>116625)
                     /locus_tag="HG535_0B00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286863.1"
                     /db_xref="GeneID:59234691"
     CDS             complement(116314..116625)
                     /locus_tag="HG535_0B00680"
                     /inference="similar to AA sequence:RefSeq:NP_011725.3"
                     /note="similar to Saccharomyces cerevisiae TRX2 (YGR209C)
                     and TRX1 (YLR043C); ancestral locus Anc_5.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142758.1"
                     /db_xref="GeneID:59234691"
                     /translation="MVSAIASASDFDKVISVDKLVVVDFFAVWCGPCKMIAPMIEKFS
                     TEYTEADFYKVDVDELPDVARKCEVSSMPTFILYKSGKPVAKVVGANPAAVKQAIASN
                     I"
     gene            <117321..>119852
                     /locus_tag="HG535_0B00690"
                     /db_xref="GeneID:59234692"
     mRNA            <117321..>119852
                     /locus_tag="HG535_0B00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286864.1"
                     /db_xref="GeneID:59234692"
     CDS             117321..119852
                     /locus_tag="HG535_0B00690"
                     /inference="similar to AA sequence:RefSeq:NP_013146.1"
                     /note="similar to Saccharomyces cerevisiae STU2 (YLR045C);
                     ancestral locus Anc_5.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142759.1"
                     /db_xref="GeneID:59234692"
                     /translation="MNGGADNDDVDFTKLPLNERLTHKLWKARSDGYQELNRLFSNAT
                     QKQGKDDDSFMIYWKDPSRFGDYVTDSNVVAQEQAILALECLLKNVGLPKQIDVKTVM
                     YNWIPALAEKGLASSRAVTKNKAMECIILICSFDDSIAESVELVLPFFNKKLPKLVAA
                     SINCIRELLASFGFAKAPLNNLLPELLDPLVKLAGHADRNVRAQTIALIVEIYKANGR
                     NKSLLNELLLTHLKPIQQNELEKLFDEADSNMSASRGSKRLFQWEKEQMELEKNRLQE
                     NQQTDKDGDTLMDLKLKAEEPALDIDPFEMLPAESILDKLPAGFHDRISSTKWKDRVE
                     ALQEFWDNTLSKVKKIKYERQEYTEILSLYAQIIQFDANVQAVTIVAQSIQKICEKLR
                     FPGFSKNYVTIIFVPLLQRTKEKKPSVIEAIRGCLQSVCKLYNPLSSEDNNEDMLQEI
                     LEFMKHKNPQIRMETTELFSFILRELPVSKEVIDKNLQDEIIPTVIRIVNDTQPTIRN
                     SGFGCFAQLLRIMGRNETFTNALEKLDSLKRKKIQELCAKLPESSSSPSLSAENLERG
                     RVHSGRFDSRPSSSSSIPSKRVASSPLKKVSKAASPNVQKSRMLLTSQSLAMPRSMPG
                     SPSTRTPNSISTGNGTKSPVQLQKLINEKQNWLKERQHLSNHINELTSTQNRINDENE
                     MLREQLKNLQTEIHERGLQVRSKDLQLAKLQDRVEQLQAQAHAQSQQNNRLLQLERNQ
                     QQAPTSLSSDTASAISTNLGVRSVSSSSFEPLTERSKHLRTPSESSDDLPRRVDSLQL
                     NHSLASSNNDIINEESWKRAAEVTSQLKARIERMRAKTKGISNNF"
     gene            <121011..>122705
                     /locus_tag="HG535_0B00700"
                     /db_xref="GeneID:59234693"
     mRNA            <121011..>122705
                     /locus_tag="HG535_0B00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286865.1"
                     /db_xref="GeneID:59234693"
     CDS             121011..122705
                     /locus_tag="HG535_0B00700"
                     /inference="similar to AA sequence:RefSeq:NP_013145.1"
                     /note="similar to Saccharomyces cerevisiae PDC1 (YLR044C);
                     ancestral locus Anc_5.122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142760.1"
                     /db_xref="GeneID:59234693"
                     /translation="MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMR
                     WAGNANELNAAYAADGYARVKGMAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVP
                     SISSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMLTDIAAAPAEIDRCIRTTYVTQ
                     RPVYLGLPANLVDLKVPASLLDTPIDLSLKPNDVSAETEVVDLVLELIKDAKNPIILA
                     DACCSRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAV
                     EGADLILSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLL
                     TKVAEAAKGYKPVAVPARTPANAESADSTPLKQQWIWNEVGKFLQEGDVVITETGTSA
                     FGINQSHFPNKTYGISQVLWGSIGFTTGATLGAAFAAEEIDPKKRVILFIGDGSLQLT
                     VQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWKNLDLLPTFGAKDYE
                     THRVATTGEWKKLTTCEKFNENSKIRMIEVMLPVMDAPSSLVAQAKLTASINAKQD"
     gene            complement(<122873..>124111)
                     /locus_tag="HG535_0B00710"
                     /db_xref="GeneID:59234694"
     mRNA            complement(<122873..>124111)
                     /locus_tag="HG535_0B00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286866.1"
                     /db_xref="GeneID:59234694"
     CDS             complement(122873..124111)
                     /locus_tag="HG535_0B00710"
                     /inference="similar to AA sequence:RefSeq:NP_011726.1"
                     /note="similar to Saccharomyces cerevisiae YGR210C;
                     ancestral locus Anc_5.121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142761.1"
                     /db_xref="GeneID:59234694"
                     /translation="MPRDPLIGIVGKPSSGKSTTLNSLTDAAAAMGAFPFTTIDPNRA
                     TGYVQIDCACSRFGLEKLCKPNYGWCLNGKRHIPIMLLDVAGLVPGAHAGRGLGNKFL
                     DDLRHADALIHVVDVSGTTNEEGKNTRGYDPMQDIEWLQDEIRLWIEGNLKKRWGSIV
                     RRHTATKSSIVDTLQSQFGGYGSHAPMIRRALDRIDDLPPLDKWDDSWITKVVTSFMK
                     EKFPTVLALNKMDHPDADKNVSKIMLKYPDTKAVLTSAITELFLRKLKKQKFISYEEG
                     SEFVDTYEDDPENLRPLDEKTMNRIENIRDLVLYRFGSTGVVQVLQAATEVLNLMPVY
                     TVRNIQTFTGGNGQNVFRDCFLVKKGTSVAKVSKYIMGTELTVAAIETVGGVRVSEDS
                     LVEPGKNDILSFKIAPRSKE"
     gene            <124431..>125948
                     /locus_tag="HG535_0B00720"
                     /db_xref="GeneID:59234695"
     mRNA            <124431..>125948
                     /locus_tag="HG535_0B00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286867.1"
                     /db_xref="GeneID:59234695"
     CDS             124431..125948
                     /locus_tag="HG535_0B00720"
                     /inference="similar to AA sequence:RefSeq:NP_011727.3"
                     /note="similar to Saccharomyces cerevisiae ZPR1 (YGR211W);
                     ancestral locus Anc_5.120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142762.1"
                     /db_xref="GeneID:59234695"
                     /translation="MSLQETGQKEAEQVGNGLFKPVGEAVEDMQEESKFNGVSDGGEM
                     EANQDLVRTTDASDSMGHPIQEIESLCMNCHQNGTTRLLLTSIPYFREVVLMSFECPH
                     CGFKNSEIQSASAIQEKGSKYILKIENSEDFNREIIKSENATCKFVELDIEIPAKKGQ
                     LTTVEGLLNEMIEDLESDQPARKAIDENLHDRIDEFIKKVRSYMNCEPNTVPLTFVLD
                     DPAGNSWIEYKPGEPLHKWSHAEYLRTDEQNVEVGIITKDQLEQRRKEKLEELSNRDR
                     NPSQSVKVDSTSSNFLSDATEIENFNNEVQTFKITCPSCMHECECHMKPVNIPHFKEV
                     IIMSTVCEHCGYRSNEVKTGGAIPEKGRKITLYCDDPADLSRDILKSESCSMTIPELS
                     VEIQEGTLGGRFTTLEGILKQVYDELESRVFSQTSDSMDEPTKQRWLAFFDKLKSALD
                     GKVKFNVIMVDPLAGSYIQNVYAPDPDPNMTIEDYERTEQQNDDYGLNDMKVDQQ"
     gene            <126863..>128275
                     /locus_tag="HG535_0B00730"
                     /db_xref="GeneID:59234696"
     mRNA            <126863..>128275
                     /locus_tag="HG535_0B00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286868.1"
                     /db_xref="GeneID:59234696"
     CDS             126863..128275
                     /locus_tag="HG535_0B00730"
                     /inference="similar to AA sequence:RefSeq:NP_011728.3"
                     /note="similar to Saccharomyces cerevisiae SLI1 (YGR212W);
                     ancestral locus Anc_5.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142763.1"
                     /db_xref="GeneID:59234696"
                     /translation="MAKRTLNSLERFYYYRGELNVLSSIFVAVQLNKLPTKEQLFQTL
                     KKLIEEYPQLHCNIFKDETNGELIIKSIEKRPIEFDDVVEYVSSRDDDEGINDIFKNY
                     QFPYHVEKPLWKILIDRDKRRQTLVVNHVLFDGISCVKFWESFFMTLNDLSAEEGDNN
                     EALFSPQVDVNTVPVVHPYENWPVTWKYVILRPLLATIFKWSPSALLRLNPNLFQFKS
                     YIFPSGLLESKKDNMKTGFQIRNDNCQFILKLSSVKLKRVLRECKSNKVSLTSFLASL
                     ICLTLKNTSKSDDYKGSILKVDIPMNTRKALGDRFNDLDSKTLQLGNLVASLQIQKDM
                     NDLDDIWAAAKDFQHGLKLQSVDNINETINNTKLLDVVDEADFVIEKLKTNGPPGTFE
                     ITNLGFQSFCLKENPDAEFIVEDSIFNEPQSTASIFTCAVVSTQLGGLTCSISYPREI
                     KSQFQPFVDSISNYFSTRED"
     gene            complement(<128433..>130607)
                     /locus_tag="HG535_0B00740"
                     /db_xref="GeneID:59234697"
     mRNA            complement(<128433..>130607)
                     /locus_tag="HG535_0B00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286869.1"
                     /db_xref="GeneID:59234697"
     CDS             complement(128433..130607)
                     /locus_tag="HG535_0B00740"
                     /inference="similar to AA sequence:RefSeq:NP_013148.1"
                     /note="similar to Saccharomyces cerevisiae FRE8 (YLR047C);
                     ancestral locus Anc_5.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142764.1"
                     /db_xref="GeneID:59234697"
                     /translation="MMAVDGYKAFLERLWDWICSHMPGFDHPIVVPLGKEYIVKYSRR
                     CFLFTTVFICILLPLWNSISPTKRVFKVTHYLKHNVFRSQKWIHRSPLYHNQSFHQFL
                     FWTVVVSFFTFCNSYGDLLQVTKRMGRISVALMPPLLFLTSRPSPLPETLYLTLIPLH
                     KWISRVVVLESLLHTIIYIRYMARKNTLFKLKKMANIYGIIAMALFLLIGITSLKKIR
                     RKQFRVFYIVHYISTWLTVILLHFHARPGIPYYTLLNCTLLISQVVYRVLHTRSTIIT
                     AISISPSLTLIEFPATDLAKKPILPGGHVRISKYHKNWIKRWFLSFVPIQHPFTLASL
                     PTDLTVRLVVRNGRFPLISNEKYYVTGVFKPRLTFMSKTELQDLVRPSRKSPLSIFGL
                     GKNKSSSNPHRNSLSLSPLSFDVNVRRVLMCVGGSAISFALPLMRILKFNGVNVRLIW
                     VSRDITDLKLLNHFKFNFDGMEIYISNLSGNEEEIEIDYIENYDDNEYFDENVVPSSS
                     FRSQANDTSTLLSKYSYGNNNHLDSLNSNNYGSIRRQGSLGCIRSVGQVDPKDEVDFT
                     HEFSVRKHRSTRSQENLNTYSTHTSAFLSDGNIFRKPSIIETPISDDQKIALTKKKSN
                     TGKPGDVEVSDLKLKIPSGIQVCFGRPTLGDSDYAWCLERECDMTSEIDLSCRLTNQA
                     NTEVDDLAQVVVIAAGPPGLIETTRRFATDGGLHFHQEAYSL"
     gene            <131596..>132644
                     /locus_tag="HG535_0B00750"
                     /db_xref="GeneID:59234698"
     mRNA            join(<131596..131685,131976..>132644)
                     /locus_tag="HG535_0B00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286870.1"
                     /db_xref="GeneID:59234698"
     CDS             join(131596..131685,131976..132644)
                     /locus_tag="HG535_0B00750"
                     /inference="similar to AA sequence:RefSeq:NP_011730.1"
                     /note="similar to Saccharomyces cerevisiae RPS0A (YGR214W)
                     and RPS0B (YLR048W); ancestral locus Anc_5.116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142765.1"
                     /db_xref="GeneID:59234698"
                     /translation="MSLPATFDLTPEDAQLLLAANTHLGAKNVQVHQESYVFKTRPDG
                     VNVINVGKTWEKLVLAARIIAAIPNPEDIVAISSRTFGQRAVLKYAAHTGATPIAGRF
                     TPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEYVDVAI
                     PCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYRNPEEVEQQVSEEV
                     AETADDEEEIKEEATEEKTEATEWAEETTEAVAW"
     gene            <135638..>136459
                     /locus_tag="HG535_0B00760"
                     /db_xref="GeneID:59234699"
     mRNA            <135638..>136459
                     /locus_tag="HG535_0B00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286871.1"
                     /db_xref="GeneID:59234699"
     CDS             135638..136459
                     /locus_tag="HG535_0B00760"
                     /inference="similar to AA sequence:RefSeq:NP_015125.1"
                     /note="similar to Saccharomyces cerevisiae YPL199C;
                     ancestral locus Anc_6.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142766.1"
                     /db_xref="GeneID:59234699"
                     /translation="MSAAVSHDRGPLISTGERDYNHATDKEYQRLRNQADEAFQKKNK
                     LSQESQAAYKQGDGARAHQLSEKAKIQQRVAEKFNLEAAEYVFVQNNADSRSDEIDLH
                     GLYVKEALWILRSRVRNAINSNEPQLKVIVGKGLHSQNGVAKIKPAVEDLCNEANLND
                     HVDHKNPGAIVIDLRNARIPQEWNEADKVDGLPYGTDNQQQFPAPGNAHFNNGYQPQQ
                     QPQYIPQQQQHHYQQQQQQQQQQQQQQQQQANNGGDGDILVKLLKFVCICIQKNI"
     gene            complement(<136528..>137637)
                     /locus_tag="HG535_0B00770"
                     /db_xref="GeneID:59234700"
     mRNA            complement(<136528..>137637)
                     /locus_tag="HG535_0B00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286872.1"
                     /db_xref="GeneID:59234700"
     CDS             complement(136528..137637)
                     /locus_tag="HG535_0B00770"
                     /inference="similar to AA sequence:RefSeq:NP_011440.1"
                     /note="similar to Saccharomyces cerevisiae MPS2 (YGL075C)
                     and CSM4 (YPL200W); ancestral locus Anc_6.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142767.1"
                     /db_xref="GeneID:59234700"
                     /translation="MSMHLDKSSSSIVLDVAWNEVDKKNQGFIYAKNFPALIKSIETI
                     LSHGEEDSSQLSLLSNTGVDVIDTFAKEKEFFKIYKDEFKEIFQGLVGKSFKDAIEGT
                     MISKKKILASVEYNENEEGSPEKSRQDSPGRLSHRLRILETKLKTTNEELRFKDGIIA
                     EKDRELISLTRSVGEYKDKYEFLQRQFSFYKGHGEAINDGDNNKGEQDAKLEDNERYS
                     STRHEFIISELKRKLQEQTVLITTLRDQIQIGGVELGSTNGKSSKRGGFTVGILKNFD
                     TFSTTNLLLLFFLMTFTVLSFIFFFIRNWLQTNNAEFQSQKDLSWWENISLLSRIGWF
                     FMDWTEPIIESENQIRNDEALAAYDRIFGLGGSEQ"
     gene            <138744..>140564
                     /locus_tag="HG535_0B00780"
                     /db_xref="GeneID:59234701"
     mRNA            <138744..>140564
                     /locus_tag="HG535_0B00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286873.1"
                     /db_xref="GeneID:59234701"
     CDS             138744..140564
                     /locus_tag="HG535_0B00780"
                     /inference="similar to AA sequence:RefSeq:NP_011442.3"
                     /note="similar to Saccharomyces cerevisiae HSF1 (YGL073W);
                     ancestral locus Anc_6.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142768.1"
                     /db_xref="GeneID:59234701"
                     /translation="MDKLPNFNDEDIEKILHPNNLFGDELRPLEKDTSSGVIEDIVNP
                     SLDAESLSREDTGSSSNQPGTHLIQRMAPMGIYQGSPHMNNNNQLLPFRNAVQPAQPA
                     TPQQQQSTRHSKTRPAFVNKVWSMLNDESNANLIHWSDDGKSFIVVNREEFVHEILPK
                     YFKHSNFASFVRQLNMYGWHKVQDVRSGSIQTSTDDKGQFENEFFIRGREDLLEKIVR
                     QKSSATNAKVNNANGGPYNGSDLNVMGELNLGDSSNINALLGELEQIKYNQMAISKDL
                     LRINKDNEMLWKENMMARERHRTQQQALEKILRFLASLVPHMDQKMITEGILNNSNNN
                     VPINSHNGNINGNDSSNDLHIVNNFDEDLTNLTANTPLDSSQPYGSNAYSLNEPMLMD
                     QRGKSRYLLKNRTNSTTSSSTSRMRNYSSDGRISEIPFDQDEETNSESNLDKSNYAVG
                     LRDQNARYNPNFFNHLQSNIDEQDERIKHLEDMVHVLSPSDPNLNKNQQMNSNAHLNP
                     NTNFDLQDYCFSNVNSPTLDANRHTKLNTSTGLSPLIQTDNEDLISLGNLPNTLISDV
                     SGATQQSVPHEKRSAEEMSEASKDAMIEEINTPSSKRSRS"
     gene            <141838..>143985
                     /locus_tag="HG535_0B00790"
                     /db_xref="GeneID:59234702"
     mRNA            <141838..>143985
                     /locus_tag="HG535_0B00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286874.1"
                     /db_xref="GeneID:59234702"
     CDS             141838..143985
                     /locus_tag="HG535_0B00790"
                     /inference="similar to AA sequence:RefSeq:NP_011444.1"
                     /note="similar to Saccharomyces cerevisiae AFT1 (YGL071W)
                     and AFT2 (YPL202C); ancestral locus Anc_6.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142769.1"
                     /db_xref="GeneID:59234702"
                     /translation="MNCQSGDTPEYPADSRVDMNANGNVDTKGDGDEESETLANDQSR
                     LIHLDPIPNFKDKSEIKPWLQKIFYPQGIEIVIERSDNIKIVFKCKAARRGKKTRDKG
                     VVPKMETEQTPSPGPSSKKKRSVSRFNTCPFRIRATFSLKRKKWNIVVLNNNHSHPLK
                     FNPDSDEYKKFKAKLREDNDWEAVKQFDELEYRTLSNLPIETSVITCDCGLTNEIKSF
                     NIVLPSTRPLCSSSSKTPTNMELCEDNTCTGTATFPGTSGFTSQLVKKPKSKKTRQLP
                     HKENLLRSTTTQNFLAAGNAPITTNSSMPGFLDNPTSTNLNSNLNQFLTLASSQNTVT
                     DLNEIDFTNIFNKRVHNKCPHQHNHRCSMPSHTCNYKNPRHNSSYDDSGTSVKQPNSS
                     SKLNNEINIDDSINQYGSVLFSPMPGSSNLYLSPSDEVLASPSNHRPSTTYGNSDNFF
                     DFVGKPDLYLQYSNDQNSNKDTDSFTDSTALDATVRYSDVSSQFHGITRAPNPEDDRD
                     SRFSSSKGLNEIKMIDEKLSDYSRQSQVSQPPQPLGPSHPQPLSQLSQLSQLSQLSHL
                     SQLSQLSQISHLSHLPQEPQAPQAPQAPQAPQAPQEPQEPQAPQAPHAPQAPHASQIL
                     QQQSENDVLPTFPLHGNAQYSEQHVKQEILSHEIHVQEHDLYLKDFDINWNLQNQNLN
                     SMSPSIDSTTVKREDDNTNDNEQNFWEMNFENS"
     gene            complement(<144129..>144497)
                     /locus_tag="HG535_0B00800"
                     /db_xref="GeneID:59234703"
     mRNA            complement(<144129..>144497)
                     /locus_tag="HG535_0B00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286875.1"
                     /db_xref="GeneID:59234703"
     CDS             complement(144129..144497)
                     /locus_tag="HG535_0B00800"
                     /inference="similar to AA sequence:RefSeq:NP_011445.1"
                     /note="similar to Saccharomyces cerevisiae RPB9 (YGL070C);
                     ancestral locus Anc_6.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142770.1"
                     /db_xref="GeneID:59234703"
                     /translation="MTTFRFCRDCNNMLYPREDKESQRLLFECRTCSYVEEAGTPLVY
                     RHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFV
                     CLSCSHIFTSDQKNKRTQFS"
     gene            <144766..>145317
                     /locus_tag="HG535_0B00810"
                     /db_xref="GeneID:59234704"
     mRNA            <144766..>145317
                     /locus_tag="HG535_0B00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286876.1"
                     /db_xref="GeneID:59234704"
     CDS             144766..145317
                     /locus_tag="HG535_0B00810"
                     /inference="similar to AA sequence:RefSeq:NP_011447.1"
                     /note="similar to Saccharomyces cerevisiae MNP1 (YGL068W);
                     ancestral locus Anc_6.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142771.1"
                     /db_xref="GeneID:59234704"
                     /translation="MSLRLITSKSITVSSRLLRRGATRVVTSSQRFNSGVTDSPVNQT
                     VDPKINKIVEEISKLTLLETSALITELKSQLNIPDIAFPTAGAVGGPAGNGSQSGENT
                     AVQEEEKPEEKTIFAIKLESFDAKSKPKIIKEVKNLLGLSLVEAKKFVEAAPKVLKDN
                     VAKEDAEKIKSTLEGLGGKVSLE"
     gene            complement(<145542..>146660)
                     /locus_tag="HG535_0B00820"
                     /db_xref="GeneID:59234705"
     mRNA            complement(<145542..>146660)
                     /locus_tag="HG535_0B00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286877.1"
                     /db_xref="GeneID:59234705"
     CDS             complement(145542..146660)
                     /locus_tag="HG535_0B00820"
                     /inference="similar to AA sequence:RefSeq:NP_015121.1"
                     /note="similar to Saccharomyces cerevisiae TPK2 (YPL203W);
                     ancestral locus Anc_6.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142772.1"
                     /db_xref="GeneID:59234705"
                     /translation="MEPMNSDYQQQHLHQQQQSYQPVQQTAQYYSNMPYGGEDATHKS
                     LLPQRSVISKGKYSLQDFQIMRTLGTGSFGRVHLVRSVHNGRYYAMKVLKKQQVIRMK
                     QIEHTNDERRMLKLVEHPFIIRMWGTFQDARNLFMVVDYIEGGELFSLLRKSHRFPNP
                     VAKFYAAEVTLALEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAKEVVTVTWTLC
                     GTPDYIAPEVITTKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVNY
                     PPFFHPDVVDLLSKLITADLTRRLGNLQSGSQDIKSHPWFSEVVWEKLLAKDIETPYE
                     PPITPGIGDTSLFDQYPEEHLDYGIKGEDQYAQYFTEF"
     gene            complement(<147005..>148546)
                     /locus_tag="HG535_0B00830"
                     /db_xref="GeneID:59234706"
     mRNA            complement(<147005..>148546)
                     /locus_tag="HG535_0B00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286878.1"
                     /db_xref="GeneID:59234706"
     CDS             complement(147005..148546)
                     /locus_tag="HG535_0B00830"
                     /inference="similar to AA sequence:RefSeq:NP_015120.1"
                     /note="similar to Saccharomyces cerevisiae HRR25
                     (YPL204W); ancestral locus Anc_6.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142773.1"
                     /db_xref="GeneID:59234706"
                     /translation="MDLRVGRKYRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRS
                     RHPQLDYESRVYKYLSGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFTF
                     KTVIMLALQMICRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFN
                     THRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKA
                     TTKKQKYDRILEKKLCTSVETLCGGLPQEFAEFMVYCRSLRFDERPDYLYLARLFKDL
                     SIKLEYHNDHLFDWTMLRYTKAMVEKQHDLLMVESNNNSSSTSNVNATNPNANLNQNQ
                     NQNATTNTNASNKNDSFNRVKLLAMKKFATHFHYCKSEDKHHPTPEEIKQQSVQNSNA
                     AASLPEELLNAIDKGMENLKQQQAQQQQQQQQPGQTGQTGQPQLGQVQLQHPEPLLQQ
                     QQQQQQQQQQQQQQQQDLQKQQQAQTLGAHRSTHYPPQVQQQQPQQQQQQQPLQRPSG
                     EDIWL"
     gene            <149846..>151030
                     /locus_tag="HG535_0B00840"
                     /db_xref="GeneID:59234707"
     mRNA            <149846..>151030
                     /locus_tag="HG535_0B00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286879.1"
                     /db_xref="GeneID:59234707"
     CDS             149846..151030
                     /locus_tag="HG535_0B00840"
                     /inference="similar to AA sequence:RefSeq:NP_011448.3"
                     /note="similar to Saccharomyces cerevisiae NPY1 (YGL067W);
                     ancestral locus Anc_6.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142774.1"
                     /db_xref="GeneID:59234707"
                     /translation="MSDLGTAVAVNNGDNGMFFGCESLNRISFLRSDIEFIRATMNHS
                     STVFVVFVNGEAVLDKDKNSILLTHLKDDTKLDDAIRKLVPLMNTAGIRMLESGVNIT
                     FLGLMEPDKRSADVVSDNLFIHKDIYRGVPYYGIDIRPNSGTLIKPEDVEHLLKMETV
                     KRMSVFEMNNAIASLYSHAKMYLNWLGKFKYCPDCGSALYPVDGGTKLKCSNPDLTQY
                     CEVRDLPVNNVCFPRTDPVVIIAITTRDFSKICLARNKRRIGSNVMYSTIAGFMEPAE
                     TIEKACSREIWEETGVKCSEVSLVCSQPWPYPVNLMIGCYGIVDFNGDNEIINLNHDD
                     EIMDARWFDTKDISEAIDNYSGKGFVDFSMDKITFPGSTAIAHHLIKLICDKFKRSQG
                     SL"
     gene            <151197..>152144
                     /locus_tag="HG535_0B00850"
                     /db_xref="GeneID:59234708"
     mRNA            <151197..>152144
                     /locus_tag="HG535_0B00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286880.1"
                     /db_xref="GeneID:59234708"
     CDS             151197..152144
                     /locus_tag="HG535_0B00850"
                     /inference="similar to AA sequence:RefSeq:NP_015118.1"
                     /note="similar to Saccharomyces cerevisiae YPL206C;
                     ancestral locus Anc_6.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142775.1"
                     /db_xref="GeneID:59234708"
                     /translation="MVQIVGHRAFKGQYIENTSIAFERAYEAKSEIIETDLQMTRDGV
                     VVVNHDSDTGRIWDHEMVISEHNYDEVSKLRCKDDATLKMLTLVELLEWAVDHPNTRL
                     MLDIKFSNNKIILIKAYAAMLSVKNDIKYWQSRVIWGLWLVDWFEYGVETGVLKDFDI
                     VVISFSLDIVKQFVEYSHSLNNPHYKLFGISIHFVASWTERFRNIMLPVLQERGVKIF
                     LWTVNKLIDFKYMSGLPVYGVVTDDPIVARQLCIEYPYISEFTVPAWTTFNGLRFHVY
                     LIVYEIVCSLLLKPWVHRQFAGFSFAYFLFLSLRKMHLL"
     gene            <152573..>154201
                     /locus_tag="HG535_0B00860"
                     /db_xref="GeneID:59234709"
     mRNA            <152573..>154201
                     /locus_tag="HG535_0B00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286881.1"
                     /db_xref="GeneID:59234709"
     CDS             152573..154201
                     /locus_tag="HG535_0B00860"
                     /inference="similar to AA sequence:RefSeq:NP_011449.1"
                     /note="similar to Saccharomyces cerevisiae SGF73
                     (YGL066W); ancestral locus Anc_6.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142776.1"
                     /db_xref="GeneID:59234709"
                     /translation="MISVHSHIKGVKEEVKRQFVDNIGDSNSSNRDGGWKDLLPLVKN
                     NPVQIDHINQVSKEKFFNSKARIIENPVETAFQYRICVSCGKPIALNAIMDHLENHCQ
                     GSRDTESFSKMKKDIEYESTNANSGRSNSEDIPTTPTQDSKRFKENSETPQGTSKRQR
                     KVKQRNPTEKHLIDFDKQCGVELPEGGYCARSLTCKSHSMGAKRAVEGRSQPFDTLLA
                     EYHKQHQTKIGAAAEKRAKQQKVQKQQKQVEREHKKQLQQQREGQRKNKSSGSSQNNV
                     GKGKSGNSTDKSANHANNHGSYITLSPEEETTQVLNGVSRSFPLPLESTVLSSVRHRT
                     KYFRMREMFASAFSVKPGYTAPGYGAIHSRVGCIDIDRTTDYKFRIRTPQPMNQVPQG
                     ATPQQLQKLQHQRMLQAQLMQMQKENHTQQGHSEFQQRARAAGAHLSESNNAAQAVNS
                     MQKSNVQQNVQENGFTPQEIQQQQQKLRQQQLQQQRFEAAAFHLANATKLMQGSSPES
                     SNNMANSPPSSSINQSLGSPIGGRVNVGIGYTTK"
     gene            complement(<154318..>155847)
                     /locus_tag="HG535_0B00870"
                     /db_xref="GeneID:59234710"
     mRNA            complement(<154318..>155847)
                     /locus_tag="HG535_0B00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286882.1"
                     /db_xref="GeneID:59234710"
     CDS             complement(154318..155847)
                     /locus_tag="HG535_0B00870"
                     /inference="similar to AA sequence:RefSeq:NP_011450.1"
                     /note="similar to Saccharomyces cerevisiae ALG2 (YGL065C);
                     ancestral locus Anc_6.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142777.1"
                     /db_xref="GeneID:59234710"
                     /translation="MTELKRKLRIAFIHPDLGIGGAERLVVDAAVGLQEQGQDVTIYT
                     SHCDKSHCFEEVRNGTLKVKVYGDGLPTNVGGRFFIVFANLRQLYLVMKLVLTREIMR
                     YDLFIIDQLSTCLPFLHMLGNAKTLFYCHFPDQLLAIRSSFIKKLYRVSFDIMEQFTM
                     SAADCVVVNSNFTKTVYQKTFTYLKGKVNVVYPCVDLTFGPIQDKDKELAEVLLNTRD
                     KFYLSVNRYERKKNIELALKAFALSEEMNNPHAKLIICGGYDGRVVENVEYLKHLHKI
                     SDTLQLSYATIFYPEISNLKDLQTSDTATKKVIFLTSISTSLKDLLLSKTELLLYTPS
                     FEHFGIVPLEAMKYGKPVIAVNTGGPLETVEPLIKGKTENIATGWLKTADPEEWSNAI
                     NEFKNVRDQKVVVFSETGPKRVRKLFSREAMTNSFVENIKTFIDSKRTSYIWEKLLIV
                     LFNLLLQVIMSRIFIVKPWTYLLLAVTSTLCFRNIGTGLYWLAVYLSISILLRGVSSI
                     I"
     gene            <156024..>157280
                     /locus_tag="HG535_0B00880"
                     /db_xref="GeneID:59234711"
     mRNA            <156024..>157280
                     /locus_tag="HG535_0B00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286883.1"
                     /db_xref="GeneID:59234711"
     CDS             156024..157280
                     /locus_tag="HG535_0B00880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142778.1"
                     /db_xref="GeneID:59234711"
                     /translation="MKRISKNGFHGRAFSQTYSPRSDSGYFKRRLEDLKDQNTITKDD
                     PLNRLSEIKEQNSLVDNEEGLKDLYRQLPQKTFRKDFGKELHYVTTGTSMNRQAKDIA
                     LSRAWKGQEHLEDATLRMLVDSTGKSKSGVSIYGKNLAFIDPNEARKDSQPLTASRKL
                     KKKLEDAQDNLQKYRLDKEKEIDEREQSEFRALYTEKFTPIGSFEKIRSIADQRVEES
                     RRKGGFDSLEELRGKPLALPRLNQHIDRTEYYLNNMLARQKIVPPWIEAQSRVNRETN
                     ELRREMLRNFESELVTFLEEYKAITPGHDFNKTCYFLKGKFGSVETFIMEKHTAWKLS
                     YMPILSMKITTLNNSLRAYNLQAPLPQQKLYLQSEKEASRVLNAIDLQSLVNKKMEER
                     SKKENINTMLNTKNIFSLGRFFPNWK"
     gene            complement(<157358..>159748)
                     /locus_tag="HG535_0B00890"
                     /db_xref="GeneID:59234712"
     mRNA            complement(<157358..>159748)
                     /locus_tag="HG535_0B00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286884.1"
                     /db_xref="GeneID:59234712"
     CDS             complement(157358..159748)
                     /locus_tag="HG535_0B00890"
                     /inference="similar to AA sequence:RefSeq:NP_015117.1"
                     /note="similar to Saccharomyces cerevisiae TYW1 (YPL207W);
                     ancestral locus Anc_6.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142779.1"
                     /db_xref="GeneID:59234712"
                     /translation="MALNWLTACGTLFCAGLYLWLGGRKSVAMAIVVFYGAVHLDSKI
                     ERVKSTADKFIENESSIDEEKPKKKKCCGGKGGSGCCSSKGNKKKGGCSCGHSKNADI
                     EDIADSLESGLVVSTSQEKDTSSGEKSTSRETNAEKRDNIIAVDFTQAFKRLSKKKGK
                     NGKDARPRKHITKASVLKKPKEEDDLVKSAMTVSNESLLSSQVYVFYSSLQGGAERSA
                     RKVLETLSRLIELKAPPILLNMDDITDIDDYFVSVPCENALYILVVPSYDTDCPLDYF
                     LQTLEENFNDFRIDKFPLRKLVGYGILGIGDSETWPEKFCYQAKKVDHWIARLGGRRI
                     FPVGEVCMKTEAESKVQEWADLLCETIKDDTPILYEYDEEVTSSNEDDRPEEDMIDLE
                     DIGNSDISGNDTKQMVAKNSPTYKKLTKQGYTIVGSHSGVKICRWTKSDLRGTGSCYK
                     HSLFNIVSSRCMELTPSLACSSKCVFCWRHGTNPVSKNWRWELDEPDYILENALQGHY
                     SKIKQMRGVPGVVMERFAKAFKVRHCALSLVGEPIMYPYITKFIELLHEKQISSFLVC
                     NAQHPDALASIGKVTQLYVSIDAPTKTELKKVDRPLFKDFWERMLQCLDILNSEQSHQ
                     RTVFRLTLVKGFNMADVSAYADLVQRGLPSFIEVKGATFSGSSDGNGNPLTMQNIPFY
                     EECTKFVKEFAAELQRRGLGYGIAAEHAHSNCILIASTEFKINGEWHTHIDFDKFFEL
                     LASGKQFYPMDYVAKTPEWALFGNGGFAPGDTRVYRKGKKKRMMQSSEKESNETQA"
     gene            complement(<160810..>162597)
                     /locus_tag="HG535_0B00900"
                     /db_xref="GeneID:59234713"
     mRNA            complement(<160810..>162597)
                     /locus_tag="HG535_0B00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286885.1"
                     /db_xref="GeneID:59234713"
     CDS             complement(160810..162597)
                     /locus_tag="HG535_0B00900"
                     /inference="similar to AA sequence:RefSeq:NP_015116.1"
                     /note="similar to Saccharomyces cerevisiae RKM1 (YPL208W);
                     ancestral locus Anc_6.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142780.1"
                     /db_xref="GeneID:59234713"
                     /translation="MEEQSIQRLIAWGKFQGAALPEGVSFEYSDRKGIRCVCEKSLSS
                     PYLTIPDDLIISGKLIPLEFPEADHKRGNTWLKFLLAKMKFGGEECNSDLSEKFRPYL
                     DCLPKIVDCPLVWNPRELSHLAGTNLGSSVRPKLKDILTEWYRFVKENEVTEEAAVSS
                     DCSFYKDYGQLSDESIFRWLVEPLSNGSTLQWSSASAFLWSHLILLSRAFPHYIIDQN
                     VDQASLMLLPIIDLLNHDYHSKVEWGFNEGQFSFKKLDSIEEDAELCNNYGCKGNEEL
                     LSGYGFVLEENPFDFVALKIKLPLETITTILKEEPTLKIPTLDDYTNFAFEKQSQNLP
                     NKPEASVFEDGIVYFINKLNASCLDPLLNMFAYLCRGNSEWHSLASKFNGLQNLRNAL
                     ESKLAAAKSFSSQRDDCSIDSSKYEVNSYRRHCARIYRDGQLSVLKDGLKKLKAMEKT
                     WLTEYKDRLLTVKKITKYDKGFFGEELPAYFESIDRKQDDVVFENNFELLVIWILIKI
                     ENNSFIEKHDWVSEQYRNFLIDAKNEDITSDRMDPSIESFRRRMINGTTQTDRTITLK
                     KIVHTFDFVQKNSFTRISSSNPDTIMVRN"
     gene            <163194..>164357
                     /locus_tag="HG535_0B00910"
                     /db_xref="GeneID:59234714"
     mRNA            <163194..>164357
                     /locus_tag="HG535_0B00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286886.1"
                     /db_xref="GeneID:59234714"
     CDS             163194..164357
                     /locus_tag="HG535_0B00910"
                     /inference="similar to AA sequence:RefSeq:NP_015115.1"
                     /note="similar to Saccharomyces cerevisiae IPL1 (YPL209C);
                     ancestral locus Anc_6.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142781.1"
                     /db_xref="GeneID:59234714"
                     /translation="MEHDSRIQSQRARRDSLMQRNMLLSMRLNHNNAGHIPSKAKATL
                     RTKAPMGKTWRATNSPQRLMSMKNSSQGSGWNYQRSTDKNSHDTENARVLSPHRAQHP
                     QIRASPKRGIRPSLSPIKAKSMSLDDFDIGKKLGKGKFGRVYCVRHKKTGFICALKAM
                     EKSEIVHYNVQKQIRREVEIQSSLNHPNLTKLYGFFHDEKRVYLVMEYLINGELYKRL
                     KSHGPLNDILASFYVYQMADALDFMHQRNIIHRDIKPENILIGFNNVIKLTDFGWSVN
                     NPHNVKRKTLCGTIDYLSPELICSREYDDKVDIWALGVLTYELITNSPPFEEDSDALT
                     HKRIVKGDLRFPESVSSDARDLILKLLKHKPQDRILLKDVKKHPWILKNRPFW"
     gene            complement(<164460..>166187)
                     /locus_tag="HG535_0B00920"
                     /db_xref="GeneID:59234715"
     mRNA            complement(<164460..>166187)
                     /locus_tag="HG535_0B00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286887.1"
                     /db_xref="GeneID:59234715"
     CDS             complement(164460..166187)
                     /locus_tag="HG535_0B00920"
                     /inference="similar to AA sequence:RefSeq:NP_011451.1"
                     /note="similar to Saccharomyces cerevisiae MRH4 (YGL064C);
                     ancestral locus Anc_6.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142782.1"
                     /db_xref="GeneID:59234715"
                     /translation="MILKTLSRMRYFPLFIGMRQSLSGSVRLYSRRSRGPEIKNKLKL
                     ATTVGSTKQTGSTLSRKPSPNIRVSDKRGPKIKTPAHRSKDKSRSTFNYGNFGGLKES
                     GAEESQRASKIISKISDFDQLKVLPVVRNAIKQVIADESLAKGKIKDIKPSPIQVVSI
                     RKLASNLMDPKLQLHAIAAETGSGKTIAYLTPLLDYLKRQEIETPEYWESINKKAVIR
                     SVILVPTHELIEQVYSTVSRIDESLELHTCKWGSSLPYSDLLEQIKNRIDILVTTPAK
                     LMSLFNIRMISRPDKILSQLKFVVLDEADTLLDQSWVEDMHAAIKKMPNTNHIVFCSA
                     TIPNEFNRTLGSLFPTVVSITTPRLHKLPNSLEFKVIDASLNPFKGSKVKALAQVMYA
                     ILNDGTEPNFEKRCIVFVNEKKDVSTLVEKLSTTYGHNCVGLTGDDKVSERLEKIAAF
                     IQPPKVLETPQKTVQREADNTKIYKIPNSNILITSNEGEKSNIPPPSSRLRILVTTDL
                     MARGLNFRGVKNVILYDVPKTSIDLVHRAGRTGRMKQRGRVFMLIDKTAKSWARGIPK
                     IVKNSIALS"
     gene            <166435..>168330
                     /locus_tag="HG535_0B00930"
                     /db_xref="GeneID:59234716"
     mRNA            <166435..>168330
                     /locus_tag="HG535_0B00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286888.1"
                     /db_xref="GeneID:59234716"
     CDS             166435..168330
                     /locus_tag="HG535_0B00930"
                     /inference="similar to AA sequence:RefSeq:NP_015114.2"
                     /note="similar to Saccharomyces cerevisiae SRP72
                     (YPL210C); ancestral locus Anc_6.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142783.1"
                     /db_xref="GeneID:59234716"
                     /translation="MGKENLTQLLSQLNVQSTQEDSCEVEKICKELLKNGCENPGFIL
                     RACLVAVIKQDRYKSSLEILKQNKDIDDKYGEEFILEKLYVFYKLDATHEFEALYSKI
                     NPPPLESFGKANNRGILHVRAQFCYKQGLYEEAFKIYNLLAKHNGDLIDNDLELACNE
                     RVPLTAMPDIINDSTILSQVNEESYDLLLNDSMILSARGKYDEAIELLEQAYKIAKRE
                     GYDRDQEAIGLQLAFVLQMKGDNKASHIHLQELVSLLKQGGRKSPFTLLARMNEKSFA
                     DLSKYNDNLNLSIRELDFKTLDSMKSKQFTREQWTVINRNRLILHLFNNNSVQYGSSL
                     LSRSLHNYSNLVNDVIFESYKTQAKKLYHHAVQMINSGVNGSVIGFLIITVQLLVVEK
                     QWQNAIAVCELYLNKLANSTSQVDTVEHHAVCYILFELYKITGRDHSKSVLLKNLTNG
                     KKTISKDVPFWKHVGFQHLSLGNIKDAKKLFKQVFAYDSDKALEKVIFDTTLDVDESQ
                     DITQNIDVEKLLLQGIKCLETSNKLESKQHISKVQKKRINLKKQKKKEQRLKKFLQTH
                     GSTKNVDPERWLPLKDRSSYRPKKKQSLTKQTQGGAMNKKAEQALDITNKLKKTVPTT
                     RRKKGHK"
     gene            complement(<168428..>168973)
                     /locus_tag="HG535_0B00940"
                     /db_xref="GeneID:59234717"
     mRNA            complement(<168428..>168973)
                     /locus_tag="HG535_0B00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286889.1"
                     /db_xref="GeneID:59234717"
     CDS             complement(168428..168973)
                     /locus_tag="HG535_0B00940"
                     /inference="similar to AA sequence:RefSeq:NP_015113.1"
                     /note="similar to Saccharomyces cerevisiae NIP7 (YPL211W);
                     ancestral locus Anc_6.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142784.1"
                     /db_xref="GeneID:59234717"
                     /translation="MRQLTEEETRVLFEKLAGYVGRNISYLVNNKEVPHVFRLQKDRV
                     YYAPESVANLATSVARPNLMSLGICLGKFTKTGKFRLHVTSLPILAQNAKYKIWIKTN
                     GEMPFLYGNHVLKAHVGRMSDDIPEHAGVIVLSMNDVPLGFGVSAKTTNEARNLQPTS
                     IVAFRQADIGEYLRDEDTLFT"
     gene            <169412..>171161
                     /locus_tag="HG535_0B00950"
                     /db_xref="GeneID:59234718"
     mRNA            join(<169412..169563,169652..>171161)
                     /locus_tag="HG535_0B00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286890.1"
                     /db_xref="GeneID:59234718"
     CDS             join(169412..169563,169652..171161)
                     /locus_tag="HG535_0B00950"
                     /inference="similar to AA sequence:RefSeq:NP_011452.4"
                     /note="similar to Saccharomyces cerevisiae PUS2 (YGL063W)
                     and PUS1 (YPL212C); ancestral locus Anc_6.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142785.1"
                     /db_xref="GeneID:59234718"
                     /translation="MTGDNLKPAYDDDQMDSEAYKRGAQYKWTKARKADYEGKVDGDH
                     NQDEKRVKLDTTVVPKENGNDDGEQVIKEKRLPKRKVAVMIGYCGTGYHGMQYNPPNP
                     TIESELFRAFSEAGAISKDNSTDLSKNGFMRAARTDKGVHAGGNLISLKLIIEDPDIK
                     QKINDKLPEGIRVWDIERVNKAFDCRKMCGSRWYEYLLPTYALLGPKPGSLLYENIVK
                     SKEEYPGVVADDEDSINFWTELEGQIKETFSEEELKAIQSFSPLSTDEFADNEALYLN
                     VKKYKQLENKHKRKYRLSEKKLSHFSEAMNRYLGAHNFHNFTLGKDFKESSAIRFMKE
                     IKISRPFVVGDAETEWISIKIHGQSFMLHQIRKMISMATLIARSGCPTDRILSAYGPQ
                     KINIPKAPALGLLLESPVFEGYNKRLEKFGYKPIEFSRYQDEMDAFKMKHIYDKIYKE
                     EVEMNIFNGFFTHIDNFDRHVQGSESSEKTGNDIQRGIFDYLTAKGIPSVPAPEKPKT
                     VSETEEVETDSAVADKPNSVEGDIQDTTVQDVGITDSASQRNVQA"
     gene            <171397..>172719
                     /locus_tag="HG535_0B00960"
                     /db_xref="GeneID:59234719"
     mRNA            <171397..>172719
                     /locus_tag="HG535_0B00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286891.1"
                     /db_xref="GeneID:59234719"
     CDS             171397..172719
                     /locus_tag="HG535_0B00960"
                     /inference="similar to AA sequence:RefSeq:NP_011386.2"
                     /note="similar to Saccharomyces cerevisiae RSM23
                     (YGL129C); ancestral locus Anc_6.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142786.1"
                     /db_xref="GeneID:59234719"
                     /translation="MLGLRSRQFSTTILSRAAAPSRGKAQGFAKKASGNKTATKRISG
                     DTLYKNWTDTVASSKLSQNASFVEIPTLNSSDLNSTLNKVASYTNKQYRSLYHLGSFK
                     KNQYNELFPKPISLVRESSTKKFLDLLRTSSNKKFIITGEAGVGKSVLLAQTHAVMCE
                     SKGIIIHISYPEAFLNGRKDFVYDETTKQYIQPMYLKQLLRKILKSNDEKVLRSLKLS
                     KDYTFSNADPKDSAIKKQITLKGSQNDLFDLISVKTHSRNSGNLFQAIISELLIQKAH
                     PVFFTIDNFSRILTTPFSSYKDVNNKNIHLLEFQIGKIIMDTISGDSKFLHRDSAVVL
                     AISGVDRTNRTLPTALGKVEEDVYISRDHYDPEFASILKKGEVREFEVPKLTKDEVKE
                     LLEFYLKSEIILNSESQQSFERLADQKYFLSGNGNPRELLKSIVLMHS"
     gene            complement(<172824..>174188)
                     /locus_tag="HG535_0B00970"
                     /db_xref="GeneID:59234720"
     mRNA            complement(<172824..>174188)
                     /locus_tag="HG535_0B00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286892.1"
                     /db_xref="GeneID:59234720"
     CDS             complement(172824..174188)
                     /locus_tag="HG535_0B00970"
                     /inference="similar to AA sequence:RefSeq:NP_011385.3"
                     /note="similar to Saccharomyces cerevisiae CEG1 (YGL130W);
                     ancestral locus Anc_6.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142787.1"
                     /db_xref="GeneID:59234720"
                     /translation="MNASSSPEIPGIIQPGMVTQDLKMMVCKLLNSPKPSKTFPGSQP
                     VSFQHSDIENKLLSQDYYVCEKTDGLRVLMLILINPVTREQGCFMIDRENNYYLINGF
                     RFPKLPRKDKRELLETLQDGTLVDGELVLQTNPITKLQELRYLMFDCQAINGRCLTSS
                     PTSSRLAHLGKEFFKPYYDLRSIFPDKCVTFPFKLSMKHMNFSYDLVKVANSLEKLPH
                     KSDGLIFTPVRTAYCIGTKDSLLLKWKPEDENSVDFKLVLDIPMVEDESTPKKDPNRW
                     YYNFNVKPNFELYVWLGGADVNTKLKDFGNPFSKKEFELLERTYKKFAALEVSDEKWQ
                     ELKSLNEPLNGRIVECTKDQETGAWKFLRFRDDKLNGNYTSVVQKVLESISDSVKLED
                     LAEVANDIKELWEDRKEEERGSAVSSHAPPMIKRVQKSTNGVNDSNETPIQPRYVDED
                     DFSE"
     gene            <174328..>178791
                     /locus_tag="HG535_0B00980"
                     /db_xref="GeneID:59234721"
     mRNA            <174328..>178791
                     /locus_tag="HG535_0B00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286893.1"
                     /db_xref="GeneID:59234721"
     CDS             174328..178791
                     /locus_tag="HG535_0B00980"
                     /inference="similar to AA sequence:RefSeq:NP_011384.1"
                     /note="similar to Saccharomyces cerevisiae SNT2 (YGL131C);
                     ancestral locus Anc_6.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142788.1"
                     /db_xref="GeneID:59234721"
                     /translation="MCELRYIQTETSQTICRDMAHNDSKSMPKQRAGTRSVNYSEKEA
                     DADLIRRIDQFEKVDTKSKPPNRVGRPRSNKSTADKNGNTGTSSGVTKNKHQSFLNDK
                     AVGWNFIPVLPPNLRKTSRFSNILDLKDALVNVSQNTLKNSDRLLLKAGDTIYMVSEP
                     PGEPYYIGRVVQFVPKVEFSQLIDKLKAVTSELSAKYFHVKMNWFYRSRDIQDKTSNF
                     DTRLVYASLHEDICPIISYRGKCTVLHVDEFENENSNTAEFITRPNVFYFDQLFDRYS
                     LAYYNVVSSEKLLTLHKSSPFLYLLSKRFRYMFIEDKYPLNKILRKYVIKDNTSENEA
                     NDESWDDRCSVCREWCRSSQRLKCDECYSCVHLHCMDPPLEKKPNKGIIWLCFNCLKR
                     HEGTSEALRELNDEQTKQTESIGAFKDKLDCISRNVIEEGDSKVDERHWFQYMGQNMI
                     CHLEDLLQRNFYIPYPFKNSRIGIKYQWAGNAKFEKWEPVPYSTDRTDERGSDQTSDL
                     LWVMEDGKINDGSLEAYIQKCKDKFPAELKIMAESCNFLDMITKALMDQNYSLDRAFS
                     ECKKLLSRESLREPTFSTLEVEKFENAVAQYGSELHLVCKDVDSQPMSSIVRYYYYWK
                     KTENGQRIWGGFKGRPKNKAKLNAADKEVEKLTNKGKSPRERKPTKLALENKNTVVKE
                     ELKFLDESCFETENLSLVRTCFKCVFCDIDYSPLWYKITGGCDDEHVKNKMHTGFNDK
                     FENKTGAHKEVNNVRKKTSGESNDSSNKQPRLDALCIRCARLWRRYGIKWQPPVDILK
                     RLSGNSMYVLNSNIDQALEERNANVLTSKPEQARNKLLEWEQVTDSEFILRQRPDFIQ
                     NPDHFAKLKTNTLSSRSALYRLAKKPIDKNQFNIEHSRRELENLLATVMRKQAKTIDH
                     RPKSAPVVKKEKQETATKSKSTPQGDLPKKSPTPPILTAVNYGIDLNSGGDIQIEIPS
                     LNGKLGTVTIKNNFEKVIIDEILLDQLKRLSTARKRTHFEESSILSFEPSLKARKIDN
                     DGILGSTSNHDPMPMANIRPSPEVVHENSTTALLRAYRNSVTPREGPPGVKFSIDAKR
                     SSNDDIQRSEYCSVCRQKFEKFQYKDLCCHNCGMRVHYCCYGANRDKENFHEVGSKNS
                     TWICDPCSNDLNPSASTNYKCVLCYSKNREFEFSKNPNDGALREALKCTNSGSWAHAA
                     CAIFNKDIKFGSASSLQPIMNTKLALMKNSNNSCGLCGIEGGGLVKCDLCERLFHVTC
                     SQKNPGFSLVFKMADIHRSDNEATVSGNSHYFTPVLLCNDHQMNPADVNSVYASLDTR
                     ISNKSSSLMNIFMSSRNYESKYNMVYERYLEQRECEEKDTTKVKTDGISENVNEIECT
                     DTSIDGNPPLDDEKVKEAVSFLQDLCTRKKNESRKSEQTDENFCDFIQTYTSKSDSYG
                     NRGEELSEAEVKMLMDGINPDDFDIQCSKDGKESKRKKQKNKIKELVNSSK"
     gene            complement(<178843..>179556)
                     /locus_tag="HG535_0B00990"
                     /db_xref="GeneID:59234722"
     mRNA            complement(<178843..>179556)
                     /locus_tag="HG535_0B00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286894.1"
                     /db_xref="GeneID:59234722"
     CDS             complement(178843..179556)
                     /locus_tag="HG535_0B00990"
                     /inference="similar to AA sequence:RefSeq:NP_015111.1"
                     /note="similar to Saccharomyces cerevisiae LEA1 (YPL213W);
                     ancestral locus Anc_6.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142789.1"
                     /db_xref="GeneID:59234722"
                     /translation="MKITPSVVIDAPEYYVDHFNGKYNLDKCTILRNLRLESDSEAMS
                     SSLKHIAKPTRVLDFTNNELILIPDLQLRTDIHTILLGRNQISHVDGKALPSRLVNLV
                     LASNNIAHFEQLNGLQASPKTLKNVVLRGNQVCHLQGYREYVVRLLPQLEVLDFTRVT
                     PKDREKSKVESPIGAPSMSISSDNFRNEPRDKSMEIMNLVVGKMSEEKRKVLNQQLKN
                     ATSLAEIAKIEKLLSGRVQ"
     gene            <179880..>181496
                     /locus_tag="HG535_0B01000"
                     /db_xref="GeneID:59234723"
     mRNA            <179880..>181496
                     /locus_tag="HG535_0B01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286895.1"
                     /db_xref="GeneID:59234723"
     CDS             179880..181496
                     /locus_tag="HG535_0B01000"
                     /inference="similar to AA sequence:RefSeq:NP_015110.1"
                     /note="similar to Saccharomyces cerevisiae THI6 (YPL214C);
                     ancestral locus Anc_6.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142790.1"
                     /db_xref="GeneID:59234723"
                     /translation="MFDKKSVDYSLYLVTDSGMLPTGTSLYSQVKAGLENGVTLVQLR
                     EKETDTKTFVEEALKIHELCQQFNVPLIINDRIDVALAINAEGVHVGQDDMPIPLVRK
                     LLGPNKILGWSVGKTSEVERLAQWGPEMIDYIGIGMVFATSTKKNPKKSPMGPQGVIG
                     ILNALETSKATWCRTVAIGGLHPVNIERVLYQCVSTSGKRSLDGISVVSDIMAAADAA
                     AATVNLHTLLRKKTFQFVDLYLGNGELKPEGLKNVIEQVKQNRPLVQHITNKVHQNFG
                     ANVTLALGSSPIMSEIKSEVHDLARIPHATLLLNTGSVAPLDMVQEAILAYNQVGRPI
                     VFDPVGYSATETRHVLNDTLLSSGQFTCIKGNSSEILSLAKLSVEKMKGVDAHTGTID
                     KKLLERATRLVAYQYKTVVVCTGEYDFIADGTVSGQYALSVGSRGKTVETIPCLVIEN
                     GPIEIMGHITASGCSLGSTIACFIGGLNTNGNLFEAVVAAVLLYKSAGKLAAERCQGS
                     GSFYFQLVDALYQLFRDNKPETWTANFQRL"
     gene            complement(<181627..>182628)
                     /locus_tag="HG535_0B01010"
                     /db_xref="GeneID:59234724"
     mRNA            complement(<181627..>182628)
                     /locus_tag="HG535_0B01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286896.1"
                     /db_xref="GeneID:59234724"
     CDS             complement(181627..182628)
                     /locus_tag="HG535_0B01010"
                     /inference="similar to AA sequence:RefSeq:NP_015109.1"
                     /note="similar to Saccharomyces cerevisiae CBP3 (YPL215W);
                     ancestral locus Anc_6.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142791.1"
                     /db_xref="GeneID:59234724"
                     /translation="MFPRGALQGGTFPTLRILPICSRAYLSQSNVFYNQLTRGDLAAS
                     PENIAKDSHLQSRPLDVSHYAPVKPAKKKVSESKYESTTYELPKWKEALGELVIRTFN
                     LDMDKVRAGSVAGSYYYNMCKEQALQYENKELSDTAKFFYEDLKLPRTFSQWFQVTIL
                     HEWMLFVRMRAMPFKYGRNYQQKLVDRTFSDIEMRLFEEMNVNSGRIADQYLKDFNSQ
                     LRGAIFAYDEGFYTDDATLATAVWRNLFGGRKNIDFVHLEAVVRYIRSQLYVLSMLSD
                     REFALGNFKFVPANESVSVLTKEQEKELKKKVIEKYEAMDKNKDLLPSDRSKLSYTN"
     gene            complement(<183666..>187118)
                     /locus_tag="HG535_0B01020"
                     /db_xref="GeneID:59234725"
     mRNA            complement(<183666..>187118)
                     /locus_tag="HG535_0B01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286897.1"
                     /db_xref="GeneID:59234725"
     CDS             complement(183666..187118)
                     /locus_tag="HG535_0B01020"
                     /inference="similar to AA sequence:RefSeq:NP_011382.1"
                     /note="similar to Saccharomyces cerevisiae ITC1 (YGL133W)
                     and YPL216W; ancestral locus Anc_6.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142792.1"
                     /db_xref="GeneID:59234725"
                     /translation="MVLYKRKAITLPDPKPLPVDINIEVWHIDETGEWFETYEEYLTR
                     FDFYARHHFTCEITGTSCLTFFEALDSEETQFRYVEERFPLKLREPVARFLHFNGIKR
                     LDALVENVYARFKNDFFPGETVYLRKNNKDLLDGSPSQASPQREDTPFKGSSRDESTQ
                     PQYQKPYIIKEKAQFNASMDAQTGEIIMPAYSKYMLIEENHGNKSLIADQSQLYRDRS
                     TFTKHLIKCFCKITLKRASSKMGAPWAVKEEYLPMYGLTMEWPLEMIKYKEDDVSEST
                     KNKRDRSEEDIEDTLQNGSKNVEELGETNRDEVEEESSKRRKNDEPREESVTYENSAA
                     PAITSIVEDLVLPFQGPASIFDKLYCYNEFLESVPVNETSIKSFKNVEKLLQVFQFLT
                     TFGPKLYLSNFNLDQFITSIKCTDAHELKGEVVYVNCASTTKENANDDIPCSNWRRNA
                     HFRQLIESKNSEDIIYRVLKDEPASEEVIDNINHNGCGLLIEAFVAVLRLFINEEGDW
                     QVLVTGEWLSGPDNQEVPHKDKETSRTVDIDTEDSEYARKDENEIEEDEEEEQEKEKE
                     DDELSSALDNCLNYRNVNWAERLTKRQFNNGFWLIILMGIFDSCNHIPTYTNAMDNIT
                     KKLIPENISSSQLSKQLWRNFCKLSFEEKVTCLWILVDLVSNFSPDIKSAVDFSMDLC
                     GQIRSEKFKIAKDLKSELSTLNNLQATLNNLAEAETVDESAYSQLEEQLEAQKVKVDN
                     LQYDRSLLGKKLMENDFQRLKPLGIDRYGNKYHWLDLSGAVVPDIQEEANDNWRRQQQ
                     SQYHSGRIWIQGPNESTVRFLLNISYAELRKWVELAEREGSAFATKEVFHIYRACDGS
                     YKLISGSDEYEIVNKEQIANPLFELTPIQKKIIDETPQSLMLTDKTWYCLERIEDLRM
                     IMDWLDTWGRREHDLLRQFKGIEEYLESSFTIRERRLLSFSSDDAEEKLVKEFQENEL
                     TAEEIGFSKAELISSSTMTNDSNTSGNNDFVKHENELEKIAEEIMRLDDCSKTRKILD
                     RIEKLESRRDRLLDIKQAVESSMGPGERVQARTEKKRIRNIITRKLEKQSEILTDLLN
                     RRHFKAMEDVIEWKNDLAIRKWGTPLRKNASGNKKNNSPDTVHDKLQEIMNLTSRTKE
                     AATV"
     gene            <188021..>191566
                     /locus_tag="HG535_0B01030"
                     /db_xref="GeneID:59234726"
     mRNA            <188021..>191566
                     /locus_tag="HG535_0B01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286898.1"
                     /db_xref="GeneID:59234726"
     CDS             188021..191566
                     /locus_tag="HG535_0B01030"
                     /inference="similar to AA sequence:RefSeq:NP_015107.1"
                     /note="similar to Saccharomyces cerevisiae BMS1 (YPL217C);
                     ancestral locus Anc_6.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142793.1"
                     /db_xref="GeneID:59234726"
                     /translation="MSTMDQSNREHRKKKEKNPAKKKLHSQGMNAKAFAVSAPGKMAR
                     NMQRSSDVNERKLHVPMVDRTPDDDPPPIVVAVVGPPGTGKTVLIRSLVRRMTKTTLT
                     EINGPITVVSGKRRRLTIIECPANDLNSMIDVAKIADLVLLLIDGNFGFEMETMEFLN
                     IAQHHGMPRVLGVATHLDLFKSQSTLRASKKRLKHRFWTEVYEGAKLFYLSGVINGRY
                     PDREILNLSRFISVMKFRPLKWRNEHPYMLADRITDLTHPELIEKQGKQIDRKVALYG
                     YLHGTPLPSATGTKVHIAGVGDLSISQVERLPDPCPTPYYQQKLDDYEREKIKEQGSS
                     AASVTPRRRKRLDDKDKLIYAPMSDVGGVLVDKDAVYIDVGKRNEELSFVPGEERGEG
                     EKLVTGLQKADKNYAEIFEGVGLQLFSNDEVLHTGEEFDHEDIDEKLDQGRGTLRNPR
                     LYGESIQVEDADIENLASDNEKDELDAAEAVSEKINIDFGFNDGKMKADIDSEFELSD
                     HEGEGWERAISAKLSSRSNRRRNWDIGKLIYMDNISPNECLRKWKGKEDDNDNDEANS
                     DIEVENDKGDGADDFFKRKHEAESKIQDYEGDLEKFVPYFDTIEKLTQKWSTFSPIRD
                     RFIGAPKLQNVEVDEESSNNDDEELYGDFEDLEATSAEEINGMDQRISGDEGKSEDEG
                     QSEDEGSDGNDSFTNFEEEEQKELTLEEERELNASKKEKLHLQFEMEEGDNFKEDDPN
                     NEYDTWYELQKAKMAKQQDINNAEFQSMSPEQRQKIEGFKAGSYVRIVFDNIPMEFIE
                     NLDPHVPVIMGGLLPAELKFGIINSRLRRHRWHKKILKTNDPLVLSLGWRRFQSLPVY
                     TTSDSRTRTRMLKYTPEHTYCNAYFYGPLCSPNTPFCGVQIVANSDTGNGFRIAATGV
                     VEEIDASVEIVKKLKLVGFPYKIFKNTAFIKDMFSSAMEVARFEGAQIKTVSGIRGEI
                     KRALSKPEGHFRATFEDKILMSDVVILRSWYPVNVKRFYNPVTSMLLKDKTEWKGMRL
                     TGQIRAAQGIETPSNPDSAYKKVERVERHFNGLKVPKIIQKNLPFKSQIHQMKPQKKS
                     TYIAKRAVVLGGEEKKARAFMQNVLTLSRSKDEKKKAKKQDDRKERLKKLAKAEEEKS
                     HKDRQKKKEYFASQGKKRPSSSNEDNKSNSFKKRK"
     gene            complement(<191694..>192392)
                     /locus_tag="HG535_0B01040"
                     /db_xref="GeneID:59234727"
     mRNA            complement(join(<191694..192238,192368..>192392))
                     /locus_tag="HG535_0B01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286899.1"
                     /db_xref="GeneID:59234727"
     CDS             complement(join(191694..192238,192368..192392))
                     /locus_tag="HG535_0B01040"
                     /inference="similar to AA sequence:RefSeq:NP_015106.1"
                     /note="similar to Saccharomyces cerevisiae SAR1 (YPL218W);
                     ancestral locus Anc_6.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142794.1"
                     /db_xref="GeneID:59234727"
                     /translation="MVWDIFGWFRDVLASLGLWNKHGKLLFLGLDNAGKTTLLHMLKN
                     DRLATLQPTWHPTSEELVIGNIKFTTFDLGGHLQARRLWKDYFPEVNGIVFLVDAADP
                     ERFVESRVELDALFNIAELKNVPFVILGNKIDCENAVSEAELRSALGLMSTTGNARVE
                     GQRPVEVFMCSVVMRDGYAEAFQWLSQYI"
     gene            complement(<192667..>193998)
                     /locus_tag="HG535_0B01050"
                     /db_xref="GeneID:59234728"
     mRNA            complement(<192667..>193998)
                     /locus_tag="HG535_0B01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286900.1"
                     /db_xref="GeneID:59234728"
     CDS             complement(192667..193998)
                     /locus_tag="HG535_0B01050"
                     /inference="similar to AA sequence:RefSeq:NP_011381.1"
                     /note="similar to Saccharomyces cerevisiae PCL10 (YGL134W)
                     and PCL8 (YPL219W); ancestral locus Anc_6.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142795.1"
                     /db_xref="GeneID:59234728"
                     /translation="MDTLEVPLRTGFFQNSNFSELNDDSELLDSPPGNSAKKVRFQSS
                     KHDDETNDSGKYLNHEDDPLQGKKNVEDLLEYANQVNDYVAQNLDKINSFRSDLLNDG
                     SYVKPYSDVATQATNLSASMSNFELSDNEYDDHDTSTDMLSTGLVNDGSSALNKSEKV
                     LLETLPSTEISEIIDYGTDNDQISESSDSTLENSPISRPCDTMPIQLNKDIKNPIFNS
                     SEKVQPQTSQQPDKDNPKTSLIIADIKSSSDVPELSPVEGINILEDTIKCILQLSQND
                     IDKKKINDSCSSNDPTFNDDDPYDPNEYSNFFMKSAPTITYQQLISRIQAKCMFGSVV
                     YTTATFLLQTLLLTREGIEGPIILRQILNENEIHRLIIASVRIATKLLEDCVHSHQYF
                     CKVCGVSKRLLTRLEASLITCLKDDALIITSEKLAASIKVKDELIQTNFSH"
     gene            complement(<194966..>195619)
                     /locus_tag="HG535_0B01060"
                     /db_xref="GeneID:59234729"
     mRNA            complement(<194966..>195619)
                     /locus_tag="HG535_0B01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286901.1"
                     /db_xref="GeneID:59234729"
     CDS             complement(194966..195619)
                     /locus_tag="HG535_0B01060"
                     /inference="similar to AA sequence:RefSeq:NP_011380.3"
                     /note="similar to Saccharomyces cerevisiae RPL1B (YGL135W)
                     and RPL1A (YPL220W); ancestral locus Anc_6.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142796.1"
                     /db_xref="GeneID:59234729"
                     /translation="MSKISSTQIREHVQELLKYSNETKKRNFLETVELQVGLKNYDPQ
                     RDKRFSGALKLPVCPRPNLSLCIFGDAFDVDRAKSCGVDAMSVEDLKKLNKNKKLIKK
                     LAKKYSAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYSKVTDVRSTIKFQLK
                     KVLCLAVAIGNVEMDEDTLVNQILMSVNFLVSLLKKNWQNVGSLVIKSTMGPAYRLY"
     gene            <196308..>197264
                     /locus_tag="HG535_0B01070"
                     /db_xref="GeneID:59234730"
     mRNA            <196308..>197264
                     /locus_tag="HG535_0B01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286902.1"
                     /db_xref="GeneID:59234730"
     CDS             196308..197264
                     /locus_tag="HG535_0B01070"
                     /inference="similar to AA sequence:RefSeq:NP_011379.1"
                     /note="similar to Saccharomyces cerevisiae MRM2 (YGL136C);
                     ancestral locus Anc_6.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142797.1"
                     /db_xref="GeneID:59234730"
                     /translation="MALVREFAIRFSIGEFRGVHGQIRQIRCNSSSQNRWLKRQSNDY
                     YTREAKIRDLRSRAAFKLMEIDDKFRLFAKNGSQRVLDLGFAPGAWSQVAKDRIGFNG
                     VVLGVDILPCEPPSGVSSIQANILSKKTHELIRLFFFKHFELNHDDKLHPDKGYFQHM
                     LEEELTHKEDFRTYKEVFTTDTFDDSVAAEQSHKLPIDVIISDMYEPWIQTSGFWNNL
                     TNFPYYRMANTSGLAIRDHYQSIDLGDAALITAIDLLKPMGSFVCKLYTGKEDKLFEN
                     RLRKVFKKVSRIKPDACRTESKEIYFVGLGKRAKTNKIDVFS"
     gene            complement(<197440..>199602)
                     /locus_tag="HG535_0B01080"
                     /db_xref="GeneID:59234731"
     mRNA            complement(<197440..>199602)
                     /locus_tag="HG535_0B01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286903.1"
                     /db_xref="GeneID:59234731"
     CDS             complement(197440..199602)
                     /locus_tag="HG535_0B01080"
                     /inference="similar to AA sequence:RefSeq:NP_011378.1"
                     /note="similar to Saccharomyces cerevisiae SEC27
                     (YGL137W); ancestral locus Anc_6.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142798.1"
                     /db_xref="GeneID:59234731"
                     /translation="MSVAFNPKDPSTFASACLDCTVKVWSLGQPTPNFTLSTGQERGV
                     NYVDYYPLPDKPYIITSSDDLTIKVWDYQTKSCVATLEGHMSNVSYAVFHPTLPIIIS
                     GSEDGTLKIWNSSTYKLEKTLNLGLERSWCIATHPTGKKNYIAAGFDNGFTVLALGND
                     VPTLSLDPVGKLVWSGGKNAAASDIFTAVIRGNEQVEENEPIALQAKELGSVDVFPQN
                     LTHSLNGRFVAVVGDGEYVIYTALAWRNKSFGKCHDFAWGPDSSSFAIIDETGQVHYY
                     KNFKEVTSWSIPLTYGIEKIYPGALLGAKADGFAYFFDWETGNLVRRIDVNAKDIIWS
                     DNGELLMIINTEKDGNEEASAYSLFFNRALYDEAASEGNVDEEEGVEDAFDVLHEINE
                     SITSGKWVGDVFIFTTSTNRLNYVVGEKTYNLTHFSKEMYLLGYLARDNKVYLADRDI
                     HIYGYEISLDVLEFQTLTLRDELPEAMESILPNIESQEALLKIARFLEGQGYYEEALN
                     VSPDKEQKFDLSLKLGQLSLAQELLSDEDSDLKWRSLGDASLEKFNFKLAIEAYTKSH
                     DYESLFLLFSSFNDKKGLLSTAKDAESHGKYNLAFKAFWVAGDIDNTQRLLVKSERFS
                     EAAIFAATYGIKSDDVVEKWKDSLVSQGKKSIADRISVFENDNSRTEATLIDFEPNVN
                     GEAEEAFEESSEVIGEDENHSEVPETSQVNGSEGAEAQ"
     gene            <200550..>201908
                     /locus_tag="HG535_0B01090"
                     /db_xref="GeneID:59234732"
     mRNA            <200550..>201908
                     /locus_tag="HG535_0B01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286904.1"
                     /db_xref="GeneID:59234732"
     CDS             200550..201908
                     /locus_tag="HG535_0B01090"
                     /inference="similar to AA sequence:RefSeq:NP_011377.1"
                     /note="similar to Saccharomyces cerevisiae YGL138C;
                     ancestral locus Anc_6.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142799.1"
                     /db_xref="GeneID:59234732"
                     /translation="MPPFEIIFWILSLCIVASAFPFRVAEIKEAFEPQDMLCSSEFQE
                     IKGSYSKLFQGLTGVGLPKTTPDSSRKSYTGFKFIRSFNLQLPSLILNNSLKVVLCKS
                     GKVQWEFTRPLTQDIDWAKPMCFYTPGEKMPVRKGKKWSTWFKKEGSGIRSIYPVSLK
                     EQASNDLSHFNCYKLARRKKYTARKVSLFFPGSWVGGMFYCQITDEIKKNVIDSMDEN
                     LEFKDTNDFGICKIENSIPLFPLESDDYSKSWVVHERPKIRSFQNKLKGRFQVTKLIP
                     YLFTANNPFDVTNFMGSNLSIATITNNSWQRPLREQLLNTAQNSKNFPKASDQWYKEI
                     EVEEKYQMSTEELSKLDSLTDRTINRIAEIANGPNSTIKYFFSAANLGLSSNQNKKRL
                     KGFLRKIEARIWNRFSFQDKSIATISDNQWELRGMRNQWENLKIIPEKHNYTLLENKL
                     DR"
     gene            complement(<202074..>204425)
                     /locus_tag="HG535_0B01100"
                     /db_xref="GeneID:59234733"
     mRNA            complement(<202074..>204425)
                     /locus_tag="HG535_0B01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286905.1"
                     /db_xref="GeneID:59234733"
     CDS             complement(202074..204425)
                     /locus_tag="HG535_0B01100"
                     /inference="similar to AA sequence:RefSeq:NP_011376.3"
                     /note="similar to Saccharomyces cerevisiae FLC3 (YGL139W)
                     and FLC1 (YPL221W); ancestral locus Anc_6.241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142800.1"
                     /db_xref="GeneID:59234733"
                     /translation="MRLMILWWAVYSLMVPAAIAKRTLVATSLVTCMENSQLTASSFN
                     VTFNPDDRSLHYSLTMATQIDGNITAEVEVYAYGFRIITQNVDLCEVGWKQFCPLNPG
                     NVQVDSIQYVPQHYANQIPGIAYQVPDIDAYARVRVYNNQSENLACVQAFFSNGKTVS
                     QTGVKWATAVVAGIGLLLSALLSTFGNSTAASHISANTMSLFLYFQSVVVVSMEHVHR
                     VPPIAEAWAENLAWSMGLIRISFMQRIFRWYIESTGGNPSLYLTSRTVSLLTQRSLEY
                     LDYFGLVKRATNVLYGNSNVVIFRGIERLGYSSNIENTSIVATGFTFFILCGYVLAGF
                     IMACKYSIELSIRCGWMRNDRFLTFRQNWKTVLKGSLLRYIYIGFTQMLILSFWEFTK
                     RDSPAVIVIACFFIVLSLGLMLWAAYRTWYFATQSIQMHNNPAAYLYGDEVVLNKYGF
                     FYTMFNARRYWWNIAILSYIFVKAVFIAFAQASGKTQSLVVFIIDLVYFIALIYYKPY
                     LDKPTNIMSIFISTVTLVNSFLFMFFSDLFNQSYTVSAVMGWIFFIMNAAFSLILLLM
                     LLTFIGIIIFSKNPDSKFRPIRDDRTSFQRYNANDGTVNPKVANELMALGDVANDHDE
                     NWESHLYDQQMSAKVLDEEKSSMNNENSSSSTDKPTLSEKILRKFSLNRTKSKVERDS
                     NDESNDITRLTPDSDQLSNSPPKKYPGVTHIRQASDSQNGLINSYEQEESFKLNQPDI
                     MEDGKELPPKSISRMPERDISLDSMTNDQDPTQKTDILGSKFI"
     gene            complement(<204940..>207945)
                     /locus_tag="HG535_0B01110"
                     /db_xref="GeneID:59234734"
     mRNA            complement(<204940..>207945)
                     /locus_tag="HG535_0B01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286906.1"
                     /db_xref="GeneID:59234734"
     CDS             complement(204940..207945)
                     /locus_tag="HG535_0B01110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142801.1"
                     /db_xref="GeneID:59234734"
                     /translation="MLFSRCGDECVLRSFPCLSLEQSPSVVPLPGILYKITFGRSDAE
                     NILGYFKSSKHYQKHFLLADVKAWNKQNFDTANKETIESLETFGRTFDPPNDDKGLYI
                     CLIPAKSKDNHIGCISKVVGVLTEEKVVTISFKTFCRAIVKTPSSKPKCQVWSSELSL
                     DSVQRMVKSCGNEQMKRLIAEFIEVLGTTDNFINSFKKKYEILLDKTSGDHLLLLSPL
                     SNTLYFQLNKAQFNKAWSTLLGLITELTESMDEAPINANLMQILKLMDLTVTVLPTST
                     TQKLDFLSSFSLIERCEIFKTIMDDFKQVFKHLYSSTEYVQAHFSQASNLEKSRLIAN
                     QLKSLRFFIEDVKAQNRSRIPMAASKVKSMISIDGKERKSPPAQGDESDPEDDLSGDE
                     NDEMTTLRDFIKNLNKLGVHRDGIKLLRKDFKIFLSTNPQNAEYQVLRNYFDVVNDIP
                     FGKYTNRASINLEEARQKLDNDHFGLNSVKNRLIEYLCTLKLSEQLKKRGESRKSPIL
                     LLVGPPGVGKTSIAKSVADMLNLKFQRISLGGVHNEAEIRGHRRTYVGAMCGIIINAL
                     KKSGCMNPLILLDEVDKLLSTTGSGSGYGFKLNGDPGAALLEVLDPEQNNTFMDHYVG
                     FPVDLSQVLFLCTANDLAGISGPLLDRLEVIEIPGYTPEEKVKIGSKFLLPKQIRING
                     LDKCERCFTLSNQAWYSLVTEYVRESGVRNLERKLATIVRGKVVEYVKEEDHQRTNDQ
                     QIVTKNEMFKYLGFPLHPIATELLRNVKMAEKEGIVNGLSYSSDGTGNVLVFEIIKTG
                     SVDKSQGPVTTATGNLGTVLQESIDIGCSLVKSILRRGLIVGEDCQITNEFFSSKYHL
                     HVPMGAISKDGPSAGTAITLALMSLALRRPVDPLLCMTGEITLRGKILPIGGVKEKLL
                     GAQMYGMKRVLLPIANKQDVIQAVADSVAPFIEDKTSQDEISLVQEKMNLSVAYVSDI
                     YDVLRYAWPDITFHAEVPVEQNHQCLSKM"
     gene            complement(<208705..>210741)
                     /locus_tag="HG535_0B01120"
                     /db_xref="GeneID:59234735"
     mRNA            complement(<208705..>210741)
                     /locus_tag="HG535_0B01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286907.1"
                     /db_xref="GeneID:59234735"
     CDS             complement(208705..210741)
                     /locus_tag="HG535_0B01120"
                     /inference="similar to AA sequence:RefSeq:NP_015102.1"
                     /note="similar to Saccharomyces cerevisiae YPL222W;
                     ancestral locus Anc_6.242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142802.1"
                     /db_xref="GeneID:59234735"
                     /translation="MGECRHILKVLKESGRSRFIKELTPDALVPTIEKAIKIANEEEQ
                     NQNDDSESDQRLRDKAFHTPRTVSRGCHFAYTIPEKRPHYNTLLKSPSAHAALDLHMD
                     DSLEKLLSGENFYYSASRGIFPYSTVYAGFQFGEFAGQLGDGRVVNLFDVIDSTATLQ
                     TLELKGSGLTPFSRFADGKAVLRSSIREFIISEALYNIGIPSTRALQITLLPGTRAQR
                     GMISEPTAVVCRVAPSWLRLGSFDLFRWKPDLKGLLKLTDYTINEVFSHGKEFPKNLS
                     INIFKKDFFPYEDEAPRPINTIEGVTQYDLLFRHVARKNANCVAYWQAYGFLNGVLNT
                     DNVSIMGLSMDFGPFNFLDKYQPNYTPNHDDILGRYSYENQPAVIWWNIIQFAQSLSI
                     LIGAGKKHIGLVKSLQDTMGPLDKRVENEIVIRANDLTRAVNNEYKFIHLTKYAVLMS
                     KRLGIELNIPETFTNKEEIEKSVQIVEKFRNDVLEPLFTILKRTQIDYNNFFVNLQNF
                     KGGFIDISEDGINGLNTKFASIFFSIEQLKKLRNFYAGNRRPLTTDAGETRLITETYD
                     ELIKWANQCSNYIVDDDTRISIAKKHNPLFIPRSWILQEVIDDFMHNQKAKLMNADEE
                     VDTTLLQKLYLMSSNPFNPDRWDSSLKPEVEKRWANLNDIDDPSKFMQKNSCSS"
     gene            <211357..>213495
                     /locus_tag="HG535_0B01130"
                     /db_xref="GeneID:59234736"
     mRNA            <211357..>213495
                     /locus_tag="HG535_0B01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286908.1"
                     /db_xref="GeneID:59234736"
     CDS             211357..213495
                     /locus_tag="HG535_0B01130"
                     /inference="similar to AA sequence:RefSeq:NP_013895.1"
                     /note="similar to Saccharomyces cerevisiae HOT1 (YMR172W);
                     ancestral locus Anc_6.243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142803.1"
                     /db_xref="GeneID:59234736"
                     /translation="MTHMGQLLIGGPNTHITNGIGDGNGHANAVSRDRVDTHGIAVSG
                     IAPVSGADNTAESRIGLGGGRTQQDELAMSLNLALAPEQLSKSPTNTVTHQNANTVSA
                     VNTAANFNNTSAIPSPVINRSSNSIDGSNRSNNKSTGLSGLRTSIHSMASSASSPVVS
                     NDVGSNTMRMFQRMDEMSARLIAMEEMFHKLCKTIDQQSVTIEELKGLNSQLANDLSH
                     KIDHLSQAKEQSKDAADQDSFVTDLLNSITNVSSTYLRKIRSRTDVNKKTSSAEAMNE
                     SNQHFLPEYHHGQHYTGNNSNTDSKSNSLHAFEGKRPSNATFTLNPDGIKRRKKHEFM
                     AVDGNSNQAENHNTNGHSTHALNSSQNSGFNSNIPSGAQSYTDLNSINAFGTMSLPNL
                     TLENTGITPLLKYGVNGMHFPKVNENSNSVNNHTSSHEITDNNIPQQQNRLQQMDGVH
                     NKEQQHPQLDKLPKPVNFSVGLDPVRTGTEASINHAGIGNDVVLDEDDDEAGYQEDDD
                     DDNEEEDDGEDDDDDDENEEDEDDEDGDQDTPHEKKSQNKTPKKRKHNRDFGKSSHID
                     HRLAITDDKNIKAATPKNGKAILLKLDTETEGRSSVINKHRDINYTLLKAPSNVRTIW
                     EEYSVGIDGNPSIKGLEEKYGNKWRLNRNRKTFARRKRLYKFILNGTSKGKSADEMID
                     ILEERRFYKDDNGEVKRRTIGWLQQSLTGI"
     gene            <213945..>215471
                     /locus_tag="HG535_0B01140"
                     /db_xref="GeneID:59234737"
     mRNA            <213945..>215471
                     /locus_tag="HG535_0B01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286909.1"
                     /db_xref="GeneID:59234737"
     CDS             213945..215471
                     /locus_tag="HG535_0B01140"
                     /inference="similar to AA sequence:RefSeq:NP_013897.1"
                     /note="similar to Saccharomyces cerevisiae DDR48
                     (YMR173W); ancestral locus Anc_6.244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142804.1"
                     /db_xref="GeneID:59234737"
                     /translation="MGLFDKVKQYASSGDNNNSRDGNSQQGDFVDKIEGYAGKERVAQ
                     FQNKVGKDNFDKLESTVRDRFSKTSINDDDSKKNNSSSSGKNDSYGSGNNDSYGSGNN
                     DSYGSSNNDSYGSGNNDSYGSSKKNSSYGNNDDTGNTDSYGSSNTDSYGSGKKNSSYG
                     NDDSYGSGNTDSYGSSNNDSYGSSKKNSSYGNDDSYGSSKKDSSNSDSYGSNNDDSYG
                     SSKKNSSYGNDDNYGSSKNDSSNTDSYGSSKKNSSYGNDDSYGSSKNDSSNTDSYGSG
                     KKNSSYGNDDSYGSSNNDSSNTDSYGSSNNDSYGSSKKKSSYGNDDNYGSSNNDSSNT
                     DSYGSSNNDSYGSSKKKSSYGNDDSYGSSKNDSSNTDSYGSNNNDSYGSSNNDSYGSN
                     KNNSSNTDSYGSNNNDSYGSNNNDSYGSSNNDSYGSNKNNSSNTDSYGSNNNDSYGSN
                     NNDSYGSSKKNSSYGNDDNYGSSNNDSYGSNNNDSYGNSGSGSYGNDNNDSYGSGDRY
                     "
     gene            <216661..>217155
                     /locus_tag="HG535_0B01150"
                     /db_xref="GeneID:59234738"
     mRNA            <216661..>217155
                     /locus_tag="HG535_0B01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286910.1"
                     /db_xref="GeneID:59234738"
     CDS             216661..217155
                     /locus_tag="HG535_0B01150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142805.1"
                     /db_xref="GeneID:59234738"
                     /translation="MKQEPAPPQLRVLCRPLRAVFRRKGFFEKHSHLVPDRCRALRLP
                     EEKLWTAGTGSVFGPGPKSICKSKVSKLLHTVWSVRGGSRQAGTRHGRWRPAAGAICS
                     YQVYWGMIIHAFMHLHMLRRFLHVFFLVKETVKVKITGVYANRSLRCSGRVTGPRQQS
                     PFLL"
     gene            <218443..>222810
                     /locus_tag="HG535_0B01160"
                     /db_xref="GeneID:59234739"
     mRNA            <218443..>222810
                     /locus_tag="HG535_0B01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286911.1"
                     /db_xref="GeneID:59234739"
     CDS             218443..222810
                     /locus_tag="HG535_0B01160"
                     /inference="similar to AA sequence:RefSeq:NP_013901.1"
                     /note="similar to Saccharomyces cerevisiae ECM5 (YMR176W);
                     ancestral locus Anc_6.247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142806.1"
                     /db_xref="GeneID:59234739"
                     /translation="MHQSRPITKIVHLLNEQDDSDLSIQCQVPLSGSTLDMGNDKRSH
                     ALAANAAPRVSKKPPTSKGNNGQKVRTLGSELVSSKSESTTPFAKKSQASKSKSSGQF
                     DIERLRRTKITPGRNSSTLKVYHENSGLFYEISTNSVPVFKVLKSQVPDPIVFYESVK
                     DLGSQHGCVKLVFCDSNGAFQYEEKESCDKFGGNPDQFWFRAVTQFTGSLGANKQHMY
                     EFYRDLLNYHEMTKDEGQNFSRVPSINKRVLDLYRLFNCVRLRGGYEAVCQEKLWAQI
                     GRELGYSGRIMSSLSTSLRLAYVKVLLGYEQYLKNKNEKGPHEVAIPMIEQKQDDGFL
                     NQGADNEYIFEVAHSAAEYKVLRELSEVKGCTKHYSVESHGVCTDKHNHSLPRCESNA
                     WQVGLETYESNVFNSHCSPIYDLRQYYEKSERHIESLRTKYANSSSEFTSNFQEFEQP
                     NFERLFFEFLSSGKEPHFVDTGLGLEAAAHNFGSSFIPNNKDKYNAFKDQWNLENFPL
                     QENSLLRHLDLDFRNYTHTTVNVGMLFSVEGWHTNGNFLPSINYNHLGAAKLWYVVPS
                     TDMEKFELLVETINNKLHFENSQVSPPCIYDEKLKNSEFYKCYSESALLLHDEWVGPE
                     KSSRAAGKTTSQKSLPGDLLLHPKLLERHGIKWLTVTQESGTYIFTFPKAYTSNIASG
                     FCASENAFFAPHSWLCNNILEGSEWFYKNNMLPGILPFQFLLNITSYKDNTSFSRTAK
                     HILKQLAQEEIHYRSKVRKALNEKGCIKNKFDYISDISFKPAGGSKVVITDSLDTKTL
                     TCEEFLKMITESELEKLSACERKVLLQNSQLHIYCSDERIMSILSESDDLCNSNKYEG
                     EDSNDVLFKNLKALQKEGTVPLAILEGLSRKINPEIPWFAEFEELLFKVRALQQDCER
                     ILSSFTSSCQVDAFENLGNGLNLDEPQVGNGDLDLAFFHSIVHKIEESCVTFPSMFEV
                     LRRRGDVNAFEVKLKESLQSKTLVDLKYAYSLGRWLNVASKYLEPVVYWMCRNKWLES
                     YQTLLTSNSKHISVAYTIHDLHSFLKYGIKYCGAEQSEKLQKVKQIIVKSQNVINLIN
                     GILNHKHTGEFKLDDLKNVVQMAFEECLPVNQELTTTLVSILNAVNGAKDKLSPLLQM
                     IDVNRPFQFQLIEGIKKNSKDSLQLLTKFDGSTNDKRIAMSDVLSQKFFSDNIKACKN
                     WINKVNKIFTKSKREKLRNRLLSALDVKFDKYHKKDDSEPTENQEIYCFCRRGDIGGT
                     MIECEVCKEWYHTGCIAPHTWKLPQDSNSVFVCSVCSPRVCVSSASIDYSIIQNLFLE
                     SVKLKLAPDRQMLSDVSSIFESLFLFKIDMMERLSISEGQLAPDVTLNQAKHYLRKLI
                     KSNCRFASWDGVLEAFCQVKNVELNEDLKSRRLVILTGPESIMHANETSVASSTTSDV
                     PNTPEKAEDAERKIKIEKD"
     gene            <224329..>225831
                     /locus_tag="HG535_0B01170"
                     /db_xref="GeneID:59234740"
     mRNA            <224329..>225831
                     /locus_tag="HG535_0B01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286912.1"
                     /db_xref="GeneID:59234740"
     CDS             224329..225831
                     /locus_tag="HG535_0B01170"
                     /inference="similar to AA sequence:RefSeq:NP_013902.1"
                     /note="similar to Saccharomyces cerevisiae MMT1 (YMR177W)
                     and MMT2 (YPL224C); ancestral locus Anc_6.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142807.1"
                     /db_xref="GeneID:59234740"
                     /translation="MIRGGLGPRLSPSLSRLHAGSRIIGVIMFHSAVNKRQQKHKGAT
                     ERSIEVRLQENPNFKNLEDSFKEEHQHVHLRESETEENDQVITGKKRKLNSAAALSHT
                     HSHAGVNPMLVMSKEAVKKNPGVRITWIGLAINVGLAAGKFAGGIVFHSQALMADAVH
                     AASDMVSDFLTLVSVGLASNKPTSAYPFGYGKMETVGSLAVSGILAMAGLSIGWTSLC
                     EIVGPLLPHMIVEFYEGIVGVTHSHSASITKDVTDVNAAWIAGASIIVKEWIFHATKK
                     IATETNSNVLMANAWHHRVDSLTSLVALVTITSGYFFEIQSLDAVGGLLVSALVIKAG
                     GQGLNDAIKELIDKSLSSDDDRYVEVESTLKDVLGKLVSNSNSKEPYIIKDLVVLPSG
                     PNIRANVVLQTPLQRWGNVLDISEFEMVTDHIRYMLHKNIPGLKKLNIEFIEERTESD
                     EGHSDLHADVDHQSLEQDPHTYSHNHSPIHSHTHSHTHSHTHSDQHTHKH"
     gene            complement(<226037..>226483)
                     /locus_tag="HG535_0B01180"
                     /db_xref="GeneID:59234741"
     mRNA            complement(<226037..>226483)
                     /locus_tag="HG535_0B01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286913.1"
                     /db_xref="GeneID:59234741"
     CDS             complement(226037..226483)
                     /locus_tag="HG535_0B01180"
                     /inference="similar to AA sequence:RefSeq:NP_015099.1"
                     /note="similar to Saccharomyces cerevisiae YPL225W;
                     ancestral locus Anc_6.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142808.1"
                     /db_xref="GeneID:59234741"
                     /translation="MSLNTFDPEKADNLEDIERQFAVVAVEQAETYWGLLTKIPGSKL
                     RLTKLDDEIYETFMEHFPEYRDVERIKKFSEEELKTKEAKERWRQFCKVFETKVEDYN
                     FGTLLRTDASEEYGQHSTCFVVRIQFYAFEVARNKHKLNDWAAIKK"
     gene            <227479..>228336
                     /locus_tag="HG535_0B01190"
                     /db_xref="GeneID:59234742"
     mRNA            <227479..>228336
                     /locus_tag="HG535_0B01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286914.1"
                     /db_xref="GeneID:59234742"
     CDS             227479..228336
                     /locus_tag="HG535_0B01190"
                     /inference="similar to AA sequence:RefSeq:NP_013903.1"
                     /note="similar to Saccharomyces cerevisiae YMR178W;
                     ancestral locus Anc_6.250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142809.1"
                     /db_xref="GeneID:59234742"
                     /translation="MLQYKTPLKRLLKMSKVNAACVIIGDEVLNGKITDTNSKFFAKY
                     CYGMGIRLGEIVTIADDETQIVNTMRRISKDYQFIVTSGGIGPTHDDITYESVAKSFN
                     LPVKIDEECKTRMDRISHPEARLDAKGLKDCYRMVTMPSGSLVKNYYVADDLWVPICS
                     IDHKVYILPGIPQLFTRMLTSFTPTIRKIYDLKENDHEYIRFFIKTPQSESQISSYLR
                     DLQNEANTVSNEIKIGSYPHFGLGFNTVSILGTKDNEKFLKDISSRTVTALKGEQISA
                     EQEEEYSNP"
     gene            complement(<228448..>231948)
                     /locus_tag="HG535_0B01200"
                     /db_xref="GeneID:59234743"
     mRNA            complement(<228448..>231948)
                     /locus_tag="HG535_0B01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286915.1"
                     /db_xref="GeneID:59234743"
     CDS             complement(228448..231948)
                     /locus_tag="HG535_0B01200"
                     /inference="similar to AA sequence:RefSeq:NP_015098.1"
                     /note="similar to Saccharomyces cerevisiae NEW1 (YPL226W);
                     ancestral locus Anc_6.251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142810.1"
                     /db_xref="GeneID:59234743"
                     /translation="MPPKNFKDLNDFLNDQPQDPNLVASPFGGYFKNNNTNNYQKQRT
                     VNQGQQYRSSGSNFNSKQNYNYGSNYGQGYNYQQSSVTPDHSNTPTPSNSTTSLTSLN
                     ENMSNLQLSPISSILSQIPQCQTITDCKKQLDLAIEEFAKTDYSAINIESWKLLDIIA
                     KFTKPKNPPLVRESAMLLISKLGQTFTQKYPEEAYLLPLFDSALDSTADKENTVKRAA
                     QHAIDSLINCFPIESLTSAVLPVILKYLASGAKWQSKLQALAVVDRIREDSPNDLLEL
                     TFKDTVPVLTDVATDFKPELAKQGHQALLSYVSILDNLDLSPRFKLIVDTLQDPAKVP
                     QSVKALSGVTFVAEVTEPALSLLVPILNRSLNLSSSSQEQLRQTVIVVENLTRLVNNR
                     IEIESFIPQLLPGIQKVVDTASLPEVRELAEKALKVLKEDDEPAPAGQFSGRLTIEEG
                     REFLVKRLAKLPEDDLKFQLNDDIIINYFSKLLTVDANVNDWKRLQSYMIEVLGEDHE
                     EFVEKEFINDLRAIFHQEKVSYDESEGVEIVNTDFSLAYGSRMLLNKTTLRLLKGHRY
                     GLCGRNGAGKSTLMRSIANGQLEGFPDKNTLRTCFVEHKLQGEEGDLDLVSFIALDEQ
                     LQGTSREEISKALKSVGFDEERRNQTVGSLSGGWKMKLELARAMLQKADILLLDEPTN
                     HLDVANVKWLEDYLLENTNITSLIVSHDSGFLDAVCTDIIHYENKKLKYYKGNLEKFV
                     EQKPEAKAYYTLSDSNAQMRFPPPGILTGVKSNTRAVAKVSNVTFSYPGAAKPSLVGA
                     TCALSLSSRVAVLGPNGAGKSTLIKLLTGELVPQEGEVQKHPNLRIGYIAQHALQHVN
                     EHKEKTANQYLQWRYQFGDDREVLLKESRKISEDEKEMMAKEIDIGDGRGKRAIEAIV
                     GRQKLKRSFQYEVKWKWWKPKYNSWVPKDTLVAEGFEKLVQKFDDHEASREGLGYRQL
                     IPSVISKHFDDVGLDAEIANHTPLGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLD
                     RDSLGALAVAIRDWSGGVVMISHNNEFVGALCPEQWIVENGQLTQKGLKQIDQSRFED
                     GGNTDAVGLKNAKAPSPSVVDDDSPANIKVKKRVKRLTRNEKKAQAERRRLRYIEWLS
                     SPKGTPKPVNTDDEDEGDED"
     gene            <233502..>235661
                     /locus_tag="HG535_0B01210"
                     /db_xref="GeneID:59234744"
     mRNA            <233502..>235661
                     /locus_tag="HG535_0B01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286916.1"
                     /db_xref="GeneID:59234744"
     CDS             233502..235661
                     /locus_tag="HG535_0B01210"
                     /inference="similar to AA sequence:RefSeq:NP_013904.1"
                     /note="similar to Saccharomyces cerevisiae SPT21
                     (YMR179W); ancestral locus Anc_6.252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142811.1"
                     /db_xref="GeneID:59234744"
                     /translation="MTDVTKMALKILYSLDNGTTATYLARSKKQQCVRIATIPNPDST
                     LENDVGSFKIGAVELSFVLQEIYLNSPELLNHNISRSGHDYNLYYQDICELDEPLVSL
                     GLLSEIRQKMGKLSTQESYPYEDGEEEEPFIVTGRICSSFAALLKPSYKATGNNTQRK
                     HNTPSNDTLEVKLRFIRVVTNKNARRPSASISNVPMIPVPTAVVNQMHFKSSNGTNPT
                     QKMGRPARIITGSKRQTNPTPAPKAERTQSLPIWNPKQGSNHTGLPTNSIAHKIFLAD
                     RNTENLQAKSSHQQATTYQVSALQQDNTVQKFRVDDSVSKRFDFMLNKKKKNQNQPQQ
                     QRQQLESTKSSFLNTNKKYTTAAKARRCNTMAAIPLALGNSLPNLKTESKQQRSGSIS
                     SGVYKSIQEQESVFQQILSNSPTKQHNTPASAEDDKENLPPSIVPKDNIDLDLLNFSD
                     VGLKSDLDWFGNYDPFNSPSIIPEVPLEHALKPSSATPKDPNTCNTVDIENDGEDEEG
                     DKTPRINDNNDKVDALNDADRTSPIDTLSMPLMELNDRPSGRMVSCQEQLQRLPLLGN
                     QLKSTSFISRREVFKDELRGPSEEEIDNDEDATSVLMQFSSSYPDNSPSLKKSDSQRK
                     ITTSEYSSPLLKRHRDCDIQEACEDEEEQKDNFKKQRIMPSSPTMFNYPDDSSNHEDA
                     NDLFSSFMHGPQNENQDVDSTPDTRYENQSSDHIKNI"
     gene            <236073..>237089
                     /locus_tag="HG535_0B01220"
                     /db_xref="GeneID:59234745"
     mRNA            <236073..>237089
                     /locus_tag="HG535_0B01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286917.1"
                     /db_xref="GeneID:59234745"
     CDS             236073..237089
                     /locus_tag="HG535_0B01220"
                     /inference="similar to AA sequence:RefSeq:NP_015097.1"
                     /note="similar to Saccharomyces cerevisiae ALG5 (YPL227C);
                     ancestral locus Anc_6.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142812.1"
                     /db_xref="GeneID:59234745"
                     /translation="MTAGICWGYINDVNAFKLLATLVTVAVASMYSLVYLLSHTPREP
                     FSEELQSITVDENGDRLTTELVAVNSATHHASEGILLSVVVPSYNETGRILLMLTEAI
                     KYLESAFPQKWEIIIVDDGSRDGTTDYCLKQAHEQFKLRAGELRVIHFIKNRGKGGAV
                     RQGMLHIRGKYGLFADADGASKFSDVEKLLESVKKLEKNETGKDKAAVAIGSRAHMIN
                     TDAVVKRSVIRNFLMYGLHTLVFVFGIRSIKDTQCGFKLFNKAAIEQIFPYLHTEGWI
                     FDVEILMLAIRKLIPIVEVPISWHEVDGSKMELARDSINMAKDLVVIRMAYILGIYKD
                     YRKI"
     gene            complement(<237139..>238647)
                     /locus_tag="HG535_0B01230"
                     /db_xref="GeneID:59234746"
     mRNA            complement(<237139..>238647)
                     /locus_tag="HG535_0B01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286918.1"
                     /db_xref="GeneID:59234746"
     CDS             complement(237139..238647)
                     /locus_tag="HG535_0B01230"
                     /inference="similar to AA sequence:RefSeq:NP_013905.1"
                     /note="similar to Saccharomyces cerevisiae CTL1 (YMR180C)
                     and CET1 (YPL228W); ancestral locus Anc_6.254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142813.1"
                     /db_xref="GeneID:59234746"
                     /translation="MSTSEQSRQQPKRALSLDDLVNHDENPKVKSPNYGQNNESVSSL
                     NSSEIRRETSVNSINPNDFMGDETDTDDDVGMGGGGVNFDKDMTFDYDKQEGKSPQKD
                     ESKRATEQKNTLLAAPQEPKSSLIEKKNPSTSRKTSDAGTAASTNTFEPQGSENSVTT
                     IFDERASLKSRKNNLKKDLQILNEIAATSKPNKYKNVPIWAQKWRPTIKALQNIDKKD
                     FKIDNSFLNIIPDDDLTKSVQDWVYATIFSIPPDMRQLIEMEMKFGVIMDAKSPDRIN
                     PPVSSQAVFTELDTTMVPTIDPSVFEELKKYIRGLSEVSENRGKFSTIESHTKDSTYR
                     VGVATQRPRFLRMSTDIKTGRVGQFIEKRKIAHLLIYSPKDSYDVKISINLEIPVPEN
                     EPPEKYKSQTPLSERSKERVSYIHNDSCTRIDITKVEKSEHGRKGSSPEITHEIELEI
                     NTPALLKAFDSIATDSQVYASVIRTFLNNGTIIRRKLTSLSYAIFEGQKKGM"
     gene            <238975..>239442
                     /locus_tag="HG535_0B01240"
                     /db_xref="GeneID:59234747"
     mRNA            <238975..>239442
                     /locus_tag="HG535_0B01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286919.1"
                     /db_xref="GeneID:59234747"
     CDS             238975..239442
                     /locus_tag="HG535_0B01240"
                     /inference="similar to AA sequence:RefSeq:NP_011063.3"
                     /note="similar to Saccharomyces cerevisiae YER137C;
                     ancestral locus Anc_8.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142814.1"
                     /db_xref="GeneID:59234747"
                     /translation="MSRESRIGRNAEEDIRKISQAMDALAKLIIEKRQDGTQLQLEYQ
                     HKLERLNQVIELILGMRHNESETRYELDANHLDRLLRGNIEIVEKTVETLSTNSQAQA
                     ESYALIPIVKKSHASETSIHRKKKKKNKICCSFCNEPGHTRAKCEKKLLFSKE"
     gene            complement(<239501..>239865)
                     /locus_tag="HG535_0B01250"
                     /db_xref="GeneID:59234748"
     mRNA            complement(join(<239501..239734,239812..>239865))
                     /locus_tag="HG535_0B01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286920.1"
                     /db_xref="GeneID:59234748"
     CDS             complement(join(239501..239734,239812..239865))
                     /locus_tag="HG535_0B01250"
                     /inference="similar to AA sequence:RefSeq:NP_009527.1"
                     /note="similar to Saccharomyces cerevisiae LSM2 (YBL026W);
                     ancestral locus Anc_8.174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142815.1"
                     /db_xref="GeneID:59234748"
                     /translation="MLFFSFFKTLVDQEVTVELKNDIELKGTLKSVDQFLNLKLDNIS
                     CSDESKYPHFGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDAARREAMMEKK"
     gene            complement(<240052..>241500)
                     /locus_tag="HG535_0B01260"
                     /db_xref="GeneID:59234749"
     mRNA            complement(<240052..>241500)
                     /locus_tag="HG535_0B01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286921.1"
                     /db_xref="GeneID:59234749"
     CDS             complement(240052..241500)
                     /locus_tag="HG535_0B01260"
                     /inference="similar to AA sequence:RefSeq:NP_011062.1"
                     /note="similar to Saccharomyces cerevisiae GDI1 (YER136W);
                     ancestral locus Anc_8.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142816.1"
                     /db_xref="GeneID:59234749"
                     /translation="MNDDATDQDPDKTRWIRSCQNTFQTAITCQSKMDQETMDTDFDV
                     IVLGTGLTECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPISKEER
                     EAKFGRDRDWNVDLIPKFLMANGELTKILAHTDVTRYVDFKQVSGSYVFKQGKIYKVP
                     ANEMEAISSPLMGIFEKRRMKKFLEWISSYQEDELATHQGLDLDKNTMDEVYYKFGLG
                     NSTKEFIGHSMALWTNDDYLQQPARQSFERILLYCQSVARYGKSPYLYPLYGLGELPQ
                     GFARLSAIYGGTYMLDNPIDEVLYNEEGQFKGVKTKLGTFNAPLVIADPTYFPEKCKS
                     TGQRVIRAICILNHPVANTNNADSIQIIIPQSQVGRKNDIYIAVVSEAHNVCSKNHYL
                     AIISTIVETDKPHIELESAFKLLGPIEEKFMGIAELFEPKDDGSKDKVYLSRSYDASS
                     HFESMTDDVKDIYFRVTGHPFVLKPRDTNEDQ"
     gene            <241832..>243421
                     /locus_tag="HG535_0B01270"
                     /db_xref="GeneID:59234750"
     mRNA            <241832..>243421
                     /locus_tag="HG535_0B01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286922.1"
                     /db_xref="GeneID:59234750"
     CDS             241832..243421
                     /locus_tag="HG535_0B01270"
                     /inference="similar to AA sequence:RefSeq:NP_010346.3"
                     /note="similar to Saccharomyces cerevisiae YDR061W;
                     ancestral locus Anc_8.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142817.1"
                     /db_xref="GeneID:59234750"
                     /translation="MTAGQYIVHIKDALFRSSLMKKAKPVFKEKIKAFDIKSGEKWVI
                     WGPGKAKLMNILGNKYLCDPPLSLQYGKIKGRQLRIEQVLFKGVVPTAHLSARYEYFK
                     DDFDQNCKKFIINNAIGSNAVSYDVATSDRVVNMILYEKLVSELFLEDLQERWVMGLS
                     NGQMRRARLAYSLLKEPDLLLIDDPFLGLDPTAASIISNFLATYDESLTSVVIGMRYQ
                     DEIPPWCTHICHVKEEEGVVFQGSIETFHKEIISIKNEVEAASRTLKSNTFTIEDLIS
                     PHPWFGKSHHEIIKMPNCVELNYVDVKYKGEPVLKNLTWKVRPGSNWHIKGNNGTGKS
                     TLLSLLTAEHPQSWNSKIIENGAPRRSGKANYFDINKRIGMSAPELHAILLRNVGSKQ
                     TVREIISSGFHDASSNNFIPLWDNLDKNKRLLIDMLLTYFNMSTIADSIVFGQLTVSQ
                     QKLVMFIRSLVKMPEILILDEAFSGMEIEPMIRCHELLEEWPGTILAVSHVEEETPKC
                     DYTLRLIAPGQFEINDQNNNL"
     gene            <243846..>245543
                     /locus_tag="HG535_0B01280"
                     /db_xref="GeneID:59234751"
     mRNA            <243846..>245543
                     /locus_tag="HG535_0B01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286923.1"
                     /db_xref="GeneID:59234751"
     CDS             243846..245543
                     /locus_tag="HG535_0B01280"
                     /inference="similar to AA sequence:RefSeq:NP_010347.1"
                     /note="similar to Saccharomyces cerevisiae LCB2 (YDR062W);
                     ancestral locus Anc_8.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142818.1"
                     /db_xref="GeneID:59234751"
                     /translation="MSSTPATNIRVPMIPPDDLPRSVKQENEYGRLESEEHLYQVKPM
                     KRSNQMEKPIVDTPPYYISLITYLNYLILIILGHIHDFLGMKFQKDKHADVFEHDGLA
                     PWYSKFESFFARRMKKRIDDCFSRPATGVPGRFIRCIDRISHDLNNYFTYPGTTSMCL
                     NLSSYNYLGFAQSEGQCTDAAIKCVEEYGLHCGGPRTQIGSSNLHIQAEQLIARFVGK
                     DEAMLFSMGYGTNANFFNAFLDSKCLIISDELNHTSIRTGVRSSGAAVRAFKHNDMDE
                     LEKLIREQIVLGQPKTNRPWKKILIVVEGLYSMEGTLCNLPKLVELKKKYKCYLFVDE
                     AHSIGAMGPTGRGVCELFDINPKEVDFLMGTLTKSFGAAGGYIAADKWIMDRLRMDIT
                     TASYAESVPPPVLGQVISSLMTITGELNPGEGKERLQRIAFNSRYLRLGLQRLGFIVY
                     GCPDSPVIPMLLYCPSKMPAFSRMMLQRKIAVVIVAYPATPLIESRVRFCMSSALTKE
                     DLDYLLRHVSEVGDKLCLKLSSGKAGVPQDGIPPRWDVEDVIARTGEDCKDDRFFRV"
     gene            <245799..>246248
                     /locus_tag="HG535_0B01290"
                     /db_xref="GeneID:59234752"
     mRNA            <245799..>246248
                     /locus_tag="HG535_0B01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286924.1"
                     /db_xref="GeneID:59234752"
     CDS             245799..246248
                     /locus_tag="HG535_0B01290"
                     /inference="similar to AA sequence:RefSeq:NP_010348.1"
                     /note="similar to Saccharomyces cerevisiae YDR063W;
                     ancestral locus Anc_8.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142819.1"
                     /db_xref="GeneID:59234752"
                     /translation="MASLYHIGSATKQQIQKFRISTSRSEKIRFLPIKIEPKPSYEIV
                     IDEESLEELEDAEELSGLTDALPNNCPRFLLLAYPITKKDGIKQVPLVLLYWKPATVV
                     SPEWKMLYAGALEQVRSECAPRQLVEVSSGLEEEEDIEELQKQIEAN"
     gene            <246583..>247561
                     /locus_tag="HG535_0B01300"
                     /db_xref="GeneID:59234753"
     mRNA            join(<246583..246603,247127..>247561)
                     /locus_tag="HG535_0B01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286925.1"
                     /db_xref="GeneID:59234753"
     CDS             join(246583..246603,247127..247561)
                     /locus_tag="HG535_0B01300"
                     /inference="similar to AA sequence:RefSeq:NP_010349.3"
                     /note="similar to Saccharomyces cerevisiae RPS13
                     (YDR064W); ancestral locus Anc_8.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142820.1"
                     /db_xref="GeneID:59234753"
                     /translation="MGRLHSKGKGISSSAIPYSRNAPAWFKLSSEAVVEQIIKYARKG
                     LTPSQIGVLLRDAHGVTQAKVITGNKIMRILKSNGFAPEIPEDLYFLIKKAVSVRKHL
                     ERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN"
     gene            complement(247780..247853)
                     /locus_tag="HG535_0Btrna4V"
                     /db_xref="GeneID:59235350"
     tRNA            complement(247780..247853)
                     /locus_tag="HG535_0Btrna4V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59235350"
     gene            <248029..>249144
                     /locus_tag="HG535_0B01310"
                     /db_xref="GeneID:59234754"
     mRNA            <248029..>249144
                     /locus_tag="HG535_0B01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286926.1"
                     /db_xref="GeneID:59234754"
     CDS             248029..249144
                     /locus_tag="HG535_0B01310"
                     /inference="similar to AA sequence:RefSeq:NP_010350.3"
                     /note="similar to Saccharomyces cerevisiae YDR065W;
                     ancestral locus Anc_8.180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142821.1"
                     /db_xref="GeneID:59234754"
                     /translation="MVQNFGELASHRLYVLTLFRHTLRNANRYCYSVHLRNRIHKVVK
                     TVIWKHRFDKSSWTVYSLLKKLLFLNEQLTHGDVWAVWPMLTQFSKKKKPFHGSELAT
                     IVKQLKTDNPVSALRNIEEERQRHILARYINHQQGNNRLPHNIPEEYKVKLLLPMAMH
                     EDAMLRLLKIQHQLNKGVPKVFLTHTSAGSSRIWFVRSALNKSRAQSKALGVLLRAEK
                     KKSQKRLDALERCRQNAVWALEEAIWEQALEGDICSHRDVSRHLSELQNSVVERSHQT
                     DSDIEPTKLQMWLNPIKEVMNMLTNQQQEKMRFFRNYKDEVLVNGGRFKMWERKSHLM
                     HDRRVKRFKQLVKSELERVSPFLSGHDLPSLLNKYKF"
     gene            complement(<249218..>249919)
                     /locus_tag="HG535_0B01320"
                     /db_xref="GeneID:59234755"
     mRNA            complement(<249218..>249919)
                     /locus_tag="HG535_0B01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286927.1"
                     /db_xref="GeneID:59234755"
     CDS             complement(249218..249919)
                     /locus_tag="HG535_0B01320"
                     /inference="similar to AA sequence:RefSeq:NP_010351.1"
                     /note="similar to Saccharomyces cerevisiae YDR066C and
                     YER139C; ancestral locus Anc_8.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142822.1"
                     /db_xref="GeneID:59234755"
                     /translation="MRMSGIEEFQNVALGPFQKHRQLSIREAEIISLEIIELLCDSHC
                     KDEATLKYLARLITPATYQDLLDERNLNKKCGYPMCNRQPERLRDPFSIDYTTKRFLW
                     ENNPYAYLSIYCSKFHFRCSQFYEVQLSDEALFARTGVHLVHNSPQEKKEIDEKYRIE
                     LFEELLRQKASEDDIKSLIAGLRKLGINNGANQEHKDDDQEMEEDLSKWLAEINIIEN
                     DKPSILGDLTKDDDE"
     gene            <250053..>251810
                     /locus_tag="HG535_0B01330"
                     /db_xref="GeneID:59234756"
     mRNA            <250053..>251810
                     /locus_tag="HG535_0B01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286928.1"
                     /db_xref="GeneID:59234756"
     CDS             250053..251810
                     /locus_tag="HG535_0B01330"
                     /inference="similar to AA sequence:RefSeq:NP_011067.3"
                     /note="similar to Saccharomyces cerevisiae YER140W;
                     ancestral locus Anc_8.182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142823.1"
                     /db_xref="GeneID:59234756"
                     /translation="MEAKHNIKVGYQYFKSTLCGGSRDTMCANEAKSKCNDQHALKND
                     KTERHRRNTRSRIRQRWNQFRDYVRQETYEIFSNRNCEGTFDPAEVSSVDYELEKLIN
                     MTRIPFLLERLMFWALLACLDCFLYYFTIMPLRLIHGLIFRFKKGRALKLSTSHNERI
                     MGFLIIVACFILSKLDTSKAYHRIKRQSSVKLYMLFGVLEMSDKMLASIGQSLLSVLL
                     ASKSAKRTNYQRILLLGTSVLYLVCHGFVMVYQTVALNVAVNSYSNALITLLLSLQFA
                     EIKASLFKRTDKEGLFQLTIADLVERSQLILLLIIIAIRNLVAKSKSQSNLVPNSWAL
                     NATSSVIIGALCGPMFTVLGSELVVDWIKHAYVTKFNRIRPEIYHKFLYIMCEDHSVS
                     LQKFRERLGLPIPAYVILFIVMVKPTLSQVMDKSSITSIAQNFLVMLLGFICLMIFKI
                     VLHIIVLKWGQELRFGGHASTSLIEKDYVPGDVGAGSAKIDHRARCVINHDSDSNIHG
                     SEKKASSANLISPSSASSPSIYQKQTVSTRLQATPFDVPTEKESHRDGSESRKVNSLK
                     NRFGLGNVSRYKMVSKRIW"
     gene            <253159..>254601
                     /locus_tag="HG535_0B01340"
                     /db_xref="GeneID:59234757"
     mRNA            <253159..>254601
                     /locus_tag="HG535_0B01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286929.1"
                     /db_xref="GeneID:59234757"
     CDS             253159..254601
                     /locus_tag="HG535_0B01340"
                     /inference="similar to AA sequence:RefSeq:NP_011068.1"
                     /note="similar to Saccharomyces cerevisiae COX15
                     (YER141W); ancestral locus Anc_8.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142824.1"
                     /db_xref="GeneID:59234757"
                     /translation="MIFKSLLAGTGAKLLTKSSYTISRNALCNLRRFATQRPKGINIL
                     RNSVCQRSLVRPFSASSMIKQAEAVSVPKTLLNSSNVVGYWLIGTSGLVFGIVVLGGL
                     TRLTESGLSITEWKPVTGALPPMNQADWEEEFRKYKESPEFKQLNSHIDLDEFKFIFF
                     MEWIHRLWGRAIGAVFLLPAVYFAATRKTSGHVNRRLFGLSLLLGLQGFVGWWMVKSG
                     LDPAQLEERKSKPTVSQYRLTAHLGMAFLLYMGMIFTGFEILKENKWMKNPAKALELF
                     KMTDSPSLGPLRKISVAVLALTFVTAMSGGMVAGLDAGWIYNTFPKMGENWFPSSREL
                     MDPQFARKEDNSDIWWRNMLENPTTVQLNHRILAITTFCSVFALHMYCSRHKSIIPKS
                     ADRTVKAMMGLVTIQAGLGIATLVYLVPISLASLHQAGSLALFTSAIIFVAQLKKVRI
                     PTKILISGLYVQQLKKSGSKIITEASKLAK"
     gene            complement(<254711..>255721)
                     /locus_tag="HG535_0B01350"
                     /db_xref="GeneID:59234758"
     mRNA            complement(<254711..>255721)
                     /locus_tag="HG535_0B01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286930.1"
                     /db_xref="GeneID:59234758"
     CDS             complement(254711..255721)
                     /locus_tag="HG535_0B01350"
                     /inference="similar to AA sequence:RefSeq:NP_011069.1"
                     /note="similar to Saccharomyces cerevisiae MAG1 (YER142C);
                     ancestral locus Anc_8.184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142825.1"
                     /db_xref="GeneID:59234758"
                     /translation="MTVLLGGLINKVALRIQKNIRDCTRSVSRKCQRTNFTAELKAMK
                     RKLEENEDSTNTIKEEGTDRVSNTVSIIPEEFREKHIKEFGDACDHILKIDGDLLDAI
                     TQNDFPLFLKKDQVPKDTDHYFTKLASAILAQQISGAAAKSIKKRFMDHFGGEFPSAM
                     DVHHELSDTERRQEIRACGLSGRKMIYLESLTDYFVNHAEEILSLFETKGNDDEVIQE
                     LTENIKGIGKWSAKMFLVTGLERMDIFASEDLGIARGCSNYLGTRPWLVKELIKNRIS
                     VKRSKIKHKKLNWKIYDDDLVEACADRFSPYRTVLMFILWRLSSTNVDAMAKNEADFS
                     NK"
     gene            <255756..>257018
                     /locus_tag="HG535_0B01360"
                     /db_xref="GeneID:59234759"
     mRNA            <255756..>257018
                     /locus_tag="HG535_0B01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286931.1"
                     /db_xref="GeneID:59234759"
     CDS             255756..257018
                     /locus_tag="HG535_0B01360"
                     /inference="similar to AA sequence:RefSeq:NP_011070.3"
                     /note="similar to Saccharomyces cerevisiae DDI1 (YER143W);
                     ancestral locus Anc_8.185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142826.1"
                     /db_xref="GeneID:59234759"
                     /translation="MFLSVSNEVNDQVFGPIEVSGDMTLPDLVALLELDCQFDDVKHD
                     LYYNMNKLDLLAGSTLNEIFDSDNDLLQIRNKIGVSVAEGSDDAFVEHFRQEMLRNQA
                     LRSQLMMQIPGLKQSLNDRQLFRERFGPLILQRKSSMNVHGNSQNPFGISQLEYSRIM
                     SDPDDPSNQKRINELINRQEIEEQFQNAWEYTPEVFTTIHMLYISIEINGHPVKAFVD
                     TGAQMTIISTRLAEETGLTRLIDKRFIGEARGVGTSKILGRIHQAQIKIETQYIPCTL
                     TVLDTHVDILFGLDMLRRHGAIIDLKKDVLKIAGVETKFLGEAEIPRELMEDLEGSSS
                     EKSKIVTGKPLPSFGQRFSGSAEQSPSDSTKRREVTKSSVLPEKPVAYSEQTIKQLMD
                     LGFSRSEVIKALDQTNGNVDFAASILFQ"
     gene            complement(<257090..>257737)
                     /locus_tag="HG535_0B01370"
                     /db_xref="GeneID:59234760"
     mRNA            complement(<257090..>257737)
                     /locus_tag="HG535_0B01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286932.1"
                     /db_xref="GeneID:59234760"
     CDS             complement(257090..257737)
                     /locus_tag="HG535_0B01370"
                     /inference="similar to AA sequence:RefSeq:NP_010352.1"
                     /note="similar to Saccharomyces cerevisiae YDR067C;
                     ancestral locus Anc_8.186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142827.1"
                     /db_xref="GeneID:59234760"
                     /translation="MSLVTPLHFSFVQPNFYRGSYPREINFPFLRTLNLKYILSLTPD
                     PLDKDLGISKFCTENGIKMIHIECSKETKDKTKPKVKRKKKTVPIEYGVLHECIKFLI
                     DGRNYPCYMHCMNGELVTSLVVACLRKFSYWGTVSILNEFLAYNSSINIHERSFIEDF
                     NSEIEIDGLLLQDKVPWIAIQHVASQKQDECKKEIEITKVSSSKNMLPKLKFHSL"
     gene            <257942..>258859
                     /locus_tag="HG535_0B01380"
                     /db_xref="GeneID:59234761"
     mRNA            <257942..>258859
                     /locus_tag="HG535_0B01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286933.1"
                     /db_xref="GeneID:59234761"
     CDS             257942..258859
                     /locus_tag="HG535_0B01380"
                     /inference="similar to AA sequence:RefSeq:NP_010353.3"
                     /note="similar to Saccharomyces cerevisiae DOS2 (YDR068W);
                     ancestral locus Anc_8.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142828.1"
                     /db_xref="GeneID:59234761"
                     /translation="MDFFYDEQAVANEEDSAHQQDEKTVQAFNKLEDEVAQGYVRTTE
                     ALRSFVQESDGGVQLNLKLNPDVSEKAQQYLEQLDANLHNVESLAQDYWTQVAKPGFW
                     SSVTAKLGTKLDEVVNLGEENLKNTAELTKHNTIGGNRTEAELRALSTDKNVYLNSKS
                     EVDKEIDVDAKTDEIAKLVEQDKDLANLMNEIVPQDISYTAFWTTFFTERQRILDMED
                     KRKKILEANSLLKEEEVGWDDVEDEVAEDEAAEDEEPVLVKKEDTDSSENIYNDVTPI
                     PTTKDSKQVQEEDRQENVNADADDDDDWE"
     gene            complement(<258950..>261580)
                     /locus_tag="HG535_0B01390"
                     /db_xref="GeneID:59234762"
     mRNA            complement(<258950..>261580)
                     /locus_tag="HG535_0B01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286934.1"
                     /db_xref="GeneID:59234762"
     CDS             complement(258950..261580)
                     /locus_tag="HG535_0B01390"
                     /inference="similar to AA sequence:RefSeq:NP_010354.3"
                     /note="similar to Saccharomyces cerevisiae DOA4 (YDR069C)
                     and UBP5 (YER144C); ancestral locus Anc_8.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142829.1"
                     /db_xref="GeneID:59234762"
                     /translation="MTEMKTEPIKKYCKGIPTLSRLAEKFVFQEDDFHNRSNDMMTVL
                     QHCLDTLEAYRDVYKKLKMERDGLTESELFEIYEAAYIYYKIVHINILNKLPNLQEFQ
                     TVKRQSNSNDQKLMEIYNMLVKSLLNDDKIAQIKHFLREHCGPESSGAATIDNGIEKD
                     SKTFDSGTFISVDQLKHLLFHYNDSTLLLDIRPRAEFNKKHINFKNIVCIEPISFKSD
                     YTDIDVEKRSLITSPQKEIDLFRNRTDFEFIVLYTSEPDERNKSNHNYQQEMVLLDLF
                     MNRSFGKPLRADSKIFVLKAGISNWISNNGDCITEIDDKSGDQLYLNGRNSTLRFQSL
                     PDHSPSISASMDGSMKEMLSESPNNGFSAFQRHQQQPPPAGFKNMFSSSLTSLSSKLP
                     CKTSIIDHSSGSDSDVFTHYPETPHLLAEEKGKKRIVNHGHISPISSRALTSISKHSI
                     SAQPPRIYTNNKGFLNQNTSLTSSATISKPPTQPIPLLPQLPMQDSSKSHTTQHTEKY
                     DLDFTVGLENMGNSCYISCIVQCLLGTHELTNIFLNNSYEKHINLNSRLGSKGVLAKF
                     FARLIHTMHQQGAFKLKEKGKAVKPIQFKMACGSINSLFKGSGQQDCQEFCQFLLDGL
                     HEDLNQCGNNPPLKELSPDAEKMRERLSMRIASSIEWERFLTTDFSVIVDLFQGQYAS
                     QLCCKVCGLTSTTYQPFTVLSVPVPHVKSCTIEDCFNEFTKTEELETDEQWSCSTCKK
                     KQPSTKKLTITRLPRNLVIHLKRFDNMLNKNNVFVEYPFLLDLTSYWASDFDGRLPPG
                     VTDELPTRGQIPPFTYKLYAVASHSGSLYGGHYTAYVDKGINRGWYYFDDTNCRPVRT
                     KTECITSNAYVLFYHRVYGI"
     gene            complement(<262103..>262381)
                     /locus_tag="HG535_0B01400"
                     /db_xref="GeneID:59234763"
     mRNA            complement(<262103..>262381)
                     /locus_tag="HG535_0B01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286935.1"
                     /db_xref="GeneID:59234763"
     CDS             complement(262103..262381)
                     /locus_tag="HG535_0B01400"
                     /inference="similar to AA sequence:RefSeq:NP_010355.1"
                     /note="similar to Saccharomyces cerevisiae YDR070C;
                     ancestral locus Anc_8.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142830.1"
                     /db_xref="GeneID:59234763"
                     /translation="MFLQGAKVCTRSVPISAGLRAFGSSPCAGFPGRKVHQDAAEQKE
                     QKLFDKNKAKLEKMEHHEGSDKRDSRSKLKKRGDDARIEQNRPDDGVY"
     gene            complement(<262735..>263331)
                     /locus_tag="HG535_0B01410"
                     /db_xref="GeneID:59234764"
     mRNA            complement(<262735..>263331)
                     /locus_tag="HG535_0B01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286936.1"
                     /db_xref="GeneID:59234764"
     CDS             complement(262735..263331)
                     /locus_tag="HG535_0B01410"
                     /inference="similar to AA sequence:RefSeq:NP_010356.1"
                     /note="similar to Saccharomyces cerevisiae PAA1 (YDR071C);
                     ancestral locus Anc_8.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142831.1"
                     /db_xref="GeneID:59234764"
                     /translation="MVSSTLPLHMYIRPLIVEDAKQVSMLETQGFPQNERASPEIINY
                     RLTACPELCSGLLIREFDEDTKEVKQENLIGHILGTKIPKNTSNPNKTFITLESMGKA
                     HSEPSDTIGIHSLVISPNYQKKNLATLLLTDHIQKLSNQEVGKKIVIIAHEPLVPFYE
                     RVGFKVAGENKDVAKDAQFASTKWLDMVRELVKEEYEN"
     gene            complement(<263633..>264820)
                     /locus_tag="HG535_0B01420"
                     /db_xref="GeneID:59234765"
     mRNA            complement(<263633..>264820)
                     /locus_tag="HG535_0B01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286937.1"
                     /db_xref="GeneID:59234765"
     CDS             complement(263633..264820)
                     /locus_tag="HG535_0B01420"
                     /inference="similar to AA sequence:RefSeq:NP_011072.1"
                     /note="similar to Saccharomyces cerevisiae FTR1 (YER145C);
                     ancestral locus Anc_8.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142832.1"
                     /db_xref="GeneID:59234765"
                     /translation="MSSAERVFNVGVFFVVFRECLEAVVVVSVLLSFLRQAIGSKDWA
                     LYKRLRLQVWIGVVAGFIICLGIGGGFIGAYYRYNNDIFGSAEDLWEGVFCMIATIMI
                     SMMGIPMLRMNKMQAKWRVKIARSLVEKPKSRRGYFNIGFLARRYVMFLLPFITVLRE
                     GLEAVVFVAGAGITTTGSRATAYPLPVFVGLVAGIFVGLLLYYGASRSSLQIFLIIST
                     CILYLISAGLFSRGAWYFESYIFNKKSGGDASESGDGNGSYNIRKAVYHVNCCNPELD
                     NGWDIFNALLGWQNTGYLSSMLCYNIYWLVLMIVLGLMMFEEKKGHLPFCEKLRLREL
                     NPMYWIKNKKKNEITEEQKAELFRKLNNLEFDGEGNIKHDDENSSSNDKVVQSYENTA
                     AKV"
     gene            <265635..>265892
                     /locus_tag="HG535_0B01430"
                     /db_xref="GeneID:59234766"
     mRNA            <265635..>265892
                     /locus_tag="HG535_0B01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286938.1"
                     /db_xref="GeneID:59234766"
     CDS             265635..265892
                     /locus_tag="HG535_0B01430"
                     /inference="similar to AA sequence:RefSeq:NP_011073.1"
                     /note="similar to Saccharomyces cerevisiae LSM5 (YER146W);
                     ancestral locus Anc_8.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142833.1"
                     /db_xref="GeneID:59234766"
                     /translation="MSVEVVPLEIIDKTINQKVWIILQSNREFTGTLVGFDDFVNVIL
                     EDAVEWANGSASNELEKVMEHHGRLLLSGNNIAMLVPGGKP"
     gene            <266072..>266557
                     /locus_tag="HG535_0B01440"
                     /db_xref="GeneID:59234767"
     mRNA            <266072..>266557
                     /locus_tag="HG535_0B01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286939.1"
                     /db_xref="GeneID:59234767"
     CDS             266072..266557
                     /locus_tag="HG535_0B01440"
                     /inference="similar to AA sequence:RefSeq:NP_010358.3"
                     /note="similar to Saccharomyces cerevisiae SNF11
                     (YDR073W); ancestral locus Anc_8.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142834.1"
                     /db_xref="GeneID:59234767"
                     /translation="MDSNVQSQHQNQQGVPLQGQDLGQGQRQGPGPGLYANAAGSVGM
                     NGAQEASSEPTEEEQVQYKIQLLLHINSILLARVIQMTQNKNAETGGTASLPDNLKLL
                     ASQYLKRVHANLQCISQVNQGIKKAKPIILEPPQPLVQQPAQDILVKLYLLMSRVFEI
                     W"
     gene            <266943..>269780
                     /locus_tag="HG535_0B01450"
                     /db_xref="GeneID:59234768"
     mRNA            <266943..>269780
                     /locus_tag="HG535_0B01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286940.1"
                     /db_xref="GeneID:59234768"
     CDS             266943..269780
                     /locus_tag="HG535_0B01450"
                     /inference="similar to AA sequence:RefSeq:NP_010359.1"
                     /note="similar to Saccharomyces cerevisiae TPS2 (YDR074W);
                     ancestral locus Anc_8.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142835.1"
                     /db_xref="GeneID:59234768"
                     /translation="MTVDSKASLSDEPKDVEWPKKQRIINCVTQLPYSIQLGEKNDDW
                     KVSPATGNSALYSSLDYLNTYKKCEQYEQHIVGWTGEIKRENETPFKLSNTVTGHTGT
                     EMKNKTDDIDDDPLYLTKSQMEKLTAKLKEKNFSDDDQINQKNVHVHPVWLLRRDQKR
                     WRNYAENVLWPTFHYILKFSTEGGDKENRWWYDYVKFNEAYAMKISEIYQPGDIIWVH
                     DYYLLLLPQLLRMRFNDEHLVIAYFHHSPWPSNEYFRVLPRRKEILDGLVGANRICFQ
                     NEGFARHFVSSCKRLLEATAKKSRNSLGIDSYQIGAYGGDVIVDSLPVGVNTEALVRD
                     AFTRNIDEKVLAIKDAYEGKKIIVGRDRLDAVRGVVQKLRAFETFLAMYPEWRDQVVL
                     IQVSSPTANRSSQQSIRLEQQVNELVNSINSQYGSLDFSPVQHYYMRIPKDVYLSLLR
                     VADLCIITSVRDGMNTTALEYVTIKSHNSNYDCYGNPLILSEFSGSSTVLKDAMIINP
                     WDSVAVAKSIKKALQLTSNEKKVLEDMLRAEVPTIQDWTDKFLSSLKRLTDYTLPSSK
                     KITPALNRPILLENYKQAKRRLFLFDYDGTLTPIVQDPAAAIPSARLIGILQKLAADP
                     KNQIWIISGRDQKFLSKWLGGKFPQIGLSAEHGCFVKDVNCENWVNLTEKYDMSWQKK
                     VGEIMESFTNRTPGSFIERKKVALTWHYRCTVPELGEFHAKQLKEELSAFASGSDLEV
                     MEGKANLEVRPKFVNKGEIVKRLIWHKHGTPQDMLATKREELERDQMPDFTLCLGDDF
                     TDEDMFTQMNAIEEVWNKKYPDEKNRWGNFGFYPCTVGSASKSTVAKAHLTDPQQVLD
                     TLGLLVGNVSLFQSAGTVDLDSRGHVINSESSLKSEQASADYAMKRQTSNSALKRESS
                     SSSMKRELSNSSFKREISNTFLQRESSYDSK"
     gene            complement(<269906..>271819)
                     /locus_tag="HG535_0B01460"
                     /db_xref="GeneID:59234769"
     mRNA            complement(<269906..>271819)
                     /locus_tag="HG535_0B01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286941.1"
                     /db_xref="GeneID:59234769"
     CDS             complement(269906..271819)
                     /locus_tag="HG535_0B01460"
                     /inference="similar to AA sequence:RefSeq:NP_011074.3"
                     /note="similar to Saccharomyces cerevisiae SCC4 (YER147C);
                     ancestral locus Anc_8.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142836.1"
                     /db_xref="GeneID:59234769"
                     /translation="MALPELSFEVLGQLSKEYLDHAHRVAGDIKDEDQLKDYFKLVSM
                     SVQCLQYLKTNYPLSIAQDAEITYQLVEVLLEETLNFDLAEAYLSSIRERLQNHHGSY
                     SNWSVLHEKMKFEFLTLYVLPMKRDDKFHYRIALKNCDEVVHFLAEWKYDKNVTGSWL
                     LIFQYVNIRLNIKLNNVKRALSQFQEMTVVGKGSTEWKSFIILCHVNFYLNQRLIIPS
                     YLLKALGSLSCDQVGAKLYGWKLMLELIIQIYKDSDITGNLNEFKEFFAEQKDALKDD
                     QDSVTLEIGPSVHMHIQLSSVFQYKHLKNVLLLLQSVSYLVNCYAKRANFSTKFLPKV
                     SLTTKKLISSVTQSGPHSLSFYDSRIEWYRTIQQFSEFYQKWEGLLLTGQIKDTRGNT
                     FLTQDYAALLSVISHQIGSMKDGSQICDSYNEIISRNRTSNEVRMVALLNAYIIRVSL
                     MSGSVQKQEQLIHCNSLWLQITNTLEQTDLHLNPTWDCTVVVIWLISHFESFTAYPLP
                     VSDDERSSYIERFKVYYEKNKFEGNEVDNDLNDSGVKKLKKSLLMQILLNYVGGRLFE
                     QDLTVISQISGICFRLARQQKFLILEYVVGLWHLMNCTVAMKRKEVVLVTATLDSIVK
                     KLSAGEQSSEPAS"
     gene            <272100..>272813
                     /locus_tag="HG535_0B01470"
                     /db_xref="GeneID:59234770"
     mRNA            <272100..>272813
                     /locus_tag="HG535_0B01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286942.1"
                     /db_xref="GeneID:59234770"
     CDS             272100..272813
                     /locus_tag="HG535_0B01470"
                     /inference="similar to AA sequence:RefSeq:NP_011075.3"
                     /note="similar to Saccharomyces cerevisiae SPT15
                     (YER148W); ancestral locus Anc_8.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142837.1"
                     /db_xref="GeneID:59234770"
                     /translation="MSEQERLQEFQNANKIVFDQNTRQVWESQEKNDIDNSNAKDIAV
                     KSQQEDESDDSATSGIVPTLQNIVATVNLGCRLDLKTVALHARNAEYNPKRFAAVIMR
                     IREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGS
                     CDVKFPIRLEGLAFSHGPFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQRG
                     EIYQAFEAIYPVLSEFRKI"
     gene            complement(<272910..>274079)
                     /locus_tag="HG535_0B01480"
                     /db_xref="GeneID:59234771"
     mRNA            complement(<272910..>274079)
                     /locus_tag="HG535_0B01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286943.1"
                     /db_xref="GeneID:59234771"
     CDS             complement(272910..274079)
                     /locus_tag="HG535_0B01480"
                     /inference="similar to AA sequence:RefSeq:NP_011076.1"
                     /note="similar to Saccharomyces cerevisiae PEA2 (YER149C);
                     ancestral locus Anc_8.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142838.1"
                     /db_xref="GeneID:59234771"
                     /translation="MIDDLKGLELMERANPWLFSEDSYEEYPTKYEDLKQYLSNDLDT
                     NLPYRNSRPYTHVDYLDFLLYKKDQNGSLIDVDKKLLCEYALYQVQSHQRNGKLKDVS
                     AKTLQQLLDIQPQSAEWYESLLVLLESTNATKVDAPLFDIGKTSTKKNPNSKGLQRSN
                     TTIRTNGALQELTSFVLSNAVKKGVELQPVNMDSPVEFLKNAIDSLTNYSQNDNGKQS
                     NMENDATGIYTQKKELETAFEDLQLAHSFLTKQFEKDRAEHIQNVEQLQNTNKELHQK
                     ILECHSNLSQSETKLQEMDIEVKRLKESSSLENDFVRNIDLSSPVPSPINLLNPESPT
                     LSNGNGHSFSIMKMEFKRMLAESQRKYEREIQEERESRMHVEKELEAFKKKTGMK"
     gene            <274223..>275203
                     /locus_tag="HG535_0B01490"
                     /db_xref="GeneID:59234772"
     mRNA            <274223..>275203
                     /locus_tag="HG535_0B01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286944.1"
                     /db_xref="GeneID:59234772"
     CDS             274223..275203
                     /locus_tag="HG535_0B01490"
                     /inference="similar to AA sequence:RefSeq:NP_010360.1"
                     /note="similar to Saccharomyces cerevisiae PPH3 (YDR075W);
                     ancestral locus Anc_8.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142839.1"
                     /db_xref="GeneID:59234772"
                     /translation="MNCNNSGKTYMVTLEGTRQMNLDKIIILLKQGKHIREDCVYSLC
                     IQAQELLMNESNVTHVDTPVTICGDIHGQLHDLLTLFEKSGGVEKSRYIFLGDFVDRG
                     FYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKVYGFYDEIMRKYGNSNVWRYCCE
                     VFDYLSLGAIINERVFCIHGGLSPDITTIDEIRSIDRKQEVPHEGAMCDLLWSDPDEV
                     DTWSLSPRGAGFLFGKGEVDQFLQTNNIELIARAHQLVMEGYKEMFDGGLVTVWSAPN
                     YCYRCGNVAAVLTIDGQLERSYTIFDAVQSQNGMGHTIIPTKKPQMDYFL"
     gene            <275369..>276454
                     /locus_tag="HG535_0B01500"
                     /db_xref="GeneID:59234773"
     mRNA            <275369..>276454
                     /locus_tag="HG535_0B01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286945.1"
                     /db_xref="GeneID:59234773"
     CDS             275369..276454
                     /locus_tag="HG535_0B01500"
                     /inference="similar to AA sequence:RefSeq:NP_010361.3"
                     /note="similar to Saccharomyces cerevisiae RAD55
                     (YDR076W); ancestral locus Anc_8.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142840.1"
                     /db_xref="GeneID:59234773"
                     /translation="MSVGISLSQFISDNPDPLSSGIPELDQALNNGFQTRSIYEVYGP
                     PGIGKTRFGLQLLEHTDPRDRLLWIETFKPMPGVAPATLAAGRKIEKVKITTFTELFF
                     FINALDTSYRLLVMDGMSQLVCNHLYVLQKRAKRSPAHSSNPSSTASWKLHEMKCKHL
                     VQLFTSMTKYANQHNTTIILLNDCMNTSFTNDDVNTGIHEDGLDVIADKTNFYVISAA
                     KRRNVQILKSSLLASSVAMGKRDAKWEIFLKKKIGLFWGWQTTAPLATGTDHTTKAET
                     AATTGATASTSTKPRKCRLVIVNTGKRSRHDADNGDSERGSLQRICTEFDQNGRLRSL
                     NAQNSSQVPKTDTASDEFVFDSQSSVV"
     gene            <277281..>277847
                     /locus_tag="HG535_0B01510"
                     /db_xref="GeneID:59234774"
     mRNA            <277281..>277847
                     /locus_tag="HG535_0B01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286946.1"
                     /db_xref="GeneID:59234774"
     CDS             277281..277847
                     /locus_tag="HG535_0B01510"
                     /inference="similar to AA sequence:RefSeq:NP_010362.3"
                     /note="similar to Saccharomyces cerevisiae SED1 (YDR077W)
                     and SPI1 (YER150W); ancestral locus Anc_8.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142841.1"
                     /db_xref="GeneID:59234774"
                     /translation="MKFSTALVAAVVPAVAMAQFANVTSSSATSELPTLGPNGTQITS
                     LPTSVPPTIGPNGTQITSLPTSVPPTIGPNGTQITTSLPTGPGGYNSTNYITTTEVVT
                     EYTTYCPYPTTFTENDVTYTVTAPTTLTITDCPCTITTVIPSPTLSPEPSSATTSSSQ
                     TIQPAPNAGNNMVVPSIMGVAGVAWLLL"
     gene            <278322..>281651
                     /locus_tag="HG535_0B01520"
                     /db_xref="GeneID:59234775"
     mRNA            <278322..>281651
                     /locus_tag="HG535_0B01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286947.1"
                     /db_xref="GeneID:59234775"
     CDS             278322..281651
                     /locus_tag="HG535_0B01520"
                     /inference="similar to AA sequence:RefSeq:NP_009794.3"
                     /note="similar to Saccharomyces cerevisiae YBR235W;
                     ancestral locus Anc_6.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142842.1"
                     /db_xref="GeneID:59234775"
                     /translation="MASNFYDIPGSHKPSSSEPHNESTSLLPKRKSSLTYFSYKATPQ
                     CRKISSRHDPANPNRDKLGTYGGVFVPTALNVLSILMFLRFGFILGQLGIICTLGLLL
                     LSYLINLLTTLSISAISTNGTVRGGGAYYMISRSLGPEFGGSIGLVFFFGQVFNSGMN
                     AIGLVEPLLYNLGISNDESRSAALFQLLPKGHWHEFIYATVILLLCLSIALVGSQTVS
                     RAGNILFLVLVLSIASIPLSALIKMPFSVDDNLVYSGISWKTFTENLYPHLTKGAAGS
                     VLKSKETFNDLFGIFFPATAGIFAGAGMSSELRKPSRSIPKGTLWGLLFTFLCYTIVV
                     ISMSFTIPRQSLYGDVQVIQSVSAVQWIIFMGEMSTALFSIIVGMVGAAYVLEAISRD
                     SIIPGITIFHKKPLFSLLFTWFLTQLCLFSDVNKIATFITMTFLMTFAVMNLACFLLE
                     LSSAPNFRPSFKYFDRYTAISGAIMSTIAMFVVDGISASGIILAMVVLFLMIHYFCPP
                     KSWGDVSQSLIYHQVRKYLLRLRQDNIKYWRPQILLLVDNPRTSWKLIRFCNHLKKGG
                     LYILGHVTVITNFQDQLPELKKQQRAWLKIRELTKIKAFVQIGTGPTLSWGIRNVFLG
                     SGLGGMKPNITVVGMFDLQHHREFSSPNMNDNDSSPPNLSNSTPTEFDGFKEPLPTDE
                     CKNENKVKVQQWVQIVEDLSSMQSNIAVAHGFRNLNLPKDTEKFECKRYIDLYPIQMC
                     AQMKFQNDSPSVTTTNFDTYTLILQLGAILVTVPQWKHTHTLRTILFVEKELDRSDEI
                     KRMENLLGVLRIEAEVLVVSLDQFRVYNTIVKGDPITFKYVNEKLKDDSWWKDLVEAR
                     DTLKPKRRFSMAAPVAVKSKDLHSHKHKLSKLHSLGISLTMSSSMPQTVPITDLDSDD
                     DTDVGSVFDSSASIPSLTQRLNYETNRRKNHAVKAATPLHKKIDDSTAQSLRPVFSSN
                     KLPVTKVLEDGSGDKPTLVPIVEPAPQDDRISEQQSRNQILPELSPCCSKDSLVLAMN
                     NLAFNDLPSRAQHLVLNDIMTQLSSMSDLIFSTLPIPALGTHDDADASLLYIEDLDTW
                     LEGLPPTMLINSQTMTVTTAL"
     gene            complement(<281724..>282992)
                     /locus_tag="HG535_0B01530"
                     /db_xref="GeneID:59234776"
     mRNA            complement(<281724..>282992)
                     /locus_tag="HG535_0B01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286948.1"
                     /db_xref="GeneID:59234776"
     CDS             complement(281724..282992)
                     /locus_tag="HG535_0B01530"
                     /inference="similar to AA sequence:RefSeq:NP_009795.3"
                     /note="similar to Saccharomyces cerevisiae ABD1 (YBR236C);
                     ancestral locus Anc_6.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142843.1"
                     /db_xref="GeneID:59234776"
                     /translation="MSARPEKPVWMSQEVYDRQYGIPERNNKPQNKNDSIADPSKKDD
                     EPKLNEANGQEMTQSSESQKPIFRIAKRKHQQFDLEEKQRRIEISRLRDEQLKKHEIE
                     LAANRTINVDQIVRQHYNERTFIANKARRNLSPIIKLRNFNNAIKYMLIDKYTRPGDV
                     VLELGCGKGGDLRKYGNANISQFIGVDISNASIQEAHKRYNSMRNLSFQVILITGDCF
                     GESLGVAVESFPECRFPCNIVSLQFCLHYAFETEEKARRTLLNISKSLRIGGHFFGTI
                     PDSEFIRYKLNKISPEVEKPSWGNSIYKVTFENNEYLKNDHEFPSPFGQMYVYWLEDA
                     IDNVPEYVVPFETLRSLGDEYGLELELQMPFNKFFVQEIPHWIDKFSPRLKEGLQRSD
                     GKYGVEGDEKEAASYFYTMFAFRKVKDYVE"
     gene            <283183..>285753
                     /locus_tag="HG535_0B01540"
                     /db_xref="GeneID:59234777"
     mRNA            <283183..>285753
                     /locus_tag="HG535_0B01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286949.1"
                     /db_xref="GeneID:59234777"
     CDS             283183..285753
                     /locus_tag="HG535_0B01540"
                     /inference="similar to AA sequence:RefSeq:NP_009796.1"
                     /note="similar to Saccharomyces cerevisiae PRP5 (YBR237W);
                     ancestral locus Anc_6.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142844.1"
                     /db_xref="GeneID:59234777"
                     /translation="MLPVSPHDANKAEILQERQKRLAKWKQKKAHSDEQSKTKQENLT
                     NSENTNHDRQAERRQKLQEWKDKRRKRNEESSDKQSPQPREQKKRKSSMKGKTKNNDS
                     ANVFDASDDEEFVSTKVELFVPKTSSSKDGSNAVLSHGKRETTKNDKDPLDEYMQGIH
                     SIKGTSTNNRIGYLFDEEDNDTGVEDMAFERTDTNEDTRYAKIAKMKLKKQVLSIKYT
                     SEDLEPFRKNFYVQPEEFDSMSESEIEEIRLSMGNIKVKGNQCPVPVSRWSQLGLSSD
                     VMNLITQDFDYGSPTPIQSQAIPAIMSGRDVIGISKTGSGKTISYLLPLIRQIKAQRP
                     LSRDETGPLGLILAPTRELALQINEEVQKFIRGDDSVSSICCTGGSELKHQINVLRRG
                     IEIIVATPGRFIDLLTLNSGKLINTKRITFVVMDEADRLFDLGFEPQITQIMKTIRSD
                     KQCVLFSATFPNKLRSFALRVLRSPLTVTVTSNSLVNENVKQKFEIVDGEEKKFLKLL
                     KILNESIKTEDEEEEELKEDDEPKDEKIIIFVSSQQICDILFKKLECEGYHLFSIHAG
                     KPYQERLKNLENFRSTKNSILICTEVLSRGLNVPEVSLVIIFNAVKTFAQYVHTTGRT
                     ARGTNKGVAITLLLENELAASFILSKALRTSELEEHDEHQVRALKDMSAAFTSGIKEG
                     RYKVSSGFGGKGLDNLESKREEKQMEQKKRFEGGNASSHEDGHRQSNQEDDNNTTHIK
                     VPKIEYTVIKNSNTDGTITYSARVNVNDLPQLVRWEVTKNTTLMLVKRETGCSITNKG
                     RYYPEGKLPESPRDEPKLYLLLESKEEKDIRLSIDILEQKVKEGVRKVSNNFIKDTKY
                     "
     gene            complement(<285786..>286199)
                     /locus_tag="HG535_0B01550"
                     /db_xref="GeneID:59234778"
     mRNA            complement(<285786..>286199)
                     /locus_tag="HG535_0B01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286950.1"
                     /db_xref="GeneID:59234778"
     CDS             complement(285786..286199)
                     /locus_tag="HG535_0B01550"
                     /inference="similar to AA sequence:RefSeq:NP_011407.3"
                     /note="similar to Saccharomyces cerevisiae YGL108C;
                     ancestral locus Anc_6.149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142845.1"
                     /db_xref="GeneID:59234778"
                     /translation="MGLCASTSDTQTDSSTPAVSKRTVKTSTVKTSTVASKPAPKKRS
                     KKTRKSQTVITPKQSGGNKILNDSEDDNREKLSAREAARLAAEKRLQDSNDKSTRGEL
                     GRKLAEERSKSHKSQLMKQAEQQRLNKANDSLNND"
     gene            complement(<286743..>288842)
                     /locus_tag="HG535_0B01560"
                     /db_xref="GeneID:59234779"
     mRNA            complement(<286743..>288842)
                     /locus_tag="HG535_0B01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286951.1"
                     /db_xref="GeneID:59234779"
     CDS             complement(286743..288842)
                     /locus_tag="HG535_0B01560"
                     /inference="similar to AA sequence:RefSeq:NP_009797.1"
                     /note="similar to Saccharomyces cerevisiae YBR238C and
                     RMD9 (YGL107C); ancestral locus Anc_6.150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142846.1"
                     /db_xref="GeneID:59234779"
                     /translation="MMFRFAQQAQVIKGRLPNQFAHASARNSFNHSVRFNSAVTLERQ
                     DSSNGTPANPLAQTSNQVNAAVNKVRHLRNNIKTNGTSSGPLQHSYNNKNRNIPHSTI
                     SVDSPWYHKVCAFEDCVSQTLYMSQTPRRKNMKQQSEHPNSNANPLFWDSIGRAMDLY
                     HDLISTPELNSDRVSKLVHLLHNGLRANRNQLTRMNKKPDYDSQSFHKEMTNYLCKSL
                     RDISGDVLQGKVELNEYGAMHLITAFKELLLFEEAVDIWKAAMNGSNQYTSNIFLNPR
                     VVGVILPILYDNGVSYPEIQTLYEKSSSMINYFHPNLSVGMIRASLSAGENEMALKLF
                     QQLCEESTEMKYGYLIETHLSFIGECKDLTVAQTFFDKALNDEMPYKIDLQVSYVKSF
                     LRNIWKQTSDFNRVYEIWYKSSVHYGKGVNHGISSSLNDTFFDIFFENYAHDKLQGFQ
                     TLQSLIQTYNQIKPIDEPFFNIILAKCTIWRDRKIIDYIDKIYALYHIPKTIVAFRIL
                     LKSMGSVDDASNVEILQRWIDLVSKSDEIGQRFIANADWAALRDATVTWTQYSREDQL
                     NKERQSSNSSSGSPKSSASTELFTASNGDVDYSHPALQAANASGAFDDHYSNNYQRGQ
                     QQEENASNINQRMILYLKIVKRYSPYCRDSRQLARLTTGTAVKYSVLHEALSEFQELD
                     VTDIPVPYFGNLKQNCN"
     gene            <290814..>291254
                     /locus_tag="HG535_0B01570"
                     /db_xref="GeneID:59234780"
     mRNA            <290814..>291254
                     /locus_tag="HG535_0B01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286952.1"
                     /db_xref="GeneID:59234780"
     CDS             290814..291254
                     /locus_tag="HG535_0B01570"
                     /inference="similar to AA sequence:RefSeq:NP_011409.1"
                     /note="similar to Saccharomyces cerevisiae MLC1 (YGL106W);
                     ancestral locus Anc_6.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142847.1"
                     /db_xref="GeneID:59234780"
                     /translation="MTASKTNKDIFTLFDKKGQSSISRQSFGDYLRAIGYNPTNQQTE
                     KILANANAPDQLSLELIDQLIQSNEKELNATTTGKVDDFIKAFQVFDKENTGKVSVGD
                     IRYMLTSLGEKLSDDEVDELLKGVEIDSEGGVDYKKFIEDILRQ"
     gene            complement(<291312..>292835)
                     /locus_tag="HG535_0B01580"
                     /db_xref="GeneID:59234781"
     mRNA            complement(<291312..>292835)
                     /locus_tag="HG535_0B01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286953.1"
                     /db_xref="GeneID:59234781"
     CDS             complement(291312..292835)
                     /locus_tag="HG535_0B01580"
                     /inference="similar to AA sequence:RefSeq:NP_009798.3"
                     /note="similar to Saccharomyces cerevisiae YBR239C;
                     ancestral locus Anc_6.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142848.1"
                     /db_xref="GeneID:59234781"
                     /translation="MTETNTKECSKSNGPEQKATTKQMKKRRNTHIACVNCAKWHLSC
                     EANRPCFRCISKGIEHTCVDAPRKKSKYLAGVPDDSLSIRRRGSPSNNFMQSSDTSNG
                     SSSNGNNDISDSQEQQNFRNPQHIVHRSKFLSNAADSEYSILSRIINEDTLINKIPVD
                     LLYSSKQLNSNNDTVPRVADSSNVNLPPHYYPSSGQNVYSVLLGDNSLNVVSSKIDLF
                     ENHFPLIPVDIASRSLNFKRLLPHDRSPKSGDICQNPHINQYYLNVESLSFPEIMGIF
                     KQNQHTNTGVSVSFALECCAPDAMRMYSNPEWEHSLRYATPMEIYTLINKPFSHTPGF
                     HHLFTYLRKRFNQQALVEICQSLAEFRPIFIACSVTLTEEDMIFMEQCYQRTLLEYVK
                     FIVQIGTPTCVWRRNGQISYVNEEFEILSGWNREELLNKMTFIVEIMDDESVRDYFKT
                     FSKVAYKDFKGSEQMQVCNLLSPIKGEIIKCCCMWTLKRDVSGLPLMILGNFMPILT"
     gene            <293306..>294457
                     /locus_tag="HG535_0B01590"
                     /db_xref="GeneID:59234782"
     mRNA            <293306..>294457
                     /locus_tag="HG535_0B01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286954.1"
                     /db_xref="GeneID:59234782"
     CDS             293306..294457
                     /locus_tag="HG535_0B01590"
                     /inference="similar to AA sequence:RefSeq:NP_011410.1"
                     /note="similar to Saccharomyces cerevisiae ARC1 (YGL105W);
                     ancestral locus Anc_6.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142849.1"
                     /db_xref="GeneID:59234782"
                     /translation="MSELVEKFQSLSIQQPDTLSREQQAQAAQWDSVLKTGQFQERLD
                     DLNVLLRDNSFILSTLKPTITDVNVFEVSLPLVKEQVFSSKDVKGTYTKYRHILRWID
                     YLQKLLKVSEEGQLKISYDIDLPREVIEKKKKSAEAKKGSEESQGDKKSSKKEKPPTK
                     ENENGDIKPKGKPDEETLKKLREEAKAKKAAKKAANANQQQQQQASANEKPKPSVIDF
                     RVGFIQKAIKHPDADSLYVSTIDCGDEEGPRTVCSGLVKHFSLEAMQERYVVTVCNLK
                     PVNMRGIKSSAMVLCGSDETKVEFVEPPAGSKAGDKVFFEGFGDEEPLKQLNPKKKLW
                     EQLQPHFTTTEDLEVVFKDDEDKEAPVRKLTNKNGDSFKVVSLVNAQVR"
     gene            complement(<294521..>296047)
                     /locus_tag="HG535_0B01600"
                     /db_xref="GeneID:59234783"
     mRNA            complement(<294521..>296047)
                     /locus_tag="HG535_0B01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286955.1"
                     /db_xref="GeneID:59234783"
     CDS             complement(294521..296047)
                     /locus_tag="HG535_0B01600"
                     /inference="similar to AA sequence:RefSeq:NP_009799.3"
                     /note="similar to Saccharomyces cerevisiae THI2 (YBR240C);
                     ancestral locus Anc_6.154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142850.1"
                     /db_xref="GeneID:59234783"
                     /translation="MVELQVEQDKQERELQVEQDKQERELQVEQDKQERELQVEQDKQ
                     EHDQQLKAKLLAPLRGRTFSGCWACRLRKRRCDEMRPRCSYCIEHNIKCCYDVRLVWL
                     EENSYRISLKNNSEAQLVRMSQMKRKRCCIDEDSEGTKQRKLTTSNSQSARVALSPPN
                     SESEIEEEPDDKKTLPVPIDAEPELELELEQSNLNIRRLQTYDNHVKSVYGTGRVRNY
                     DQKSVNKTLNGLLRKLENHSKNSFKNSGISTHKEGPFSVFDMHFDDESISINNNIPSP
                     PMNNHTQKNTNSFQELHERKEFIDCLVENKIYTILWLNTHGNMILSREEYCKWFLGYM
                     KRILPFEFCKVLEKIISDANPFNISNWLSIIKNKWLHNPDWQTVSFTLLTVVHGYTCP
                     ELSSELENWFLTQSILQYSMYPLINFIVRNSTNLILLYHCNVLLNNNNECSQDIYQDE
                     LTNELNVLVTKKVVNIWRDRILKQLCSCEDTTKSCSQLKYWELQLKYNEIFYTDVYST
                     "
     gene            complement(<296977..>298449)
                     /locus_tag="HG535_0B01610"
                     /db_xref="GeneID:59234784"
     mRNA            complement(<296977..>298449)
                     /locus_tag="HG535_0B01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286956.1"
                     /db_xref="GeneID:59234784"
     CDS             complement(296977..298449)
                     /locus_tag="HG535_0B01610"
                     /inference="similar to AA sequence:RefSeq:NP_009800.1"
                     /note="similar to Saccharomyces cerevisiae YBR241C and
                     VPS73 (YGL104C); ancestral locus Anc_6.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142851.1"
                     /db_xref="GeneID:59234784"
                     /translation="MSENDSLLYPSRGVARNERIAFPVIYCTLIVCLGSAQFGYHTAE
                     LNAPQQFMSCSEFSVPNGNENVPYDSTWLGRHHFRQCVPMDDEQIGLVTAMFCVGGLF
                     GSYYAGWLANVYGRKKVCIYGCVLSGLGSLMLFASNSYSGLILGRILVGISSGICIVV
                     IPLFINEISPVEWRGSLGSLNQVCINMGILFTQSLALKFADSYRWRWLLFTGFLLAVV
                     NIVLLFIILESPKWLMIRGRLREAEMSLYKLRNGSLEDAKAEIQKWRTDAQHQEDQEN
                     LDGNKEGPTLWQYVRNPMFRKPRNVILALLLGQQLCGINSIIFYGVKVISQLLPDHAI
                     QVNLGISLVNVLVTLAASALIAVSGCKPLLMFSAGLMSISSFLISIGIVKRMATLLVS
                     STFLYITAFALGLGPIPFMIIGSLSAPQDAATAQSFGTVCNWLGTFFIAYLFPMVHDL
                     VGGSVYCIFGFIAVGFCFYTYYYIPETKNKASYTDVWSGY"
     gene            <299042..>299978
                     /locus_tag="HG535_0B01620"
                     /db_xref="GeneID:59234785"
     mRNA            join(<299042..299090,299578..>299978)
                     /locus_tag="HG535_0B01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286957.1"
                     /db_xref="GeneID:59234785"
     CDS             join(299042..299090,299578..299978)
                     /locus_tag="HG535_0B01620"
                     /inference="similar to AA sequence:RefSeq:NP_011412.1"
                     /note="similar to Saccharomyces cerevisiae RPL28
                     (YGL103W); ancestral locus Anc_6.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142852.1"
                     /db_xref="GeneID:59234785"
                     /translation="MPTRLTKTRKHRGHVSAGKGRVGKHRKHPGGRGMAGGFHHHRTN
                     LDKYHPGYFGKVGMRYFHKQQAHFWKPVLNLDKLWTLIPEDKRDEYLKSSSKSAAPVI
                     DTLAAGYGKILGKGRLPSVPVIVKARFVSKLAEEKIRAAGGVVELIA"
     gene            <300147..>300905
                     /locus_tag="HG535_0B01630"
                     /db_xref="GeneID:59234786"
     mRNA            <300147..>300905
                     /locus_tag="HG535_0B01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286958.1"
                     /db_xref="GeneID:59234786"
     CDS             300147..300905
                     /locus_tag="HG535_0B01630"
                     /inference="similar to AA sequence:RefSeq:NP_009801.1"
                     /note="similar to Saccharomyces cerevisiae YBR242W and
                     YGL101W; ancestral locus Anc_6.157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142853.1"
                     /db_xref="GeneID:59234786"
                     /translation="MFIGSIRLLRQYSNSARVKTVVWNRMSTTTTSSMSNGIHKVWKP
                     QDHIPSEVQVMLSKPQPNYILSFLHVVQQLKIQRRTGWLDHDINPCESIADHMYRMSI
                     TSMLINDTKVNRDKCVRIALVHDIAEALVGDITPFGGVTKEEKHRREWETIQYLCENL
                     IEPHNRTAAEEIMNDWLAYENISSLEARYVKDIDKYEMLVQCFEYERASNGQKNLEQF
                     WSAVSSVKTEEVGSWVKDLCEERREYFAQLSRKK"
     gene            complement(<301077..>302411)
                     /locus_tag="HG535_0B01640"
                     /db_xref="GeneID:59234787"
     mRNA            complement(<301077..>302411)
                     /locus_tag="HG535_0B01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286959.1"
                     /db_xref="GeneID:59234787"
     CDS             complement(301077..302411)
                     /locus_tag="HG535_0B01640"
                     /inference="similar to AA sequence:RefSeq:NP_009802.3"
                     /note="similar to Saccharomyces cerevisiae ALG7 (YBR243C);
                     ancestral locus Anc_6.158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142854.1"
                     /db_xref="GeneID:59234787"
                     /translation="MFRYLLPSIVLVIAYSSKQHSAVLSSIAFSLVGYVVTDLLIPRV
                     GNSFIKIGLYGKDLSKVGRPVIPECIGAICAAVYILLMMFCIPFMFYKYMVTTTSGGG
                     IRDISTESYQLTDNLFPHAKLSEYLSSLLCLESTALLGIADDLFDLRWRHKFFLPAIG
                     AIPLLVVYYVDFGATHVLIPGFMQNWLQRTNLDLGALYYMYMMSMTIFCPNSINILAG
                     VNGLEVGQSIVLGILALLNDSLYLTMGPQTSWESHRFSAIIILPFLGVSAALWKWNRW
                     PAKVFVGDTYCYFAGMIFAVVGILGHFSKTMLLLFLPQILNFLYSCPQLFHIVPCPRH
                     RLPRFDENDGLLYPSITNLKETPAKKFFQPVLRALHVLKLIHVEFVNGEIVSCTNMTL
                     INLVLVWLGPMREDRLCNTILQLQFVVGVVAIIARHALGALLFGHDNLWAIV"
     gene            <302569..>303612
                     /locus_tag="HG535_0B01650"
                     /db_xref="GeneID:59234788"
     mRNA            <302569..>303612
                     /locus_tag="HG535_0B01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286960.1"
                     /db_xref="GeneID:59234788"
     CDS             302569..303612
                     /locus_tag="HG535_0B01650"
                     /inference="similar to AA sequence:RefSeq:NP_011415.1"
                     /note="similar to Saccharomyces cerevisiae SEH1 (YGL100W);
                     ancestral locus Anc_6.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142855.1"
                     /db_xref="GeneID:59234788"
                     /translation="MRPFDSGHEDLVHDVSYDFYGRHVATCSSDQHIKVFSLDKDTND
                     WQLSDSWRAHNSSIVSLDWASPEYGRIIASGSYDKTVKLWEEDPDQEECSGRRWNKLC
                     TLNDSKGALYDVKFAPAHLGLRLACIGNDGTFRTYDALEPSDLRSWTLTSEIKVLSVS
                     PASHLQSDFCLSWCPSRFSPEKIAVCALDQALIYQRGKDNKLHVTAKLEGHGGLIRSV
                     SWAPSIGKWYQLIATGCKDGKVRIFKLTERPVAHSASSFVGSYDDDASMDKVDSLDLH
                     VELISEHDDHKSEVWSVSWNLTGTILSSAGDDGKVRLWRSSYSSEFKCMSVISAQQQQ
                     QQQPTFQERSQDP"
     gene            <303985..>304473
                     /locus_tag="HG535_0B01660"
                     /db_xref="GeneID:59234789"
     mRNA            <303985..>304473
                     /locus_tag="HG535_0B01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286961.1"
                     /db_xref="GeneID:59234789"
     CDS             303985..304473
                     /locus_tag="HG535_0B01660"
                     /inference="similar to AA sequence:RefSeq:NP_009803.3"
                     /note="similar to Saccharomyces cerevisiae GPX2 (YBR244W);
                     ancestral locus Anc_6.160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142856.1"
                     /db_xref="GeneID:59234789"
                     /translation="MVSKFYSFAPTDSKGEPYPFKQLEGKVVLIVNVASKCGFTPQYE
                     ELEKLYTKFKDEGLVILGFPCNQFGSQEPGSDQEIASFCKLNYGVTFPVLKKIDVNGK
                     SEEPVYEFLKKEKSGLLGLSRIKWNFEKFLIDKQGNVVERYSSLTKPQSLESEVQRLL
                     KE"
     gene            complement(<304665..>307868)
                     /locus_tag="HG535_0B01670"
                     /db_xref="GeneID:59234790"
     mRNA            complement(<304665..>307868)
                     /locus_tag="HG535_0B01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286962.1"
                     /db_xref="GeneID:59234790"
     CDS             complement(304665..307868)
                     /locus_tag="HG535_0B01670"
                     /inference="similar to AA sequence:RefSeq:NP_009804.1"
                     /note="similar to Saccharomyces cerevisiae ISW1 (YBR245C);
                     ancestral locus Anc_6.161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142857.1"
                     /db_xref="GeneID:59234790"
                     /translation="MTNEQKYWEELKQFQVDVPSRGCTETKSRYLLPNSSCRKFDIEA
                     TAKRFEHLLSLSVLFKHFIQSKAKKDDRFKRVLDILEKGDGKDKKKGNGLHDKRRRKT
                     EREEDAELLRGEEEEEEGIDDVEFQFTESPTFVNGHMRDYQIQGLNWLISLHRNGLAG
                     ILADEMGLGKTLQTISFLAYLRYVEKTPGPFFVIAPKSTLNNWLREINRWTPEVSAFI
                     IQGDKQERAELLRDKLLMCDFDVVIASYEIVIREKASFKKIDWQYIVIDEAHRIKNEE
                     SMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDSQDFDDWFSSESTE
                     EDKDKIVKQLHTVLQPFLLRRIKNDVEKSLLPKKELNVYVGMSSMQRKWYRQILEKDI
                     DAVNASNGTRESKTRLLNIVMQLRKCCNHPYLFDGAEPGPPYTTDEHLVYNSAKLKVL
                     DQLLKKMKEQGSRVLIFSQMSRLLDILEDYCFFREYEYCRIDGSTAHEDRIQAIDEYN
                     SPDSKKFIFLLTTRAGGLGINLTTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKV
                     FRFVTDNSVEEKILERATQKLRLDQLVIQQNRISSQKSKKENKADSKDALLSMIQHGA
                     ADVFQSASGSSRNTPQPEDEAAQEIDLDALLAKSQDKTQSLSKKYSALGLDDLQKFNQ
                     DSAYEWNGQDFKKKTQKDIISPIWTNPTKRERKENYSVDGYYKDVLQTGRASTPNHPR
                     MPRPRPFYSHQLQSPQLKALYEKERMWNTKKSGYVPTQEDVKTTYGNIIDEEEKKQKL
                     EILKISVANAQPLTEEEENQKSEWEKEGFPNWSKTDFRKFISASGKYGRNSIQAITLD
                     LAPKTYDEVREYAKSFWAYIERVEDYEKHLKYIETEEEKIKRVKQQQEALRRKISQYA
                     NPFIDLKLNHPPSTNNKRTFSEEEDRFILILLFKYGLDRDDVYELIRDEIRSCPLFEL
                     DFFFQSRTPVELARRASTLLQCLEKEFNDGLVLEDVKDRLKQEDESGKRMREEMEVEE
                     QQAKEEQQIKAVEPTTDMEPTTDLEPVNMATKKIKSE"
     gene            <308183..>309334
                     /locus_tag="HG535_0B01680"
                     /db_xref="GeneID:59234791"
     mRNA            <308183..>309334
                     /locus_tag="HG535_0B01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286963.1"
                     /db_xref="GeneID:59234791"
     CDS             308183..309334
                     /locus_tag="HG535_0B01680"
                     /inference="similar to AA sequence:RefSeq:NP_009805.1"
                     /note="similar to Saccharomyces cerevisiae YBR246W;
                     ancestral locus Anc_6.162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142858.1"
                     /db_xref="GeneID:59234791"
                     /translation="MEESKIIKATTTQLPPCCLRIVDNEYILVGSYHLDKPSGKRTGL
                     MEIFDRNLELTNSYPTYGAILDLKLSPFDTNLVATAHSTGNVTVWKFTLTKDKKSVEL
                     RQLGNLQVFDVNILVTSLQFSPLDSRILLATNTLGTSAIIDLVDESVTFSIDSTATTY
                     QRLVKTSYNVQGSFENAMEVKARKFAGKHALECWTGEFGQLQPLQNVVFTGGDDATIM
                     AHDLRTKATVWSNNRIHEAGVVGIKTSSPTFRNSKSTSIITGSYDDKIRSLDLRMLGD
                     DIYPGHNTPVAKQWDCDLGGGVWRFSEMPSNLTRTFSEAPSNSNKLLVCCMYNGAKVV
                     DVAEDSEDMFRVTNYLKKGHESMCYGGDWCTDFIATCSFYDNSLQIWNL"
     gene            <309596..>311515
                     /locus_tag="HG535_0B01690"
                     /db_xref="GeneID:59234792"
     mRNA            <309596..>311515
                     /locus_tag="HG535_0B01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286964.1"
                     /db_xref="GeneID:59234792"
     CDS             309596..311515
                     /locus_tag="HG535_0B01690"
                     /inference="similar to AA sequence:RefSeq:NP_011416.3"
                     /note="similar to Saccharomyces cerevisiae LSG1 (YGL099W);
                     ancestral locus Anc_6.163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142859.1"
                     /db_xref="GeneID:59234792"
                     /translation="MPLKEAPKKWKPPKGPKPIQRKNKNAIGLGRALKYARQKENAVE
                     FLPDGEMRFITEKHEADWVKLRSVTQESALEEFLGTAELADKDFAADRHANVKIIRMD
                     SGDDSAVTQGFSLTNEQRENINLKQREHARELIVPRRPAWDKTMTRFQLDRQEKEAFL
                     NWRRKLAMLQESNEDLLLTPFERNIEVWRQLWRVVERSDLVVQIVDARDPLLFRSVDL
                     ERYVKEIDERKQNLLLVNKADLLTLKQRVAWAKYFKSKNVAFSFYSALKANETLQKQE
                     ELGEDYVQEEMKEELEDGEVEDESILESVKILTLDQLEELFLARAPAVPLTVPLPGQQ
                     PVTQIGLVGYPNVGKSSTINSLVGAKKVSVSSTPGKTKHFQTINLSDSVILCDCPGLV
                     FPNFAYNKGELVCNGVLPIDQLRDYIGPCTLVAERIPKFYIEAIYGIHIQMKSPEEGG
                     HGEHPTAQELLVAYARARGYMTQGFGSADESRASRYILKDYVNGKLLYINPPPKLDDD
                     TPYTREESAEFNKDIYAFERLPETRQIQLLEAAKSKAIVDFDLARDLNKLTFSAHTGA
                     ENGSEASGVTHGGKQAALHNASSSLDRDFFQMNSITGKLTSPFHKNAVVGNNGKKHNK
                     KNKKDKKRAEMRPEW"
     gene            <312196..>312960
                     /locus_tag="HG535_0B01700"
                     /db_xref="GeneID:59234793"
     mRNA            <312196..>312960
                     /locus_tag="HG535_0B01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286965.1"
                     /db_xref="GeneID:59234793"
     CDS             312196..312960
                     /locus_tag="HG535_0B01700"
                     /inference="similar to AA sequence:RefSeq:NP_011417.1"
                     /note="similar to Saccharomyces cerevisiae USE1 (YGL098W);
                     ancestral locus Anc_6.164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142860.1"
                     /db_xref="GeneID:59234793"
                     /translation="MKAALRDALAHQMTDQVEDPFLAYLLSTKVSENLNVLRNDLLKE
                     QVILDGTRSNANTIGAYQKNCAQLAFEASSKKHETIELMKRKYDNYQESLKKRRYSVD
                     FDAASDGVDPVVNLEVSEPDGLTDETAELRRRLLGHRVSDAESGIGSTKSIDRQIEDQ
                     DNLQTTLLEDMTNLVGTLRQSASAFQNALEEDRNVLSAAEIGVQIASKSLVDIGGKLK
                     KYDKKKLGYLFYITVFLFMIIGLILTFIIIRLFPAL"
     gene            complement(<312989..>314740)
                     /locus_tag="HG535_0B01710"
                     /db_xref="GeneID:59234794"
     mRNA            complement(<312989..>314740)
                     /locus_tag="HG535_0B01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286966.1"
                     /db_xref="GeneID:59234794"
     CDS             complement(312989..314740)
                     /locus_tag="HG535_0B01710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142861.1"
                     /db_xref="GeneID:59234794"
                     /translation="MGEDRYELDSFNSTPADMSTATPDSNFYDVEDRQGKSGTKVEQE
                     SFEGAEQEDLELDLRDPHTFPLVLASLWTSSALSALDGTIVSTTINDVASRFQQASLV
                     TWVATSYLLTTCSAQPLYGKISDIIGRRKCLLFGQFVFAIGIIFCSVARTIPQLAIAR
                     AICGIGGSGTSAMTNIILSDMVPLSERAKYWGYGSVLWAIFQSIGGPLGGILLEYFGV
                     SGLFIPQIPFCIAPLYLSWKYVWDYNEDTKKSWKKIDFGGSLCLLLMISSFIVLLSNN
                     NDGSLEHVSWPPHKKASLVIFVSSLLTFAFVENYVAVENIIPFSVIKGTLGLVAIIYG
                     LVALINYTCLFVVPLYLQLIWGVSVSQSGWYIMCVVISSAAGALWSGWIVKKFSNTDR
                     HATIYYSAVLLFLMTLLTLFGYAGIYQAVRNSSPVMAGDKINPFFNVRMIFGISTLGF
                     SQGSQNVTVMLFNVAKVGRKGQASSTSVNFLFRSLGNVLSVSIALTMFTNSLRGELSE
                     ALLGKDDDLLLTLLKDNAYLRSPSMPATHIKTIMDAFRKSLLNSFLPCRWSVILNVLF
                     GIFLLIVVNRKLRRIIT"
     gene            complement(<315560..>317014)
                     /locus_tag="HG535_0B01720"
                     /db_xref="GeneID:59234795"
     mRNA            complement(<315560..>317014)
                     /locus_tag="HG535_0B01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286967.1"
                     /db_xref="GeneID:59234795"
     CDS             complement(315560..317014)
                     /locus_tag="HG535_0B01720"
                     /inference="similar to AA sequence:RefSeq:NP_009806.3"
                     /note="similar to Saccharomyces cerevisiae ENP1 (YBR247C);
                     ancestral locus Anc_6.165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142862.1"
                     /db_xref="GeneID:59234795"
                     /translation="MGKVANARSRKQRHDPLLKDLDSVQGTLRKAHGKTTSKREDDAD
                     EHEEFIDSNTSRKILQLAKQQQDEIAVEEDKQLQEAKNNSARFKSMQYHDGSGEEEEE
                     DEDEDGNSGNISDFDEYHGEGVENEEEEIVEIDEEDNAMFEQYFKGSGDYNASSGSYN
                     LADKIMASIKEKEMEHDDEINESAGNVPQQPEEDLREKAMRGEGVALPEKVIRAYTTI
                     GTILSTWTHGKLPKLFKVIPSLRNWQDVLYVTFPEQWSPHVVYEATKLFVSNMSAKES
                     QKFVTLILYERFREEIERSQDHSLNYHVYRALKKSLYKPSAFFKGFLFPLAESGCNVR
                     EATIAGSILAKVSIPVLHSSAALSYLLRLPFSPSTAVFIRVLLDKKYALPYQTVDECV
                     YYFMRFRVLEDGSNYEDATRTLPVVWHKAFLTFAQRYKNDITQDQRDFLLETVRQKGH
                     KDIGPEIRRELLAGASREFVDPSVENNDLMIDIK"
     gene            complement(<317299..>318057)
                     /locus_tag="HG535_0B01730"
                     /db_xref="GeneID:59234796"
     mRNA            complement(<317299..>318057)
                     /locus_tag="HG535_0B01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286968.1"
                     /db_xref="GeneID:59234796"
     CDS             complement(317299..318057)
                     /locus_tag="HG535_0B01730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142863.1"
                     /db_xref="GeneID:59234796"
                     /translation="MWLWRFLLRAFAGCLLLKVCLCSKTDSASGPVLGSLGGTLDESL
                     EESFSCLRLDYSDFDDEADFRNDVLTEIRNQFDSAKAKYAGDDNLMATFGMLLNVKLR
                     QLHLESNSMEKISQDLIRISRGLTLLLEADKNTTEFCTIPVTLPVTVPANMSSESELV
                     SLASQEMERMNIDQTVSAFRKTFDPDKKRILRTGSFVFLMFSTTADVCVLTGWGPCIV
                     LYVVGSGGLLVWFAQILRETFGSQTIQFLQTIDN"
     gene            <318494..>319942
                     /locus_tag="HG535_0B01740"
                     /db_xref="GeneID:59234797"
     mRNA            <318494..>319942
                     /locus_tag="HG535_0B01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286969.1"
                     /db_xref="GeneID:59234797"
     CDS             318494..319942
                     /locus_tag="HG535_0B01740"
                     /inference="similar to AA sequence:RefSeq:NP_011418.1"
                     /note="similar to Saccharomyces cerevisiae SRM1 (YGL097W);
                     ancestral locus Anc_6.166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142864.1"
                     /db_xref="GeneID:59234797"
                     /translation="MVKRAASAGLENGNHVNGKRVSKAHASHIINTQDDYKHLYMSVQ
                     PLDIFCWGTGSMCELGLGPLAKNKEVKRPRLNPYLPHDSSKIVSFAVGGMHTIAVDSE
                     DNIWSWGCNDVGALGRDTSGAVEKLKDMDADDSNDDEDGDLNACESTPTKIPRESLPP
                     LAKGHKVVQLAATDNMSCVLFSNGETYAWGTFRCNEGILGFYREEIKIQRTPWKVPAF
                     SKFQIVQLAPGKDHILFLDEEGYVFAWGNGQQHQLGRKIMERFRLKTLDPRPFGLKNI
                     KYIAAGENHNFALTRDNKLVSWGLNQFGQCGTSEEIEDGALVTKPKQVILPEDCTVKM
                     VSAGEHHSLVLSQNGDLYSFGRIDMFEIGIAKSDLPEYSYTDVHDKIRAVPIPTKLKN
                     VPKFKSISAGSHHSVAVAQNGIAYSWGFGETYAVGLGPSGEDTEVPTRIKNTATQDHN
                     IIMAGCGGQFSVSGGIKLSEQDAEKRADEMDD"
     gene            complement(<320201..>321868)
                     /locus_tag="HG535_0B01750"
                     /db_xref="GeneID:59234798"
     mRNA            complement(<320201..>321868)
                     /locus_tag="HG535_0B01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286970.1"
                     /db_xref="GeneID:59234798"
     CDS             complement(320201..321868)
                     /locus_tag="HG535_0B01750"
                     /inference="similar to AA sequence:RefSeq:NP_009807.3"
                     /note="similar to Saccharomyces cerevisiae HIS7 (YBR248C);
                     ancestral locus Anc_6.167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142865.1"
                     /db_xref="GeneID:59234798"
                     /translation="MTVVHIIDVESGNLQSLTNAIEYLGYDVHLVKSADDPDLANASL
                     LILPGVGNFGHFVDNLYSRGFEKPIMDYVKGGKPIMGICVGLQALFSASSESPTSKGL
                     EIVDMKLSRFDESTKSVPEIGWNTCTIDGEQSLFGIDPFKRFYFVHSYAAILTPETEK
                     KLHEGGWKIAKARYGDEEFVAAVCRGNVFATQFHPEKSSKAGLDVLDNFLKQRHPVTH
                     YTDEEKSLAENDYSNNGLTRRIIACLDVRTNDQGDLVVTKGDQYDVREKTSGNDVRNL
                     GKPVEMAQKYYEQGADEVTFLNITSFRDCPLKDTPMLEVLKRAAQTIFVPLTVGGGIK
                     DIVDLDGTKIPAHEVANLYFRSGADKVSIGTDAVYAAENYYSNGCTGDGTSPIETISK
                     AYGAQAVVVSVDPKKVYVNSPNETKNKTFQSRFPDNEGRTWCWYQCTIKGGRESRDLG
                     VWELTKASEALGAGEILLNCIDKDGSNSGYDLELIEHVKNAVKVPVIASSGAGNPGHF
                     KEAFEMTRADACLGAGMFHRGEYTVNDVKRHLLQHGFKVRLDQTQNN"
     gene            complement(<322283..>323383)
                     /locus_tag="HG535_0B01760"
                     /db_xref="GeneID:59234799"
     mRNA            complement(<322283..>323383)
                     /locus_tag="HG535_0B01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286971.1"
                     /db_xref="GeneID:59234799"
     CDS             complement(322283..323383)
                     /locus_tag="HG535_0B01760"
                     /inference="similar to AA sequence:RefSeq:NP_009808.1"
                     /note="similar to Saccharomyces cerevisiae ARO4 (YBR249C);
                     ancestral locus Anc_6.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142866.1"
                     /db_xref="GeneID:59234799"
                     /translation="MSESPMFPASDSSESNEDVRILGYDPLVSPALLQVQVPATQQSL
                     ATAKRGRKESIEILTGRDDRLLVIVGPCSIHDLDAAAEYAQRLKKLSDELKGDLCIIM
                     RAYLEKPRTTVGWKGLINDPELNNSFNINKGLQFARQLFVTLTDIGVPIGSEMLDTIS
                     PQFLADLLSFGAIGARTTESQLHRELASGLSFPVGFKNGTDGTLDVAIDAVQAASHPH
                     HFMGVTKHGVAAITTTRGNENCFIILRGGKKGTNYDAQSVAEAKKQLAPGSNGLMIDY
                     SHGNSNKDFRNQPKVNDVVAEQIANGENSIIGVMIESNINEGKQNIPPEGKSGLKYGV
                     SITDGCISWETTEGVLRKLAAAVRERRNLNKK"
     gene            <324803..>326173
                     /locus_tag="HG535_0B01770"
                     /db_xref="GeneID:59234800"
     mRNA            <324803..>326173
                     /locus_tag="HG535_0B01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286972.1"
                     /db_xref="GeneID:59234800"
     CDS             324803..326173
                     /locus_tag="HG535_0B01770"
                     /inference="similar to AA sequence:RefSeq:NP_014917.3"
                     /note="similar to Saccharomyces cerevisiae MOD5 (YOR274W);
                     ancestral locus Anc_8.725"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142867.1"
                     /db_xref="GeneID:59234800"
                     /translation="MTSFLFSKLEKSKKNWNYREGLIKINSWTMLRKLLNRLFMTSGN
                     KVIVIAGTTGVGKSQLSIELASRFNGEVINSDSMQVYKKIPIITNKHPLEERNRISHH
                     VMNHVDWTEEYYLHRFEKECFAAIDDIHSRGKTPIIVGGTHYYLQVLLNKHMTSEKRA
                     LTDEQKNILFSNNPEMVYKTLKDHDPVIASKFHPNDTRRVQRMLEIYYETGKRPSELY
                     SKQSTQLRYDTLFLWLHSDYQPLESRLDERVDNMLGSGGLEEIEELYRFYKDNKYSLT
                     QCENGVWQVIGFKEFLPWLEKEQNITLEQCTERMKIRTRQYAKKQVKWIKKMLVPDVK
                     GNIYMLDASDLTQWNLLVADRAKKITEEFIHDREMTYDFAPERLKTLLVSRDIPVRKP
                     DDWKQFSCSICLDQKGKNLIIIGEKNWNIHLRSKRHKSNLTKGLRKLQFEKWKADQRE
                     KHVICD"
     gene            complement(<326188..>328155)
                     /locus_tag="HG535_0B01780"
                     /db_xref="GeneID:59234801"
     mRNA            complement(<326188..>328155)
                     /locus_tag="HG535_0B01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286973.1"
                     /db_xref="GeneID:59234801"
     CDS             complement(326188..328155)
                     /locus_tag="HG535_0B01780"
                     /inference="similar to AA sequence:RefSeq:NP_014918.1"
                     /note="similar to Saccharomyces cerevisiae RIM20
                     (YOR275C); ancestral locus Anc_8.726"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142868.1"
                     /db_xref="GeneID:59234801"
                     /translation="MTELLCIPFKRSLNIDLRNELSKVIDSMSYQTSSFFTSDLDEIS
                     LVREKMCDLEVSNSRLENLKQYWFYLLCLQIKFPDYQIEFTWFQTLSPKSYACSQYSL
                     IFESLNVLYNIGSMYSILALDANDGSVSSLKKLCLFFQYSAGCFEYILDHLNDSKEPV
                     FDKSTGLALVSIMLGQAQECFWFKALKDSHKDSILARLAQQVVVYYSQAIIYSRKSEL
                     IRSHWISHLESKKHYFEAVVDYRRGISLGEKSEYGAMVKSLSAAIERLSKSEMPSKPE
                     FMKKVTAALKNAQRENDFIYLQPVPSSLEEVKPAPMVKSIPISDFLRTTVRPEDSLFK
                     DLLPISLMESCTGFNERQEEYVKQHICQPLQALNKLLNKNIPKFEISQETKPASEQEM
                     EHITHVIKDQKKKNGQVNDLLNQVQSILREEYQTDEELRKRFGTLNWVLEESSLANKP
                     FYEKLTKLNEYLEQGKTVDNETASLFETIDRKLITAPIKLPESNNPVIKEAFSIMRAR
                     EQYIQDVEARSAEHRILPKIVSEYKKTGEANFEPLFRSHIKFFDQDIKHVAHQKIQND
                     IISAKLTKQTAETTTQRLEPYNLYIEDLKYSRNLLQDVKSSIESGSQFYENLLKSTKS
                     LLIEVQEFENTRRDQKRKLEEKLIVSNQKPV"
     gene            complement(<328392..>330641)
                     /locus_tag="HG535_0B01790"
                     /db_xref="GeneID:59234802"
     mRNA            complement(<328392..>330641)
                     /locus_tag="HG535_0B01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286974.1"
                     /db_xref="GeneID:59234802"
     CDS             complement(328392..330641)
                     /locus_tag="HG535_0B01790"
                     /inference="similar to AA sequence:RefSeq:NP_013939.1"
                     /note="similar to Saccharomyces cerevisiae EFR3 (YMR212C);
                     ancestral locus Anc_8.727"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142869.1"
                     /db_xref="GeneID:59234802"
                     /translation="MQLFAPKHQKLVNQCYPSGRTTDKKPKSSETSYLLYYVNSRRSK
                     LEKVSTYLVKRTVADLNRRRVGNVSVTLELMAQIITNCKENLNVFVKDFLSIMQRIVS
                     NNNFNNDVTVVELVEKTYCNICQNVDGALFSGDSEFVKMYQAFVTIYFKVVNDSLHND
                     DLVLKGCIDISQTKNIASSPQIKHLIPESVHCVLVKFVERNPRYKLPHLDPSGDQNLG
                     KRLSRTQTRTLGLDDIQDTEADLSVRALKSYFGTTETDKLSASIRSLSDFIQTTPNKD
                     LLEFICNGIPVQLRYIVVLLLIRQLNIKTSKHIIILKLVSSLLVSDVSIVGLSILDMM
                     RKILKFQMENISQFDIVEQCSLTLADLNNKIYYRGQTSDMLYELIVKLKSTKNTNEIS
                     VLNGDVKQLLKQIVSPCLSLELFLDLAPFAAENEIVSLFDAVEDQTSGGWLFSRLFEL
                     IRKLKSSDHQRSLMHKVFEKYKNLALLSGLKYFTESVAESEPAYYIYHIEAARYLDID
                     DYRSQTEYKRETNSIFTKEDLVNFYSDVGSNKYSKKGMQILLSQNMQMSNSDLLSDTN
                     GRSTIVGSLEGVTQDSSSEAIRSQNQEMNGNKKSNGTALHDYKMDNSISLGPNNKSWG
                     TYRFQTPKVADLKRAMSRKGQQNVKRESSLRGGSQSVKSRVTNITFLLSELKSLDDET
                     SHIHDPDEDEIVGMDKPDLVKSHALKPSISVSGSNRKSFVKPTERSQDEFTDAVEEVP
                     TTGTRGRLF"
     gene            <330938..>332680
                     /locus_tag="HG535_0B01800"
                     /db_xref="GeneID:59234803"
     mRNA            <330938..>332680
                     /locus_tag="HG535_0B01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286975.1"
                     /db_xref="GeneID:59234803"
     CDS             330938..332680
                     /locus_tag="HG535_0B01800"
                     /inference="similar to AA sequence:RefSeq:NP_013940.1"
                     /note="similar to Saccharomyces cerevisiae CEF1 (YMR213W);
                     ancestral locus Anc_8.728"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142870.1"
                     /db_xref="GeneID:59234803"
                     /translation="MAPVPVYVKGGIWTNLEDQIVKAAIQKYGTHQWSKIASLLQKKS
                     ARQCEIRWNEYLNPKLNFTPFTKDEDTKLLDLARKLPNQWRSIADAMGRTAQACIDRY
                     NRLLEGDNDDSSDLRLGSSIDFKVGDLNPKSETLVAKPDDVELADDEREMLAEARARL
                     LNTQGKKATRKIRERMLEESKRIAQLQKRRELKQAGVKTGIRPGKKKYSTELDYNVDV
                     VYEQAPPSGIYDTSEEDVRLTREFKNFESNVERKGLKDKSNLPKSHKKEKQARSDRTQ
                     TVSTVQARDGSVLTNDYKKPVLSLPMPGTKRPAVEEKFETKRMKLLENTLTGAVFKEN
                     TETKLLVPEKIKKEEQNISINHIVKSTKSIRNLFAELPKPKNDFEIALDDEEDEESRN
                     HDEFREEESNKEDLHLSGEISTPKEIALKLQCLNTQKDDLPPLRENPKNSFDQTYNEL
                     IACSMLNEPYIQSHDIEPYLEAVEMEIEKSKPLTARTVSIAEELPSQVQLSESIRKKM
                     TTIKNLQEELAYLDPLIVRNDAISRQVCGQQLPTLRSLQLKHYVYYKMYLNESEGILQ
                     RRKRIKHDATTSTE"
     gene            <333197..>333667
                     /locus_tag="HG535_0B01810"
                     /db_xref="GeneID:59234804"
     mRNA            <333197..>333667
                     /locus_tag="HG535_0B01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286976.1"
                     /db_xref="GeneID:59234804"
     CDS             333197..333667
                     /locus_tag="HG535_0B01810"
                     /inference="similar to AA sequence:RefSeq:NP_014919.3"
                     /note="similar to Saccharomyces cerevisiae CAF20
                     (YOR276W); ancestral locus Anc_8.729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142871.1"
                     /db_xref="GeneID:59234804"
                     /translation="MARYTIEELLQLKPSETLTANFPAEEFRAIIEKVSQVQALREEE
                     FAAHHVGHFNRRRSSHHHGKPKIKHTKPKVTTDSDGWCTFEGKKKGSGDEEEEEIFKE
                     TVSTPIAQETLKIKPNNKNISSSRPADTTDLVTDKPTLSFNAFAALESDEGEEE"
     gene            <334044..>335156
                     /locus_tag="HG535_0B01820"
                     /db_xref="GeneID:59234805"
     mRNA            <334044..>335156
                     /locus_tag="HG535_0B01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286977.1"
                     /db_xref="GeneID:59234805"
     CDS             334044..335156
                     /locus_tag="HG535_0B01820"
                     /inference="similar to AA sequence:RefSeq:NP_013941.2"
                     /note="similar to Saccharomyces cerevisiae SCJ1 (YMR214W);
                     ancestral locus Anc_8.730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142872.1"
                     /db_xref="GeneID:59234805"
                     /translation="MKFPHSLLLSFLVLQFALAQDYYAILGLNKDASDKEIKSSYRQL
                     SKQFHPDKNPGNEDAHHKFIEIGEAYEVLSDPEKRKIFDQYGAEALKNGGPGQGGQGG
                     FHDPFDIFEQMFNRGGPGGGFGQRQKPRGHNLRVQEELSLKEYYTGSTLDFSLMLNDV
                     CDHCDGTGSEDGKVTQCPDCQGRGVVIQLIRMGIITQQIQQVCGRCGGRGSIVKTPCK
                     VCQGAKVVKKSKSFHVEVPAGAPRHYSEVKHGESDKGADFDAGDIFIEFNENSKNNMG
                     YRRRGDHLFRTEVLSAREALSGNWERHIEFLDETKEVKLSRPSNTIVSDGEIERVAGF
                     GMPKRGKGFGDLFIEYKVIMPHKLASGGYQAMRDEL"
     gene            complement(<336922..>339036)
                     /locus_tag="HG535_0B01830"
                     /db_xref="GeneID:59234806"
     mRNA            complement(<336922..>339036)
                     /locus_tag="HG535_0B01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286978.1"
                     /db_xref="GeneID:59234806"
     CDS             complement(336922..339036)
                     /locus_tag="HG535_0B01830"
                     /inference="similar to AA sequence:RefSeq:NP_013943.1"
                     /note="similar to Saccharomyces cerevisiae SKY1 (YMR216C);
                     ancestral locus Anc_8.732"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142873.1"
                     /db_xref="GeneID:59234806"
                     /translation="MGSSINYPGFGSKSHQYNDNGAEQFEHDEAWKHNGSAPTGSNDS
                     KLYKKNYVNKASSAGGNNGGNGSGTGTATSNLSLALKNSNLKSAPEPQNHSEQPMGAG
                     AASIPEPAAVAMPLELLQQGQNIVADEDCLEDDYSSCDEKNEESLKDYKPGGYHPAFK
                     GEKYKNGRYMLVRKLGWGHFSTVWLAKDLQNSKNTHVAVKVVRSDKVYTEAALDEIKL
                     LRRMRSNTEQDHLGSSHTLCLLDNFVHSGPNGEHIVMVFEVLGENLLALIKKYEHRGI
                     PMIYVKQISKQLLLGLDYMHRRCGIIHTDIKPENVLMEIGDVESIVEMVEAMDKEKKD
                     WRRLQRQASAELTQSPSPYGSQQQVSNLASSTSTESPPIKRIPSRRPRRHTVITESQP
                     LPSPLSSTNFHEMKYQFLGYNNSSGTLTSSNFQNMLHSKSNVAIQNPLMNNPFTISPA
                     NDTTNNPNAFKDTQINEEQLATSFSSFDISQSDEVNPVEVGISPNDSSAINDNNIIQI
                     KIADLGNACWYDEHYTSSIQTREYRAPEVLMGAPWGCCADIWSTACLIFELITGDLLF
                     EPNGGHSYSKDDDHIAQILELLGEMPSYLLQEGKYARKFFNSRGQLRNISKLKHWPLK
                     SVLTEKYHYSPEESQDIADFLLPMLNLDPRKRADAGGLVNHPWLRDTLGMENISLPDR
                     KLYESGSDIPGWYQEVTGHPRH"
     gene            <339973..>341544
                     /locus_tag="HG535_0B01840"
                     /db_xref="GeneID:59234807"
     mRNA            <339973..>341544
                     /locus_tag="HG535_0B01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286979.1"
                     /db_xref="GeneID:59234807"
     CDS             339973..341544
                     /locus_tag="HG535_0B01840"
                     /inference="similar to AA sequence:RefSeq:NP_013944.1"
                     /note="similar to Saccharomyces cerevisiae GUA1 (YMR217W);
                     ancestral locus Anc_8.733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142874.1"
                     /db_xref="GeneID:59234807"
                     /translation="MSAAVSNMFDTILVLDFGSQYSHLITRRLREFNIYAEMLPCTQK
                     ISELGWKPKGVILSGGPYSVYEEGSPHVDRAIFDLQVPILGICYGLQELAWIDGSHVG
                     RGDKREYGPATLNVVDSNHRLFKGIDRSIVWMSHGDKLHGLPSDYEVIATSENSPYCG
                     IGHTKKDIFGIQFHPEVTHSTQGKLLLKNFAVDICKAQQNWTMENFIETEIQRIRNLV
                     GPTAEVIGAVSGGVDSTVASKLMTEAIGDRFHAILVDNGVLRLNEAENVKKTLVEGLN
                     INLTVVDASDEFLDKLKGVTDPERKRKIIGNTFIHVFEREAAKIKPKDGKDIEFLLQG
                     TLYPDVIESISFKGPSQTIKTHHNVGGLLEDMKLKLIEPLRELFKDEVRHLGELLGIS
                     HELVWRHPFPGPGIAIRVLGEVTRAQVEIARKADHIYIEEIKKAGLYNNIAQAFACLL
                     PVKSVGVMGDQRTYEQVIALRAIETTDFMTADWYPFEHDFLKRVASRIVNEVDGVARV
                     TYDITSKPPATVEWE"
     gene            <342077..>342901
                     /locus_tag="HG535_0B01850"
                     /db_xref="GeneID:59234808"
     mRNA            <342077..>342901
                     /locus_tag="HG535_0B01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286980.1"
                     /db_xref="GeneID:59234808"
     CDS             342077..342901
                     /locus_tag="HG535_0B01850"
                     /inference="similar to AA sequence:RefSeq:NP_014921.1"
                     /note="similar to Saccharomyces cerevisiae HEM4 (YOR278W);
                     ancestral locus Anc_8.734"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142875.1"
                     /db_xref="GeneID:59234808"
                     /translation="MVNKIQENLQLRFPMKALLLKNKTSQLDKYDTLFKSNGFDPEFM
                     PLLTHTNVTEEFLQLIESPGYLDNLRYIIITSQRTVECLSESVLPLLSQEARSKLLGK
                     TIYTVGPVTKDFLKRVGFQHLRGGEDAGNGNVLADIIISDLLGVEDKEEVNEHSIHEL
                     LFLVGEVRRDIIPKKLSQRGINVREVVMYKTQNIQDNASRFQNAINNKCWVVFFSPQG
                     TEGILKCLNEEVCRKIKIASIGPTTEEYLKSHGITPDIVSPKPDAENLLNAIRSYV"
     gene            complement(<342932..>346219)
                     /locus_tag="HG535_0B01860"
                     /db_xref="GeneID:59234809"
     mRNA            complement(<342932..>346219)
                     /locus_tag="HG535_0B01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286981.1"
                     /db_xref="GeneID:59234809"
     CDS             complement(342932..346219)
                     /locus_tag="HG535_0B01860"
                     /inference="similar to AA sequence:RefSeq:NP_013945.1"
                     /note="similar to Saccharomyces cerevisiae TRS130
                     (YMR218C); ancestral locus Anc_8.735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142876.1"
                     /db_xref="GeneID:59234809"
                     /translation="MEAPFISPAVSISYFDPFEVFENVKEEFLDSIPFKNVHWKPPHG
                     TVRTIETLAVNLKNESKSEDNGIYQHMHFIRFIVVNCISMDEYRAKVRPLIRQWLPVD
                     EALAYRTNILRSPMPLVLFYSNSEVVDSSLFKTTPLLNKLNKDFPSVKVLELRSVYKS
                     PQEKKEFWNQLSGQLKMLVLSIFYQRLTHYQKELEHLGEKIENFDNELLLREKLVELY
                     LALNMHDQVIDLLNSIEKKVVPHLKTELPNGYLDGSHGILQESSPDYYFIGTMLKGKK
                     LTKLRFYRYFFVRKLELQLKGDSTTVKVLTVHKLLRDFLYKMETIFKNDSYWLQFKYE
                     FLCQAYECLPTENLMETRGEVLLSKRDCWIEGVQSCTNFKLASKIFPESKITYKFDKF
                     KDTFSTEEVYHENYLKLTKEIMSIYNNCEGKRQRMVDILFIEIGNFHYQRGEYEEAVS
                     IFLSCHEYYTQSKWLFIGKNILQTFINSLIKCPLITELIIEGEAVPVSTILSNALLHI
                     LKISDDYDEKKKWCNQFFTIQQKESVRLLYPMDDLLNVVLTNTVYLTAPNTYAMDIHI
                     DNHGIPKEIEVETMKLILKNSNDDFVFFEACEISINEYQKSYTLKSKNVRFGTFLPVS
                     FEVNTGNTIFTRQFSNEDKNEIFLHPLYDPTGVSFTISEARELNLEENKLEISFRNID
                     KTETFDLEVFVPRIGIPPRSSVSFSTDEDVHSFKVSSRNLHQKITYYMKDPRTSFELN
                     TRLSFVKKDCTQRYSEERIFLIECYLPVSVSVEDIFKRDLFIFKFLLNSSTFEEPIIL
                     HSSKLLPPKDIDHYEISGEYSPESLKYLTADPNEYCLNCYQIRTPKRYDPADIFHLAV
                     SYNTLKEQLDQLVTDAVLVQGNIKWHSHFEVWKSFWEYFVLPKLQYDYNSFQRSWLII
                     LTKGSFEMKDLLHHVEKLSMGDVVANGMIDCLERIINGVQLSEIDISGYAKNLATRTL
                     IVPVQMPKVEHLFYLEIIKGDDQPSHEVGMPLPVKIKIDRAVEKWGKTESFGSFVFEI
                     INSNEWLVHGKKRLLLLTTYTELEIDIIPLKKGYLSFPRVEITNVDCDELARIDNSNI
                     SETILVL"
     gene            <346385..>351001
                     /locus_tag="HG535_0B01870"
                     /db_xref="GeneID:59234810"
     mRNA            <346385..>351001
                     /locus_tag="HG535_0B01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286982.1"
                     /db_xref="GeneID:59234810"
     CDS             346385..351001
                     /locus_tag="HG535_0B01870"
                     /inference="similar to AA sequence:RefSeq:NP_013946.1"
                     /note="similar to Saccharomyces cerevisiae ESC1 (YMR219W);
                     ancestral locus Anc_8.736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142877.1"
                     /db_xref="GeneID:59234810"
                     /translation="MSSGFSDLNETNDNNLNLKIPTRNIERFSAVTSERNTTFARYTR
                     RSTTYSKAYKRHRTSQPQKMSASQKTAHEDSSKALSWVGSLIKRGRSILSNLKEEDKT
                     FEKQLREEAETHRLHEELVNNVLNDVDGEIVDATTGKGYGTDTSFKNFDGTLRDSFTD
                     SGASKSEDDIENESCSENGLFVDLDQHEDEDRTEPETELNTVMNTNIHKVNESDKESI
                     ASATSIIILSDYEEKISADEPPNRHTTTNHIFEKVVDRNKLRDDYQDPIPSEVESTEE
                     MDQDDESQSSESDSALSSTSSNSRFGHSSIPNGLEYNPMRMVFNESGHFDDYNSHTAS
                     DTSIPHHDELESKSPRISLDETRVDSQEESQKLKDKMDTASQTRIHESTAESLDISGV
                     EAAENSSEQSVEESIARGEELFDLNNKTNEDKISADYVNKDEIYPTHVDYGHDNLHRE
                     DGAVSEGNSIEKSIRPANTEAMPQRLESLKGERVDTGINKDATKVPEVTNAYTTTHSM
                     ESANDGTHYELPGNIYDFEAIANLAMSQVLSANHLDLQAEDRIDADLGETSKIVQDSY
                     NENPRSEHDYNGENQEDLSDGNIAVYTDDGTDTHQVSVHEGVEDSPKRTQMPLLRKIF
                     KPDAAETDEDTTFSSAADETLYYSVDENLDLTSNSQELPVDEEKQMNLTYEIHFTGSA
                     YSSASSEDNREVLEPPEYVSPLTENPFLTAYEGDPISLLQRTLASIGQAPKVCSQKME
                     STAESTQVQLEEEGSELWKDQGEKMSTNAIERETALNSGSNRSTTSDNVLKSEISVNN
                     EQSRSERSLDASEGAGEILLEELESPVTPCHIVLTKPIIEDSDFENDSAVFENSFIAE
                     LKSGDDTIAEAIEDLYLVETDPVVEFPVISAEAFETSTAAFNIEELQAGDNSISIVEQ
                     GQLSFVIEEPIIELPDAMDEPSIIVEECDVYERAPSTKPLVSSTHNKNEQYYSNFLKK
                     RSFFADEIEKDVKKGHYENKCSAATADGVNNPDIEVESSTKLEKGHGSKLDHRSLSMK
                     VLSSPIRALGTIANHIKNVGNVASDFVKRIDAMDIEEDASSTAVTINESAEKKDQKVD
                     QITANHEEHRKLQDEQLNEQQNELYHNDEKEPWLIKKEEGESADLATGLFDGDWKHEV
                     LNNSNSTNQRDSALSVPSLTRLETSLSVARNGDGSQKSENTQDVISSIEHIQHISDIV
                     DGTPLNLLKSDFLYSSVNNTDVVPHEELNMTVKEDGEAEITINLDKNLNDYLILDDKL
                     NMDELRNEELNTTVQVGGEADITIISDNNTDNISISDEKLTNDEELSDEKMNNEVSKN
                     EKMSSEKSLNDNIKVTGENAQEHSYPAAVSGVTTIDDFENVKSVDIISSSSGSESIRV
                     SEISGSPSGINLTNVAALPDDLLSDPPSEDSPDSEPYDNNNEDADALSSVALEVAVMK
                     QSDGSGKSDDLKTSAASEVLRDVEQEDFSGNDDASTSNEENLRLGMTSNVNNFKSRSK
                     RKRSSHPALVGGKARKRARKLKKSKSNTSYYRNHRKQSKRGQTD"
     gene            <351192..>352550
                     /locus_tag="HG535_0B01880"
                     /db_xref="GeneID:59234811"
     mRNA            <351192..>352550
                     /locus_tag="HG535_0B01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286983.1"
                     /db_xref="GeneID:59234811"
     CDS             351192..352550
                     /locus_tag="HG535_0B01880"
                     /inference="similar to AA sequence:RefSeq:NP_013947.1"
                     /note="similar to Saccharomyces cerevisiae ERG8 (YMR220W);
                     ancestral locus Anc_8.737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142878.1"
                     /db_xref="GeneID:59234811"
                     /translation="MVERRAFSAPGKALLVGGYLVLEPEYKSYVVALSARMHAVVSTS
                     EAIQKGNPSIQVRSSQFNNDCWTYQLQQTNGYSLSERDNKKNPFIEKVLLNVLNYFDP
                     CISNLKDVNIEIFSDSEYHSQSESSLKRNSLKKFAFHTKSITEVPKTGLGSSAGLVTV
                     LTTALASVLRKELNPYSKADLETIHKLAQVAHCQAQGKVGSGFDVASATFGSIIYRRF
                     MPELISNLPDMSVSKIQIYKEKLKHLVDETDWNFTADRIRLPDNLRLMMGDVNNGSET
                     TKLVGKVKAWYREAYPSSSEIYENINSKNSAFIDCLNEINNLSKNKQIYDGMLTAINS
                     GNDEAINSYTALKQIRQSVNGIRENFRLITKESGADVEPLVQTTLLDACMKLNGVLTG
                     VIPGAGGFDAIALLTTDTTDLRSQTDGKHDFKDVSWLDLQQADIGVLEEIPSHYDNLR
                     SD"
     gene            complement(<352610..>353710)
                     /locus_tag="HG535_0B01890"
                     /db_xref="GeneID:59234812"
     mRNA            complement(<352610..>353710)
                     /locus_tag="HG535_0B01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286984.1"
                     /db_xref="GeneID:59234812"
     CDS             complement(352610..353710)
                     /locus_tag="HG535_0B01890"
                     /inference="similar to AA sequence:RefSeq:NP_014922.3"
                     /note="similar to Saccharomyces cerevisiae RFM1 (YOR279C);
                     ancestral locus Anc_8.738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142879.1"
                     /db_xref="GeneID:59234812"
                     /translation="MLRIVPSEIETIKQDSMEGVNNNENNIPSKGSYPDVEKDYTTVN
                     NAGVNSMVEEGKANNESTGEKTSGAAIWNNLFKANKIRDELQTQIRLYAEKIKPIEFE
                     SYHEYFLIKTFKKGKSASGHVDIDSLRRRNSSIYYKKIKMPEYTAPGGYTNSSGTSSN
                     NLLSEEEDEEDQDDADFCVGSGKGDARSYPDDLYGDLGDNVGPARKRRTRAQLAAQIE
                     KDEVENAVSLKSEDAQSKKSPNRDVSYLNISTNNDSENPRRRSSRLSQKFSESKEASS
                     SPDTQPDDRTTNIRDLYESLVPKVRQPYRRSDWILPSKYRYTPEKQMRTRPVYEKVKI
                     NELVASEKIRNVLSRFEGGVAGVRKRGWNTVS"
     gene            complement(<354075..>355655)
                     /locus_tag="HG535_0B01900"
                     /db_xref="GeneID:59234813"
     mRNA            complement(<354075..>355655)
                     /locus_tag="HG535_0B01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286985.1"
                     /db_xref="GeneID:59234813"
     CDS             complement(354075..355655)
                     /locus_tag="HG535_0B01900"
                     /inference="similar to AA sequence:RefSeq:NP_013948.1"
                     /note="similar to Saccharomyces cerevisiae YMR221C;
                     ancestral locus Anc_8.739"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142880.1"
                     /db_xref="GeneID:59234813"
                     /translation="MNWANMSEDKSKRLKIVQITCASIWCLFSAGIVFGFAALKTILI
                     KEGIYADMCQNDIGILKAKGPCVEQDLKLNFLFTAAAGVTNVIALPVGTILDRYGPRV
                     CGIIGAFWIICGSQMFIWSDSLLKYTDPYLTGYILLAVGGPFVFISCFQLANTFPKRS
                     GSILSLITGTFDSSAALFLFYRIIYEKWDSDLHLSKFFKIYLVVPLFIIFCQLFFMPH
                     ESYKTQGNVMKLSVEGLDENGHLLEGDDGSAIIPDQQERQSLLSQETMEQNGILTAQR
                     SRQKSVLETYVEAKLEKKTGGIFGILHGYTVREQLKSPLFYLMVIFTTICMLRINYFV
                     ATIRSQEEYLLGDFEKAATMNSIFDVALPLGGLVSIPLTGIILDHFKTLDTLAIVMGT
                     SITIGILGLIPHSFVSNLIGIVLLVVYRPFYYTVVSDYVSKVFGFDTFGTIYGTLICI
                     SGVLNMFQSVLDAWTHNIFKMNPFPINFVLVLVTIISGSVLLQRAHREVREKQAGKQS
                     LPEEEIASSSNTTTYGTN"
     gene            complement(<355918..>356763)
                     /locus_tag="HG535_0B01910"
                     /db_xref="GeneID:59234814"
     mRNA            complement(<355918..>356763)
                     /locus_tag="HG535_0B01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286986.1"
                     /db_xref="GeneID:59234814"
     CDS             complement(355918..356763)
                     /locus_tag="HG535_0B01910"
                     /inference="similar to AA sequence:RefSeq:NP_014923.1"
                     /note="similar to Saccharomyces cerevisiae FSH3 (YOR280C);
                     ancestral locus Anc_8.740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142881.1"
                     /db_xref="GeneID:59234814"
                     /translation="MASIATKRKVLMLHGFTQSGQLFRSKTGGLRKNLTKLGFELYYP
                     TAPHLVTKALLKRLYGTSENIDGDPLKSPLDLASKFGSSNSTDEIYGWYLKEDPHSAS
                     FDIETSTLTLLHDFVVENGPFDGLIGFSQGAGFGGYLLTNFNELLNLTKQEQPDFQFF
                     ISYSGFKLDDIKYQEAYTRSPISIPSLHVQGELDTVVSEIRVMSLFNACEGGKRTLLK
                     HPGGHFVPNSKHFTVQVCNWIQTTTGNYTNTVDNASAKDVPKESMEPTFDDSFLDAID
                     SMGKI"
     gene            complement(<356955..>357614)
                     /locus_tag="HG535_0B01920"
                     /db_xref="GeneID:59234815"
     mRNA            complement(<356955..>357614)
                     /locus_tag="HG535_0B01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286987.1"
                     /db_xref="GeneID:59234815"
     CDS             complement(356955..357614)
                     /locus_tag="HG535_0B01920"
                     /inference="similar to AA sequence:RefSeq:NP_013949.1"
                     /note="similar to Saccharomyces cerevisiae FSH2 (YMR222C);
                     ancestral locus Anc_8.741"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142882.1"
                     /db_xref="GeneID:59234815"
                     /translation="MARKILALHGLAQSGEYFCSKTKGLRNELEKLDYEVIYATAPNT
                     YSPADIPDDLGDVITSDSAKNVLAWIEDDLQNSTYFLPKATLDYLHDFVIGHGPFEGV
                     LGFSQGAGVAGYLLTDFNGLLNLTEDQQPPLKFFMVFSGFRFAPECYQEQYDKNPISI
                     PSLHVQGELDTITEPYKVEALYNSCKPDTRTFLKHSGGHYVPNSRGFAKKVTEWLNTI
                     N"
     gene            <357962..>359335
                     /locus_tag="HG535_0B01930"
                     /db_xref="GeneID:59234816"
     mRNA            <357962..>359335
                     /locus_tag="HG535_0B01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286988.1"
                     /db_xref="GeneID:59234816"
     CDS             357962..359335
                     /locus_tag="HG535_0B01930"
                     /inference="similar to AA sequence:RefSeq:NP_013950.1"
                     /note="similar to Saccharomyces cerevisiae UBP8 (YMR223W);
                     ancestral locus Anc_8.742"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142883.1"
                     /db_xref="GeneID:59234816"
                     /translation="MTGCRHIQQVFENEKSKEGVLKTCNAARYMLTHFSAKDKYLHAM
                     TCSKCHEINRGTTFMCLQCGFCGCWNNSHFLTHSKKVGHVFGISSSNGLLFCFKCGDY
                     IGDVELIMVSMLNKHWEDVSLKTVVPKMNQRDGLSGLLNMGSTCFMSSILQCLIRNPY
                     FFQFSISHSHTKICPVQDMSSCISCALEQMVHQFYGSPYKHQEPYAGFIGLLTSSWKR
                     NENLAGYSQQDAHEFWQFLLNQIHNDYLRCHNKENDKQHNDVLCECVAHLSFQGLLKS
                     SIVCPACHNIFRTTFDPFMDLSLNIKDKSTLYNCLDSFHKEEQLHDFDYHCDICNTSE
                     DAIKQLSVYKLPPVLVLQLKRSEHLLNGNSVKLDNFVEYPSYLNMKNYLDNEDTMRMT
                     PDVIYELIGVVSHKGSASEGHYIAITKVSGGQWFKFNDSMVYSLTEKEALSEQAYLLF
                     YAALQVN"
     gene            complement(<359403..>360275)
                     /locus_tag="HG535_0B01940"
                     /db_xref="GeneID:59234817"
     mRNA            complement(<359403..>360275)
                     /locus_tag="HG535_0B01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286989.1"
                     /db_xref="GeneID:59234817"
     CDS             complement(359403..360275)
                     /locus_tag="HG535_0B01940"
                     /inference="similar to AA sequence:RefSeq:NP_014924.3"
                     /note="similar to Saccharomyces cerevisiae PLP2 (YOR281C);
                     ancestral locus Anc_8.743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142884.1"
                     /db_xref="GeneID:59234817"
                     /translation="MQNEPMFQVQVDESEDTEWNDILRDKGVIPQRPPSPSEQLEEAL
                     EEALAKQHENRLEDKALSDLEDLEDEEDEDFLELYKRKRLAEIAKMQEKSKFGDVIEI
                     NKPEYHKEITLASIGDTKGKGLASLSIESDSEEDEKKRGSNETTGVYVFVHLSLESKL
                     QSRILANIFRKLSPRFREIKFVEIKATRAIENYPESNCPTLLVYYKGDVVKNMITLLE
                     LGGNDTKLKDFEELMVRVGAVSEKDERLIINQDDEDARESKRLNLAKGGIRSGISGKF
                     NQGIGAEDDDDFFD"
     gene            complement(<360449..>362458)
                     /locus_tag="HG535_0B01950"
                     /db_xref="GeneID:59234818"
     mRNA            complement(<360449..>362458)
                     /locus_tag="HG535_0B01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286990.1"
                     /db_xref="GeneID:59234818"
     CDS             complement(360449..362458)
                     /locus_tag="HG535_0B01950"
                     /inference="similar to AA sequence:RefSeq:NP_013951.1"
                     /note="similar to Saccharomyces cerevisiae MRE11
                     (YMR224C); ancestral locus Anc_8.744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142885.1"
                     /db_xref="GeneID:59234818"
                     /translation="MDYPDENTIRILITTDNHVGYNENEPITGNDSWKTFQEIMMIAK
                     NNKVDMIIQGGDLFHVNNPTKKSLYQVMKSLRLACMGDKPCELELLSDPSKVFHYNEF
                     TNVNYEDPNFNISIPMFAIAGNHDDATGDSFLCPMDILQVGGLVNHFGKVMETDNIKV
                     VPLLFQKGDTKLALYGMASVRDERLFRTFKDGNVTFEVPAMREGEWFNIMCVHQNHTG
                     HSNTAFLPEQFLPDFLDIVIWGHEHECVPHLVHNPTKNFDVLQAGSSVATSLCEAEAQ
                     PKNVFILELKYNLQPKLIPVPLNSVRTFVMRSVALRDVPHLRPHDKEGITRHLVEQVE
                     EMISEANEQTKEKIADEYSNVNDNDIDPQIPLPLIRLRVDYSGPLHDLASIDYQVENP
                     RRVSNKFVGRVANSNNVIQFFKSKKRHLTTTKRNKRTASSDKDIETLIDEAGGELEVQ
                     TLVNDLLAKMQLSLLPEVGMNEAVKKFVEKDEKLALKDFIDREIDNEVDILFSNKDFL
                     QTNNPEHIKSLIKQVKRSNNSVPFTPQQTAAAEDLLSANIDAESSNSEEHESNEDIVL
                     SHEDGLGKKPARGNTESTRKKKPQPETSSIILLEEADEANNIDERVFSEEDEDMTARR
                     NTQNKTKASRAISTSSTKRISGSKAKSSRTPKTDILSSLLARKRR"
     gene            <362612..>363310
                     /locus_tag="HG535_0B01960"
                     /db_xref="GeneID:59234819"
     mRNA            <362612..>363310
                     /locus_tag="HG535_0B01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286991.1"
                     /db_xref="GeneID:59234819"
     CDS             362612..363310
                     /locus_tag="HG535_0B01960"
                     /inference="similar to AA sequence:RefSeq:NP_014926.1"
                     /note="similar to Saccharomyces cerevisiae YOR283W;
                     ancestral locus Anc_8.745"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142886.1"
                     /db_xref="GeneID:59234819"
                     /translation="MTKDIPYYCDNEDSNIIRLFVIRHGQTEHNVQKILQGHQDTDLN
                     RTGIAQAAKLGDYLEKSNIKFDKVFSSDLKRCKQTIQKVLETSGQANISVEYCKGLRE
                     RCMGVIEGMHITDAEAYASKHGKGSFRDFGESPDDFLERLTSCLGKCIADSIAENSQV
                     ANLAVVSHGGAIRTLLRWLHYEEGNAHNIIVFNTSVTIIDYFRQTGEFVVRRVGNTQH
                     LGDGEFVVSDLRLR"
     gene            <364791..>365210
                     /locus_tag="HG535_0B01970"
                     /db_xref="GeneID:59234820"
     mRNA            <364791..>365210
                     /locus_tag="HG535_0B01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286992.1"
                     /db_xref="GeneID:59234820"
     CDS             364791..365210
                     /locus_tag="HG535_0B01970"
                     /inference="similar to AA sequence:RefSeq:NP_014928.1"
                     /note="similar to Saccharomyces cerevisiae YOR285W;
                     ancestral locus Anc_8.746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142887.1"
                     /db_xref="GeneID:59234820"
                     /translation="MWKTIVDAWNGNNEEEHNYGTTKVFDFEGMKNLIKRKDPSIVLV
                     DVREPAECEVVKIPGSINVPFRSHPQGFSLGDGEFLSTFGIPKPTKDKELVFYCASGR
                     RAASAESVAEKSGYTHTALYPGSINDWVARGGDKAYF"
     gene            <365411..>365851
                     /locus_tag="HG535_0B01980"
                     /db_xref="GeneID:59234821"
     mRNA            <365411..>365851
                     /locus_tag="HG535_0B01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286993.1"
                     /db_xref="GeneID:59234821"
     CDS             365411..365851
                     /locus_tag="HG535_0B01980"
                     /inference="similar to AA sequence:RefSeq:NP_014929.3"
                     /note="similar to Saccharomyces cerevisiae YOR286W;
                     ancestral locus Anc_8.747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142888.1"
                     /db_xref="GeneID:59234821"
                     /translation="MLRLHCVRRICPSQVFLRTLSSNNPKVYSFDDVRKMVEHTPKST
                     VLVDVREPRELESYEMPNAINIPLQSAPGALSLNNNEFEELFHFPKPPKDKELVFFCL
                     KGIRAKAAEELARSYGYEKTAVYPGSISEWLAKGGEKVKPKNEP"
     gene            complement(<365913..>366800)
                     /locus_tag="HG535_0B01990"
                     /db_xref="GeneID:59234822"
     mRNA            complement(<365913..>366800)
                     /locus_tag="HG535_0B01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286994.1"
                     /db_xref="GeneID:59234822"
     CDS             complement(365913..366800)
                     /locus_tag="HG535_0B01990"
                     /inference="similar to AA sequence:RefSeq:NP_014930.1"
                     /note="similar to Saccharomyces cerevisiae YOR287C;
                     ancestral locus Anc_8.748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142889.1"
                     /db_xref="GeneID:59234822"
                     /translation="MSYFFKSIQPGYESASDEEHFEEIIKRRASKVDNNANDSSDDEL
                     KTLTFGSLKKADTMLLESEKDERKKSIPQKDYKEKSFEPNSEESESESNSDEGDFFED
                     DQIRNSSSKRSTKKGKHAPKEHSSKKRVPKIRDIPGLDIPKNRNSNLYQDIRFDKSTG
                     EPQNDVATRKNYKFLDEYRSKEIKELESLLKDKKFLSKVSTFEVQEMNEQLKSMKSKL
                     QTLQNKELERQIIQDYERDINKDNKNKFHLKKNDRRKVIQKWKFDHMKSQQREKVMER
                     KRKKRLGKEFKQFEFHKTR"
     gene            complement(<367151..>367536)
                     /locus_tag="HG535_0B02000"
                     /db_xref="GeneID:59234823"
     mRNA            complement(join(<367151..367389,367479..>367536))
                     /locus_tag="HG535_0B02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286995.1"
                     /db_xref="GeneID:59234823"
     CDS             complement(join(367151..367389,367479..367536))
                     /locus_tag="HG535_0B02000"
                     /inference="similar to AA sequence:RefSeq:NP_013952.1"
                     /note="similar to Saccharomyces cerevisiae MRPL44
                     (YMR225C); ancestral locus Anc_8.749"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142890.1"
                     /db_xref="GeneID:59234823"
                     /translation="MITKFFAKVVVRFNPFGTEAKTARLLLSAIPPAQRIQGAQIQNE
                     VLTSDSVKVPTVKITFKDKTEMEVDPRTTSFQEISNIFDRHSRKLSLKESIENS"
     gene            complement(<367783..>368742)
                     /locus_tag="HG535_0B02010"
                     /db_xref="GeneID:59234824"
     mRNA            complement(<367783..>368742)
                     /locus_tag="HG535_0B02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286996.1"
                     /db_xref="GeneID:59234824"
     CDS             complement(367783..368742)
                     /locus_tag="HG535_0B02010"
                     /inference="similar to AA sequence:RefSeq:NP_014931.3"
                     /note="similar to Saccharomyces cerevisiae MPD1 (YOR288C);
                     ancestral locus Anc_8.750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142891.1"
                     /db_xref="GeneID:59234824"
                     /translation="MLVLRWILFVVCQILPVVWCQNFYDNDPNIIELTPRNFDKVIHR
                     TNYTSVVEFYAPWCGHCKQLKNTMKKVAKSLDGVVQVATVNCDLAKNKQLCAQHKIEG
                     FPTILIFRPPKIDITTSKPQHLPRTHAFEVYMGKRKLAAIADFALSRMKSYVKKLFGL
                     TKLESVLKSSPRKKILLFSSRGDVSPTFKSIALDWLFEFDCFTVQNEKLAPLTDSVEL
                     QDSFPEIYKSLQSLIPTQRKSKTSMLVVIDPNDDKMYVYEGESVSKTEIAKFLYEEFE
                     VKPREGPLSERANYLEALKKGDKKKTRAEGKPKSAKKIVNDEL"
     gene            complement(<368931..>370406)
                     /locus_tag="HG535_0B02020"
                     /db_xref="GeneID:59234825"
     mRNA            complement(<368931..>370406)
                     /locus_tag="HG535_0B02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286997.1"
                     /db_xref="GeneID:59234825"
     CDS             complement(368931..370406)
                     /locus_tag="HG535_0B02020"
                     /inference="similar to AA sequence:RefSeq:NP_011636.3"
                     /note="similar to Saccharomyces cerevisiae MEP1 (YGR121C)
                     and MEP3 (YPR138C); ancestral locus Anc_3.475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142892.1"
                     /db_xref="GeneID:59234825"
                     /translation="MAEGYVWTESYDEGTVGFIILGAALVFIMVPGLGFLYSGLARRK
                     SALSLIWAVIMATLVGMVQWYFWGFSLAFSKTAPNNKFIGNLDSFGFRNVYGKADPEA
                     AYPELAFAVFQMMFMCVTLSIVAGATAERGRLLPHMVFLFVFATVVYCPIAYWVWAPG
                     GWCYQWGVLDWAGGGPVEVLSAVGGFVYSYFLGKRNESLLINFRPHNVSMVTLGTSLL
                     WFGWLLFNAATSLSPNLKSVYAFMNTNISAATAGMTWCLLDFRLERKWSTVGLCSGII
                     SGLVAATPSSGCITLYGSFIQGIIAGIVCNFSTKIKYYLKVDDAMDILAEHGIAGVVG
                     LIFNALFGADWVIGMDGVTSHKGGWISHNYEQMYKQIAYVAACVGYCAVVTAIICFVI
                     DKIPGLQLRITEEAEARGMDEDQIGEFAYDYVEVRRDYSQWGFDSGNNQEEDGEEGEE
                     EEHEMHRLHGRQVDTTTSSSGEANDDISHSEKKANALPSTT"
     gene            <371493..>372734
                     /locus_tag="HG535_0B02030"
                     /db_xref="GeneID:59234826"
     mRNA            <371493..>372734
                     /locus_tag="HG535_0B02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286998.1"
                     /db_xref="GeneID:59234826"
     CDS             371493..372734
                     /locus_tag="HG535_0B02030"
                     /inference="similar to AA sequence:RefSeq:NP_011637.3"
                     /note="similar to Saccharomyces cerevisiae YGR122W;
                     ancestral locus Anc_3.476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142893.1"
                     /db_xref="GeneID:59234826"
                     /translation="MRSKDVERVFNKGLSLKYPEALEGLENCPSAEIVLQRNECIRAV
                     ADAKGALDWLSRIDLLLNYAGALLQLLQDSSGSAVSSLATDLVITLLNASGYYQEISL
                     DTMERAYGTAMATSMWSTSGLYLRKGLGLLQFTLAPPISDITSCLSQTLKLRISSTIN
                     EMIMEFQFVQQIGIVVLSLSKLRSRVHKERKDAMLDIQEGDLNDLSRNSLVYAKLVIG
                     CLETSSRYSNDCGNIINKSGMAYLNSLIFLLLSLDQYSKDECGVSVGMIDMSISYLQK
                     LVPKSQLEASLLLEKRKKRDILKSAFQKNEIKNKTIRTSLDIWSKKSKNNQLLPLLKL
                     TLDDFLIQLAILLRYRYVQTNEKLSFKPIVSDESTLRKLFPRSVASELQGSEWVFDRE
                     TRSLQEVSATPYTETNANDYY"
     gene            complement(<372735..>373601)
                     /locus_tag="HG535_0B02040"
                     /db_xref="GeneID:59234827"
     mRNA            complement(<372735..>373601)
                     /locus_tag="HG535_0B02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037286999.1"
                     /db_xref="GeneID:59234827"
     CDS             complement(372735..373601)
                     /locus_tag="HG535_0B02040"
                     /inference="similar to AA sequence:RefSeq:NP_015465.1"
                     /note="similar to Saccharomyces cerevisiae VPS66
                     (YPR139C); ancestral locus Anc_3.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142894.1"
                     /db_xref="GeneID:59234827"
                     /translation="MEKFTNWRDRGTGIAPFLPPSVSAPGFGAKLVLGLTLLVKSLFI
                     LPLLVICAITRSKSVLKLILLILFNCKVDVTIHGVKKRDMQGAKHYPQKDKLYMCNSS
                     SPLDALALSLIALDQSLFLIPFEKTIYKMSREKYMDFVLDGSLNAKKYGQEVSSMDQL
                     KGYVLFMFPEGTSSNGKSILPFQVDVDSMQEFLGYSSNSATLVQTIHIKINGTLVTPL
                     TITKSKYIVRMLIKGVNIKIKINEPQSIFPIDDVRINMNDGNKFKLVSKTLDIESKGR
                     FAQEFFRSVPKN"
     gene            <373686..>374969
                     /locus_tag="HG535_0B02050"
                     /db_xref="GeneID:59234828"
     mRNA            <373686..>374969
                     /locus_tag="HG535_0B02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287000.1"
                     /db_xref="GeneID:59234828"
     CDS             373686..374969
                     /locus_tag="HG535_0B02050"
                     /inference="similar to AA sequence:RefSeq:NP_015466.1"
                     /note="similar to Saccharomyces cerevisiae TAZ1 (YPR140W);
                     ancestral locus Anc_3.478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142895.1"
                     /db_xref="GeneID:59234828"
                     /translation="MAWVYCATKKKRLHHHQHSINQYTLCQTFIVFIMSLPNVLARGD
                     EFLGEYPRNSTLWRFFSYGTCVFTIGMSKLILKSLYNVKLDHMDRLDNAINRSQSENR
                     GLLTIMNHMSVIDDPFIWGIFPWRIYKDLDSVRWCLGANNVCFQNKILATFFSLGQVL
                     STERFGVGPFQGSIDAAIRLLSPDDTLDLEWTPYSETPNKLVLPQKAGSLVKTIKEDY
                     LPPIKRYKPSWMHVYPEGFVLQLHPPFSNSMRYFKWGVSRMILESTVAPIIVPIFTTG
                     FEKIASEEAAGSTIKRYIPTNFGAEIKVTVGNTIEDNVIEKYREEWRQLVDKYYDPKN
                     PVDLTQELKYGKEAQDLRSRLAAELRKYIAQIRHDECKFPEEDARFQSSAWWKSYTLT
                     EGASDPDVKFIGKNWAIRRLQKFLTKQEENDRSSR"
     gene            complement(<375056..>377206)
                     /locus_tag="HG535_0B02060"
                     /db_xref="GeneID:59234829"
     mRNA            complement(<375056..>377206)
                     /locus_tag="HG535_0B02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287001.1"
                     /db_xref="GeneID:59234829"
     CDS             complement(375056..377206)
                     /locus_tag="HG535_0B02060"
                     /inference="similar to AA sequence:RefSeq:NP_015467.1"
                     /note="similar to Saccharomyces cerevisiae KAR3 (YPR141C);
                     ancestral locus Anc_3.479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142896.1"
                     /db_xref="GeneID:59234829"
                     /translation="MAELPTTPTRTRNYYSSIPSPKAGSYSPVQYKRRDANAKSSSSS
                     GAIPYDRDEENLGSNDCTAAKSFGSSCSTHLTSFYKENIRELNQLQDILFQKKAMLDS
                     LNDELSECRLKYNNAESKWETLREEKASKIRQLQLKSNELIKLKQEQSIQRAFVTQGH
                     ELNLQQLKAKNEAEVNKRANEYRETVEMLRYSKIRKFQQDRDALLDRVEGIRNAILTN
                     NNTLQDMLKQKDMKHCISKEKWLEQYQEKWKENVKINEAYSSKNDTLNVEIIESLKPE
                     VGKKRRKLEELTIEQDNLSKSLEINKMANVRLNDEVVSKIDDIDKLQQEKEQLQEYIK
                     NTEVELQQIHEILMKEESMRRSLHNELQELRGNIRVFCRVRPALSHENSRSENICVRR
                     FDDSAGTQTIDIQKEKRGSAPYTFKFDRIFDQSETNNDVFEEICQLIQSSLDGYNVCI
                     FAYGQTGSGKTYTMLNPRDGIIPSTIAHIFNWIDALKERGWQYEISCQFVEIYNDVIA
                     DLLRNENSVENGQEDGHRNVRHEIRHDQENKTTIITNVTSCQLQKPESVEGLLRKANK
                     LRSTASTAANDRSSRSHSIFIIHLNGVNKISGEESSGVLNLVDLAGSERINTSQVVGE
                     RLRETQNINKSLSCLGDVIHALGSPDASKRHIPFRNSKLTYLLKFSLMGNSKTLMFVN
                     ISACSENINENINSLRFASKVNSTRLVTRKIDDQ"
     gene            <377561..>378289
                     /locus_tag="HG535_0B02070"
                     /db_xref="GeneID:59234830"
     mRNA            <377561..>378289
                     /locus_tag="HG535_0B02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287002.1"
                     /db_xref="GeneID:59234830"
     CDS             377561..378289
                     /locus_tag="HG535_0B02070"
                     /inference="similar to AA sequence:RefSeq:NP_015469.1"
                     /note="similar to Saccharomyces cerevisiae RRP15
                     (YPR143W); ancestral locus Anc_3.480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142897.1"
                     /db_xref="GeneID:59234830"
                     /translation="MVSKGKLGGLTHERGKNSKRSATSDKETSSDRKPEGVKNDGGNE
                     SAHESTIESSASESDEDSEVDVTDSSDEEEDQFPLKKKSKKSKHDDGSNDFSGAVNAI
                     LSSHLKAYDRNDPIMARNKKVLKQNESDKLEQKAKKALLAEKKKKLEKARNKDVIPKI
                     TDDAQSGEEIRKVLERETRLRKIARKGAVKLFNAILSTQVKTEKDAKTKFGDIKNVHE
                     REQLITDVSKERFLDMVKAAGEED"
     gene            379539..379610
                     /locus_tag="HG535_0Btrna4R"
                     /db_xref="GeneID:59235349"
     tRNA            379539..379610
                     /locus_tag="HG535_0Btrna4R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:59235349"
     gene            complement(<379851..>381398)
                     /locus_tag="HG535_0B02080"
                     /db_xref="GeneID:59234831"
     mRNA            complement(<379851..>381398)
                     /locus_tag="HG535_0B02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287003.1"
                     /db_xref="GeneID:59234831"
     CDS             complement(379851..381398)
                     /locus_tag="HG535_0B02080"
                     /inference="similar to AA sequence:RefSeq:NP_011639.3"
                     /note="similar to Saccharomyces cerevisiae PPT1 (YGR123C);
                     ancestral locus Anc_3.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142898.1"
                     /db_xref="GeneID:59234831"
                     /translation="MLNMPSTVAEDAAKAVELKNEGNVQIKKLNYPKAIEFYTMAIEL
                     DGTQSIYFSNRALAHLKLDNFQSSLHDCETALKLNPKNIKAYHRRGLSYVGLLEFKKA
                     RNDLQVVLKGKPGDTTATRALEVCEKFIREERFRKAIGDDGESNKARFCETVRLDTFD
                     SNADLLKYEGPKLTLFQLSDEKGDCAGAEISDMNPEFISKLVEMFTQGKNLPKKYAAA
                     IVSHANRLFRKEPTVVELCNRETPDAKITVCGDTHGQLYDVLNLFRKFGKVGPKHTYL
                     FNGDFVDRGSWSCEVALLFYCLKIVYPHNFYLNRGNHETNNMNKIYGFEDECNYKYSS
                     RIFDMFAESFESLPLATIINDDYLVMHGGLPSDTSCSLEDFKKIDRFSQPPREGAFME
                     LLWSDPQEADGFGPSQRGLGFAFGADITKQFLEKNKLKKIFRSHEVRMSGVQFEHDGK
                     LATVFSAPNYCDTQGNLGGVIHVVPGEGKLLQNGNDDENLIVETFEAVPHPEIKPMAY
                     SNGGLGF"
     gene            381644..381717
                     /locus_tag="HG535_0Btrna1I"
                     /db_xref="GeneID:59235328"
     tRNA            381644..381717
                     /locus_tag="HG535_0Btrna1I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:59235328"
     gene            complement(<381860..>383500)
                     /locus_tag="HG535_0B02090"
                     /db_xref="GeneID:59234832"
     mRNA            complement(<381860..>383500)
                     /locus_tag="HG535_0B02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287004.1"
                     /db_xref="GeneID:59234832"
     CDS             complement(381860..383500)
                     /locus_tag="HG535_0B02090"
                     /inference="similar to AA sequence:RefSeq:NP_015470.1"
                     /note="similar to Saccharomyces cerevisiae NOC4 (YPR144C);
                     ancestral locus Anc_3.482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142899.1"
                     /db_xref="GeneID:59234832"
                     /translation="MVLEIDEVKKIAKQITSANDKRHYNSIIKLINGLTVEDTSILKE
                     DSVERNIRFLTVAVHQIFKKLFDRGDLTLDSATRRNRELLQFTQWLRKAYESFKRKIL
                     LLIAETPFETSLALDCQDVYIQLLESESIHFASNEDTPFFPNKSLKNLIVALWQSDLA
                     ETEQDTRTGQSENTILKEFLEKYYSSYVDIQYYFQTEFKQLLEDEREKYTSNKSIAKW
                     LTLVNNHCHCSESNNELEVFVPNPPTAINSVSKYKSNIEKNWLVLLGGELSLQQYKTI
                     LLVLHKRIIPHFHEPTKLMDFLTDSYDLQATANSGDVVPILALNGLFALILRYNLEYP
                     NFYAKLYQLLTPNLFHVKYRARFFRLMDTFLASTHLSAHLVASFIKRLARLTLSAPPG
                     AIVSVIPFVYNLLRKHPSCMIMLHNPAFISSPFMSTDDVQKLKNLKADYRDPFDASEP
                     NPENTKALDSSLWELATLMDHYHPNVATLAKMFGQPFRKLNYNMEDFLDWSYDSLLAA
                     ETSRKLKVLPTLEYEAFDRLFEDDDIEEKKSFLAGVTW"
     gene            <384593..>386314
                     /locus_tag="HG535_0B02100"
                     /db_xref="GeneID:59234833"
     mRNA            <384593..>386314
                     /locus_tag="HG535_0B02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287005.1"
                     /db_xref="GeneID:59234833"
     CDS             384593..386314
                     /locus_tag="HG535_0B02100"
                     /inference="similar to AA sequence:RefSeq:NP_011640.1"
                     /note="similar to Saccharomyces cerevisiae ASN2 (YGR124W)
                     and ASN1 (YPR145W); ancestral locus Anc_3.483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142900.1"
                     /db_xref="GeneID:59234833"
                     /translation="MCGIFASFRNEDVLSYKPKALQLSKRIRHRGPDWSGNITKNSTI
                     LVHERLAIVGLDTGAQPITSPCGDYILCVNGEIYNHIQLREKTPEYGYKTLSDCEPII
                     PMYLKHDIEAPDHLDGMFAFCLYDAKQDRIVAARDPIGVVTMYMGRSSKSPKTVYFAS
                     ELKCLTDDCDNIIAFPPGHIYDSKTDKITRYFNPDWLDEDRIPSTPLDLKQVRYSLER
                     AVRKRLMAEVPYGVLLSGGLDSSLIASIAARETEKANKEMSPSQYDSEESHLAGIDKD
                     GNLHSAGWSRLHSFAIGLPDAPDLKAAKKVAKFIGSIHHEHTFTLEEGLDALDDVIYH
                     LETYDVTTIRASTPMFLLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSASEFHTE
                     CVKRVKNLHLADCLRANKSTLAWGLEARVPFLDREFLQLCMNIDPKEKLINQKEGRIE
                     KYILRKAFDTTDEPDVQPYLPEEILWRQKEQFSDGVGYSWIDGLKDTADRVVSDEMFA
                     APKSSWGDDIPTTKEAYWYRLKFDALFPQKTVADTVMRWIPKADWGCAEDPSGRFAKI
                     HEQHVDN"
     gene            <387641..>390772
                     /locus_tag="HG535_0B02110"
                     /db_xref="GeneID:59234834"
     mRNA            <387641..>390772
                     /locus_tag="HG535_0B02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287006.1"
                     /db_xref="GeneID:59234834"
     CDS             387641..390772
                     /locus_tag="HG535_0B02110"
                     /inference="similar to AA sequence:RefSeq:NP_011641.1"
                     /note="similar to Saccharomyces cerevisiae YGR125W;
                     ancestral locus Anc_3.485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142901.1"
                     /db_xref="GeneID:59234834"
                     /translation="MPGISPTGMSASNRNPRKNRQSISEAISISLGLHKSESPQDGDG
                     LLSSENEQSNWATPQGNNYLGRSYVSGFLSASSFPNGFDSDALPLSRLRTKSIHASQN
                     LHKETAKLSNDFNGDEAEDDRYDELGAHDNAEDYGDYKDNYLENNNDERSFSDFYDRN
                     ERGDAISDEYESLVHGPGQTYQAVTSSTEGSSSGLRRSASNSAVVNHISNFCYKFIHY
                     LPAAILGLLLNILDALSYGMIMFPITDPVFSSLGPSGLSIFYISTVISQVTYSSGFSS
                     FVSGIGSEMIEVTPFFHNMALAIKESLPGKDDEIITTTIFCYAFSSIITGATFYLLGK
                     LKLGKIVGFFPRHILIGCIGGVGYFLIATGIEVTTRVPSVEYTWHFLANLFSNVDILL
                     KWGLPALLTAILIVTQRCFQNALVLPSFYIVTLFAFHFIVAITPSLSLSKLREIGWIF
                     PVAASSDKWYDHYKLFDFTKVHWNLVLKQFPTMLALTFFGILHVPINIPALAISLKQD
                     KIDVDKELIAHGYSNFFSGLLGSIQNYLVYTNSVLFIRAGADSAFAGYLLAALTFAVM
                     IIGPVLISFIPICIVGSLIFLLGYELLYESLFETLGKVTTFEYITIVIIVLTMGIFDF
                     VLGVIVGVLIACFSFLFDSAKLKTINGEFDGQVAKSTVYRDYLQTHFLDGVGEQIYVL
                     KLQNVLFFGTIISIEEKINKLLEDTDAKDSKKRRIKYLILDFKNINSDNIDYSAAEGF
                     NRIKRFTQSERIQLIVSSIQERDHIYSAFSKVGLLDDVELFSDLNSALEWCENEFLTK
                     YQRLRSIAKKKQQKKMDVNLAIRKATDRKISLDGLLKKNDGVISQSRNSISFPDNTPR
                     NHQMLSVAQNLFKSEQQTRNSLRAPGQETPLVLPLLLFALKLYIPSLISEDPSVRGKE
                     VQLWSQLCPYFIKRRLASQSILLHNDNIFFVIESGLIKITFDLPSGTLYETMSNRTCY
                     GKASSKDFSSGKDQKATIITETDAVVWIIDSSALNKLRDNNLPLYTDLILLILSIRDK
                     RFKELLGYTLVCS"
     gene            <391169..>391825
                     /locus_tag="HG535_0B02120"
                     /db_xref="GeneID:59234835"
     mRNA            <391169..>391825
                     /locus_tag="HG535_0B02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287007.1"
                     /db_xref="GeneID:59234835"
     CDS             391169..391825
                     /locus_tag="HG535_0B02120"
                     /inference="similar to AA sequence:RefSeq:NP_011642.3"
                     /note="similar to Saccharomyces cerevisiae YGR126W;
                     ancestral locus Anc_3.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142902.1"
                     /db_xref="GeneID:59234835"
                     /translation="MSKSKGSNSTDTEFDDISSFSSIDSYKPQPFTGFENGEEQGQGQ
                     LQEQGDLVSRASTNTLSKPDSNAIEKVVTHNALSGNVETKESLQKEGLNLKDKSVPDI
                     NAPLTSTSETAAFPEEYRIETQTGLVKLKTLNDLSRKDTRVSIGSNDKISRKSTDKGN
                     HSIKSGQESGQDEVLSSHSSYDPHNLENAIEKNKHEIEKYQKHKHEKGIKGFVHRLFD
                     "
     gene            <391997..>392929
                     /locus_tag="HG535_0B02130"
                     /db_xref="GeneID:59234836"
     mRNA            <391997..>392929
                     /locus_tag="HG535_0B02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287008.1"
                     /db_xref="GeneID:59234836"
     CDS             391997..392929
                     /locus_tag="HG535_0B02130"
                     /inference="similar to AA sequence:RefSeq:NP_011643.1"
                     /note="similar to Saccharomyces cerevisiae YGR127W;
                     ancestral locus Anc_3.487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142903.1"
                     /db_xref="GeneID:59234836"
                     /translation="MCILMATTSHPDYDLILISNRDEFFARETGCTRWVDNDFVLCPT
                     DDALVNHDGYTCGTWFGINRDGKLATVLNLKLLDQPAVVVGQHSLKSRGILPISYLSK
                     RQSSFSNWDNFAKFNNQYPHLADTGSFNLFYGDCITGDYRIIDSLGNTFGVLNRDTKD
                     DFMVLSNDVYQNGESQNTWGKVKLGKDGLRELVSASRNESERSLIANCFALASRCSVD
                     TKQRNGSEITYSIDTTMNTIFTPPLKVPSSDDLGCSMPYGDYYGTRSQIVLLIRRGLN
                     HVKCIERTLHSSDSDCNTYGASNPKATQEFDFTL"
     gene            complement(<392988..>393920)
                     /locus_tag="HG535_0B02140"
                     /db_xref="GeneID:59234837"
     mRNA            complement(<392988..>393920)
                     /locus_tag="HG535_0B02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287009.1"
                     /db_xref="GeneID:59234837"
     CDS             complement(392988..393920)
                     /locus_tag="HG535_0B02140"
                     /inference="similar to AA sequence:RefSeq:NP_015473.1"
                     /note="similar to Saccharomyces cerevisiae YPR147C;
                     ancestral locus Anc_3.488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142904.1"
                     /db_xref="GeneID:59234837"
                     /translation="MNIETYPHSQYPTSILHIEPHNAHAAKLDSPLFVWIPGNPGLLE
                     YYEEMLKMIHRNNPEWEILGISHAGMSPGNPLLGKGSKNTKIYTLEEQIEHKIEVVNN
                     FSSPGRPILIMGHSVGAYIIQKVIISKCLIGRVIKLGMLTPTIIDIHTSEKGVLFTKL
                     FRWVKNLPQLAAWGSDLLFNKIVPRFCIKPFLSFVMGCKRDSRAVDASSLLLHNSGFV
                     MQALGLAQYEMEIIRSDWQFQRELLDLCRTEDISIWLLFGNSDHWVSDETRRQLIHFY
                     QEVHVRPNISIQVSSVIPHSFVIDHSQYVVDNYF"
     gene            complement(<394082..>396076)
                     /locus_tag="HG535_0B02150"
                     /db_xref="GeneID:59234838"
     mRNA            complement(<394082..>396076)
                     /locus_tag="HG535_0B02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287010.1"
                     /db_xref="GeneID:59234838"
     CDS             complement(394082..396076)
                     /locus_tag="HG535_0B02150"
                     /inference="similar to AA sequence:RefSeq:NP_011644.3"
                     /note="similar to Saccharomyces cerevisiae UTP8 (YGR128C);
                     ancestral locus Anc_3.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142905.1"
                     /db_xref="GeneID:59234838"
                     /translation="MPSISQPFRLAILPRLTSLTDTSVQTNHIQVADDLFPASNKITI
                     GISESAISQYILNPTPKLVFSIPIPSTNVVTACDIAQLEENLEQDKRKLQEIWCYALK
                     AGKNYTLNVVINDADSESILNSSGELNGSKKLRLKDEVVNLKIQNETIVAVLKCGLIL
                     TYDYDLKLLHSMDVLYGNVTVVNHFKEKEKTFMFVMCSLEESKVCFKLFELYTQELTS
                     VPIMELSSIILEDFELIKSKICYQSGRLYRLIGDQMLTYSLPHCQLLQKVQIPMVSES
                     QVISMNPVSPNRILLTLDNIIYLLDLMHNSILFQRELTHVKSFQILKSAVINSQIGSN
                     ASNNKTIAIGVANKQDSNSTCSLEMINVDVGTGTVKDSLGKSFQIFNQSAKSYALEPL
                     LTNEELSSLNDDERSRQGNNFDFDDIYRQLVKCGKSASSFDDVFLNELKIRREHYTEE
                     DRYICDQEFLSKVVNLIFENFQKEYPKSLTFLLTHPLFPVDCTRKLLSRLSEHPRLFK
                     QAIVTCPNLPLKELLFELFSIQNGELSLDISLRILQDYTTDMIRDEIKKLSKIEIQNF
                     IDFLINSKDTEIVSNGRQLFQLLSLILDSIGLLTLEGSMLARLSEYIDQQVVIAERNT
                     NSWYLLDDRQAPRVGTFASNSFAKVQKEPAPRYSVEYLDI"
     gene            <396330..>396935
                     /locus_tag="HG535_0B02160"
                     /db_xref="GeneID:59234839"
     mRNA            <396330..>396935
                     /locus_tag="HG535_0B02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287011.1"
                     /db_xref="GeneID:59234839"
     CDS             396330..396935
                     /locus_tag="HG535_0B02160"
                     /inference="similar to AA sequence:RefSeq:NP_011645.3"
                     /note="similar to Saccharomyces cerevisiae SYF2 (YGR129W);
                     ancestral locus Anc_3.490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142906.1"
                     /db_xref="GeneID:59234839"
                     /translation="MDLAEYRARLRELKKMSTQVTMKNLKMVDEEAKQLAMKGKPKVY
                     KMDEEDPAEGVKEKEQKNHREKLMNYNMKEYEEWELGQQRRNARGEHGGNADLQEIAK
                     YSYDKQLKQNQCITPVSTSSKRTHKIHKDYATGKVRLPDNKNLVNQLAKDSKHLATKR
                     YTARSKEIERNAIRNTPGGYINVKNKQFNEKLDRQLKKRDT"
     gene            complement(<396945..>398171)
                     /locus_tag="HG535_0B02170"
                     /db_xref="GeneID:59234840"
     mRNA            complement(<396945..>398171)
                     /locus_tag="HG535_0B02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287012.1"
                     /db_xref="GeneID:59234840"
     CDS             complement(396945..398171)
                     /locus_tag="HG535_0B02170"
                     /inference="similar to AA sequence:RefSeq:NP_015474.1"
                     /note="similar to Saccharomyces cerevisiae YPR148C;
                     ancestral locus Anc_3.491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142907.1"
                     /db_xref="GeneID:59234840"
                     /translation="MTDYFSDFSLNKITNSIASAAHKTQDTLSQAISNVNLRDPHANL
                     SIKTRTRYLQELLGTVDEISKLPPQYESLEKKTDALEKSCRRVLTVTKTFELEGYDYP
                     PNLTESISDWWSFGKEGWFGTSSKKPEKGSINENEKSEPFMPRSFAQALSKAAHDSST
                     VFLNSAQVDHSGEQAAKNDVEADFDEDFADAEDVKKMLETFSVCYKNIDENKHEMDTS
                     IAKEFNTKLEKLINEDFKKVHELRKKVEDSRLKFDTVLYEIKLKRKKLEEKSNALSNF
                     DKKINSNGETEGSEISQNGEAKKEAIEDTNVSASKVEAELKDEVKTEVKDNKKAGGEQ
                     ETEALSEDDKLLEQLEDEFVSNTTAAVEVMGEITDCSELLSLLKLFQNFQLVYYRQCV
                     VELENSLKSLTELEDE"
     gene            complement(<398440..>400674)
                     /locus_tag="HG535_0B02180"
                     /db_xref="GeneID:59234841"
     mRNA            complement(<398440..>400674)
                     /locus_tag="HG535_0B02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287013.1"
                     /db_xref="GeneID:59234841"
     CDS             complement(398440..400674)
                     /locus_tag="HG535_0B02180"
                     /inference="similar to AA sequence:RefSeq:NP_011646.1"
                     /note="similar to Saccharomyces cerevisiae YGR130C;
                     ancestral locus Anc_3.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142908.1"
                     /db_xref="GeneID:59234841"
                     /translation="MTTVARASNGNDGASESLEEELEYVSPFRDATAVQIAQRRRLAR
                     YPTTSATSGYTMVNPSDMGYKTLGDQQQRAKDIAFPVYLSNNEKRQALLLEKLRAKEA
                     HLKYLRDSQVLTDLRPNEEKLESDETALSRDGDEAEDEDAEKESANAKSEDEGKDAVE
                     VAPLVEAKHDAAAVDVGHAEVDEAVEEAVAPETTAEDKPEASLAVGEAAAPETTEGDE
                     VEDEEAVAPETTEEEKPGGEETAAEVAAPESVVEDKSEVPEEDHTSDVLSPPIDPHLA
                     PRVPIPEETEKAFKIPWFRSSSKSKGEYPVATPENPEEIVITAQEGHLNKAVYDKIQY
                     ESKVHYQWLTDFNKIEEEKYYNKKLDYSNKLKAVQLEIDEIHSQMDQLKKETSKTLDI
                     FEAELTRKMLDSTQVHVNKKHKIFKETDTLRNQKSLQKDTVLIKSEELQKEIDDLNES
                     KSGVQAEYIGWTNRLADLSAHIDAKVSKVLAITEQSKKTQSEIDKLKETKNQLILETE
                     NNNVQHEENKKVLEDVKNKAYLPQINEIDNQINDLLSKMALIKQEGANERIELSAITK
                     RVEEERRAHEEKLMLEAEERKRKEEDLLNKQRLELEKVAEEQKLQHEEELQKLKVSYE
                     ELEAKLLEQETRHNELQDQEKAKTLEKEKEVEELKKQAQKLAVDSTKESAVESTKESA
                     EEPAKISAVEFAKESAKAPEKIETAKETTSDTSKEPSKEQAVEKTKEPVEEPVSTTDS
                     KTST"
     gene            <401696..>402223
                     /locus_tag="HG535_0B02190"
                     /db_xref="GeneID:59234842"
     mRNA            <401696..>402223
                     /locus_tag="HG535_0B02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287014.1"
                     /db_xref="GeneID:59234842"
     CDS             401696..402223
                     /locus_tag="HG535_0B02190"
                     /inference="similar to AA sequence:RefSeq:NP_011647.1"
                     /note="similar to Saccharomyces cerevisiae YGR131W and
                     NCE102 (YPR149W); ancestral locus Anc_3.493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142909.1"
                     /db_xref="GeneID:59234842"
                     /translation="MLALVDNILRAINFCFLVILLGLVGSLLATQSSHSSRVNFCMFA
                     AAFAMVTDSFYGLLANFLEPLAWPIILFVLDFLNFAFTFTAGTVLAVATRTHSCTNTD
                     YLDSNNITQGSTQRCRESQAVTAFFYFSFFIFLAKMILSGLSLLSNGPFSAAGGFSAR
                     RRKTAQVGVPTISQV"
     gene            complement(<402550..>403392)
                     /locus_tag="HG535_0B02200"
                     /db_xref="GeneID:59234843"
     mRNA            complement(<402550..>403392)
                     /locus_tag="HG535_0B02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287015.1"
                     /db_xref="GeneID:59234843"
     CDS             complement(402550..403392)
                     /locus_tag="HG535_0B02200"
                     /inference="similar to AA sequence:RefSeq:NP_011648.3"
                     /note="similar to Saccharomyces cerevisiae PHB1 (YGR132C);
                     ancestral locus Anc_3.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142910.1"
                     /db_xref="GeneID:59234843"
                     /translation="MSRLVETVAKIALPVGIAVSALQYSMYDVKGGSRAVIFDRLSGV
                     QKQVVGEGTHFLMPWLQKAIVYDIRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVLRL
                     PNIYQNLGLDYDERVLPSIGNEVLKAIVARFDAAELITQRELVSQRIRDELSHRSSEF
                     GIQLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQVRNASVIRAEGEAE
                     SAECISRALAKAGDGLLLIRRLEASKDIAQTLANSPNVTYLPSSSASGSDGTPNSLLL
                     NVGR"
     gene            <403560..>404033
                     /locus_tag="HG535_0B02210"
                     /db_xref="GeneID:59234844"
     mRNA            <403560..>404033
                     /locus_tag="HG535_0B02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287016.1"
                     /db_xref="GeneID:59234844"
     CDS             403560..404033
                     /locus_tag="HG535_0B02210"
                     /inference="similar to AA sequence:RefSeq:NP_011649.1"
                     /note="similar to Saccharomyces cerevisiae PEX4 (YGR133W);
                     ancestral locus Anc_3.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142911.1"
                     /db_xref="GeneID:59234844"
                     /translation="MSRIVKEYKKIKKVLEGHGEAFENLIVQLAPVNEYDLLSWKATI
                     RGPSDTPYNGFSIGLTIKIPSDYPISPPMVKFEPYKMPHCNVNFQTGEICLDILTRQH
                     WSPAWDLLHVLKAIEQLLQEPVPESPLNVDIANILKEGDRTAYTGLVRYYFCGGT"
     gene            <404172..>404588
                     /locus_tag="HG535_0B02220"
                     /db_xref="GeneID:59234845"
     mRNA            <404172..>404588
                     /locus_tag="HG535_0B02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287017.1"
                     /db_xref="GeneID:59234845"
     CDS             404172..404588
                     /locus_tag="HG535_0B02220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142912.1"
                     /db_xref="GeneID:59234845"
                     /translation="MVEKITWAQVGSSTVSGLLSPAFVTGSGSQLVFTSGCVGTDEKT
                     GKLPSSIEDQARNAFLNLKTVLEKSGSSTDSILKVLLFLSDKSYAVKVNEIYKEFFPN
                     QPARSCILVSFPNESLKVELECVAQVESKRKRWFKL"
     gene            complement(<405272..>405778)
                     /locus_tag="HG535_0B02230"
                     /db_xref="GeneID:59234846"
     mRNA            complement(<405272..>405778)
                     /locus_tag="HG535_0B02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287018.1"
                     /db_xref="GeneID:59234846"
     CDS             complement(405272..405778)
                     /locus_tag="HG535_0B02230"
                     /inference="similar to AA sequence:RefSeq:NP_015477.1"
                     /note="similar to Saccharomyces cerevisiae SUE1 (YPR151C);
                     ancestral locus Anc_3.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142913.1"
                     /db_xref="GeneID:59234846"
                     /translation="MSFKLVMFGRRFFSCSASQTFKRKSSHNDVFRMLPRVPTTQFLE
                     SRELTRDILFSGYRPVMYPVTQNPLLAERNRNGETTLISEVIGERRKEEQQNNDHNYS
                     VMAGPRGCGGIHSGGVNGTWRYSPKLPNKLLPYNIWTTTSMGMEYFPEWLNLPRQVVR
                     KLKPFDRH"
     gene            <406407..>409736
                     /locus_tag="HG535_0B02240"
                     /db_xref="GeneID:59234847"
     mRNA            <406407..>409736
                     /locus_tag="HG535_0B02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287019.1"
                     /db_xref="GeneID:59234847"
     CDS             406407..409736
                     /locus_tag="HG535_0B02240"
                     /inference="similar to AA sequence:RefSeq:NP_011650.3"
                     /note="similar to Saccharomyces cerevisiae CAF130
                     (YGR134W); ancestral locus Anc_3.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142914.1"
                     /db_xref="GeneID:59234847"
                     /translation="MEATAQGLSVLDIRSDAEVVDENENEPVSHKEGTLKEKLSSEGI
                     PFETTTADLIRLLKDETIIKNRDIRYFLISESAIIALFATQAGPSLINHDFAVSHDPP
                     ISPAATSVLRRQWEINDYIFCKFLLFVLENRNFVFNVKEFNRPRYKASLGFLTENVIH
                     NSSLVLASDYNLLYDYLRTIKDTMLLDWLVLTMRIGDGDKYLQQTVNDYHKNFEITNC
                     YRNYYSYYTLVEQGAKQSKISALKFSNFFKLFDPRSLSFDQPDSKKLDDTDFGKNNET
                     VFSFNINQDGTLDFMSPKIRHDILSKALGLQKIDSPLLFTQFRILSGLIDPLTQPLPN
                     DKHIISIDFLYQLTLGFMFPGIEELTQVDGLDWKFHTCFNMQKIIKRSMIRLNFDDFE
                     RLNSINNSDESINWRKQLNKWLPHGFSTQNLELIYMVDILAVYYIYKSYEHLPIQLNP
                     FLSTLISMWKNLTCVILLGLEIDRLEEEHETFDTPLLVRATVRGATALRSVVAAVLNG
                     HVEYYKHDFKHESVNTFMSPYGRKLCQGALYADLRSHAAAILALGTDLEDVTELLADL
                     QAGDRFDEDVRYMFEYEYDDFNDSDLEENDSRINDNSTKGKMPIQRRCNCLFDDDVME
                     HEGDYNESNESEFENGEELKQNQFGSHMKLLTTGKSQAVRHPNSFEFDYSGKDWRDIP
                     RGRNFYYFESYKFIKNPDLEIIISLTLKASSSRLEEDESLLLLRSVASCVKNEQDELL
                     LSDFFSEPKSHVDRNKDGEEDEKHFVQPDDIYDLWCLESTFEKVIQRNPHLAWRLMDE
                     MLVCSGYRRVLIWFITHMKLKFPVIEYIYELVMGLRGSSISEYSHSTLQSGLDRTPSR
                     KNIEKEMLLLPFSRQDLIELSNIETKMLMQEFFTNAAISLSEKSNEANEGQNGEGETD
                     ISLYDVELMKLICSMVRTFIAEGKLDFSESESAFELQALLMNWLTIIPEARSLFFDLK
                     TKLGEMNSNFEKVNGQGALNATALEDPATQETNDNIDEKNFEYNKKLMNLLPLPLKDN
                     EANVENAAVQTLRNFINRFPFTSSKPSIGRKLIYENDEILPMAKTERPLDLHNYLLKF
                     DAKYKSICISENEAPNQIVGS"
     gene            complement(<409772..>411223)
                     /locus_tag="HG535_0B02250"
                     /db_xref="GeneID:59234848"
     mRNA            complement(<409772..>411223)
                     /locus_tag="HG535_0B02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287020.1"
                     /db_xref="GeneID:59234848"
     CDS             complement(409772..411223)
                     /locus_tag="HG535_0B02250"
                     /inference="similar to AA sequence:RefSeq:NP_015478.1"
                     /note="similar to Saccharomyces cerevisiae YPR152C;
                     ancestral locus Anc_3.498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142915.1"
                     /db_xref="GeneID:59234848"
                     /translation="MRWLTWEGALQYHTMARIWTEYTAPDGTKYYYNAKTKRSTEEKP
                     LSFFDTDDVRYNKKARLNITRRPYFVLPLANQWHLVICDNGDKFFHNDETKESVWELK
                     DQQSLNLLREVDKQKLVLLVGIARGYCSPLDSTIYEEVWGELEAATPAMDAEYSSEKV
                     AFDTSNDEEEVKTEMVDEDSMNDDSEDEDALFSRDVLVTGYSSSSEDEEQSEGETAQV
                     SAEDDASDARLIGLHAIDGQPNDYDEQSSLGVKEEFFELLKKYDCDPFSLWPMQLKKV
                     QNDPIFYKITDDALKENIFEEWCQRTVESKSTQALEPGEEEEESENEDELEPTKFHYL
                     AHIVAKSDIKANTISQDIKSQNKSLFKRYKIKRFVKDKKEQDSFVSSLLFFFKKIELA
                     ERQSIFENLLRDNERVIVENINGQENKLRRILNDDDFSENKAYFIETQLLKLEKIIGI
                     KGNLQDLADNTKYYVLGIKDKLIALKHYLKSLI"
     gene            <411430..>412197
                     /locus_tag="HG535_0B02260"
                     /db_xref="GeneID:59234849"
     mRNA            <411430..>412197
                     /locus_tag="HG535_0B02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287021.1"
                     /db_xref="GeneID:59234849"
     CDS             411430..412197
                     /locus_tag="HG535_0B02260"
                     /inference="similar to AA sequence:RefSeq:NP_011651.3"
                     /note="similar to Saccharomyces cerevisiae PRE9 (YGR135W);
                     ancestral locus Anc_3.499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142916.1"
                     /db_xref="GeneID:59234849"
                     /translation="MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMATDGI
                     VLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLKTY
                     NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGW
                     KAISVGANTSAAQTLLQVDYKDEINLEGAIDLALKTLSKTSDSSTLTYDRVEFATIQK
                     DEKGDLHQKVYKPQEIQELLVAAGITKKDDDDEDKED"
     gene            <413158..>413835
                     /locus_tag="HG535_0B02270"
                     /db_xref="GeneID:59234850"
     mRNA            <413158..>413835
                     /locus_tag="HG535_0B02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287022.1"
                     /db_xref="GeneID:59234850"
     CDS             413158..413835
                     /locus_tag="HG535_0B02270"
                     /inference="similar to AA sequence:RefSeq:NP_011652.1"
                     /note="similar to Saccharomyces cerevisiae LSB1 (YGR136W)
                     and PIN3 (YPR154W); ancestral locus Anc_3.501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142917.1"
                     /db_xref="GeneID:59234850"
                     /translation="MSASLINRSLTTVRTELEFLQESNVISEQTFRRIMESLPERYNP
                     NDSKQPVEKVSEFVEAIYKFDPQQDGDLGLVPGDKVEVLEKPSPEWFKGRCNGKVGMF
                     PSNYVKSAFSGSSSSSRANLAPPPPQYEQQPSQQMMQQQPSQQMMQPQPSGSSYQQPF
                     PPASANYYQQPPPPPQQQQQQQQQQQQQQAPNKPSHFKKFGSQLGNAAIFGAGATIGS
                     DIVNSIF"
     gene            complement(<413939..>415774)
                     /locus_tag="HG535_0B02280"
                     /db_xref="GeneID:59234851"
     mRNA            complement(<413939..>415774)
                     /locus_tag="HG535_0B02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287023.1"
                     /db_xref="GeneID:59234851"
     CDS             complement(413939..415774)
                     /locus_tag="HG535_0B02280"
                     /inference="similar to AA sequence:RefSeq:NP_015481.1"
                     /note="similar to Saccharomyces cerevisiae NCA2 (YPR155C);
                     ancestral locus Anc_3.502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142918.1"
                     /db_xref="GeneID:59234851"
                     /translation="MVTDPFIQQYLERIDEYLELSLQQLSLSLSPKQHNKDEEEDLQS
                     LQEKLQKIKLIVAKIHASLRSHSSKVVEVDYATVLDLLSDLPREQFIEHQDGLINLVT
                     NAIYQYTLLLCYYTLKSECVSFLPEAYESARYYKRVSDSKLWSTLYFVQTLPNKIAIF
                     SRQLNYSFKKLKAIDASSEYSAEKLKILGHNFLEDVKPKWNKMMMVHDFRFVGLPKKS
                     VSWAYFFLNLPRAMIRDELHKKIDYMDHLTKNYTTKLGQLIISFESGSKSTISDDYRK
                     HVAALQEFFNGNDNDNIYSMVQHTMQFRSNVEKICDTKPSIATRYWPCALLVLTYGPS
                     SIISIWQSRFKILHFLQENVVDFAMGLIYNWIYIPLKNVWATVRHDDDSSIAMMSAGT
                     LDSEINSLTRMIVSFVKEKSNSNIDVDTLVQQIEHGDLTDFMEIYENQLEKPIKNIVT
                     GGLIRSLLIQVQKTKVEGSLALNGIDKMLQSQQLVFGVVAVSPALLILYVTTTCVYRL
                     IKVGNFWSNIEECKQNLGACLNNVERLLNYDESAKKDTVDNCLAQGLLTIEISSIARY
                     GSLLVPRSRLNEWYRDVEEISDSQLSNSSRINVVNRIYHVYGRFF"
     gene            complement(<417005..>418861)
                     /locus_tag="HG535_0B02290"
                     /db_xref="GeneID:59234852"
     mRNA            complement(<417005..>418861)
                     /locus_tag="HG535_0B02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287024.1"
                     /db_xref="GeneID:59234852"
     CDS             complement(417005..418861)
                     /locus_tag="HG535_0B02290"
                     /inference="similar to AA sequence:RefSeq:NP_011654.1"
                     /note="similar to Saccharomyces cerevisiae TPO2 (YGR138C)
                     and TPO3 (YPR156C); ancestral locus Anc_3.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142919.1"
                     /db_xref="GeneID:59234852"
                     /translation="MSELQSVDSFNSDSSSQFQDDQQQPQEYVPSGTNRNGNQLSLTR
                     TETVKSLQDMGMTSDAPVPDVNAPQTNTKTAIFPEEYTMETPTGLVPVATLQSIGRTS
                     TAISRTRTRQMDRTSSVSSSIDGTHSSEEINKEKNANADQNQTDDLDPEIEFVTFVTN
                     DPNNPHNWPLWVRWSFTIILSCLVVCVAYGSACIAGGLFTVSEKYHVGSEVAVLSVSL
                     MVIGFSLGPLIWSPVSDLYGRRVAYFVSMGLYTIFNIPCAISPNISGLMVCRFLCGVF
                     ASSALCLVGGSIADMFPSSTRGKAIAFFAFAPYAGPAVGPIVNGFISVSTRRMDLIFW
                     VNMAFAGVMWIIVAFIPETYAPVILKRRAAKLRKETGNAKIMTEQEAQGVSINEMMKA
                     CLIRPLYFAATEPVLDATCFYVCLIYSLLYAFFFAYPVIFSELYGYKDNYIGLMLIPI
                     LIGAIMALGFTFWCESQYLKLIKTRKATPEDRLLGAMIGSPFAAIALWILGATAEKHV
                     IWVGPASSGIAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTT
                     QMYHKLGLHWASWLLAFISTAMIALPFGFKKWGKELRHKLSSKDYSIDSIDA"
     gene            <420343..>422946
                     /locus_tag="HG535_0B02300"
                     /db_xref="GeneID:59234853"
     mRNA            <420343..>422946
                     /locus_tag="HG535_0B02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287025.1"
                     /db_xref="GeneID:59234853"
     CDS             420343..422946
                     /locus_tag="HG535_0B02300"
                     /inference="similar to AA sequence:RefSeq:NP_011656.3"
                     /note="similar to Saccharomyces cerevisiae CBF2 (YGR140W);
                     ancestral locus Anc_3.504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142920.1"
                     /db_xref="GeneID:59234853"
                     /translation="MDQTDVDIGTQVRDLVDSLSPRTAHQYKSYNAKYVQWLRGRKII
                     GSDAEASVLYRELPLSAHLVHWFLLDTLILESGHGQGGGGDKRGDKRGDEDGDDDKDD
                     FKIATLKKMVSSLKFLNKLCAIHGNSSKIDDKYVENVTKLHSHWISLNKDDLLPLVKV
                     SINLWNDYTPSLAEKFFKSCFEKTRFIVDFQLRFISKLSYDQRSKIKLSQLKPGADNR
                     SISFDQKTWSSLQVYLPDSHPRVKSHMPIVLSSRSCPFLCPLTSLATYLYLRFYGIKT
                     MTKGDGFPNLLEERSSHKDTWLDLPLIRGKSLLDYPRDETLSNYYSSVFRYCQLPYKR
                     RDFFTKPSLQFPTWSESDFSGFFDDYYNKSVNQKDAAAFADHVPVDFKQIMNFKSSGS
                     YSNETRHTDLPKGLLVQIFPEIESYRRQWDSLSIESQNFIKLLEILRNHFLSNLPIIF
                     QFFPNHDLFKDPIFQNTDFQSYFHDIIGKKKIKDEYVDSLPGFVSINEDCLKSLLIES
                     STTVTNNAKTNDNLSIVDLSSSANDLMNKTFQFAQYQTLTNFRILISLLTNIFDRLEM
                     KKSSREFMIHQLGLVQDTINEKINVSKPIDVDNFVKEEEDQKQVELKNVDDSTDHTDK
                     KGRSKRNTHGLLAIEDEFSEEADIDDDDDNDNDNQDMQQELKFMINELVGERVRSTVK
                     QQMEEWETKIKKMVDAAVESKISAVVKRNLNEFEDDNEDSLSKRQRLSITPSITNNES
                     TPNYPVPEDNSKHFEMNPHLESVESVILEWFTPNPDMNNECVHHMNKNHSKIWRSSFE
                     KLYKERKVVVEFYIYLVNDRAYDRYKAVDICESFKRKTNDGTLRSLAQYLKEWKKNHS
                     NSFAGGILEEN"
     gene            <423162..>424526
                     /locus_tag="HG535_0B02310"
                     /db_xref="GeneID:59234854"
     mRNA            <423162..>424526
                     /locus_tag="HG535_0B02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287026.1"
                     /db_xref="GeneID:59234854"
     CDS             423162..424526
                     /locus_tag="HG535_0B02310"
                     /inference="similar to AA sequence:RefSeq:NP_011657.1"
                     /note="similar to Saccharomyces cerevisiae VPS62 (YGR141W)
                     and YPR157W; ancestral locus Anc_3.505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142921.1"
                     /db_xref="GeneID:59234854"
                     /translation="MKRTTFLFIRSCFYVLVFCNILVKSISISLLEDDPFIKLYEQEK
                     GEYNSPPVTSPYDLNDENRSLKEKGKVPQYVVDSCPLVHLYTEEKYWPSDIAKYVNNF
                     NITDGDSVAVFNKDKLTLSDLKPSYKYDLPNGSQGEISSEFTYLTSLDDFAKDPKWLL
                     GSPPEYGTGHIRDGPAVLLVVDKGNGWVDAFWFYFYPFNLGPFIMGYGPWGNHVGDWE
                     HSLVRFYKGEPRYVWMSAHGGGLAYKYSALEKVKKLRHINGKLTPESIYRPLIFSARG
                     THANYASVGQHAHDVPFFFMPLSDFTDRGPMWDPSLNFYGYTFDGDAFTPAGPKEQEY
                     GASWIQFHGRWGDKKLPGRDPRQKWCPVQWKYIDGPTGPYYKHLDRLSLCPEFQWWNF
                     WQACPSRRFIKKGEGLDAEKNDLVGDNCGVLLYKIRPRWLRGVFRLLMWRGVTCLLMD
                     FFTG"
     gene            <425120..>426493
                     /locus_tag="HG535_0B02320"
                     /db_xref="GeneID:59234855"
     mRNA            <425120..>426493
                     /locus_tag="HG535_0B02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287027.1"
                     /db_xref="GeneID:59234855"
     CDS             425120..426493
                     /locus_tag="HG535_0B02320"
                     /inference="similar to AA sequence:RefSeq:NP_011658.3"
                     /note="similar to Saccharomyces cerevisiae BTN2 (YGR142W)
                     and YPR158W; ancestral locus Anc_3.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142922.1"
                     /db_xref="GeneID:59234855"
                     /translation="MFSVIQSPCVFEPLPILNVLEGDQLCYGPELKKRRSVGNPCRYS
                     RPAPKTSPISMRYSVEENDDSYILSLYKKVPEGRIAEMVNQELVKLKESAYRPIYHVV
                     HDILGNSYYLEEEQDENELIRKAMSQLNMNAIYRKVAREAFQDLNIELNHRGDELTVS
                     SQRDGISKSFEIDEQIADVRVVGCKYDEVNEYGILKLMLEKISNTNNLVTLLKLSESD
                     QLRSSGQQRIAREAALEGKANQDEAERQKREEAKRTNALAEEQKEKHMQERAIALAEE
                     QRRKRLEEEIAYALAKQQKEKQMKERAIALAKEQREKRIEERKLIEAKEKEAEKERKL
                     AITHQNARIRDEAERAKLQKKIAKEQKLKQRKAALVAEKKAARLQKQFEKDSAGSKNI
                     VININFNGDQKGEWTKNHRNEDFVGTELKRITSPILEDIQDEELDRFNASLMKSPTGS
                     SIIEEAV"
     gene            <428267..>433616
                     /locus_tag="HG535_0B02340"
                     /db_xref="GeneID:59234856"
     mRNA            join(<428267..429574,429576..>433616)
                     /locus_tag="HG535_0B02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287028.1"
                     /db_xref="GeneID:59234856"
     CDS             join(428267..429574,429576..433616)
                     /locus_tag="HG535_0B02340"
                     /ribosomal_slippage
                     /note="Ty-like element, ribosomal frameshifting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142923.1"
                     /db_xref="GeneID:59234856"
                     /translation="MSNQVTIDNAEENILSKYGSAAKVPFSMNREAEDSLFTSRGKSN
                     SSEISNNGTDPNLSDSQRDFPSLQPSIPASVDNKQEGSPKSSAYDAGYQHTGSTQGYT
                     YPYPWPSPYPPIAPPMVPPMGNGMFNWNMNADGIKYIPATSYETFMYQQKLLNDQFKQ
                     YRKFYDQRSEDDTTSESAKESNNEQVLPDLDEISNPSEFPRWMRSFKRFLEDNKLGDI
                     IPDRLNESERDATKSEKAFIINSFKTYVKETAYPKSVKDAIKRGHDLFRIILCHVSED
                     SNLRSAIWRELTTISYDGSEDSYYYTSRVKELYSQLKATNSNIPEDIICEYLLKNLHG
                     QYAKIRENHYLEYDLNTIAGISKCVLRTYDRLIKNKKHTSETSPSVTNRHCYKCSSEG
                     HFAPQCPNVKDKLPKPSINSRKEKKPYHRKGIHKIGLTRDTELLGILQNSKKKRPSMT
                     KTPQTGELVEDNQHLLIDSGAAISVIRDPGLLHNINKHPNIGIADAQDREIPISVSGD
                     LQLSFPGTSIIHTQAVASTVPHVDILSLHELQKNGITVDFNNSQVTNNKGKMVARIKK
                     IGPYYWIPAKYIHKPHKKLNVMNVQKQPLFPMEFIHRLLGHVNIKTLRDSIKQGMLTN
                     LSMDDIDWSGYSNFQCEDCVSGKSKKHKHLVGSRLTYQKSYQPFEFLHTDIFGPVPHM
                     PTSSPSYFMAFTDEATRFRWVFGLWNKEAETVTSKFRELVNMVKTQFNTKVRSFQMDR
                     GSEYTNKTIRNFFKEYGIIPCYTSVGDSKANGVAERLNYTLLDDCRTLLRSSNLPLHL
                     WFYAVQFSTLMRNSLITSSVGTSSRAKAGLTGLDVSTILPFGQRVMVNNPPKNKLRPR
                     GVVGFALTPSAESHGYLIYIPSKHTITDTTNYLIIRGDPHDRTDDADAVIAPLLDQLE
                     ARQDGEFDNNMSTHSGGMEMDVSIHSGGTIHQRPVLPTPTADNLSTSSGGNDPIQTGT
                     TDTTEVIPEYISEGNNDVLGPDIHDDPPEHTNDDPPEHTNDDPPEHTSDEIADDIEEH
                     GSNMINEDPRINLQSANHAVTYDDTEGDDQPTQNEPTSNPINDPANDHPSSAIIDNTK
                     TPDPIPDTVSRRTINNDIDPSSAIASTVGIQASAYDDVAPTTEDERTTSSTSTAELDP
                     LPSEEESPAPESTTVATPDSETPESISNVGGNDQSPEVNAKSLEERKNRIFQYRNGDI
                     PRVKPPSTKRKSSLALGEIEDRTQRKRPKRHILYVNAVHSNPTPHIKPSLSYYEAIVN
                     NDDKNDAKGYNEAYMKEYDQLIKMKTWDPNKPVNEKTIPRQQIINSMFIFNTKRDGRK
                     KCRFVARGDQQKAGTYKEDLKANTVHHYALMTSLNIALDKKMFITQLDISSAYLYAEL
                     EEDLYIRAPPHMKLKGKAFKLNKSLYGLKQSGANWYKMIGSYLTNSCNMTELTGWPCV
                     FKDENECFVCLFVDDMIVLSKDIKAANKLVKTLKKKFETKVIHDGKLDENNMATYDIL
                     GLEIEYTFGKKMTIGMENSLTEKLPHLGFDIEKDNKKFLVPGTPGEHIHKDNLVVEED
                     DYKEKVKQMQKAIGLLSYVGYKYRFDILYYVNILAQHTLYPSEQVEKLTKQLLNFVWQ
                     SKHKKLIWHANKHTKTNRITAITDASFANEEGFRSQLGHYYCLNGKVIGGRSSSEKLR
                     VISSTEAEIYAVSESVPMLQGVACLVKQIDPSSSLRSKILTDSKPTISIVEDQSEDSR
                     AFRNRFFGTRAFRLRDEARRNDLKFEYIKTEDNYADILTKPTSIAIFKKLTHSWVK"
     gene            434361..434433
                     /locus_tag="HG535_0Btrna1A"
                     /db_xref="GeneID:59235325"
     tRNA            434361..434433
                     /locus_tag="HG535_0Btrna1A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:59235325"
     gene            <434730..>435647
                     /locus_tag="HG535_0B02350"
                     /db_xref="GeneID:59234857"
     mRNA            <434730..>435647
                     /locus_tag="HG535_0B02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287029.1"
                     /db_xref="GeneID:59234857"
     CDS             434730..435647
                     /locus_tag="HG535_0B02350"
                     /note="ancestral locus Anc_3.507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142924.1"
                     /db_xref="GeneID:59234857"
                     /translation="MDNAVELFKNLLYNHSVQMDFLVEKCEGEEYLRNLNEIITALCH
                     SLKNHGKIILVGCGKTFKIAKKTVALLQSLGLRSTYLHPTEALHGDMGCIKEQDSLLL
                     CSTSGETEEVILFLKYLIEMETWPEDVGGGKVLNKISVCANPESSLSVLCDNVVQVPQ
                     KFSEDEIQDGLRAPTVSTTSMLVVLDCLCIALSNAYYDGNTQRRNIIFNRAHPAGGIG
                     KRAKALKSSESAPSLEPPVASALTAKLRPAMTELEVLQTLILHDWIVVEPTLQLPSKT
                     VQLHYKIWSAQRDVEGANFCNYLKSRLQT"
     gene            <437054..>439228
                     /locus_tag="HG535_0B02360"
                     /db_xref="GeneID:59234858"
     mRNA            <437054..>439228
                     /locus_tag="HG535_0B02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287030.1"
                     /db_xref="GeneID:59234858"
     CDS             437054..439228
                     /locus_tag="HG535_0B02360"
                     /inference="similar to AA sequence:RefSeq:NP_011659.3"
                     /note="similar to Saccharomyces cerevisiae SKN1 (YGR143W)
                     and KRE6 (YPR159W); ancestral locus Anc_3.508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142925.1"
                     /db_xref="GeneID:59234858"
                     /translation="MSVRNLTNNGKNLSSSDEGMQTESSLLSTSSERRNPFLGSGEED
                     EGLLEPENSSQELLHNDSSGSIRFQAANNSGASHFADHGGEGVGGVVQQQPVSDYKGY
                     YSKNSPANAGGVPDNTRLNSAKGLPSSTSLNTGLSANDIMSPPEYDRYPLVSSRISSM
                     AQMPNPNKYTHGLNSSSPGNASDSSISSNPFLGEQDFSPFGGYPASSFPLLMEEKEDD
                     DYLHNPDPEEEARLDKKRFVIDFKHMSRRSFGGLIGILLLFLGMLVVFVVIPAVTFTG
                     RRGTQVISRLTDYQYPQLSAIRTALVDPDTPSSVLTRRALDGSQWSLAFSDEFNANGR
                     TFYEGDDQFWTAVDLNYAATRDLEWYSPDAVTTNNGTLQLRMDAFRSHDLYYRSGMLQ
                     SWNKLCFTQGALEISANLPNYGRVTGLWPGLWTAGNLGRPGYLASTEGVWPYSYESCD
                     AGITPNQSSPDGISYLPGQKLSVCTCDGESHPNQGVGRGAPEIDVLEAEADTTLGVGV
                     ASQSLQIAPFDIWYIPDYEFIEVYNFTTTSMNTYCGGPFQQAVSAITTLNTTWYEFGP
                     DAGKFQKYSYEYLNDNDNGYIRWFVGDVPTYTIYAKALHPNGNIGWRRISKEPMSIIL
                     NLGISTNWAYIDWQFLFFPVTMSVDYVRIYQPNDSISITCEPDGYPTQDYINAHMNAY
                     YNVNLTSWEEAGYSFPKNILTGDCTSSRFQLSSNDGQHSNSN"
     gene            <440016..>440657
                     /locus_tag="HG535_0B02370"
                     /db_xref="GeneID:59234859"
     mRNA            <440016..>440657
                     /locus_tag="HG535_0B02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287031.1"
                     /db_xref="GeneID:59234859"
     CDS             440016..440657
                     /locus_tag="HG535_0B02370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142926.1"
                     /db_xref="GeneID:59234859"
                     /translation="MLLGDSITVFLAGLLGFLSSVTARHNDEVVVQVNTNVLLNAQNN
                     MVEIDGQAYGILADKYDYNVDPVVENITIPARNTDNRGGGRLTVALMNVLSTFVNRRP
                     LLTGKICNTMCFSETTEDSTAYAICIYRYTKSALGCTTVDIPHLRNVIKDKLLEFARQ
                     ELTGKCITIFDSNSSVTYAKIVMLGNGISMGDVHCEAPSDWNAPTFFQKSYII"
     gene            442571..442641
                     /locus_tag="HG535_0Btrna3G"
                     /db_xref="GeneID:59235341"
     tRNA            442571..442641
                     /locus_tag="HG535_0Btrna3G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59235341"
     gene            <442983..>446012
                     /locus_tag="HG535_0B02380"
                     /db_xref="GeneID:59234860"
     mRNA            <442983..>446012
                     /locus_tag="HG535_0B02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287032.1"
                     /db_xref="GeneID:59234860"
     CDS             442983..446012
                     /locus_tag="HG535_0B02380"
                     /inference="similar to AA sequence:RefSeq:NP_011314.2"
                     /note="similar to Saccharomyces cerevisiae MCM6 (YGL201C);
                     ancestral locus Anc_3.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142927.1"
                     /db_xref="GeneID:59234860"
                     /translation="MPSPFPIDAPNSTGISNSSPPASSIGGFGSGSGLDQGSQAGSRN
                     QFPSSSQPHGTTANPAGTSSLFSSQNTFGDARSGEIDGDIPLPTLRRRAINHVQKVDD
                     VTGEKVREAFEEFLEAFSIANSETGELERVYIAQIEFMKVYDLSTIYIDYKHLFMREN
                     GALAMAISEQYYRFLPFLLKGLRSVIREYEPDLLISADSISDNRNDQDTQAPTDSLDN
                     ASSAVRPEADTINATGSATGSSIEQTERLFQISFFNLSTVHRIRDIRSEKIGSLLSIS
                     GTVTRTSEVRPELFRASFTCNMCRAVIDNVEQAFKYTEPTMCPNLACENRAFWTLNVA
                     RSKFLDWQKVRIQENANEIPTGSMPRTIDVILRGDCVERAKPGDRCKFTGTEIVVPNV
                     AQLGLPGIKPSSSLDTRGIARSSEGLNSGVTGLRSLGVRDLTYSISFLACHVVSIGSN
                     SVEKNRSEEADYEDSMHLSTTLQTSNVYQDDERDQEVFLNSLNSNEIDQLKEMVKDEQ
                     IYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKTTVEGIKLRGDINICVVGDPSTSKS
                     QFLKYVTSFATRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDE
                     FDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGN
                     LNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKRDDAIDPPFSAEQLRRYIR
                     YARTFKPTLTKGARQFLISRYRELRADDAQGYSRSSYRITVRQLESMIRLSEAIARAY
                     CVDEITPAFVAEAYDLLRQSIIRVDVDDIEIDDEASETTQGAGDSNDQDQGQAPAPEQ
                     QQERAHIDVLRPKTKTTVSYEKYVSLMNLIVQKIAQAERENGKELTATDIIDWYLLQR
                     EYDLDSEEEYWQERKLAFKVLKRLVKDRILMEIHGTRTHLSDPLDTDADPHAPQGDKI
                     VYVIHPNCEMLETLDNQIAASQSSSPSPPPPQPHGEE"
     gene            <446674..>449358
                     /locus_tag="HG535_0B02390"
                     /db_xref="GeneID:59234861"
     mRNA            <446674..>449358
                     /locus_tag="HG535_0B02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287033.1"
                     /db_xref="GeneID:59234861"
     CDS             446674..449358
                     /locus_tag="HG535_0B02390"
                     /inference="similar to AA sequence:RefSeq:NP_015486.1"
                     /note="similar to Saccharomyces cerevisiae GPH1 (YPR160W);
                     ancestral locus Anc_3.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142928.1"
                     /db_xref="GeneID:59234861"
                     /translation="MTTTSNDLITEEPRAPHVPRLTRRLTGFLPQEIKNIDTIIPLKS
                     RNIWNKHQVKKFEDKEGFEGRFIGHVETTLARSLYNCDDLAAYESTSLSVRDNLIIDW
                     NNTQQRITARDPKRVYYLSLEFLMGRALDNALINSQAGSDEPTSRPMVEKSLDELGFN
                     LEDVLKKEPDAALGNGGLGRLAACFIDSMATQNIPAWGYGLRYEYGIFAQKIIDGYQV
                     ETPDYWLNFGNPWEIERNEIQVPVTFYGYVDRSDGESTTLSPSDWIGGERVLAVAYDF
                     PVPGYKTSTVNNLRLWKAKPTTEFDFAKFNSGDYKNSVDAQQRAESITACLYPNDNFN
                     QGKELRLKQQYFWCAASLHDIIRRFKKTSRPWSELPDQVAIQLNDTHPTLAVVELQRV
                     LVDLEKLDWHKAWSIVTATFSYANHTVMQEALEKWPIGLFGHLLPRHLEIIYDINWFF
                     LQEVEKKFPKDFDLLSRVSIIEECSPERQVRMAYLAIVGSHKVNGVAELHSELIKKTI
                     FKDFVKVYGSQKFTNVTNGITPRRWLKQANPKLAELIGKALNDPKQNFLLDMPKLTEL
                     AKKADDPEFQKAWDLVKANNKLQLADLIKDTNNGVDIIDREHIKDTLFDIQVKRIHEY
                     KRQQMNIFGVIYRYLAMKKMLKEGSTIEEVAKKYPRKASIFGGKSAPGYYMAKLIIKL
                     INSVAEIVNDDAEIVDLLKVVFIPDYNVSKAEIIIPASDLSEHISTAGTEASGTSNMK
                     FVMNGGLIIGTVDGANVEITREIGEDNIFLFGNLSEHVEELRYNHQYKKTELPPELAQ
                     VLKSIESGVFSPENPNEFKPLIDSIKSHGDYYLVSDDFESYVATQELVDEVYHTQKND
                     WIKKSILSVANIGFFSSDRCIEEYSETIWNVEPVKPET"
     gene            <449904..>451625
                     /locus_tag="HG535_0B02400"
                     /db_xref="GeneID:59234862"
     mRNA            <449904..>451625
                     /locus_tag="HG535_0B02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287034.1"
                     /db_xref="GeneID:59234862"
     CDS             449904..451625
                     /locus_tag="HG535_0B02400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142929.1"
                     /db_xref="GeneID:59234862"
                     /translation="MVEVRTESGPRLAATEAAETAAGGGSGIGTTENDSISFASVSAL
                     ERQSTEISCNGELKNAETSDNSKSQRKLQHHLSREEIKDYFRTRFTTLFPTRKSLKQA
                     REQYPLNPFPALRLMTWQQTQFFLVGLLAWTWDALDFFSVSLNMAAIADDLNSTVKDI
                     SHAITLVLLLRVVGAIIFGYAGDKFGRKYPYCVTMVLIIIVQLAQGFVKSYSAFLGVR
                     AIFGIIMGSIYGVASATALENAPVEARSILSGIFQQGYALGYLLGVVFVRAIVDNSSH
                     GWRALFWFSAGPPVLFIIWRLLLPESPTYVRLKEEQKRSAIRTNNGKSIFWRNARAVL
                     KYYWITMVYLVILMAMFNFSSHGTQDLFPTMLTRQYDYSEDASTVTNSVANLGAIAGG
                     IIVAHSSAFIGRRFAIMVCIIIAGALLYPWGFVSDKSGLNASVFFLQFCIQGLWGCCP
                     IYLMEMCPMEFRTFLTGVAYQMGNMISSASSTIEATIGEKFPVEGKPEGVYDYGKVMA
                     IFMGCVLAVFLVVIILGPENKGGEVILNDDIVSSRGSLERVRSEDLEANNQLDVEEIK
                     PHSTHKE"
     gene            complement(<451788..>453263)
                     /locus_tag="HG535_0B02410"
                     /db_xref="GeneID:59234863"
     mRNA            complement(<451788..>453263)
                     /locus_tag="HG535_0B02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287035.1"
                     /db_xref="GeneID:59234863"
     CDS             complement(451788..453263)
                     /locus_tag="HG535_0B02410"
                     /inference="similar to AA sequence:RefSeq:NP_011313.1"
                     /note="similar to Saccharomyces cerevisiae ARO8 (YGL202W);
                     ancestral locus Anc_3.511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142930.1"
                     /db_xref="GeneID:59234863"
                     /translation="MTLGEAKDFSYLYSDETKARKPSPLKTCIHLFQDPNIIFLGGGL
                     PLSDYFPWDNLVVDSPLPPFAKGIGAPLTGTKEDSLKVSIKKQDQSNGTIPLARGLQY
                     GFTNGQPELIKFLKEHNTIIHDMKYADWDVIATTGNTNAWESTLRIFCNKGDVILAEA
                     HSFSSSLASAEAQGVIVFPLPIDQNGIIPEKLEAIMDNWNPEAAKPKLLYTIPTGQNP
                     TGTSLADDRKEKIYRIAQKHDFIIVEDEPYYFLQMEPYIRDPKERTAKKLTHEEFLKS
                     LAKTFLSIDTEGRVIRLDSFSKVLAPATRLGWITASKSILQSYVYLHEMTIQAASGFT
                     QALVAGTLNSWGQDGYLDWLLGLRHEYTLKRDNAIDALHKYLPKTDAFVVNPPIAGMF
                     FTVDIDASAHPEFKAKYDSDPAQVEHAIYEKVISSGVLVVPGSWFKTEGETVPPQPVE
                     SKMTGNRNEIFFRGTYAAVSPEKLTEGLKRLSIALKEEFGL"
     gene            <454583..>456586
                     /locus_tag="HG535_0B02420"
                     /db_xref="GeneID:59234864"
     mRNA            <454583..>456586
                     /locus_tag="HG535_0B02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287036.1"
                     /db_xref="GeneID:59234864"
     CDS             454583..456586
                     /locus_tag="HG535_0B02420"
                     /inference="similar to AA sequence:RefSeq:NP_011312.1"
                     /note="similar to Saccharomyces cerevisiae KEX1 (YGL203C);
                     ancestral locus Anc_3.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142931.1"
                     /db_xref="GeneID:59234864"
                     /translation="MPLNFFTWSKATLLLGLLVTIGSALLTADDYYVSPELIPGFLPD
                     SDWQDSDMYAGHIPLSNNEDEINYFFWKFVDGRRDKPLMIWLNGGPGCSSMDGALAEN
                     GPIRIDDDGKAFINEGSWHKRVDIVYLDQPVNTGFSFANKTGPLIYDDDLDVVTEHFM
                     QFLDSYFQIFPEDIYKDLMLAGESFAGQYIPFFADAIRRRNDNLEADQNRYNLNSVFI
                     GNGWLDPNNQALSYLPFAKEKNLIDETNPNFSSLLKAHENCQNAINNHNFINEQEFSY
                     EECESILTLLLSSTRNASPDIPSNEVCLNVYDYTLRDNYPACGMNWPAAVQNIPTFFG
                     TEGVLEGLNVRPEDVPRWRECDNGVTRALTNPRSIPSINLFPDIMNAGINIILFNGDH
                     DLICNTQSVTNVIDNLNWGGQKGFSEHAEYYDWIFNDAAMDTFEPAGYVKYDRNLTFI
                     NVYNASHMVSTDKSMVSRGILDIYLDDVSFDMVDGRFVLTSTSKMEPWSEDEDEDKDE
                     DDDDSGDFEGDESESEEEDEDMDDDDDGEEAEDKDEDDEEGEDTDEDEDKEDKEDTVY
                     SSHDKFRIVLVTFMSIALAIAIILYIYSKKFKPGMRAILMRSNRKHDQNKTVSWADDL
                     EDGIDFDVDEELSRSETASSRSKSKGSYTSVPTTEESFELEDM"
     gene            458127..458198
                     /locus_tag="HG535_0Btrna1H"
                     /db_xref="GeneID:59235327"
     tRNA            458127..458198
                     /locus_tag="HG535_0Btrna1H"
                     /product="tRNA-His"
                     /note="codon recognized: CAC"
                     /db_xref="GeneID:59235327"
     gene            complement(<458429..>459271)
                     /locus_tag="HG535_0B02430"
                     /db_xref="GeneID:59234865"
     mRNA            complement(<458429..>459271)
                     /locus_tag="HG535_0B02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287037.1"
                     /db_xref="GeneID:59234865"
     CDS             complement(458429..459271)
                     /locus_tag="HG535_0B02430"
                     /inference="similar to AA sequence:RefSeq:NP_010943.3"
                     /note="similar to Saccharomyces cerevisiae CHO1 (YER026C);
                     ancestral locus Anc_3.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142932.1"
                     /db_xref="GeneID:59234865"
                     /translation="MSSVRSRNNDRVKMSPEENSHENPREQSQGSVFSDDDGDDMSHR
                     TMSRRASSIFSFSAAELEPPNETDIEKFTSDQYHFSMIRNLHLADFITMLNGFSGFYS
                     IVSCLRFCSTNKPHYVQRAHFFIFLGMCFDFFDGRVARLRNRSSLMGQELDSLADLVS
                     FGVAPASIAFAIGFQTTLDVLVLSFFVLCGLARLARFNVTVAQLPKDSGGKSKYFEGL
                     PMPTTLALVLWMAILVRKGLIIEDIPFGVCRKGLFLEVHPIVAVFFLHGCGMISKSLK
                     IPKP"
     gene            complement(<459578..>461824)
                     /locus_tag="HG535_0B02440"
                     /db_xref="GeneID:59234866"
     mRNA            complement(<459578..>461824)
                     /locus_tag="HG535_0B02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287038.1"
                     /db_xref="GeneID:59234866"
     CDS             complement(459578..461824)
                     /locus_tag="HG535_0B02440"
                     /inference="similar to AA sequence:RefSeq:NP_011310.1"
                     /note="similar to Saccharomyces cerevisiae POX1 (YGL205W);
                     ancestral locus Anc_3.514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142933.1"
                     /db_xref="GeneID:59234866"
                     /translation="MTRSFTIDNDSKVLNPQKFIQKERAQSKLRIDQINTFLENTPQR
                     RDLTHSLIEEICNDPVLKTDTDYYDQTKSQQRLETAKKIARLSLYMEHDIKTIRNQFK
                     GTDLIKELQNDTEHKLPSLCNEDLSIFDKRLSLVANIDPQLGTRVGVHLGLFGNCIKG
                     NGTDEQIHYWLQERGALFIKGIYGCFAMTELGHGSNVAELQTRATYNPKSDTFSIDTP
                     DLTATKWWIGGAAHSATHSTVYARLIVEAKDYGVKTFVVPLRDPATFQLLPGVSIGDI
                     GAKMGRDGIDNGWIQFRNVVIPREFMLSRFTKVLRARDGCISVKTEPQLDSISGYSAL
                     LNGRVNMVMDSFRFGAKFVTIATRYAVGRQQFAAKKGQQESQLMDYPLHQYRVLPQIS
                     IAYMISPAAFKLMDNYYTTLNELYKVSSSDKSALMRVSQKLKNLFIDSASLKATNTWL
                     VAQLIDELRQSCGGHGYSQYNAFGKGYNDWVVQCTWEGDNSILSLTSAKSILKKFVEA
                     GTRGKFDRELDTESFSYLKPSFLRNVIMGGEEAELNKIEDYYLVWAIALVKLLNHTAR
                     LIEKTKKIDGVSKLLILISKFHALHSMLKAYHDKLNSDSESYITDENTRSVMWDIYKL
                     FSLYFIDKHSGEFQQFKIFEPDQISQDVQPQLLQILPKLRNHCIALTDSFKFPDSMLN
                     APIGYYDGDIYNNYYNEVIKNNPVESDGAGRPVYHELLSSMLKRGFEFDERLGGAAKS
                     EILARLAK"
     gene            <462783..>467741
                     /locus_tag="HG535_0B02450"
                     /db_xref="GeneID:59234867"
     mRNA            <462783..>467741
                     /locus_tag="HG535_0B02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287039.1"
                     /db_xref="GeneID:59234867"
     CDS             462783..467741
                     /locus_tag="HG535_0B02450"
                     /inference="similar to AA sequence:RefSeq:NP_011309.1"
                     /note="similar to Saccharomyces cerevisiae CHC1 (YGL206C);
                     ancestral locus Anc_3.515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142934.1"
                     /db_xref="GeneID:59234867"
                     /translation="MSDLPIDFTELADLISLGISPQSLDFRSTTFESDRYVTVRETQD
                     GNNSVAIVDLANNNHVTRKNMGGDSAIMHPSQMVISVRANGTIVQIFNLDTKTKLKSF
                     TLDEPVLFWKWLDEKHLGFVTARTIQICDVFDNNVSSKPQLLTQRHASLNNTQIINFV
                     SNKKLDWFAVVGILQENGRIAGKIQLYSRTRNISQAIDGHVAIFSNILLDGNTSPVQI
                     FVTGNRNVTTGSGELRIIEIDHDGSLPVQYQKKSVDIFFPPDATNDFPIAIQISEKYG
                     VIYLLTKYGFIHLYELETGTNLFVNRITAESVFTATSYDDKNGIACINKKGQVLAVEI
                     STSQIVSYILNKLSNVSLALTVASRGGLPGADDLFQKQFDSFLNQGDYANAAKIAASS
                     TQLRNQNTINRLKNVQAAPGAISPILLYFSTLLDKGKLNKDETIELARPVLQQDRKQL
                     FEKWLKEDKLECSEELGDIVKPFDTTLALACYLRCNAHGKVVTCLAELQQFDKILPYC
                     QKVSYQANYLVLISSLIRTNPDKASEFAISLLQNPETSSQLEIEKIADLFFSQNHIQQ
                     GTSLLLDALKGDTPDQGHLQTRVLEVNLLHAPQVADAILGNHIFSHYDKPTIASLAEK
                     AGLYQRALENYTDIKDIKRCIVHTNALPIDWLVAFFGKLNIEQTFACLKTLMDNNQQA
                     NIQIVVQVATKFSDLIGPATLIKLFDEYKATEGLYYYLASLVNLTEDKDVVYKYIEAA
                     AKMKQYKEIERVVKDNTVYDPERVKNFLKDAQLEDQIPLIIVCDRFNFVHELILYLYK
                     SHNMKFIEAYVQQINPSKTPQVLGALLDVDCDETFIKNLLQSVLGQVSINELTSEVEK
                     RNRLKLLLPFLEQTLAQGSQDQGVYNALAKIYIDSNNAPEKFLKENNNYDTVDVGRYC
                     EKRDPYLAYIAYEKGSNDEDLIRITNENSMYKYQARYLLKRSDPELWNSVLNADNSHR
                     KQLVESVIAVGIPELTDPEPVSLAVQAFMNNGLRLELIELLEKIILEPSPFSDNVALQ
                     GLLLLSAIKYEPTKVASYIDKLENYDADEIAPLCIEHGLNEEAFEIYDKDGAHGKALK
                     VLVENVMSLDRAQDYVEKVNEPDLWSQLGTAQLDGLRIPDALGSYIKAQDPSNYENVI
                     DITQQSGNIDDLIPYLIMARKSLKEPKIDGSLILAYAALGKIHEIENLLSGSNVANLE
                     AVGDKLFDAKNYKAAKLCYSSISNYSKLASTLVYLDDYQTAVDTARKASNIRVWKLVN
                     DACIDKKEFRLAQICGLNLIVHAEELDELVDKYESKGYFEELISLFEAGLGLERAHMG
                     MFTELAILYSKYEPAKTYEHLKLFWSRINIPKVIRAIEQAHLWTELVFLYAHYDEWDN
                     AALTMIEKSAKNFDHTYFKEVIVKVSNLEIYYRVINFYVTEHPSLLIDLLIVLTPRLN
                     IPRTVKIFSKSDNLPLIKPFLINVLPTNNSVVNQAYHDLMIEEEDYKALQAAVDSYDK
                     FDQLELAARLESHELIFFKKIAALLYRRNKKWSKSLAILKEEMLWKDAIETGAISKDT
                     KVVEDLLSYFVEINNKEAFVALLYTAYNLISYEFVLEISWLHSLGDYIKPYEISIKKE
                     QNDTLQKIAKQMAEKSDNMEEENAGNPLMLTNGAMGLQQTGF"
     gene            complement(<467952..>471035)
                     /locus_tag="HG535_0B02460"
                     /db_xref="GeneID:59234868"
     mRNA            complement(<467952..>471035)
                     /locus_tag="HG535_0B02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287040.1"
                     /db_xref="GeneID:59234868"
     CDS             complement(467952..471035)
                     /locus_tag="HG535_0B02460"
                     /inference="similar to AA sequence:RefSeq:NP_011308.1"
                     /note="similar to Saccharomyces cerevisiae SPT16
                     (YGL207W); ancestral locus Anc_3.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142935.1"
                     /db_xref="GeneID:59234868"
                     /translation="MEELNIDFDLFKKRILSLHSQYKSFENSPNSLLFVFGSSNEENP
                     YQKTTILHNWLLSYEFRATLIAFLPQKIVIITSAAKGKHLQKALDLFKDEKIKLEIRE
                     RNSKDAEHNAKLFIDVIEEIKIAGKNVGTPEKNFYQGKFMTEWAPLWEKAVKDNEFNI
                     FDISLGLSKVWEVKDEIEQSFIAVASRASDKFMDVLADEMVNAVDEELKITNAQLSDK
                     IENKIDDMKFLKKITADLKGLCPDTHKFNIDLLDWTYSPIVQSGAKFDLKVSARSNTD
                     QLHGSGSILASCGIRYNNYCSNVTRTFLIDPSEEMVNNYDFLLELQKEIVTNQLKVGR
                     VVKDVYNSVVEFVQKLRPDLASNLTKNIGSIIGLEFRDSTFILNTKNETRTIRAGDCF
                     NITFGFNNLKDSKTGQSYALQQADTVLLGVAGEESPKFFTECAKSKAQISFYFNNEDE
                     ENDKKPSKKPVKPEPNSKILKTKLRGDARSDSMETQKEQIRKENQRKLHEKLQKDGLV
                     RFSAADATGAGTEPRQYFKKYESYVRDSQIPSNVKDLRIHVDWKSQTIILPIYGRPVP
                     FHINSYKNGSKNEEGEYTYLRLNFHSPGSGGISKKVEELPYEDSPDNQFFRSITLRSK
                     EADRIGDAFKQITDLKKESTKREQERKVLADVVQQDKLIENRSGRTKRLDQIFVRPSP
                     DSKRVPSTVFIHENGIRYQSPLRTDSRIDILFSNIKNIFFQSCKGELIVIIHIHLKNP
                     ILMGKKKIQDVQFYREASDVTVDETGTGRKSQMKFRRYGDEDELEQEQEERRKRAALD
                     KEFKYFADAIAEASHGLLTVESTFRDLGFQGVPSRSAVFCMPTTDCLVQLVEPPFLVI
                     NLEEIEICILERVQFGLKNFDMVFVYKDFNKPVTHVNTVPIESLDFLKQWLTDMDIPY
                     TVSSINLNWSTIMKSLQEDPHQFFLDGGWSFLAMGSDDEASDESEEEISEYEASEEEP
                     EDESALSEEDEYSDEQFSDEGSEVESADGESEEGEDWDELEQKAAKADRASTYKE"
     gene            complement(<471373..>472797)
                     /locus_tag="HG535_0B02470"
                     /db_xref="GeneID:59234869"
     mRNA            complement(<471373..>472797)
                     /locus_tag="HG535_0B02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287041.1"
                     /db_xref="GeneID:59234869"
     CDS             complement(471373..472797)
                     /locus_tag="HG535_0B02470"
                     /inference="similar to AA sequence:RefSeq:NP_010944.1"
                     /note="similar to Saccharomyces cerevisiae GAL83 (YER027C)
                     and SIP2 (YGL208W); ancestral locus Anc_3.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142936.1"
                     /db_xref="GeneID:59234869"
                     /translation="MGNSPSAERSKKIGVKSPREMAEENKDISMLDVTEANKLAEPAK
                     RNSNSSLTHSFSHMNIDGANNLEAQPPLARRKSTLIFNDEDDEIPPYTDHQEHGSEGL
                     SHTTSNEEQGGNNETVSSVSVSASATPSDTSLDNVTAEQSVGDSKTSPMPAVSQTASY
                     IQSGNNQQQNRNSPKPAETMVPVDITWQQGGHKVYVTGSFTGWRKMIGLVPVVGQPGL
                     LHVKLQLPVGTHRFRFIVDDELRFSDFLPTATDQMGNFVNYLEVVAPNDTVSQQQQLQ
                     NQQLQSPQQLQQEQQHQHQLQQLQNIQDNPQTPQVSEIAPGAASQPTSSSKPVSARSR
                     IALEIEREPDEIGDGFTRFREKKPSRHELEYTQDIPAVFTDPTVMEQYYLTLDQQQNN
                     HQNMSWLTPPQLPPHLENVPLNSYSSSQGDNNENNSGALPIPNHVVLNHLATSSIKHN
                     TLCVASIVRYKRKYVTQILYAPLQ"
     gene            complement(<473293..>474381)
                     /locus_tag="HG535_0B02480"
                     /db_xref="GeneID:59234870"
     mRNA            complement(<473293..>474381)
                     /locus_tag="HG535_0B02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287042.1"
                     /db_xref="GeneID:59234870"
     CDS             complement(473293..474381)
                     /locus_tag="HG535_0B02480"
                     /inference="similar to AA sequence:RefSeq:NP_010945.1"
                     /note="similar to Saccharomyces cerevisiae MIG3 (YER028C)
                     and MIG2 (YGL209W); ancestral locus Anc_3.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142937.1"
                     /db_xref="GeneID:59234870"
                     /translation="MVLDDTLDNLNMNKKSIDFPPDNDERPFKCEVCNRGFHRLEHKK
                     RHIRTHTGEKPHQCTFPGCGKSFSRSDELKRHLRTHSGSSQRKSKKVREKAVRKPRGK
                     QQADDEKEIPKVTLTPVIAPATLPQPQVPALSQTALPTGYQPSPVPYSSSLTPLANQL
                     PQRTQSPSYNYSNSSLTLSEASGSSIFSRSGSFTANNSIPGTPASLKDMYHHKSSSIS
                     VTQQQKKFAKSLVTALSSLQGMTPLQSTRVIKSDSISIPTSPVTSRPVSAASSVVSLA
                     SMLNNELGSSTNLKGHGSTQFLDSTMSPKGSVRKNGKAKFHLSADEDDSADEESDSAR
                     GFENNRIQLPPISNVLKEIDIFKTKVND"
     gene            complement(<475887..>476381)
                     /locus_tag="HG535_0B02490"
                     /db_xref="GeneID:59234871"
     mRNA            complement(<475887..>476381)
                     /locus_tag="HG535_0B02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287043.1"
                     /db_xref="GeneID:59234871"
     CDS             complement(475887..476381)
                     /locus_tag="HG535_0B02490"
                     /inference="similar to AA sequence:RefSeq:NP_010946.3"
                     /note="similar to Saccharomyces cerevisiae SMB1 (YER029C);
                     ancestral locus Anc_3.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142938.1"
                     /db_xref="GeneID:59234871"
                     /translation="MVKADVKNGSRLPDLIHHRLRVLTQDGRVYIGELMAFDKYMNMV
                     LADCVEERIPKTQVAKLQDIKDGSTPKVEKRILGLTILRGEHVLTTVVESKPTLTKKD
                     RLSGVKKQDKQLQKQKNQRSTKRQKVDPKSSNKVSKPTATSGRNNDEIPRRKFQPPPG
                     FKRR"
     gene            <476591..>477013
                     /locus_tag="HG535_0B02500"
                     /db_xref="GeneID:59234872"
     mRNA            <476591..>477013
                     /locus_tag="HG535_0B02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287044.1"
                     /db_xref="GeneID:59234872"
     CDS             476591..477013
                     /locus_tag="HG535_0B02500"
                     /inference="similar to AA sequence:RefSeq:NP_010947.2"
                     /note="similar to Saccharomyces cerevisiae CHZ1 (YER030W);
                     ancestral locus Anc_3.520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142939.1"
                     /db_xref="GeneID:59234872"
                     /translation="MSEEPKDKRALEKDNASSTADVKPKQKRRRRNYDDYDEAVAKEE
                     KDSKANRKEKKSNGTSEGADDASDESEMDDAKLDALVGSDEEEEDLAEIDTSNIITAG
                     RRTRGKIIDYKKTAEELESKNGTELQEETEEADDDFKE"
     gene            complement(<477158..>477906)
                     /locus_tag="HG535_0B02510"
                     /db_xref="GeneID:59234873"
     mRNA            complement(join(<477158..477777,477861..>477906))
                     /locus_tag="HG535_0B02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287045.1"
                     /db_xref="GeneID:59234873"
     CDS             complement(join(477158..477777,477861..477906))
                     /locus_tag="HG535_0B02510"
                     /inference="similar to AA sequence:RefSeq:NP_010948.1"
                     /note="similar to Saccharomyces cerevisiae YPT31 (YER031C)
                     and YPT32 (YGL210W); ancestral locus Anc_3.521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142940.1"
                     /db_xref="GeneID:59234873"
                     /translation="MNNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTNDFNMESKS
                     TIGVEFATRTIEVEKKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKPSSYE
                     NCNHWLSELRENADDNVAVGLIGNKSDLDHLRAVPTDEAKNFAQENQLLFTETSALKS
                     ENVELAFRELITAIYQMVSKHQVDLGDSGNNNGMGQAPKGPTISLTPAPNESKKKSSN
                     NCC"
     gene            <479141..>481510
                     /locus_tag="HG535_0B02520"
                     /db_xref="GeneID:59234874"
     mRNA            <479141..>481510
                     /locus_tag="HG535_0B02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287046.1"
                     /db_xref="GeneID:59234874"
     CDS             479141..481510
                     /locus_tag="HG535_0B02520"
                     /inference="similar to AA sequence:RefSeq:NP_010949.4"
                     /note="similar to Saccharomyces cerevisiae FIR1 (YER032W);
                     ancestral locus Anc_3.522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142941.1"
                     /db_xref="GeneID:59234874"
                     /translation="MSLPVTPNKTDYNSSSAIHSILRSPHCRSQSHLQPQLSPCSIEK
                     TSPQSQVRFSIPQQDDVCKDDASIQQSPTRIVFPNSSSAELNNHGHLVDMHSRIMLDV
                     PENIWTFHTKNKSHSRQKSMQDIIADTLASVNSDQKDIQTTPASQKSTISQVSPLNLR
                     PQSQLYLAQHSPLNSYKVPVPLEISLPPYLSPKNKQKKRSSLIFDGDGYSEYHGHDSI
                     LHLDSKNVSETSVSEISNNSELSLTSIPSAEHDLSLNMTDCDFGETLGIDEDANVNLK
                     LQTRNLKRNQTIHNPQENNSSLQILASPSKLIQIPDLSLEYVPKNLGRSSNLYNESNL
                     HHDILRDDTLSPGKERGKLDQEFVFPKGNQTQGNEDFLKVDSSPTSRQFENVREERFL
                     QSLSCEKGKGHSHRRSRSIHQVEDFFTSTSTPPKIPERSSLRSHSPASNLSSPKVSSP
                     MSPQIERAFNPSKSDISPSSSKDSSSIYEDNGNAKKEQKIDTPQSIVGSSKKVTPQES
                     IFDRHESKQEEVVDESDVSLEIISEHLNLESEKKPVKIEGIKSEINGLKIEPLSVINS
                     FNGPSASFNFEDVTSTVEFTNKEYINLLSPRRSLSNVGSDFSRNSQFSKRTEQSNATS
                     QPQDSFGKVPLKNNAGPYRSNLSGPDNLRSVYEVRDGNITEVLVIDDEFESCSQSVSK
                     LDPNYRKRSEKHANIPLECSRILQLCEDAANQAKNVIIELIEEDCKNPNGRKIIPKQW
                     DNTSARKATKQFPMQSGSALQTSLRLRNKNESYLSRLDRAMKVQPLYEP"
     gene            complement(<481624..>484167)
                     /locus_tag="HG535_0B02530"
                     /db_xref="GeneID:59234875"
     mRNA            complement(<481624..>484167)
                     /locus_tag="HG535_0B02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287047.1"
                     /db_xref="GeneID:59234875"
     CDS             complement(481624..484167)
                     /locus_tag="HG535_0B02530"
                     /inference="similar to AA sequence:RefSeq:NP_010950.1"
                     /note="similar to Saccharomyces cerevisiae ZRG8 (YER033C);
                     ancestral locus Anc_3.523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142942.1"
                     /db_xref="GeneID:59234875"
                     /translation="MRSFIKSHRKANSLDESPLKTSTSSGDLLYSQTSSVDPLVLVPT
                     TPSHTSNNGNGVKYSPGFEPFHRLANKKMFTSKLFKKSSATNLNAQMNIHSSSPKESS
                     SAPGTPQVKRWEGKSEHSSSNEDVSKFPAIKGTVTHSWGDQSKNTQTVIRLNNPSTSS
                     SDGSDLEPAVRISSLRKGSVMSYSTTYSNENTHNTTRGTDDTQHRDKHIYNELSKVKS
                     KNRQVRIHSHDDILHLEKSSAVSLQLLASTSKTPILHKELSEQEDSQNSVSSEEDENT
                     HLNGLTGGLSTNEKSYEIRKDSGKDYLGTTRHTQGTSRSKRSDSERDSTSENLTPFDE
                     NDYDDDDDDASRFSFEINGINGRTSSIKYYSKPDPVESVYIDDMYEDENFDEDMNFYE
                     DSFDDMEFPSNNINANLSPNTLPPSNNLRASALSTNALKPKKTYNDLLALSDDETDDD
                     EEEVGDVDGTDHSALSDKNIERAGDHTSSNQQSNFDPENFEETRAELKNLSNRPLVAS
                     SLLHGFSPGPSSARFSSSVRNGEVKEKTTANIKSFSDIFNLDDGDDDSENDGIPGEIS
                     RSDYSSDDEEIESSRPTIYLNDNYADFKDNAKSSSAANDSESRTLPKTPVRILVSSPA
                     EGANIKNSNVTLDPHLNINCSGQCLPRPARSQLLKFHDLSSNLDSEIPGFMSNLYFID
                     ESEEDKYNEKQKIPDDDYIDEINTVPEDFDFSDSDQEINMFKSPLRKGSFRSTHSYSD
                     QPTGVAKESTPTRNKLEIKNKTVTFFDHAWDRSPTEKQRPLHNTIMDSSLENDNYVIS
                     PNGTGDNKNNPVTPTNSFNKPVPEYLNEYSLSPIQESSTSVDNSPVRLR"
     gene            complement(<484865..>486013)
                     /locus_tag="HG535_0B02540"
                     /db_xref="GeneID:59234876"
     mRNA            complement(<484865..>486013)
                     /locus_tag="HG535_0B02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287048.1"
                     /db_xref="GeneID:59234876"
     CDS             complement(484865..486013)
                     /locus_tag="HG535_0B02540"
                     /inference="similar to AA sequence:RefSeq:NP_011304.2"
                     /note="similar to Saccharomyces cerevisiae NCS6 (YGL211W);
                     ancestral locus Anc_3.524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142943.1"
                     /db_xref="GeneID:59234876"
                     /translation="MSFVPPSDPVNRAKKIKVSQLCEICHCRKALIRRPKNLQRICKL
                     CFFHVFETEIHNTIVCANLFQKGEKVAVGASGGKDSTVLAYVLKLLNDRYNYGIHIVL
                     LSIDEGIVGYRDDSLATVKRNQVQYDLPLEIVSYRDLYDWTMDEIVACAGVRSSCTYC
                     GVFRRQALDRGAAKLGISHVVTGHNADDMAETVLMNIFRGDVARLEKSTAIITQSSGS
                     PIKRSKPFKYSYQKEIVLYAHYKKLDYFSTECSYAPEAFRGTARELMKNLELIRPSCI
                     IDIIHSGENLILKPKKSSKNELRSASEQQPVEVRSDGSVKLQRNTTAGFIDGGKCERC
                     GYLSSNRICKACILLEGLEKNRAKVSLEKDTSVAGAARLTRALERLSF"
     gene            complement(<486205..>487272)
                     /locus_tag="HG535_0B02550"
                     /db_xref="GeneID:59234877"
     mRNA            complement(<486205..>487272)
                     /locus_tag="HG535_0B02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287049.1"
                     /db_xref="GeneID:59234877"
     CDS             complement(486205..487272)
                     /locus_tag="HG535_0B02550"
                     /inference="similar to AA sequence:RefSeq:NP_011303.1"
                     /note="similar to Saccharomyces cerevisiae VAM7 (YGL212W);
                     ancestral locus Anc_3.525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142944.1"
                     /db_xref="GeneID:59234877"
                     /translation="MVHRGSEVDVVFDDVRIINESYALYGVNVKITRAGENSVRQTFE
                     QHVFRRYSEFWDLKNKLEKEFRTELPYDLPNRGFGLWSKNKLSSEVIESRKNKLAKFL
                     RDMLNDSFDTKWKNSPLVASFLKLPAGWNETNAHVTPNQIDDRTDLDLGDPSQWMISF
                     RDSKTLLSQCKKDGSSDNTRNLMKLRLSLYQLENALDATRRSRLLNETELNRRHSLLQ
                     ALKSDINEMALHSGLGKITSNDAVDIGNEKTVLFTGVAKPKSPKKPLAGRRRIGETEE
                     TLQLNKQQLLQLHKDKIAEQDQELGQMHMIIQRQKALSLEMNQELSQQNDLLDLLGND
                     IDNTSSKLRTANRRAKQFNSD"
     gene            <487467..>488744
                     /locus_tag="HG535_0B02560"
                     /db_xref="GeneID:59234878"
     mRNA            <487467..>488744
                     /locus_tag="HG535_0B02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287050.1"
                     /db_xref="GeneID:59234878"
     CDS             487467..488744
                     /locus_tag="HG535_0B02560"
                     /inference="similar to AA sequence:RefSeq:NP_011302.1"
                     /note="similar to Saccharomyces cerevisiae SKI8 (YGL213C);
                     ancestral locus Anc_3.526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142945.1"
                     /db_xref="GeneID:59234878"
                     /translation="MSNVFISTANCGKAHDADIFGLSVCNPYTVTCSGDGSIKLWKNN
                     LLDNELPRNNYIRQFVHKTGVHHVEVFHSVERGGNELCIIACVSFSGHIFFYNVDIES
                     GDLNELNLLSPKEDKKSYWAIKWYKSDDSNICHRFAATDVKGSTYVWRFHPFEEELDE
                     EQAQKEKMKREAKARRNGEYVPDKDAEIDSTFRSATVRPHLMLDAEIPAQKPAFATCI
                     DISSSGLIATGFSNGNVVISQLRTLRPIHNFEAFGIQGIEQNSNTVRDVKFSPLGTIL
                     AVASDSGSYGCVTMYETEYGERIGSLTVPTHSNQATIGAFAHSGWVFGLSFNSTGEFL
                     ASCGYDSKVRVWDVKSRERVSTLNITASDIEEEQEILLEDEHGDSLKFPPVMAVKFIN
                     KGVRKGMGSDTNEGLCCVCMDRSVRWFREAGGA"
     gene            complement(<489256..>490560)
                     /locus_tag="HG535_0B02570"
                     /db_xref="GeneID:59234879"
     mRNA            complement(<489256..>490560)
                     /locus_tag="HG535_0B02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287051.1"
                     /db_xref="GeneID:59234879"
     CDS             complement(489256..490560)
                     /locus_tag="HG535_0B02570"
                     /inference="similar to AA sequence:RefSeq:NP_011300.1"
                     /note="similar to Saccharomyces cerevisiae CLG1 (YGL215W);
                     ancestral locus Anc_3.527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142946.1"
                     /db_xref="GeneID:59234879"
                     /translation="MATFMYYPGHVANSGVRHGAPMNQQQQQQGPTYLAAGNQGTINP
                     YGYYQQQPMQHPVQQPVHPMAHQQSYFNQGLVPPPIQHHPHACHRHTCSFPQATLPPM
                     GMFYGVPPAPILPPLAIEEPVAREESVNGGVNQFLDYDLDLISDFVVKNAYIAFGTDA
                     STIIRETNSTENIDLFTKGVSSVLNATRLPSVTIFLAIDLLHKYISKLPQGIESLGGK
                     SVNVIYQNTMIALVLANKFNDDKTFTNKSWTQATGMTLNSVNDYEKEWLEVLEWRLFQ
                     DKFTSYEKLSHSFELFCQDKRCPSPPNLLPTPHSTDNYLSPLSGYQTPAQLKANIYSS
                     PCYYNEDPNDCLHSNRSRIGVMNSSPINRIQTSQSVGVFGMNGSTNYNPSYFQYGMQQ
                     PNVESINMGVSPNRSWTVDENFHNPSKLAQMDSSYYCYSAVY"
     gene            complement(<491339..>493684)
                     /locus_tag="HG535_0B02580"
                     /db_xref="GeneID:59234880"
     mRNA            complement(<491339..>493684)
                     /locus_tag="HG535_0B02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287052.1"
                     /db_xref="GeneID:59234880"
     CDS             complement(491339..493684)
                     /locus_tag="HG535_0B02580"
                     /inference="similar to AA sequence:RefSeq:NP_011299.1"
                     /note="similar to Saccharomyces cerevisiae KIP3 (YGL216W);
                     ancestral locus Anc_3.528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142947.1"
                     /db_xref="GeneID:59234880"
                     /translation="MLNFTLKDIHQSSIVVAVRVRPFTEDELSHLINDAEVKSFPRLG
                     DTNLSLPREVLNGHKPDGEFTEESSVRPPAMLRPQGIRKVVECVDDKMLIFDPADSLP
                     LSRVNDTVLNSMYSLKRASRRRLRRNGGETKFVFDRLFDETATQEQVYECTTRPLLDS
                     VLDGFNSTVFAYGATGCGKTHTVSGTSEKPGIVFQAMQELFIKMDDLRDSRDFEISLS
                     YLEIYNETIRDLLNPEISSKKLVIREDSENRTTVTNLSLYKPTNVQEVMDLVIRGNMN
                     RTTSPTDANETSSRSHAVLQIHIMQSDKSMDLTMNHTFATLSVIDLAGSERAASTRNR
                     GQRLHEGANINRSLLALGNCINALCISDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTV
                     MIVCVSPSSTHYDETLNTLKYANRAKEIRTKVLRNQQSLDRHVGSYLKTISEQKREID
                     QLRNREATIVALNLKRHKVSQEKIHMAIEDCISAVTRSYETMENYQNAKSIKSLVLCK
                     RRFLQLVILEIANIIEIVRNEPNTIAITDSCGLLIDQLQGKILELEAKFDSPDELDLA
                     IKNCHEVSLKKLQEMENWSNLRDLAFFQSRLDHVSEMIRNEILVQYSMMLEKLLQDKT
                     LSHRLKCLSCCIIQKQDVQAAINDLVKIDDEFEEFGQSFLIQSKPSSSSSSSSLSKSS
                     RSPQRLPITKTVRWLDTDTSQVNQQTESAPSAPNSPSSSPSPPPPPPPHIHADLHTGP
                     DPAEVDVSMQDINTSSDLLPSNRNRSVRNSLLTLQLLSNTN"
     gene            <494157..>496019
                     /locus_tag="HG535_0B02590"
                     /db_xref="GeneID:59234881"
     mRNA            <494157..>496019
                     /locus_tag="HG535_0B02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287053.1"
                     /db_xref="GeneID:59234881"
     CDS             494157..496019
                     /locus_tag="HG535_0B02590"
                     /inference="similar to AA sequence:RefSeq:NP_011296.1"
                     /note="similar to Saccharomyces cerevisiae MDM34
                     (YGL219C); ancestral locus Anc_3.529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142948.1"
                     /db_xref="GeneID:59234881"
                     /translation="MSFRFNAEVFKDNSFNENIKEKLTKALNSSTSSSSSPVVTRSET
                     CGEAPYAGCSDAVPLGAATVTEQRTPQSRGSTTTTTTTTTISPKTRSTMSSKKLDILK
                     SEIIVSKVNFPTMPELEILDLDISAQPRSLVKGICKISCRDAMLQIQTEIESNLLLVY
                     SDYSPDFTTPTMICKDSFTIPITMVFSEIRLEAITNLFVKNSGIGISFNDVNLDFKFD
                     CSIKILQSTIEKRLKKSMQMLFKEVLPSVIFNMSQTLFTAEETNRNVIEGSDKGDEER
                     DCTKTVPLLKVMLEESDLELSPANMLRLSTLISSRQTLSLNATVLNVPSTIPGCLERQ
                     NLRRFNSRIPSLSNYYANFCEKKEKPADMKRSTSSLVSNYAFHEADQNILPAKVLEGN
                     AYDLKTITSIQNRVFERSTDENVRPRRRKIKIAKSKKSSNHESLKDKDNTNREPSNAS
                     GEGETTEVDSPLSIQSEDPILTAPRPLKLIKPFSLMTAPCRSEFESRAYSPATLNSVS
                     TLKLPVNLNPMYFSQTDKPSLNFEPQIVVSRANSPRKLNLLEETNYFNYRPELHKLRS
                     TIYSPLGKNNAVLLSGKELSEQRQLFEKRRLSFVGLNYKGINWGSDDEPPPYII"
     gene            complement(<496103..>496357)
                     /locus_tag="HG535_0B02600"
                     /db_xref="GeneID:59234882"
     mRNA            complement(<496103..>496357)
                     /locus_tag="HG535_0B02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287054.1"
                     /db_xref="GeneID:59234882"
     CDS             complement(496103..496357)
                     /locus_tag="HG535_0B02600"
                     /inference="similar to AA sequence:RefSeq:NP_011295.1"
                     /note="similar to Saccharomyces cerevisiae YGL220W;
                     ancestral locus Anc_3.530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142949.1"
                     /db_xref="GeneID:59234882"
                     /translation="MVTESDLKSRLESNIPDLFSSIVTDISAGCGQSFDVVVVSNTFE
                     GKNRLMRNRLVNKALKNEIAQIHAFTCKCYTESEWKKIVV"
     gene            <496518..>497393
                     /locus_tag="HG535_0B02610"
                     /db_xref="GeneID:59234883"
     mRNA            <496518..>497393
                     /locus_tag="HG535_0B02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287055.1"
                     /db_xref="GeneID:59234883"
     CDS             496518..497393
                     /locus_tag="HG535_0B02610"
                     /inference="similar to AA sequence:RefSeq:NP_011294.1"
                     /note="similar to Saccharomyces cerevisiae NIF3 (YGL221C);
                     ancestral locus Anc_3.531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142950.1"
                     /db_xref="GeneID:59234883"
                     /translation="MSKAISKSQLKVITKAINKHYPSSYADSSWDNTGLLIDCSKNEN
                     VTTEVKKPLVLLTVDLTSSVAQEAIERDCNVILAYHPFIFPSWKNLNPSRNSQHDSAI
                     KLIQQGISVYCPHTAVDAAKDGVNDWLSHGLVAHERTMIASSESIESIKDKPINGEDS
                     TEVGYGRLVKLASPLTLKQVIKNVKNSLGIDHLQVASHYEPANHSIKTIALCAGSGSG
                     VFRSLREDVDLYYTGELSHHEILKYKEMGKSVIICNHSNTERGYLREQMCHILKSEGV
                     DCIVSENDKDPLNVV"
     gene            <497527..>498117
                     /locus_tag="HG535_0B02620"
                     /db_xref="GeneID:59234884"
     mRNA            <497527..>498117
                     /locus_tag="HG535_0B02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287056.1"
                     /db_xref="GeneID:59234884"
     CDS             497527..498117
                     /locus_tag="HG535_0B02620"
                     /inference="similar to AA sequence:RefSeq:NP_010951.1"
                     /note="similar to Saccharomyces cerevisiae YER034W;
                     ancestral locus Anc_3.532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142951.1"
                     /db_xref="GeneID:59234884"
                     /translation="MDPYSLKRDNRKKFQDKQRLKHRHATPSDRKYRALNRQEKEGEN
                     SQSNEDKDEEEVELEIPSNEARYHEDITMAFGDAGEEERNSIASKRLRDILKEKAEQE
                     KFQDNLPQNESSQARITTKGLQTMDIADLNQLLGTKNNTNLTPAPRAAQRNHQLATLD
                     KQQSVESRDNRKNKESATSNVPKDLIAAQDFLDDLI"
     gene            <498368..>499486
                     /locus_tag="HG535_0B02630"
                     /db_xref="GeneID:59234885"
     mRNA            <498368..>499486
                     /locus_tag="HG535_0B02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287057.1"
                     /db_xref="GeneID:59234885"
     CDS             498368..499486
                     /locus_tag="HG535_0B02630"
                     /inference="similar to AA sequence:RefSeq:NP_010952.3"
                     /note="similar to Saccharomyces cerevisiae EDC2 (YER035W)
                     and EDC1 (YGL222C); ancestral locus Anc_3.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142952.1"
                     /db_xref="GeneID:59234885"
                     /translation="MSTDTMYFNSSRLMPASSKNKNNSVARLDKKSIQAAKKNKVRQE
                     TMDVSLPDPQILPNGEKPNFGNSKSRRKARDGLAPNRKSKNATKSKVAADETDAAEVT
                     QHLKDMYLKSGEPKPKPKNSRKRQEKRNSSTTSVSSGADSSSADCARCDETSRETPVS
                     TLSAKSVPQPTKQTSPPMTSPTQYSNSSVVSPLLMNPGLNAGINVGIISARPPSSPVS
                     QTQFQQQQQMQQPQQPGFAGYPYGNYSFASPFNAPQFMAPQTPLMNPMYPQPSLHQLP
                     VMYRALDIQQHQMEQNYLQQAQNHPYQSLPQNHQYPRPVSAPLGLDKVPKVLESSAIT
                     GRSKPYENQPHGSSKTFAGASFASKDPKVHKLPKPSFT"
     gene            complement(<499704..>501536)
                     /locus_tag="HG535_0B02640"
                     /db_xref="GeneID:59234886"
     mRNA            complement(<499704..>501536)
                     /locus_tag="HG535_0B02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287058.1"
                     /db_xref="GeneID:59234886"
     CDS             complement(499704..501536)
                     /locus_tag="HG535_0B02640"
                     /inference="similar to AA sequence:RefSeq:NP_010953.1"
                     /note="similar to Saccharomyces cerevisiae ARB1 (YER036C);
                     ancestral locus Anc_3.534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142953.1"
                     /db_xref="GeneID:59234886"
                     /translation="MPPVSASKAKRDAKKAEREAKKKADGKTVRKLGKKKEEKVEEDE
                     AELAAKEINQLKLQQDEHGLSDRVVTGVLDSLETSRDIKLSSVSLLFHGKVLIQDSIL
                     ELNYGRRYGLLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSEWSALEYVVR
                     EAEAELKRLEDLVERIIIEDGPESDVLDGIYEKMDSLDPDTFESRAAVILIGLGFNAK
                     TILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTL
                     VLVSHSQDFLNGVCSNMIDMREQKLMAYGGNYDSYVKTRSELETNQMKQYSKQQEEIA
                     HIKKFIASAGTYANLVRQAKSRQKILDKMEADGLIQPVAGDRVFSFRFPPVERLPPPV
                     LAFDDISFSYDGNKENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGG
                     RVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPQISQDFQYWRGQLGRYGLTGEG
                     QTVQMGTLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAIKEFNGGVV
                     VVSHDFRLLDKIAKDIFVVEHKTATRWDGSILQYKNKLAKNVVL"
     gene            <501801..>503048
                     /locus_tag="HG535_0B02650"
                     /db_xref="GeneID:59234887"
     mRNA            <501801..>503048
                     /locus_tag="HG535_0B02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287059.1"
                     /db_xref="GeneID:59234887"
     CDS             501801..503048
                     /locus_tag="HG535_0B02650"
                     /inference="similar to AA sequence:RefSeq:NP_011292.1"
                     /note="similar to Saccharomyces cerevisiae COG1 (YGL223C);
                     ancestral locus Anc_3.535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142954.1"
                     /db_xref="GeneID:59234887"
                     /translation="MSGLGLDVFGDRVDEALDSKVLDLFREHTVVEVKDIKLELSNKI
                     EKSHRRFTQELQEHFRDILTVTNEVGELYRFLKDGDSLFMDLCFKDNVYGVDKLPELH
                     HEPIATNLRRKSTTVTCLAPMSPVVSSATSVLLVSNWTLAITDFVSRFTASSNPGKLF
                     DKTLQEFENLRNHIAQLHPFKKIILSKCHQFLSFINDDEASHNIFTFNQWAKLYNLIL
                     RDEPPVFEWDSEQLKAFDSLLFDTTLANYTEDLLKDEQVQEFVRSAIFQSKMSEKILK
                     SIHVQLMELDDLLKSGHDVSRSLSHLHKLASRDTTASDIVDESRLYAEGLVTDQRVAL
                     YRLITSITDKLRSLKVNSGGSNQMADLKSRLIEKLQQCLPSELPGSTATLKMDDMISD
                     VMRRHNDENYRIFIERQIKRLRE"
     gene            <503304..>504137
                     /locus_tag="HG535_0B02660"
                     /db_xref="GeneID:59234888"
     mRNA            <503304..>504137
                     /locus_tag="HG535_0B02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287060.1"
                     /db_xref="GeneID:59234888"
     CDS             503304..504137
                     /locus_tag="HG535_0B02660"
                     /inference="similar to AA sequence:RefSeq:NP_010954.1"
                     /note="similar to Saccharomyces cerevisiae PHM8 (YER037W)
                     and SDT1 (YGL224C); ancestral locus Anc_3.536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142955.1"
                     /db_xref="GeneID:59234888"
                     /translation="MTISKDYQQIYYERVRKQLRINQEHLESLDYPGSRVTFPVDCKE
                     LPKPDSDLKVFFFDIDNCLYRRSTRIHDLMQVSIHDYFKTELNLDDEAAHNLRRTYYR
                     DYGLAIRGLVMFHDINAIEYNKMVDDALPLQDILRPDLALRKVLQDLRASGKIDKLWL
                     FTNAYKNHGLRCVRLLGIADLFDGITYCDYAQEDNLICKPDPNAFEKAKMESGLGQYS
                     NAWFVDDSGNNIQQGIALGMGKCIHLVEDVVDEILGANPKGSAVISDITDLPKAFPEL
                     F"
     gene            complement(<504234..>505394)
                     /locus_tag="HG535_0B02670"
                     /db_xref="GeneID:59234889"
     mRNA            complement(<504234..>505394)
                     /locus_tag="HG535_0B02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287061.1"
                     /db_xref="GeneID:59234889"
     CDS             complement(504234..505394)
                     /locus_tag="HG535_0B02670"
                     /inference="similar to AA sequence:RefSeq:NP_010955.3"
                     /note="similar to Saccharomyces cerevisiae KRE29
                     (YER038C); ancestral locus Anc_3.537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142956.1"
                     /db_xref="GeneID:59234889"
                     /translation="MSKLSSQESLPDSPLQTARNVSDLETLSSTSVELSSDDEIDEDS
                     GIKDKILTRTLTKRSLASTESEEKIAKRNHSSNSDGSISLRKFDLGQHYDPDITTSIE
                     KINSLKEQMVNNQAQEAGQTSPLALRKKKIRQLLKKPNVSSSYIDMIAKETISQKYVD
                     WHFITEDSTFVQSDSSLRNLIRSFGVSDLKIQALYNDRITISKARQYDTLCELTPVKI
                     MMDTLLKYKDDSLYFLKSLICFIMDRKVYESVECDVVWCTRVFNMFPESKFLTCYLQL
                     VNNDDYFMHYRLMRLIPSLRCSLLKCILCKSPDIPFLSELTSVFDDLLDAKSYETLLY
                     YILVVVGPDGIPFGDNKCIRYFEKCISDILDLENGEVELTLLKGILNMFRKI"
     gene            complement(<505603..>506622)
                     /locus_tag="HG535_0B02680"
                     /db_xref="GeneID:59234890"
     mRNA            complement(<505603..>506622)
                     /locus_tag="HG535_0B02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287062.1"
                     /db_xref="GeneID:59234890"
     CDS             complement(505603..506622)
                     /locus_tag="HG535_0B02680"
                     /inference="similar to AA sequence:RefSeq:NP_010956.1"
                     /note="similar to Saccharomyces cerevisiae HVG1 (YER039C)
                     and VRG4 (YGL225W); ancestral locus Anc_3.538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142957.1"
                     /db_xref="GeneID:59234890"
                     /translation="MSDLKVTNENAFSHVANSGPISILSYCASSILMTVTNKYVVNIE
                     GFNMNFIMLFAQSLVCTLALVVLKGLGYAKFRPLNRTDAKNWLPISILLVIMIYTSSK
                     ALQFLAVPIYTIFKNLTIILIAYGEVLFFGGSVTSMELSSFMLMVLSSVVATLGDKQD
                     LSAKAEKLAEELAQTGSGAGSVFSVGYLWMFANCISSASFVLIMRKRIKLTNFKDFDT
                     MFYNNILALPILLLSSFFLEDWSSANLNINLSQDSLTAMIISGLASVGISYCSGWCVR
                     VTSSTTYSMVGALNKLPIALSGLIFFDAPNNFLSILSIFIGFLSGIVYAVAKQKKTQR
                     QQPVK"
     gene            <508437..>510917
                     /locus_tag="HG535_0B02690"
                     /db_xref="GeneID:59234891"
     mRNA            <508437..>510917
                     /locus_tag="HG535_0B02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287063.1"
                     /db_xref="GeneID:59234891"
     CDS             508437..510917
                     /locus_tag="HG535_0B02690"
                     /inference="similar to AA sequence:RefSeq:NP_010958.3"
                     /note="similar to Saccharomyces cerevisiae GLN3 (YER040W);
                     ancestral locus Anc_3.539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142958.1"
                     /db_xref="GeneID:59234891"
                     /translation="MVGDSNLYDIFGSNNSPHERNPKETKINTKQASLSAMNATTFDS
                     MLEILPDSVDFSLFPTISNTNSHDSMVESPKSASVFPHLLNKDKDNVHSQLQTSFETM
                     FEHSSNPTTATTNENAVGTNSKSHNQENGSAHPIDIANQQNGEIAQLWDFNVEEFMMT
                     PNSSNGSATITAPNSFNSEMQFTAGSAPGVSLFSSIGNGNQFGISMNNNVNNNNNNNN
                     NNNNNNNSNNNNNNNNYHQLLGMEIPHAPNGSFYNQSASSSPRNSSQTTLKREDSTGL
                     HRPSLNGRRSSSQLNKILHNENGAISSAGNSVRKNSTAKQISSTSLSNYKRGSSTSSS
                     DLPKKPPLQCTNCKTLKTPLWRRDSHGNTLCNACGLFQKLHGTMRPLSLKSDVIKKRN
                     NKKRAKKTQAQSEGNSASDASNTNSNTNQNVNGNSRVSASKNGRPKKNSAVQDIKVST
                     SYENEGDGMSYSATIGSNGKKQGNESVLNNGFGGQSLQESLNPNNLMTHNHRMAPSVS
                     STTKKSRRGSTSSNNSSSSRSSSRSVVPILPKPSPNTNNQSQFSLNLVTSNSSANSAS
                     SSPRVIGSSFNPSSPMTSQPSMFSSSTGRPGITIPRRKSSRNHSSSSSFMAASLQQLQ
                     NQNQQSSISNQNTSVSNGWSQNSAAASPKTMRSPKADFELFNSPNEAPSASNSKRAHT
                     SLLSQQLQNSGQQSDHNSVEISSESKHTLNINTFHLQQNLTASLRKASVTASPRNSYV
                     DSLLQHRGINKDDASLTLRRQSSFGPKRTISFREQTVVSTPEMSLNGNGMSTTPVGLE
                     NNTYEATNNSSSSQTNIADELDWLKFGM"
     gene            complement(<512214..>512757)
                     /locus_tag="HG535_0B02700"
                     /db_xref="GeneID:59234892"
     mRNA            complement(join(<512214..512645,512728..>512757))
                     /locus_tag="HG535_0B02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287064.1"
                     /db_xref="GeneID:59234892"
     CDS             complement(join(512214..512645,512728..512757))
                     /locus_tag="HG535_0B02700"
                     /inference="similar to AA sequence:RefSeq:NP_010377.3"
                     /note="similar to Saccharomyces cerevisiae UBC13
                     (YDR092W); ancestral locus Anc_8.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142959.1"
                     /db_xref="GeneID:59234892"
                     /translation="MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPQQ
                     SPYEDGVFHLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIR
                     TILLSIQALLASPNPNDPLANDVAEDWIKNEEGAIRKAHEWTQLYASKDVK"
     gene            complement(<513177..>514958)
                     /locus_tag="HG535_0B02710"
                     /db_xref="GeneID:59234893"
     mRNA            complement(<513177..>514958)
                     /locus_tag="HG535_0B02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287065.1"
                     /db_xref="GeneID:59234893"
     CDS             complement(513177..514958)
                     /locus_tag="HG535_0B02710"
                     /inference="similar to AA sequence:RefSeq:NP_011092.1"
                     /note="similar to Saccharomyces cerevisiae PAB1 (YER165W);
                     ancestral locus Anc_8.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142960.1"
                     /db_xref="GeneID:59234893"
                     /translation="MSDITDKTAEQLEQLNIQDDQQTAPTSTDSDNQKVETSSASLYV
                     GELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGEQAIEKLN
                     YAPIKGVPCRIMWSQRDPSLRKKGSGNIFIKNLHADIDNKALHDTFSVFGDILSCKIA
                     TDEAGNSKGFGFVHFADDEAAREAVDAINGMLLNGQEVYVAPHVSRKDRQSKLEEAKA
                     NFTNVYVKNINVEATPEEFEKYFSQVGPVTSVHLEKDSEGKSRGFGFVNYEDHGDAAK
                     AVEELNESEFKGQVLHVGRAQKKYERLQELKKQYEAYRMEKLEKSQGVNLFIKNLDDS
                     IDDEKLEEEFAPFGSITSVRVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK
                     PLYVAIAQRKDVRRSQLAQQIQARNQMRYQQATAAAAAAAGMRGQFMPPMFYGVMPPR
                     GVPFNGPTPQQMAAMGGMPKNGVPMQQFRNSPVYGVPPQGAPQQGNFMRNGGNANQFY
                     QQKQRQALGEELYKKVFSKTSDEEAAGKITGMILDLPSQEVVPLLESDDLFEQHFKEA
                     FAAYESFKQEQDQQQQQPQPQQPQTQA"
     gene            complement(<515410..>519843)
                     /locus_tag="HG535_0B02720"
                     /db_xref="GeneID:59234894"
     mRNA            complement(<515410..>519843)
                     /locus_tag="HG535_0B02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287066.1"
                     /db_xref="GeneID:59234894"
     CDS             complement(515410..519843)
                     /locus_tag="HG535_0B02720"
                     /inference="similar to AA sequence:RefSeq:NP_011091.1"
                     /note="similar to Saccharomyces cerevisiae CHD1 (YER164W);
                     ancestral locus Anc_8.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142961.1"
                     /db_xref="GeneID:59234894"
                     /translation="MGMKDVTSEILENPELYGLRRSHRAPPKSYFSDDDDEDSIKASG
                     RRRTKYNEDAADDSDAEVDDEGDDEDQEGSDEDADIDDDDVDYYTSSQKPKTARTYKK
                     KASLKKKIKEANVVIPTRFSSRNNKSVNYNTDYSDDDLLESGDELDDEDEDMDSEEAE
                     EGQYEESATPQPGEDHGIDLIVTHRLKEGIDKSTEKIVPTLEQCKSNYEYLIKWSDRS
                     HLHNTWETFASLDQVRGIKRLENYCKSFLIQDLQFRLDPYVMIEDLEAMDMDQERRLD
                     EFKEFQEPDRIIDSKRELTSDGTSQLQYLVKWRRLNYDEATWENATEIVELAPEQVKH
                     FQGRANSKILPQFSSNYTAQRPQFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKND
                     NGILADEMGLGKTVQTVSFISWLVYARRQNGPHLVVVPLSTMPAWQETFDKWAPDLNC
                     ICYMGNQKSRDAIRENEFYTNPNAKGKKNVKFNVLMTTYEYILKDRMELGSIKWQFLA
                     VDEAHRLKNAESSLYESLNSLKVSNRLLITGTPLQNNIKELAALVNFLMPGRFTIDQE
                     IDFENQDDKQEEYIRDLHLRLQPFILRRLKKDVEKSLPGKTERILRVELSDVQTEYYK
                     NILTKNYSALTAGAKGGHFSLLNIMSELKKASNHPYLFDNAEERVLEKFGDGSKSREN
                     ILRGMIMSSGKMVLLDKLLTRLKKDGHRVLIFSQMVRILDILGDYLAIKGIAFQRLDG
                     TVPSSQRRISIEHFNAPDSNDFAFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQA
                     MARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGKKYTKKNE
                     PSSGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLDHAEDHVTTPELGESHLGGEEF
                     LRQFEVTDYKADVDWDDIIPEDELKKIQDEDQKRKDEEYVQEQLQLMNRRNNALKKIT
                     NSIKGEGEELDDDDDDDTKSSRKRAKANNMDVLDEREIRALYKTILKYGVLTNMFEAM
                     IADGTLPVKSIEKYEEVYNDILAIAKEHLQREESKRIKLLASLEKKAKEYRQKLNSNQ
                     IKAEDQPKDNPLSRLAAKRKEKRAVLFEYDKVRNLNAESLLNRIEDMKLLKTVIDNNY
                     KSDPLKFKFKRPPKPAQNWNCDWNQNDDEKLMAGIYKYGHGSWTQIRDDPFLGLTDKI
                     FLNEAQPVAKENKEPDDSHPNDGNPPDKRGKGITGSSKKVPGAIHLGRRFDYLVSLLR
                     DEVNGVNTATPSGASTPVNDVSHEKLPIKKRPRKAGTSTNSRASTPDSSSYKSDHSSK
                     RLKPLPKGPAAMTHNRTNTSASSNGTAKSVKNSSAKSSGTDTPPPVPTQAPHEKEYES
                     MDEEECMNIMGDIRSSLIRLRRGGKGLDRKEWAGILKKELTAVGSHIEKQMDSSRKHT
                     PVKFKKHLWSYSSNFWPASVKSQKLMAMYDKITAKPDQAKS"
     gene            <521406..>523229
                     /locus_tag="HG535_0B02730"
                     /db_xref="GeneID:59234895"
     mRNA            <521406..>523229
                     /locus_tag="HG535_0B02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287067.1"
                     /db_xref="GeneID:59234895"
     CDS             521406..523229
                     /locus_tag="HG535_0B02730"
                     /inference="similar to AA sequence:RefSeq:NP_010376.3"
                     /note="similar to Saccharomyces cerevisiae RLI1 (YDR091C);
                     ancestral locus Anc_8.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142962.1"
                     /db_xref="GeneID:59234895"
                     /translation="MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVLPT
                     SKIAFISEILCIGCGICVKKCPFGAINIINLPTNLEAHVTHRYSANSFKLHRLPTPRP
                     GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQEIIKYFRGSELQNYFTKML
                     EDDIKAIIKPQYVDNIPRAIKGPIQKVGEILKLRMERSQDEVKYFIKIMDLQNVLNRE
                     ISKLSGGELQRFAITMSCVQKADVYMFDEPSSYLDVKQRLNAALVIRSLLDPQTYVIC
                     VEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEAL
                     QFRLADANDDLRDDATRDYSYPAMKRTQGDFVLNVESGEFSDSEILVMMGENGTGKTT
                     LIKLLAGVIEADDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDV
                     VKPLKIDDIIDQEVQHLSGGELQRVAIVLGLGIPADIYLIDEPSAYLDSEQRIICSKV
                     IRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGQPSKNAFSGSPESLLTGCNRFLKN
                     LNVTFRRDPNSFRPRINKLDSQMDKEQKLSGNYFFLDNVNV"
     gene            <523722..>524432
                     /locus_tag="HG535_0B02740"
                     /db_xref="GeneID:59234896"
     mRNA            <523722..>524432
                     /locus_tag="HG535_0B02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287068.1"
                     /db_xref="GeneID:59234896"
     CDS             523722..524432
                     /locus_tag="HG535_0B02740"
                     /inference="similar to AA sequence:RefSeq:NP_011090.3"
                     /note="similar to Saccharomyces cerevisiae YER163C;
                     ancestral locus Anc_8.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142963.1"
                     /db_xref="GeneID:59234896"
                     /translation="MTRTEGLYVLGYGSLIYKPPPHYTHRILAIIHGFVRRFWQSSTD
                     HRGVPALPGRVATLVSYEDIVRTPAFMRDLQLHDKISDIQGPDDLTTIGVVYYIPPEH
                     ADEVRRYLDVREQGGYTQHEVNVHLETSPDQEGELEHLLQELPSHPKSARKILQTTVY
                     IGTIDNVSFVGQEDIKSTARTISKAKGPSGTNYAYLKMLHNALEQMPIFHNNTRVNDL
                     YLESLLRQVESLEQEESC"
     gene            <524605..>525522
                     /locus_tag="HG535_0B02750"
                     /db_xref="GeneID:59234897"
     mRNA            <524605..>525522
                     /locus_tag="HG535_0B02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287069.1"
                     /db_xref="GeneID:59234897"
     CDS             524605..525522
                     /locus_tag="HG535_0B02750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142964.1"
                     /db_xref="GeneID:59234897"
                     /translation="MISERAATALATVGTVCWCIQLIPQIWYNWRRKDCTGLPPIMML
                     LWVVSGIPFAIYFCVSEGNITLQVQPHLFMFFCLISFVQSCYYPPVRMTRWKIIAVLV
                     AFGAVDIGMEIGFILWLRPLYRKGIHWPALIFGILASIFLACGLIPPYIELAKRNGRV
                     VGINFIFLLIDSMGAWLSIVSVILGNMDIMGIVLYCIVAALELGIFISHFVWWCRFRR
                     SGSCDVPDEKVYESNDHDKNAIENNGAASISRPRASDATYDDDDDDDYHSVIGEQNIG
                     ASRMLRAVHGVSLQRDVLTYGEIESNEQT"
     gene            <525934..>528201
                     /locus_tag="HG535_0B02760"
                     /db_xref="GeneID:59234898"
     mRNA            <525934..>528201
                     /locus_tag="HG535_0B02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287070.1"
                     /db_xref="GeneID:59234898"
     CDS             525934..528201
                     /locus_tag="HG535_0B02760"
                     /inference="similar to AA sequence:RefSeq:NP_011089.4"
                     /note="similar to Saccharomyces cerevisiae RAD4 (YER162C);
                     ancestral locus Anc_8.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142965.1"
                     /db_xref="GeneID:59234898"
                     /translation="MDDKISPEYFHLIRKVLREKEPHTERPLKKKRRTRGANASEKDD
                     TVANCEIISADSPIKHDVISLSSSGSDFEEATPESTFEEDSSNDDDDSDEFEDVTEPS
                     EVQEKVSGDISIIMDVSGTTRKQVTERKPRNVCSNEERKYRKYMHMAVLLCLMIHGAL
                     RNSWIGNAKLLRRLSKLVPDKVFRLLHPEKDEELPLRSTRKLLDGLKMCMEIWQKHWK
                     IMRRYEGYECYMKHWDEIKGKIDMKRSLTEQQFVRQVLKGQGNRDIASQGFIALLRSC
                     SLNARLVMSCQPPDFTDLKEHLSVSKKKRISESTFKYPIFWCEVWDKFSKKWITIDPI
                     NLKTIEQIRFNSKLEPHGVAGSDRNCMRYVIAYDRKDGCKDITRRYQHWFNSKCRRRR
                     ITKEPEGAFWYEKILKKLHRRKKTKIDDYEDEYMRDRDENESMPDNIQDLKNHPKFVL
                     EKDLKANQCIKAGCKECGYLNVNHKKKILKVYNRRDVLDLKSARQWYNDGRILKIGSK
                     YRKIIQKQNWRKPGSSEETREERLYSIEDTEVYIAPLASAPDGKIVKNTFGNIEVLTP
                     TMIPMNCCLVESPVAIKAANFLQIEYARAVTGFKFEKGNSAKPIIGGVVVAQWFKEAI
                     LAAIDGIEYCAEREEFEKHDLESLNRWYVLLMKLRIKNNLNESYGKVNETTLVDAMQE
                     KTSEDDDDTPDDHVTDKGGFFPHPTNNVDAGGQASNLQPKEEPLSTDNKSAEQISDRE
                     HYDDDYNEFMEELDL"
     gene            <529440..>530444
                     /locus_tag="HG535_0B02770"
                     /db_xref="GeneID:59234899"
     mRNA            <529440..>530444
                     /locus_tag="HG535_0B02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287071.1"
                     /db_xref="GeneID:59234899"
     CDS             529440..530444
                     /locus_tag="HG535_0B02770"
                     /inference="similar to AA sequence:RefSeq:NP_011088.1"
                     /note="similar to Saccharomyces cerevisiae SPT2 (YER161C);
                     ancestral locus Anc_8.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142966.1"
                     /db_xref="GeneID:59234899"
                     /translation="MSFLSKLASLRKSAPAAPIIPNNINTKKDETKEHSLLPQNYIRE
                     ADPAVQRLKELRRKELLQKGELTTKKKRDSRTSGTRRSKNDDNGATETRFKRKPSNNT
                     ALEANRNVAVARKKTEPVKKMSFQELMKQAENNAKEPKVKSDEVSGHKLHLKGLREKS
                     PILNPAKSVELKKSSANERNRKPSSQHLTRHRTVSPEISSLVKIKASQVGLAQPNKKI
                     REKLESKRQDRMHKRREQEYESDMDDFIEDDEEDDGKQSSHDVGFDRNEIWAMFNRGK
                     KRSDYAFDDYEDDDMEANEMEILEEEERARKMARLEDKREEEWLKNHDREKKRRKATR
                     "
     gene            complement(<530566..>533106)
                     /locus_tag="HG535_0B02780"
                     /db_xref="GeneID:59234900"
     mRNA            complement(<530566..>533106)
                     /locus_tag="HG535_0B02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287072.1"
                     /db_xref="GeneID:59234900"
     CDS             complement(530566..533106)
                     /locus_tag="HG535_0B02780"
                     /inference="similar to AA sequence:RefSeq:NP_010374.1"
                     /note="similar to Saccharomyces cerevisiae YDR089W;
                     ancestral locus Anc_8.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142967.1"
                     /db_xref="GeneID:59234900"
                     /translation="MKFGNQVLGKSVPEWKLHNLDYEKLKRAIKRATTENTAEQNKVN
                     VDRCTRLFNEQFESINLFVSLKVKEISSRLMTIEKSIINLKKKSSVSDPSNKKRLERR
                     QLKLISAHVDGCSSELQKLSRYLIIQKIALRKLFKKFIKHYPYGKENAQEYVKSIEKG
                     PKLNEGHEGISFVSVDLDPYLLEISIIVDVLNNLEEKQQTPESSHTASSSFSAKKIIE
                     SSLSFDLSFLGESEKLQNFLISLENIEEFKFMILNLGFHLLNDEIISTAKDIQDSTEH
                     MSSMDSKSLRSVKSFMGLQHMASRQQLQQQQQYQQPEYETSKTSTPAESLPKTSPFHS
                     APISPNQHSRAPLSYIILDTSATPAFLHDESINQHPNLLVVSHEDPDRCILMCHVGGI
                     RDHIVTSCLSYDDLLKSINGENVDFKLRSNDRFTTIDKLAVEWLHSHHLQPLNPKIDF
                     KRTRFTCSDKDATYLIALDEEITMENDSTLPHAILKLRKIPHNTNANGANLNGINNHK
                     NEGDKLTELCDALVEQKVECYPMSSHDTVWSICFRLQHSQNLEAGLFGFLLRDEYEIG
                     QDDKLNSDEFFLLGKEMILSMCSDNLKTKIETDGRNNRMSVISVKAKEHSAAKVESKP
                     VRYWNEFDDDPDFFNDNGFYVDESQNSSGRQDERRTEGDYGLIRFNKSFINSTFRACQ
                     KIRIWLGLEDAPLSPLLNNNSENYGSISGASFSTISHEDLEEYIEARNQEQDESESVY
                     EYRHDQVVTFMYLSALLTSCVTSGLPLGIVLALFTRDDTDAELEVAEVLAVLICITLI
                     VSLILICSSLLLLFSRFNLAPAWHYICCFVLFLVVIFTVCYGLAEILF"
     gene            <534135..>535178
                     /locus_tag="HG535_0B02790"
                     /db_xref="GeneID:59234901"
     mRNA            <534135..>535178
                     /locus_tag="HG535_0B02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287073.1"
                     /db_xref="GeneID:59234901"
     CDS             534135..535178
                     /locus_tag="HG535_0B02790"
                     /inference="similar to AA sequence:RefSeq:NP_010373.3"
                     /note="similar to Saccharomyces cerevisiae SLU7 (YDR088C);
                     ancestral locus Anc_8.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142968.1"
                     /db_xref="GeneID:59234901"
                     /translation="MSGNSKSSDKSTSRKENIHIPRYIKNQPWFYKDGESQNNTEEDN
                     DYLIHHRQSKKDDTLDIDNNSEPKVGSGITDEFETVRVLQRRNGKQAQCTNCGASDHK
                     RIDCLERPRKVSKREDFESVISVRKDPTERANWDARKDRWYGYSGEEYDKLIKSWEKK
                     NQGSKNPKSDTVVQDALWDTDEEIELTKLGLYKDSTGMLKQDDATNSKLQRASVRLRE
                     DRAAYLNDVKSSEINYDPKSRLYKSEALGATDEKSRMFRRHLTGEALELNELNKFSRE
                     HAKKLGIKDEVENESRVNHVLVANPTKYEHMMREQKSQQAKPTDSAKLEAKRSKGTAQ
                     TEKTKKKLRDLYG"
     gene            <535889..>536725
                     /locus_tag="HG535_0B02800"
                     /db_xref="GeneID:59234902"
     mRNA            <535889..>536725
                     /locus_tag="HG535_0B02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287074.1"
                     /db_xref="GeneID:59234902"
     CDS             535889..536725
                     /locus_tag="HG535_0B02800"
                     /inference="similar to AA sequence:RefSeq:NP_010372.3"
                     /note="similar to Saccharomyces cerevisiae RRP1 (YDR087C);
                     ancestral locus Anc_8.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142969.1"
                     /db_xref="GeneID:59234902"
                     /translation="MDTTAFVKQLASNNRKVRDNALETVQKYLCTKSFKETKQIQFNK
                     LWKGLYFAMWFSDRPRPQQRLANELAELHLLYFDERDNKSDVLTTNDKAFLKFSRAFW
                     KVLSAEWLSIDRYRLDKFLLLVRRVLFNQLKYLQARKWDGTLVEAYINKVLKWSPLSG
                     NPRVSNGIPLHVIDILLDEWERLLISEDEDTNEEVDLTPLVDQTPLADIINIFTELYL
                     NTDNSKVLRKAIKENLFTDERLVRWEIDCGFPEKKSNIDEAHEETSEDPADEEAEEWH
                     GF"
     gene            <536932..>537162
                     /locus_tag="HG535_0B02810"
                     /db_xref="GeneID:59234903"
     mRNA            <536932..>537162
                     /locus_tag="HG535_0B02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287075.1"
                     /db_xref="GeneID:59234903"
     CDS             536932..537162
                     /locus_tag="HG535_0B02810"
                     /inference="similar to AA sequence:RefSeq:NP_010371.1"
                     /note="similar to Saccharomyces cerevisiae SSS1 (YDR086C);
                     ancestral locus Anc_8.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142970.1"
                     /db_xref="GeneID:59234903"
                     /translation="MAKVNEKKGAVNPVEKLAEAPVEFVREGSQFLSKCKKPDMKEYT
                     KIIKAVGIGFVAVGIIGYAIKLVHIPIRYLIV"
     gene            <537562..>537960
                     /locus_tag="HG535_0B02820"
                     /db_xref="GeneID:59234904"
     mRNA            <537562..>537960
                     /locus_tag="HG535_0B02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287076.1"
                     /db_xref="GeneID:59234904"
     CDS             537562..537960
                     /locus_tag="HG535_0B02820"
                     /inference="similar to AA sequence:RefSeq:NP_011086.3"
                     /note="similar to Saccharomyces cerevisiae BUR6 (YER159C);
                     ancestral locus Anc_8.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142971.1"
                     /db_xref="GeneID:59234904"
                     /translation="MEEQLLKREPQEVIQPIESAGSAKSDAELQEMFDKIKTHFPPAK
                     VKKIMQTDEDIGKVSQATPVIAGRSLEFFIALLVKRSSDVAKQMGCKRISGEVMKKTI
                     LKDERFDFLRENVCGETGEEEEQDDSPVDE"
     gene            <538210..>539871
                     /locus_tag="HG535_0B02830"
                     /db_xref="GeneID:59234905"
     mRNA            <538210..>539871
                     /locus_tag="HG535_0B02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287077.1"
                     /db_xref="GeneID:59234905"
     CDS             538210..539871
                     /locus_tag="HG535_0B02830"
                     /note="ancestral locus Anc_8.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142972.1"
                     /db_xref="GeneID:59234905"
                     /translation="MNLLSDASAYNLLWTTYGILLVSATFVAFKERDNSAFISANGTQ
                     TALPLALNFIASGIGCGSLSAYPQIANIAGIHGLLVYALAGGLPMLLFAFLGPLIKRK
                     VPNGFVLTEWVFQRYGLVTGWYLSLCTLLTVFLFMVSDVAALKFAISSISNVNVTYAI
                     IVEAIVTTIYTSLGGFQISFITDSLQVTIVFALITVVTCAIGEYVEIDTSRIEPSGLL
                     KTNKLGWQLVYILTLAIFTNDFFMSGFWLRTFAAKTNRDLLTGCSIACIVLVVFSTVV
                     GSSGLLAVWADLMPVADKERSGSAFFILISHLPNPVIGLTLVMIATLSTCTFDSLQSA
                     MVSSLSNDLFRNRISIVYARSLVVFVMLPVIVIGLVAEDILKIYLFVDLLSSSVVPVL
                     VVGLWNKMDTYWTGWEVVGGGFGGLLCVWIFGTVYYQSAYEGFHLLFLANGIYVDDWS
                     SFGAFVAAPLGGLFTGFSIMHIRLTCERLYSNRSSKFHRFCTNLDAITGITAVRNTIL
                     DWETSFLGPSGILLTKKKEDVSNEESTSEGLPLTKLQSPIAYATC"
     gene            <540298..>542460
                     /locus_tag="HG535_0B02840"
                     /db_xref="GeneID:59234906"
     mRNA            <540298..>542460
                     /locus_tag="HG535_0B02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287078.1"
                     /db_xref="GeneID:59234906"
     CDS             540298..542460
                     /locus_tag="HG535_0B02840"
                     /inference="similar to AA sequence:RefSeq:NP_010370.1"
                     /note="similar to Saccharomyces cerevisiae AFR1 (YDR085C)
                     and YER158C; ancestral locus Anc_8.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142973.1"
                     /db_xref="GeneID:59234906"
                     /translation="MYPTFTNNNASQDAVSVYSGNSTNTNSSFSCRGGAHNPSRMIPR
                     SNSTSDLFDIPLQHGTKAKKRKHPPYAISPEIARINGRFMSSNASLASRDKNNNYVTS
                     KGHEQHNQSLKAKAKLFPQDNSTYPQKKPHSHSCNKSQGVPLQHSHQDPNSKTFYAGH
                     VRPLKDSGIYLASNSRLNPILEGTQFRRPLTPYEMQRKQMKKSFQFPNGENFTPKNRS
                     VIGLSRLDSANPKDTQRTMSNASRSNSLAMINPGAQAALHSLSRSQSMSSVTLKYNAS
                     QPLVKMNGSPVTSGSSSSSYNSMREHASNDSTDPSSEPSTNSSATGLSPPPKGPLKPI
                     SIIQCKPVPIRPTAPQIRSTKNNMHSMKASDSLPNNVMEKAQGPSKWGTFFKKMFSPS
                     THSFLSRKKKLIAKGNEERKLKKKDVDIVCSASPSELQAETPATLKQMLVDVSASIPI
                     HESSSKDNEIGNLNKKDEQVNTKADENDDDDDYDDDDNILMDTDLVFDSLLLKADEKH
                     LSAVNKQKDLAKKLSQSDTTKNDDNSTKEIDVRAHKEEGTLDPQLDYDLISDFSKLGS
                     IINQFPTLPDPQADVSLKLPLRSNKRPVMTNKDSIRSFYQTNRHNTEYTSRLLERLNQ
                     EWTLVHLDQSIKSSLGQGVSMLKNRQLRFSGSIYVNDTWSPHEYERCDKKFIKNRRRM
                     MQLENERFVQAIKFELNEYKRNDMIVHQDSAQYTHFFL"
     gene            543573..543644
                     /locus_tag="HG535_0Btrna4E"
                     /db_xref="GeneID:59235345"
     tRNA            543573..543644
                     /locus_tag="HG535_0Btrna4E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:59235345"
     gene            <545091..>545705
                     /locus_tag="HG535_0B02850"
                     /db_xref="GeneID:59234907"
     mRNA            <545091..>545705
                     /locus_tag="HG535_0B02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287079.1"
                     /db_xref="GeneID:59234907"
     CDS             545091..545705
                     /locus_tag="HG535_0B02850"
                     /inference="similar to AA sequence:RefSeq:NP_010369.3"
                     /note="similar to Saccharomyces cerevisiae TVP23
                     (YDR084C); ancestral locus Anc_8.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142974.1"
                     /db_xref="GeneID:59234907"
                     /translation="MAESQGLVASRLNTFYVTILKSSHPLMLLLHLIGKAAPIVFYLI
                     GSFFLNFTAQFILVVLLLAFDFYFTKNISGRKLVQLRWWYDPSTKTTETFTFESYKQY
                     APGPPINSIDAKLFWWSTYLVPVIWMVFGIFCILGFKIFYLLLVMVAAVLTGMNAYGF
                     RNCDKWDPNPNSNQTDSWFQMPTIPNIENLTRLATIQSFFQNRS"
     gene            complement(<545910..>547112)
                     /locus_tag="HG535_0B02860"
                     /db_xref="GeneID:59234908"
     mRNA            complement(<545910..>547112)
                     /locus_tag="HG535_0B02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287080.1"
                     /db_xref="GeneID:59234908"
     CDS             complement(545910..547112)
                     /locus_tag="HG535_0B02860"
                     /inference="similar to AA sequence:RefSeq:NP_010368.5"
                     /note="similar to Saccharomyces cerevisiae RRP8 (YDR083W);
                     ancestral locus Anc_8.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142975.1"
                     /db_xref="GeneID:59234908"
                     /translation="MALFKVEGWDLNTEKVEFFDANAKKAAEKKKIKRDRQNKDKKER
                     QFKKNRAIEEALASTSDVEDNEDNEEENLNEKLDEENTSSIKKNEKKRPLDDKSETLA
                     NKKMSKPAVTSAAKKELTPLQQKMMAKLTGSRFRWINEQLYTISSKDALKLIKEQPQL
                     FDEYHEGFRSQVKSWPQNPIDVFVDQIKFRSKRPVNAPGGLPGLQDKKIVIADMGCGE
                     AQLSLDVSNFFKKHNKKTKKFQQKSHKVYSFDLKRANERITVADIKSVPLPDESCSIV
                     VFCLALMGTNFLDFIKEAYRVLAPRGEIWIAEIKSRFADGKGEEFVNALKLMGFFHKN
                     TDDSNKMFTRFEFFKPPQDIIEERKAKLGRRQKFIEVETEKEELEKKRSKIAEGKWLL
                     KPCIYKRR"
     gene            complement(<547364..>548755)
                     /locus_tag="HG535_0B02870"
                     /db_xref="GeneID:59234909"
     mRNA            complement(<547364..>548755)
                     /locus_tag="HG535_0B02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287081.1"
                     /db_xref="GeneID:59234909"
     CDS             complement(547364..548755)
                     /locus_tag="HG535_0B02870"
                     /inference="similar to AA sequence:RefSeq:NP_010367.1"
                     /note="similar to Saccharomyces cerevisiae STN1 (YDR082W);
                     ancestral locus Anc_8.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142976.1"
                     /db_xref="GeneID:59234909"
                     /translation="MTSRDHVAYQDGSLSFYVPELFDCGLYYNTSVPMLIKDVYDCIQ
                     KSQERCIKFYGNRISRLFWKNHPIERICVFGLVINHQWKELFKSKEEFMLISIDDCSS
                     PRCMEPKILVCKCPKPVFLSCGISGDLSRNKVRVYGTTSFKYLELQVEHLEICNDLTL
                     EIQHWQKAIKMCHQLNIPWQIDAESVQEFYSRQNGNNEQDDFISKLEFHNAKDELLYS
                     SPQDNEVEVTVLASSALVSTGTEYKRSLEIELNMNTSNIMLGSLENCSVEDYSNDKAH
                     LASASFQLTDVAAYNSTQARNTLSRYLIRCGDCKISIVELFKMNPINDYIAKFAEFRF
                     NQKNMASIKPVEQMKSEIFVDLLNKLNNCGLLIFVNQNLINTEPLRSLYDYCTNRLLA
                     LIKLKCFSGTIDHEHIKMKLNIPKLSRRAIIDIFKESIKDILEEYPSLLRNWWIEMNS
                     GKFSIVHLEYQNN"
     gene            <548994..>549461
                     /locus_tag="HG535_0B02880"
                     /db_xref="GeneID:59234910"
     mRNA            <548994..>549461
                     /locus_tag="HG535_0B02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287082.1"
                     /db_xref="GeneID:59234910"
     CDS             548994..549461
                     /locus_tag="HG535_0B02880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142977.1"
                     /db_xref="GeneID:59234910"
                     /translation="MTERPPVTCHVLDTTTGKPAAGILCTIYKLDLVSAVSPDGNNIF
                     AESSTSELKPLAMARTNEDGRVDQWTFNPDASQRELLGDLGITKKDGAPLGWSTLVHG
                     TYKIRFQVGKYYHSMGQANFHPFIEIIFEVQDSRHYHIPLLVSNYGYTTYRGS"
     gene            <549861..>552290
                     /locus_tag="HG535_0B02890"
                     /db_xref="GeneID:59234911"
     mRNA            <549861..>552290
                     /locus_tag="HG535_0B02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287083.1"
                     /db_xref="GeneID:59234911"
     CDS             549861..552290
                     /locus_tag="HG535_0B02890"
                     /inference="similar to AA sequence:RefSeq:NP_010366.1"
                     /note="similar to Saccharomyces cerevisiae PDC2 (YDR081C);
                     ancestral locus Anc_8.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142978.1"
                     /db_xref="GeneID:59234911"
                     /translation="MLSIEQRYNICLMAERHPKWTQLELARWAYETFQLPKIPSQGTI
                     SRLLAKKDIYMNCKDNEKACNRVRKPYNALVRRILQEWVSQSIWNGIPINSPIIQDTA
                     QSVWYRIPAEYREGNGSFSYKWINNFLTKMDISISNLDEELPKPPKVWTFEERSALKE
                     IFAKIPPKDLFTLDETFLAYNLPLDYAQYEASHIQRRIEVASVMLCLNLEGSEKLNPL
                     VVGKYNSYRSFRNYFPEDPVDPVSQSLLGEKMARRFGISYQSNRKSWLTSNLFHDWLA
                     RWDKRLVADNRKIWIILDDSCSHRIINPSLKNIELVYTSANSRFLPFNWGILDEFKTR
                     YRIQQYQALIELQNTLEKRTHKKMLISFEQSQLTMSNAFKFIKKAWKGVPIETIRGNW
                     KSSGILPPEMIQLDETVSMAFKKNEVLEAELNRLCNQFYCAKKWDHDMLLDLNIENKN
                     TNFLSTEELVESAIVDAVEPVTQSNNGDVYTHSTSNSLNVNPQLSEYYNFDLFNDRNL
                     AVDMGNLIDNSESDNETKSNFDKNNTENQSKVTNSTNTNDSVISSNPETTLNHDTNNS
                     NYAVNFDRILANEYMQDQQGKLYNVSTLIDKPNSLMNENGILDLRGVGIDTSIVPSDY
                     FNDMFPSSAVPGTAAPLTSGGNTSTGIPPQDINAPYSDNNATQQHNTSSAITGFEDPA
                     LNRIIDSAVASDPASESLQEFNSAHHPGATLQSHINLAKSLGNILKHTEAREVSFSDR
                     TIDEIKFNYQAILGKIKKGRRQMHNLKARRGQVQLERFLSSASPSTSDISPQNVQGPV
                     DLQLPGNATFF"
     gene            complement(<552411..>555239)
                     /locus_tag="HG535_0B02900"
                     /db_xref="GeneID:59234912"
     mRNA            complement(<552411..>555239)
                     /locus_tag="HG535_0B02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287084.1"
                     /db_xref="GeneID:59234912"
     CDS             complement(552411..555239)
                     /locus_tag="HG535_0B02900"
                     /inference="similar to AA sequence:RefSeq:NP_010365.3"
                     /note="similar to Saccharomyces cerevisiae VPS41
                     (YDR080W); ancestral locus Anc_8.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142979.1"
                     /db_xref="GeneID:59234912"
                     /translation="MGDQITVADVHVNDETPGKDISNEEKPIDETANTVYDHAIIQET
                     FSNKSQNHCIGTIDDEVSENGVQPESQSSLDSSDEDEDEDEDEDEDEDEDEDEDEDED
                     EDEDEDEDEDEDEDEDEDEDEDESDDNDEPPLLKYTRITELPSSLFARDSISACLFHD
                     DFFIFGTHSGLLILTKTDFTKTHTVKCHRSSILSIHSEGTYFATASIDGTVVIGLVSD
                     PTNVTAFDFKRPVQAVVLDNDYKTSKTFVSGGMAGEVILSQRNWLGNRVDVVLAKGRG
                     PIVGIYTMDDIIFWMNDDGITFCGINSKTQLLNIPFPQNGATETRPDLYRPHVHLPEV
                     DRIVVAWGEYIWMFKVSLAKTSGQGMNFGSILSSAASSLRAVPDRKVDLEHHFSIKMH
                     IAGISSFKDDQLMCLGFSESKDTPKNMPEIKIIDVFSGNDVYNDEIVFKNYESLTLND
                     YHLGKHIDNSSPEYFLISASDAIRIQVLTLEDHYKWYIANGQYLQAWQIGKYVVNDYT
                     RLDTGLTGIEKLIDRNQWDDAASNLVLIITSTTLNVDRKFCKYAVDKWETILARIIDS
                     GNVGSIAHRLPLKPEFNKGIYDKALDFYLDKADLKDFDILIKKWPSRYFSVKHFEDEL
                     EEKIENHDTYEISYREAIIFFYLSENRYSKAIPHMLATKDLRVFDLLLSHGLISQFRN
                     QIVQIVLLPYNDELELLPDLPIGKLREVFHKPINLLVQNRHNLKPNDILALFSEHGYL
                     LPILFLYLEQISLADPIACAPFENNLIELYARFNKVALLQFLKTKSNYDVEEAIEFCS
                     KEEGLSNELIYLWGKIGENKKALSLIIDDLNDPHLAIEFVKNWGDSDLWEFMIGYSMD
                     KPKFVKALLDSPDEFGKAYLEVIRAMPDNMEVDGLQQTLSRISKDNVLNLLVRMNILK
                     IVDDETGDICDGFLKIRTMGKVFNIDDK"
     gene            <555500..>555730
                     /locus_tag="HG535_0B02910"
                     /db_xref="GeneID:59234913"
     mRNA            <555500..>555730
                     /locus_tag="HG535_0B02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287085.1"
                     /db_xref="GeneID:59234913"
     CDS             555500..555730
                     /locus_tag="HG535_0B02910"
                     /inference="similar to AA sequence:RefSeq:NP_076886.3"
                     /note="similar to Saccharomyces cerevisiae TFB5 (YDR079C-
                     A); ancestral locus Anc_8.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142980.1"
                     /db_xref="GeneID:59234913"
                     /translation="MARARKGALIQCDPSIKALIIQIDGERNDIILEELDDTHLLVEP
                     SKVEFIKQELNRLLSKNIYDPLDDEENEQKEK"
     gene            complement(<555792..>558062)
                     /locus_tag="HG535_0B02920"
                     /db_xref="GeneID:59234914"
     mRNA            complement(<555792..>558062)
                     /locus_tag="HG535_0B02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287086.1"
                     /db_xref="GeneID:59234914"
     CDS             complement(555792..558062)
                     /locus_tag="HG535_0B02920"
                     /inference="similar to AA sequence:RefSeq:NP_011084.1"
                     /note="similar to Saccharomyces cerevisiae COG3 (YER157W);
                     ancestral locus Anc_8.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142981.1"
                     /db_xref="GeneID:59234914"
                     /translation="MTRARRDSIVSSIASHGRGTEYQTVPHLLDDSYLFNQLEKLSIT
                     IADDQETSKKPLESLRSGKAPSSAVGTVDRYEKYVVYLQQLDRNIQQYDTIMAQSKRV
                     NAELTQSIEKFNSISSNTTKFVNKTRNLYEETTELTKLYEGISPVLQYFDTLEPIIRR
                     LNHSSSANLVRKNSFKTMLSNLDSSLIFLDSHLDFRDSEKYRIKFKRCLIRACELIAH
                     YLKNLLTQIFFEINEKLSGRSATVSKVSTGPLLYNKFAMSAEDYYAQVIEITSRANND
                     KFARYHDEINSILNGCYDQYFQIRSKLLQPVTSTLIKEITNNEKEYNLVEFIQEGKSY
                     YQQLCIDEYNLFIKFFPKEQSHQRINQWLCQLCEPLYDGVRTQILRETEISTLCDSVT
                     LFSQYYEFEENSEEYSKQFHDIKFDKVFEPIVQKLQARLILRVQIYIQENIVKYTPTK
                     DSFIISRRKKTGEKLETREEDHSDPEKDLTRPSIVHVWDNDAGSYYPTLIKSLWLLSK
                     IYEMVNSVIFDDLAHHIVHDCLLSLRKAYDMVQSSSSGVNNLDIKLAYLKNLLMLRQE
                     IQNFNIQYTVNETYLDFSGVEAFFKSTSDGSRGQSATSIFSVAKSLVPKVVNSMVDAR
                     TELMAELRNLIKDFTDCVAKSITEDTLKVDNLHDQDLLKKNLELRNNIEEHLPHIHAQ
                     ICNFIEDSEIVIHLLDAIQETIIRSYDAFYENVSEKAENGGLDKSQVSELMYTDVFAD
                     FINKVTNKLVESIEIM"
     gene            complement(<558422..>558751)
                     /locus_tag="HG535_0B02930"
                     /db_xref="GeneID:59234915"
     mRNA            complement(<558422..>558751)
                     /locus_tag="HG535_0B02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287087.1"
                     /db_xref="GeneID:59234915"
     CDS             complement(558422..558751)
                     /locus_tag="HG535_0B02930"
                     /inference="similar to AA sequence:RefSeq:NP_010364.1"
                     /note="similar to Saccharomyces cerevisiae PET100
                     (YDR079W); ancestral locus Anc_8.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142982.1"
                     /db_xref="GeneID:59234915"
                     /translation="MKLPFKYTRSQLEIFRFSFCLLAPVAVMYYIGTDTDKKLNVPGF
                     WPDPETLNKIPKESYEIKAELARMKKERLEKRLRLEKKLQEELGIDIEAEKAKIKEEL
                     KLRSKSS"
     gene            <558988..>560016
                     /locus_tag="HG535_0B02940"
                     /db_xref="GeneID:59234916"
     mRNA            <558988..>560016
                     /locus_tag="HG535_0B02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287088.1"
                     /db_xref="GeneID:59234916"
     CDS             558988..560016
                     /locus_tag="HG535_0B02940"
                     /inference="similar to AA sequence:RefSeq:NP_011083.3"
                     /note="similar to Saccharomyces cerevisiae YER156C;
                     ancestral locus Anc_8.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142983.1"
                     /db_xref="GeneID:59234916"
                     /translation="MSDSKRVKLDNTGTETAMAKIICTHSGSFHADEALAVYMLKLLP
                     EYSDAEVVRSRNAEDWERSDIVVDVSGKYDGKKFFDHHQREFMETFNADFKTKLSSAG
                     LVYKHFGTDIIKSILHDVALTEGDLRVLYVKGYKQFIESLDANDNGISKYDVDELNVK
                     PRFSDTNISIPGVISAFNPAWNGDCSAAKFDEQFFKASDFIGKIFVNLITGYGKSWLP
                     AKTLVRDAINDRLSVDPSGKIVILRQFCPWKEHLFDVEKELDLQGQIQFVLFEDSAGS
                     WRVSTVPVVANSYKFRRGLPEPLRGLRDDVLSEKANIPGCVFIHAAGFIGGNANEAGA
                     LKMAQISL"
     gene            <560514..>566891
                     /locus_tag="HG535_0B02950"
                     /db_xref="GeneID:59234917"
     mRNA            <560514..>566891
                     /locus_tag="HG535_0B02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287089.1"
                     /db_xref="GeneID:59234917"
     CDS             560514..566891
                     /locus_tag="HG535_0B02950"
                     /inference="similar to AA sequence:RefSeq:NP_011082.3"
                     /note="similar to Saccharomyces cerevisiae BEM2 (YER155C);
                     ancestral locus Anc_8.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142984.1"
                     /db_xref="GeneID:59234917"
                     /translation="MKGLIWPSKNKNNGTTSRRSSTTHVMKGSGYTEGHSSPSGSAVP
                     LGCDGNVGTTLATAGPSVSPVNSSNNSSSTVGGKRKNNFSLKKNSSDNLNRSNGIYKN
                     ESHNLSLRSIGSSLHRRDTSSIDSESTDRSLKSESEYDTTRSIGEESGTLFGESVHSS
                     GTSLINQSVSQHISVEQSMDVTTKYESRNTTKSSISLNSGNYDSTVLKTGWINKSHGT
                     VTVNVHPHSSVYLQKTESHTSSRNSYRESKTFNTEGSGVETQISVPDYKLYRAQLKGP
                     LLNLFKSGLHGNVKYFDPALAETKSDTASNRPKSSLSNDHHSTQTKTSKNVSTIKYLN
                     ESYPHPGLKLDEDGKIVSGNVEALCHAVLFAYQNDDPKNERVVINLLLILPLIDEFVK
                     FLNMFNQFGSTFTKHSSKVSSSSTQFYHISSSVDVLMTERLGLVVKIILDIFPSFLLD
                     DSIFQATIKLLDTISLHNDEISNNLKFYVADKHNRLSKLTAFSRSSTMHKPIDVNNSG
                     NLHNIDINISNNQNNNNNDNNNNNNNNNNNNSTNENAFGGNSYQHNHNVNNNNKNKNA
                     TDIRKGSRLLDDIFSVEKFLVMDSDKLAKEVHSINLKFDRKWAPRFDYSLLYDSKYIN
                     KDIVALNPLVFNNNHNIHFLGRLLICHLFPTNRSASMNPKLRAKVLTKWIEFGGLFEK
                     TGDMVSWLAVATIICSIPVLRLSSSWKYVPDQTIKILFKDWIPTIAQLDRRQMSLKST
                     SSVFILAPPNLDDPFIRSNVISYFGDLIIHGDDLPDSSKFKYLEKKINRTKNAFFKWQ
                     QRLDSLNSELQNLDENAADIVPESSQIYHLWEYHLAQPPLNIKALMRISLQYEPPRVD
                     QKTYSKIGSRRSPLSSGGYLPILFNDFLPVCSLFSKSSLITASGAYLSDDNNKNTLSR
                     SKSTFRHSKLESTDITHLKQEAVELDSPAVNQLTGLSEIDAPLIKELSSRQSNRQCML
                     KCIRDAFNIESDLFRVSDHLIFKSLTDIEAKSAPSSMVVEMPKRFSQQSSNNVVASGY
                     DSSNRLSRTLEHMDLFSNMEQVSGSLNGSLINVVLKCASIDKMCDLLVLTASVFSKFI
                     DCTDLEKYFFHKRQRDQPRSRSSKGSKSEDALGLLDYAFVKLSMNMNTFTETFFSSYK
                     SFATTTYVLENIAHRYVGAKGCAFCISQLLGSNDSKSKKLDPSINEQKFPQWDTRISD
                     NENVNPSYWVKIQVGAAEALLGLVRNHYSDFTDDLACNSTLLDILKIIEQDVHVEWPV
                     RLGHLKGSLSSVDFKEIEDHVSFLSEVFHDIKITYQKQLYRPLGVTKVSRKVTSLMEG
                     FRSMSLTDFNSLCNSETSDDSMISSFRHLKYDSYEETLRWIESLDSFISEKFSFVTPQ
                     DWFTTYQVLESVCYGSLTSQFSFPLRSISYGLVTAGTSQLNELKIMDIFTWITTLLTK
                     TEHGEVCCLEKLPESVQLLVKLHRSLVVFFDTQILNTQSTINGRIELCAVVLQILNFV
                     RWKNSSLDLFQTDDVDNPNEISPHIPSFIETAISHAIMSPKSRLFEHSWNAAHEKMCS
                     HKVRKDFSSMCDILKSIDHKHIKSFIGIDGAFMSERSNLCPCPGWIMSRLLEISQFVP
                     NMSIINSKLVNFDKRRFASNIISNSMDLVPRLGDNTDIQTFGKCLFYNFDDPSHIYGK
                     VVKSVAHSEVKALKYQIKGLFNELLIKEVEKVKRDQKKAELLTIQERENNRSIILQHV
                     MQKKNRSSTILSNMQNGAPVSQGLSKTASNASTSSWASRDKRSSVTSFSGRNSPTSGS
                     GHNHMGKKLGGFFKRPFSIGGFSSSGSTSSLSSILIPDVQENGSVSPYNLPSIDSTAV
                     QDQKPVYSLKTFEIKTIVAIMNEREISGYAFCFKIIMLDNSHYILQATGAEDMAEWVK
                     MIKLSKRYSFHSEKFKGKTYNKIFGVPLEDVCEREGTVIPNIIVKLLEEIELRGLDEV
                     GLYRIPGSVGSVNALKNAFDDEGAINNSFTLEDGCWFEINAIAGCFKMYLRELPDCLF
                     TNERVSEFSELSQMHKSSVITKDEYIKRMGSLLRSLPTCYYQTMKRIVFHLNKVHQHV
                     ASNRMDASNLAIVFSMSFIDQDDLATSMGSTLGAVQSILQQFITAPEIYFG"
     gene            complement(<567075..>568316)
                     /locus_tag="HG535_0B02960"
                     /db_xref="GeneID:59234918"
     mRNA            complement(join(<567075..568190,568278..>568316))
                     /locus_tag="HG535_0B02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287090.1"
                     /db_xref="GeneID:59234918"
     CDS             complement(join(567075..568190,568278..568316))
                     /locus_tag="HG535_0B02960"
                     /inference="similar to AA sequence:RefSeq:NP_011081.1"
                     /note="similar to Saccharomyces cerevisiae OXA1 (YER154W);
                     ancestral locus Anc_8.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142985.1"
                     /db_xref="GeneID:59234918"
                     /translation="MLRFCIQRTSSRFGTNLFLGAAWVGPSRVAGIRHQSSTPGKSQI
                     TELQTQLPSVDDIGEISSSISDQIAVAVGETSNHIGYLQSIGLAKTWWWPPDVIQHAL
                     ETVHVYTGLPWWGTICTVTILVRLLMFPVYVKSSDTIARNSHIKPELDKITAQIMATT
                     ELVEGQKYALKRKKLLADNGIKNRWLAAPMLQIPVALGFFSGIREMANHPVDGFVNQG
                     AAWFTDLSQADPYLGLQVITAAVLISFTRLGGETGAQQFTPAMKKFFTMLPLLSIPAT
                     MNLSAGVVLYFAVNGTFSVLQTLTLRNKWVRRKLNIAEVMKNPQSTSTPAKGIIESFR
                     ENMAKAREQAERRQLMQDREKEQQEKTKELKENSRIKIVRRSDLNKKKQL"
     gene            <568556..>569446
                     /locus_tag="HG535_0B02970"
                     /db_xref="GeneID:59234919"
     mRNA            <568556..>569446
                     /locus_tag="HG535_0B02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287091.1"
                     /db_xref="GeneID:59234919"
     CDS             568556..569446
                     /locus_tag="HG535_0B02970"
                     /inference="similar to AA sequence:RefSeq:NP_011080.1"
                     /note="similar to Saccharomyces cerevisiae PET122
                     (YER153C); ancestral locus Anc_8.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142986.1"
                     /db_xref="GeneID:59234919"
                     /translation="MSGILVFKRCLSDAQRKDILLDCLNNKFDKVLSTIRKIAPADMD
                     YSILQTILSRGCYHGHIESVSHIWYKYVRREKSLIVSPPLLCEIGTLALNEGKYYLPK
                     QLHYHFKLFFGPESNSSLGQYTEYELLRIKVESFAKGTSSSTNFREKWKVFLEDVDHH
                     FPPDFRLSVWDYPHLARSIPQGDDDRIVKMLFTEDQIEIVNNHTLPLLLNMILLQKQH
                     SIERKFNLFRRFHQFCPILKYDDTLTILLRQCELACDGYRMNVLLEYVQDNKMPQLCR
                     KASEIMLRARKQTNHATIPV"
     gene            <570092..>571444
                     /locus_tag="HG535_0B02980"
                     /db_xref="GeneID:59234920"
     mRNA            <570092..>571444
                     /locus_tag="HG535_0B02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287092.1"
                     /db_xref="GeneID:59234920"
     CDS             570092..571444
                     /locus_tag="HG535_0B02980"
                     /inference="similar to AA sequence:RefSeq:NP_011079.3"
                     /note="similar to Saccharomyces cerevisiae YER152C;
                     ancestral locus Anc_8.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142987.1"
                     /db_xref="GeneID:59234920"
                     /translation="MSMDIPGVFNFFKGHPSFRLLPNRAVIAATTKLLDPEFRDYDDD
                     TNNRHPLTYGSDEGAYWVRDAITTFNNDQTFRFQKDDRGRSKPEFLNLDSGASYGVLS
                     ILLQTTLPHTGYTKQAFVVTPTYFLINSCFIDAGFSGKITAIDEIGNGEINIDLLERK
                     LEQFEKDPKDSQGEEALKPIMNPLRKGQKKIYKYVMYCIPTFSNPSGSSYSEETKLKL
                     IDIARKYDMLIITDDVYDMLTFEEPFDELPKPLIRFVQLDRRSNEDPESYGNTVSNAT
                     FSKLIAPGLRFGYHETVTDKLAAQLSHGGANTSGGTPSQLNSMIVGTMLLNGSAAKVL
                     SRFREEFANRAEALYESIKKFLPKETMFEMPKGGYFSWLTLPEGYDAREIGKIAYETY
                     GIILANGSDFEVIGDERNWGARSIRMSISFLEVDAISSGIELLGKVCQEYASKKGIEF
                     "
     gene            <571630..>572394
                     /locus_tag="HG535_0B02990"
                     /db_xref="GeneID:59234921"
     mRNA            <571630..>572394
                     /locus_tag="HG535_0B02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287093.1"
                     /db_xref="GeneID:59234921"
     CDS             571630..572394
                     /locus_tag="HG535_0B02990"
                     /inference="similar to AA sequence:RefSeq:NP_010363.1"
                     /note="similar to Saccharomyces cerevisiae SHU2 (YDR078C);
                     ancestral locus Anc_8.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142988.1"
                     /db_xref="GeneID:59234921"
                     /translation="MAGGQSMNYSKLFSRLINKNGQMDDTIASFLYYMFPKEMFVRAL
                     SLIESSNMFIYAFDIQEVNSRAMEPSDSASTNPDESVRQNSSESTSFVPANKPSSPHS
                     ATTHVLVAPIYENDSELLYRLIVKADSDTDPSVYVDLTNWFCSCEEFANGFLEHGLNG
                     TSKEDDIAQRLTREVTELQDFSDDRFAQLDAHSLSKQRYFHHDKVMCPHLLAFSILLR
                     SSPSVLQYFAVNKGQVLLIPITNMDEWLKLHINIVA"
     gene            <572715..>575177
                     /locus_tag="HG535_0B03000"
                     /db_xref="GeneID:59234922"
     mRNA            <572715..>575177
                     /locus_tag="HG535_0B03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287094.1"
                     /db_xref="GeneID:59234922"
     CDS             572715..575177
                     /locus_tag="HG535_0B03000"
                     /inference="similar to AA sequence:RefSeq:NP_011078.3"
                     /note="similar to Saccharomyces cerevisiae UBP3 (YER151C);
                     ancestral locus Anc_8.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142989.1"
                     /db_xref="GeneID:59234922"
                     /translation="MSAINSHDNGEESYSMYPKTSSPPLPSQGSMHFPAYQPPVPLYA
                     YPQVPYMYAGQTPAYPFNMMNQNQMMYQGGAGGSMPQQNGSVGAKKKWSNDGNSGGSN
                     TNMTSSKVPHYHHHQSSPSYHPASVSSHSNVNSPINSTATLTSRADQYKFFVPKTGPS
                     EISMQLPLFFNTKEEDYSKARSKRHALRLRILQNSSEKEENYKFASKQKEDPKNIAEV
                     TTAKDNIGSEISSHSKTGTSASLSTATSQATLPEIPPVASPPPAASTPNSVKVTSKSW
                     SAVASNAVSRTKQVAVVSSLTESTCSSPTQSQLLSQQQSRVPQRKEGDYIPPSTKGAE
                     PLGSIALRMCYDPDFIDYTLKSPAFEKNISIKSVVPRGIVNRANVCFMSSVLQVLLYC
                     RPFVDILNVVGTRNPNTRVGIAQCKLLDACINIYKKFGKDSFENEKKISQKAKSLQQH
                     QQAQDQQQDQSHQTSVIATAADAINPDEFYGSLSTIPKFKDLKWGHQEDAEEFLTHLL
                     DQLHEEFISSIDSLTDNEIQNLLKSINDDQLRIFFIRNLPSYKKAEFNKNTSTQLKEL
                     LAKYDTITESDKENGWHEVSGSSRRGKKTKSAAKRTVEMEASPMSCLFGGQFRSVLDI
                     PNNKESQSITLDPFQTIQLDISDKSINDLETAFKKFSEFEFLPFKSSSGDDVEAKKQT
                     FIDKLPQVLLIQLKRFQFINNTDKNNSMVNYNAYNGRIEKICKKINYDHELIIPTESI
                     SSFTSQGEQDRRYTLTGVIYHHGLSSDGGHYTADVYNKEVDKWYRIDDVNIIELNKTD
                     VLKGGEEGADSRTAYILMYQKS"
     gene            <575986..>577788
                     /locus_tag="HG535_0B03010"
                     /db_xref="GeneID:59234923"
     mRNA            <575986..>577788
                     /locus_tag="HG535_0B03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287095.1"
                     /db_xref="GeneID:59234923"
     CDS             575986..577788
                     /locus_tag="HG535_0B03010"
                     /inference="similar to AA sequence:RefSeq:NP_011405.1"
                     /note="similar to Saccharomyces cerevisiae CUE3 (YGL110C);
                     ancestral locus Anc_6.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142990.1"
                     /db_xref="GeneID:59234923"
                     /translation="MYKKHIPEFNGDVSKISLPIVKFPPFKLRALLIEKDPVVWLHCL
                     ETYVIYLQYLMDQNNVEKLDDSTHNELCIFVKSYISEMAEEEGRLLSLGMNHEVSQQL
                     FLLRVYIFLLIKKCGLLYLQLFNESLWDVIKFYVGKNPDTVRALVLGTLKPQINTQKA
                     QLDRVSQIQYYLKHRVEQGKFTRVDLKAFEALLSQKSQQPNLLPREFLTTLWIETLES
                     WWAKGKGKFSAIAQQLLIVSLLSASVGDICETIEQLGISNIETLSLYSLFGSILLNES
                     FQREIPAIVPKLHFLQFTNYNDEMIEGANTEVHFEAISTLLELFPNLTKAQISRLLSK
                     YDGNVQSATNAVLENPNFANEMSTGELNNVDEETPEESGPSDEDLELQDPNVNPRMNA
                     TKGASKRVPDELKNNIITRALNLLYEKDEDEYDDTYDEAEATTGSKGQPSYTNADVDD
                     STSASEHSVSRYDKIEGILWELLKQDSSLFAREKRGTKSRKDIRQRTGWSDEQIEGWA
                     RMLERSPQRARILEEKFMFKGNEKTGKTAYVKNRDNSQLAERGADNQKPAVTKYETPM
                     AKKRQQARNEKHKSSKGNHNRKSGHDKKIYKASA"
     gene            complement(<577828..>579186)
                     /locus_tag="HG535_0B03020"
                     /db_xref="GeneID:59234924"
     mRNA            complement(<577828..>579186)
                     /locus_tag="HG535_0B03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287096.1"
                     /db_xref="GeneID:59234924"
     CDS             complement(577828..579186)
                     /locus_tag="HG535_0B03020"
                     /inference="similar to AA sequence:RefSeq:NP_011404.1"
                     /note="similar to Saccharomyces cerevisiae NSA1 (YGL111W);
                     ancestral locus Anc_6.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142991.1"
                     /db_xref="GeneID:59234924"
                     /translation="MRLLAGCADGGSLKEIICKSGTDTAKQTAPQPLYAEASLSEGLK
                     SAIEHIEVISEDHLLLSRCNGSLELVQFSRHKKEQAEKGKEPELPTPSAETENEYEVS
                     EFEVVHAINGLTNDSRLEPLYEASKKRVKLCDGFVSLQLVPSSEDTYLAVTRSGLIHI
                     VQVNLQKNQLLKLNTLEVKAPLEFAQLNDCDDRVSGDRYILGYGGEENLVKIVAIDSD
                     FSKLTQIWEAKNVKNDRLDLRVPVWPVGLKFIKSFQSKMSDATKLNFQFAVITRFSHL
                     GLYRTQHGRKPMKYIDLLPNREPLNQLLLIGKESTPLGNLLAEDFCNFCIITADTKHN
                     VYKFNVDGRLESKFGQNDMTGASTFIGLSSGKYLLQGGLDRYARVYELSTSERLAKIY
                     VGGHVNSLNLINDDIGTSAEGRTDGAKNKRHREPEDDAQVADLLWNELDVKNRKKKKA
                     SK"
     gene            <579481..>580611
                     /locus_tag="HG535_0B03030"
                     /db_xref="GeneID:59234925"
     mRNA            <579481..>580611
                     /locus_tag="HG535_0B03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287097.1"
                     /db_xref="GeneID:59234925"
     CDS             579481..580611
                     /locus_tag="HG535_0B03030"
                     /inference="similar to AA sequence:RefSeq:NP_009793.1"
                     /note="similar to Saccharomyces cerevisiae ARC40
                     (YBR234C); ancestral locus Anc_6.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142992.1"
                     /db_xref="GeneID:59234925"
                     /translation="MLDTSKSVLSVFKLVKAPIYSHCFSIDRSLLAITCNTDCLVYRF
                     GGGKSPQLIATLPDHDKTVTAVDISIHGRIVTCSQDRNAYVWEPLSDGSYKPTLVLLR
                     INRAATSVSWAPNGYKFAVGSSARIIAVCYYEQENNWWVSKHIKKPIKSSVNCLSWHS
                     NGILLASGGTDGYVRVFSGFIKGLDTKEAVSNSPWGEKFPFGAVVKEWYNGSFIHDVE
                     WRSNIEKLAYVAHDGTLTVADSVEQIYSVNAPEGLPFKSLIWINDHEILCAGYSCHPV
                     MFTEGSNGWQFSKNLDKVGKQSLPQSTSEDGTDDEENPTFGMSALRKFKQLDLKGRVT
                     AAEQESAHENAIVELRPFEESNGQVTQVSSCGLDGEIVIYAV"
     gene            complement(<580704..>580955)
                     /locus_tag="HG535_0B03040"
                     /db_xref="GeneID:59234926"
     mRNA            complement(<580704..>580955)
                     /locus_tag="HG535_0B03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287098.1"
                     /db_xref="GeneID:59234926"
     CDS             complement(580704..580955)
                     /locus_tag="HG535_0B03040"
                     /inference="similar to AA sequence:RefSeq:NP_631876.1"
                     /note="similar to Saccharomyces cerevisiae DAD3 (YBR233W-
                     A); ancestral locus Anc_6.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142993.1"
                     /db_xref="GeneID:59234926"
                     /translation="MEDLSLLQQNVLEKYKKLAQVLHSLDETFKKFNSSDHSDVSPES
                     ILQQIRDIEIKIAQIGTLLKGSVYSLILQRRQQIKGSSG"
     gene            <581173..>582708
                     /locus_tag="HG535_0B03050"
                     /db_xref="GeneID:59234927"
     mRNA            <581173..>582708
                     /locus_tag="HG535_0B03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287099.1"
                     /db_xref="GeneID:59234927"
     CDS             581173..582708
                     /locus_tag="HG535_0B03050"
                     /inference="similar to AA sequence:RefSeq:NP_011403.1"
                     /note="similar to Saccharomyces cerevisiae TAF6 (YGL112C);
                     ancestral locus Anc_6.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142994.1"
                     /db_xref="GeneID:59234927"
                     /translation="MSSPSNIQQSYTIWSPQDTVKDVADSLGIDTISDDVLKSLAMDV
                     EYRILEIIEQAVKFKRHTKRDVLTTDDVSKALRVLNVEPLYGYHDGSAMDKDVSFSKI
                     NTSGGQTVYYLNDEEVDFDKLINEPLPQVPRLPTFTTHWLAVEGVQPAIIQNPNLNDV
                     RISQPPTVRGAIVTALNDNSLQTSSTGSATLALDEEKEAQHLSSVKPGQNIEVKPLVK
                     HVLSKELQIYFNRVIEALTTKNQDDADAQHMKAAALTSLRTDSGLHQLVPYFIQFIAE
                     QITHNLSDLNLLTIILEMIYSLLSNESIFLDPYIHSLMPSILTLLLAKKLGGSPTSDS
                     PAEYHEFLEKTNALRDFAASLLEYVLKKLPQIYKSLKPRVTRTLLKTFLDTNRVFGTY
                     YGCLKGVSVLESESIRFFLGNLYNWSRLVFNEQNFTLESVSENKSTKFTPEETAFLVD
                     TILSALRVLKADLPEISQGKNQNITEDDKSKLVSRCGVTVASHILKCDDARELIDAIF
                     LGE"
     gene            complement(<582810..>584768)
                     /locus_tag="HG535_0B03060"
                     /db_xref="GeneID:59234928"
     mRNA            complement(<582810..>584768)
                     /locus_tag="HG535_0B03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287100.1"
                     /db_xref="GeneID:59234928"
     CDS             complement(582810..584768)
                     /locus_tag="HG535_0B03060"
                     /inference="similar to AA sequence:RefSeq:NP_011402.3"
                     /note="similar to Saccharomyces cerevisiae SLD3 (YGL113W);
                     ancestral locus Anc_6.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142995.1"
                     /db_xref="GeneID:59234928"
                     /translation="MIGEKYTHIMDSWQVCRILEELPRDIEIDSKNFEVFRAIDIPKK
                     LLSTLKTGNKRCTCICKSDKGEYHLLETYGVNYWISWPLNALQSSKFLLDYPEKIEQQ
                     DQETPKDWSKLQFRDLLHVWKEGKSMCNISSSLELDMKVPNMESGSRTDSMRVEPDSY
                     LEAKYYESLFFIQIPLAYFVKSNISRFKNICKSTYRSNTDIVYQSILAKYLLRVKEFD
                     RRHEGSGVLKSDLGSQVSCEKRDALLAKYHAVGKEQLQNRLSSILKIREIKLQIVLLL
                     EIIAINNLDSNFIDYEHRYGKRLKLRSINIAKKMTKSKRKIQSPVTKKRKEPILDFCE
                     QLDLYLDKLCIQDIILASEPAKPVTEDDLIEEAKKNLLNKHKESSSTGFANFVLIPYY
                     DKKAPNAVRFIIRKLKGPNLRSKRLRDNKIASKLSSIEIAEAAEMAASPQGSSKMSST
                     PSSPRILGSSAFSRHVPSNTLVPELLASRSNSLVNTFFEGGNSTLQKPSFISRTTSDL
                     TMNHLQKRQLPLTDFSSQNLAVKGSNEFTSTRSFLSSTFHKLPVAQTSFRRVGRRKDI
                     NSSIPPENVLKNQERDLVQVESTPLAKSKKALPEKKAHLLNIVESPVNATNDSPVGRD
                     IDTNKGECTDSGENTTHKRNIKRRLFAP"
     gene            complement(<586022..>587440)
                     /locus_tag="HG535_0B03070"
                     /db_xref="GeneID:59234929"
     mRNA            complement(<586022..>587440)
                     /locus_tag="HG535_0B03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287101.1"
                     /db_xref="GeneID:59234929"
     CDS             complement(586022..587440)
                     /locus_tag="HG535_0B03070"
                     /inference="similar to AA sequence:RefSeq:NP_009792.3"
                     /note="similar to Saccharomyces cerevisiae PBP2 (YBR233W);
                     ancestral locus Anc_6.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142996.1"
                     /db_xref="GeneID:59234929"
                     /translation="MWNALKRRLKTIKRIGFKCIEITIGFETCPNSHFSMSNADENGV
                     ASPNVLKRKKEDCAEEQLEAEIKRVALDDDTETVTAGLTNGTCLENGLSNGNGQDSCS
                     SDGRELSSESISRHAHLRMLCLVKEASIVVGHKGETICKIKSETSTRINVSDNVRGVP
                     ERVIYVRGSCDNVAKAFGMIVRSLVSRNEESDLDENSTATTINLLISHHLMGCVIGKH
                     GSRLREIEDLSAARLSASPQQLLMSNDRILSITGVADAIHIATFYVGQTIMNSREGTR
                     MKKPIFYQPSAMYSALLSGISPPGFSHQKHHQYHPTDKYTTNRGNKRVSRSSSLMMVV
                     PANQSFPRQVSEQPLSRIPVTYTAANAANATSFTPNFMIPNVRILDGPVTTPAAQTMS
                     IVEQKIYIDENFVGNIIGRDGKHINSIKEATGCSIFIDEPVNGASERRLTVKGTSMGS
                     QAAIMLISNKIEIDRINRERKR"
     gene            <587536..>588492
                     /locus_tag="HG535_0B03080"
                     /db_xref="GeneID:59234930"
     mRNA            <587536..>588492
                     /locus_tag="HG535_0B03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287102.1"
                     /db_xref="GeneID:59234930"
     CDS             587536..588492
                     /locus_tag="HG535_0B03080"
                     /inference="similar to AA sequence:RefSeq:NP_009790.3"
                     /note="similar to Saccharomyces cerevisiae SWC5 (YBR231C);
                     ancestral locus Anc_6.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142997.1"
                     /db_xref="GeneID:59234930"
                     /translation="MNDQISSLNSQKEATFEEEQYVEEEDEDFNPDDENPQMSSDEGE
                     DGDEDDGKAPKREQRKRVKNDVDYSQIESESGGLIKTRRGRLLQQELDRKRKYETMEK
                     TEISDTIKGVWEDLQSMSDKRLGMQGSVGSILADDDSTARTNSASNAEEETILIKRDY
                     IFAGERIHEEKLVPKSSAEAQEYLNSTKFDAKEEAGGKGSKTESNVGQEDDHVSETKS
                     SKFHISKENLARLRRPLKRPPILEQIIAGSLKPKLTTLEKSSLDWATYVDKENINDEL
                     TLHNKDGYLARQDFLNKVEHFKDNQYKELRQKQLALQAQQNQ"
     gene            complement(<588540..>590729)
                     /locus_tag="HG535_0B03090"
                     /db_xref="GeneID:59234931"
     mRNA            complement(<588540..>590729)
                     /locus_tag="HG535_0B03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287103.1"
                     /db_xref="GeneID:59234931"
     CDS             complement(588540..590729)
                     /locus_tag="HG535_0B03090"
                     /inference="similar to AA sequence:RefSeq:NP_011401.1"
                     /note="similar to Saccharomyces cerevisiae YGL114W;
                     ancestral locus Anc_6.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142998.1"
                     /db_xref="GeneID:59234931"
                     /translation="MPGAEFTDRIGESSLPSPVAWHEKPAIRQVTWRATLVGLIIGSL
                     VLVSNFQFGLQTGWVSMMSMPSALLACSFFRRIWPLIFPKDPPFTDVETVYVQSMAVA
                     VGTGPLAYGFVGVIPAIEKFVTREESGYSRDQGQLFTVGQLIVWSSALAFFGIFFAVP
                     LRKQVIVREKLPFPSGNATAVLIAVLSGSEILQEVSRRELLQMRNRRLDECAEVLRPE
                     DDDDSSEHESEHELVHSFEQRRDSNTLRSEETERDAYGKNISVLSKTFTLSAAYTITS
                     YFLPMLRSIPLFGKYASRTYLLDFQPSPAYIGQGIIMGLATVSYMLFGCLLGWCVLAP
                     LARNREWVPPDADVDDWERGAHGWILWSSLSIMVVDSVVGFMVVTVKSIVNFWLVSDK
                     AQLLADYWDDSFESMLLEEERVINSRRNTNASGPQNTIRLVYAEDDHEVAPEHLVKYT
                     TVICGLIFSSVICIVLIIYLFGVNIIPIYAMITALLIALFLSVLGIRALGETDLNPVS
                     GIGKISQLIFAVIAPRNHPGSVLLNLVAGGVAEAGAQQAGDLMQDLKTGHLLGASPRA
                     QFVAQILGATWSVFLSSIVYICYNKVYHIPDKQFRIPTAVVWVDCARLVTGKGLPKNA
                     LECSLILGGVFGGLSLIKNCCRDRHYTWLKYVPSGVAVGVGIYNTPSFTFARFAGGLA
                     SHIWLKNGKHNLNAKTKLIVFSSGLILGEGICSMINMLFTNFNVPHF"
     gene            complement(<591096..>592064)
                     /locus_tag="HG535_0B03100"
                     /db_xref="GeneID:59234932"
     mRNA            complement(<591096..>592064)
                     /locus_tag="HG535_0B03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287104.1"
                     /db_xref="GeneID:59234932"
     CDS             complement(591096..592064)
                     /locus_tag="HG535_0B03100"
                     /inference="similar to AA sequence:RefSeq:NP_011400.1"
                     /note="similar to Saccharomyces cerevisiae SNF4 (YGL115W);
                     ancestral locus Anc_6.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037142999.1"
                     /db_xref="GeneID:59234932"
                     /translation="MGGTGNELEKVLMEQKLAVESIRSFLKSKTSYDVLPVSYRLIVL
                     DTSLLVKKSLNVLLQNNIVSAPLWDAKTSRFAGLLTSSDFINVIQYYFSNPDKFELVD
                     KLQLDGLKDIERAIGVEPIDTASIHPSRPLYEACIRMMGATSRRIPLIDQDEETHREI
                     VVSVLTQYRILKFVALNCRETNFLRRPLRELNIITQGNVASCQMTTPVIDVIQLLSQG
                     NVASIPIVDEENVLVNVYEAVDVLGLIKGGIYNDLSLTVGEALMRRSDDFEGVFTCTV
                     NDKLSTIMNNIRKSRVHRYFVVDGDGKLEGVLTLSDILKYILLSAN"
     gene            complement(<593287..>595122)
                     /locus_tag="HG535_0B03110"
                     /db_xref="GeneID:59234933"
     mRNA            complement(<593287..>595122)
                     /locus_tag="HG535_0B03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287105.1"
                     /db_xref="GeneID:59234933"
     CDS             complement(593287..595122)
                     /locus_tag="HG535_0B03110"
                     /inference="similar to AA sequence:RefSeq:NP_011399.1"
                     /note="similar to Saccharomyces cerevisiae CDC20
                     (YGL116W); ancestral locus Anc_6.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143000.1"
                     /db_xref="GeneID:59234933"
                     /translation="MLDHNNKSKLAHNANRSVLSLTSPAKLNIMSSEWSRGGHGKIGK
                     RALRRTHSLNSRSLKNAEAHLESEKGFIPSYARPKMSISAPPLVRRSSSFFKEEVERN
                     DFSRIRGHSSSSACSNSRPAPQDSDDMHMVSNDRFIPSLQNNSQTKVDPMALKEDLPP
                     PNASPSTHLRAQTKLVFKQTVAEACGLDINQRILQYMPQPPVASFKRQNYSISRRTHY
                     NYQQCQQQNQPELMKLRKINSNPERILDAPGYQDDFYLNLLSWSSKNFLAIALETALY
                     LWNGSSGEVTMLVDYKDTKITSVVWSDDDCHISVGKEDGNTEIWDIETMSLVRTMRSN
                     LGVRIGAQSWLETLVATGSRSGEIQINDVRLKKHIVSTWAEHSGEICGLSYKKDGLQL
                     ASGGNDNTVMIWDTRISMPQWVKRTHTAAVKALSWCPYIPNVLATGGGQTDKHIQLWN
                     STTGSRLGSISTGSQVSSLHWGQSYSSTGQMNREIVATGGNPGNAISVFNYDTKFKIA
                     EIVHAHESRICCSQLSPDGTTLATVGGDENLKFYKVFEPRRKNKRRTKGVAEDVLNLF
                     SHRSSGLSRMDSGDCLGDSQSDVETTNDGNENPSSSQRASNFLIR"
     gene            <596362..>597225
                     /locus_tag="HG535_0B03120"
                     /db_xref="GeneID:59234934"
     mRNA            <596362..>597225
                     /locus_tag="HG535_0B03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287106.1"
                     /db_xref="GeneID:59234934"
     CDS             596362..597225
                     /locus_tag="HG535_0B03120"
                     /inference="similar to AA sequence:RefSeq:NP_011398.3"
                     /note="similar to Saccharomyces cerevisiae YGL117W;
                     ancestral locus Anc_6.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143001.1"
                     /db_xref="GeneID:59234934"
                     /translation="MTGTVELEQTVEKLSNMMGEVKFSPKNRDILNNLGNELVISQSK
                     PVLEFVDIIIERFMYPRLPSKSLMGLLLLQECAIIDEESNDNDDLDNLIKYETFDLGH
                     PRILELILIRQKLEELNSTEKKTWKSDEYMTKLLTKVQQVYVLLVHLLQVLSDHIEVP
                     AHSAFYKGIVLDSIADFQRAFESFKILDFICQSLIRSVAESGKSDNSIFYVEDTLLRH
                     IESFIQGNIKWYEDIMLQSTALKEFYLTEKKMLPQSIPSHETDLLHQKGFEIFLEKRK
                     LRLRISTRRVF"
     gene            599028..599128
                     /locus_tag="HG535_0Btrna2W"
                     /db_xref="GeneID:59235339"
     tRNA            join(599028..599064,599092..599128)
                     /locus_tag="HG535_0Btrna2W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:59235339"
     gene            complement(<599897..>600889)
                     /locus_tag="HG535_0B03130"
                     /db_xref="GeneID:59234935"
     mRNA            complement(<599897..>600889)
                     /locus_tag="HG535_0B03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287107.1"
                     /db_xref="GeneID:59234935"
     CDS             complement(599897..600889)
                     /locus_tag="HG535_0B03130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143002.1"
                     /db_xref="GeneID:59234935"
                     /translation="MRRELGKEWTKKFAEFDRVPIAAASIGQVHRATLPDGKKVVVKV
                     QYPGVKDSIDSDLNNLLMFLSASRLLPKGLFLDKTVANARKELKWECDYVRESRALQH
                     FEQLLKDDPVFAVPHVYADLTTTNVITMSYMEGTEIMKLPLNTSQNVKDFISQTIMRL
                     CLEEIAIFEYMQTDPNWANFLYNAKTNKIELLDFGASRPFPSEFIQNYRKLLSYATLN
                     DREKVYEYSKKLGYLTGLETQAMVDAHVNSVITLGEPFSGPTARPFSFKNQTVSDRIR
                     ANIGLMLSERLSPPPEETYSLHRKFSGIFLLCARMESTVYSAKLFKDIFFLVDK"
     gene            complement(<600897..>601675)
                     /locus_tag="HG535_0B03140"
                     /db_xref="GeneID:59234936"
     mRNA            complement(join(<600897..600905,601388..>601675))
                     /locus_tag="HG535_0B03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287108.1"
                     /db_xref="GeneID:59234936"
     CDS             complement(join(600897..600905,601388..601675))
                     /locus_tag="HG535_0B03140"
                     /inference="similar to AA sequence:RefSeq:NP_011396.1"
                     /note="similar to Saccharomyces cerevisiae ABC1 (YGL119W);
                     ancestral locus Anc_6.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143003.1"
                     /db_xref="GeneID:59234936"
                     /translation="MIERRSLYYAFCLVSSSKEVLKGSCTIARDSFAQWASTSTLTRP
                     ILMQYQWFNDPQWNEARQLSEEIRSKNLSQQRKKQKKLSGVRNYSSYSKGQKTT"
     gene            <602189..>604519
                     /locus_tag="HG535_0B03150"
                     /db_xref="GeneID:59234937"
     mRNA            <602189..>604519
                     /locus_tag="HG535_0B03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287109.1"
                     /db_xref="GeneID:59234937"
     CDS             602189..604519
                     /locus_tag="HG535_0B03150"
                     /inference="similar to AA sequence:RefSeq:NP_011395.1"
                     /note="similar to Saccharomyces cerevisiae PRP43
                     (YGL120C); ancestral locus Anc_6.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143004.1"
                     /db_xref="GeneID:59234937"
                     /translation="MGSKRRFSDKVEHPDPVKSSIPERAAEVAEELAKSHPIPPPTPL
                     QHHDAGEFSELVRHKTTAEHAAKLENSTVNPFTGRKFTPKYVDILRIRRELPVHAQRA
                     EFLKIYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQ
                     RVAEEMDVNLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLKRYSCIILDE
                     AHERTLATDILMGLLKQVVIRRPDLKLIIMSATLDAEKFQSYFHNAPLLAVPGRTYPV
                     EIYYTPEFQRDYLDSAIRTVLQIHATEGEGDILLFLTGEDEIEEASRKISLEGDQLVR
                     EEGCGPLAVYPLYGSLPPHMQQRIFEKAPESHNGRPGRKIVVSTNIAETSLTIDGVVY
                     VVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRSGKCFRLYTEEAFKKE
                     LIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDD
                     DGNLTALGRLASQFPLDPMLAVMLIGSFEFNCSQEILTIVAMLSVPNVFIRPSKDKKR
                     SDEAKNIFAHPDGDHLTLLNVYHGFKSDEAYEYGIHKWCRDHYLNYRALSAADNIRAQ
                     LERLMVRYNLELNTTDFDSPRYFDNIRKALASGFFMQAAKKRSGGKGYITVKDNQDVL
                     IHPSTVLGHDAEWVIYNEFVLTSKNYIRTVTSVRPEWLIELAPAYYDLSNFQKGDVKL
                     SLERIRNRVDTMNQLRESEKHKKKSKHDKHNKHSKH"
     gene            <605058..>606626
                     /locus_tag="HG535_0B03160"
                     /db_xref="GeneID:59234938"
     mRNA            <605058..>606626
                     /locus_tag="HG535_0B03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287110.1"
                     /db_xref="GeneID:59234938"
     CDS             605058..606626
                     /locus_tag="HG535_0B03160"
                     /inference="similar to AA sequence:RefSeq:NP_011393.3"
                     /note="similar to Saccharomyces cerevisiae NAB2 (YGL122C);
                     ancestral locus Anc_6.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143005.1"
                     /db_xref="GeneID:59234938"
                     /translation="MSQEEYTENLKVIVAEKLSTLQGFTEDIKYVAEYIVLLMVNGGT
                     VETVVQELLTLFDSVPAESLMDVVQTAFFALEALQQGETVNSIVNKIRGVPEVQSQQM
                     ALPAQQQQQQQSQREAQPLSQQHQQLESGEYRQPQQVPSAFSGIVPLANQDNREAPQF
                     TLTGFQPQFDQQRATSNTGRPRGGARGGRGSLRGASRGSHRNNNNSRFNPLAKALGME
                     SDPNSNSSNVHHRKEGRCKVFPRCPLGKTCPHAHPTKVCNDYPNCPKPAGTCEYLHPN
                     QDEDLMREIERTRDEFQQRKAAILAARSKPIRTGIVLCKFGHLCTNPMCPFGHPTPAN
                     EDAKVIDLVWCPDNLNCTDPNCKRAHSSISKIKQVQPMGKAKNIATSGESYCSKPMGK
                     PIEKSLEQCKFGAHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCKFGVAC
                     RNAYCLFRHPEGRVLPEKKYDASSNANSTSTSERVFAMPESAAIEPVADQNRGEQLFA
                     ATNSQQVDHDTDMA"
     gene            complement(<606984..>607775)
                     /locus_tag="HG535_0B03170"
                     /db_xref="GeneID:59234939"
     mRNA            complement(<606984..>607775)
                     /locus_tag="HG535_0B03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287111.1"
                     /db_xref="GeneID:59234939"
     CDS             complement(606984..607775)
                     /locus_tag="HG535_0B03170"
                     /inference="similar to AA sequence:RefSeq:NP_011392.1"
                     /note="similar to Saccharomyces cerevisiae RPS2 (YGL123W);
                     ancestral locus Anc_6.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143006.1"
                     /db_xref="GeneID:59234939"
                     /translation="MSEQAGAPAQGGAPSQAPRRGGFGGRNKGRQGRRGGRNVEEKGW
                     TPVTKLGRLVKAGKITSIEEIFLHSLPVKEFQIIDTLLPSLSDEVMNIKPVQKQTRAG
                     QRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGNNLGQP
                     HSLATKTSGKCGSVIVRLIPAPRGSGIVASPAVKKLLQLAGLEDCYTQSNGSTRTLEN
                     TLKAAFVAIGNTYGFLTPNLWTEHALPVSPLDVYADEAAIEKKRF"
     gene            complement(<607975..>608430)
                     /locus_tag="HG535_0B03180"
                     /db_xref="GeneID:59234940"
     mRNA            complement(<607975..>608430)
                     /locus_tag="HG535_0B03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287112.1"
                     /db_xref="GeneID:59234940"
     CDS             complement(607975..608430)
                     /locus_tag="HG535_0B03180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143007.1"
                     /db_xref="GeneID:59234940"
                     /translation="MACGVVSGWCGVPGRLRAPAPMGRTAFGVGKSAWRSEVASRRRY
                     RRALRRWRVGPSARTGRSGMTRSVRRMWCAASLGLLSWSWCSVWVCVRMVRTSAHHGA
                     HVGAVFFMSMSDFTVSTTRRRRASRRLRRHDAKKSFSGQADASAWRWHL"
     gene            <608902..>609430
                     /locus_tag="HG535_0B03190"
                     /db_xref="GeneID:59234941"
     mRNA            join(<608902..608909,609217..>609430)
                     /locus_tag="HG535_0B03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287113.1"
                     /db_xref="GeneID:59234941"
     CDS             join(608902..608909,609217..609430)
                     /locus_tag="HG535_0B03190"
                     /inference="similar to AA sequence:RefSeq:NP_009789.1"
                     /note="similar to Saccharomyces cerevisiae OM14 (YBR230C);
                     ancestral locus Anc_6.128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143008.1"
                     /db_xref="GeneID:59234941"
                     /translation="MSEQLQNPVILVNVLLGSSFVTALLTGYAKYDARYLRDKSDAVI
                     LTTVGSITAILALDTVLSVKYYPKFDKKK"
     gene            <609711..>611603
                     /locus_tag="HG535_0B03200"
                     /db_xref="GeneID:59234942"
     mRNA            <609711..>611603
                     /locus_tag="HG535_0B03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287114.1"
                     /db_xref="GeneID:59234942"
     CDS             609711..611603
                     /locus_tag="HG535_0B03200"
                     /inference="similar to AA sequence:RefSeq:NP_011391.2"
                     /note="similar to Saccharomyces cerevisiae MON1 (YGL124C);
                     ancestral locus Anc_6.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143009.1"
                     /db_xref="GeneID:59234942"
                     /translation="MDFLDEQYIENVPTPGAGNVVSSAGLKPPVARSGHSSGSAQLSR
                     SSSFQWGLGNNVSSQPTTSVNMDQTICQISATPTSLTPVVTPSVTPAVTPDVVTSSPS
                     IYRAVLLESRMNDAAENEAQANSRVLDKDDALMESMSQSIYSNVDSGRRIFPFVSVDI
                     PTVFINKKPLTTEDLDLRCWDKNFFILTSAGKPIYSMHGKDEQIISFMGILHTVVNYF
                     QLENSTDIRMIESGEQKFIFLDRSPIILVAYSTRGETSNELISQLDFLHSYLLSSLSQ
                     RQVSRIFDKRENFDLRNFLESTDFENLDEICSLISEKFYPDVLLGSLQCLTLNRSYRS
                     QLHECMLQNLMRESDLPRGTLLYGLIVAPNSKLCSVLRPRGHTLHTTDLHLLFCLIFH
                     QFQNLNENQELWVPICFPKFNSNGFLYCYIKFLSSPNYKISSKSRPVLVLISAQKDAF
                     YQLKLLGDKLTSSITSNGLLDKIFQAQPVRIGDIQAPLVHHFLYKSKKHVQYVMPQLQ
                     FADRESDSVQAEEYEKKLMTYYQQIHNSVFSDGGIPFNKSIINFFNWESSLGPFEEPN
                     NIGLIQGEKTQMLGLAWITPGFELYLISNNGVNDKRILLKSAKKIISWCRKNEGKIFV
                     NEGATF"
     gene            complement(<611793..>613085)
                     /locus_tag="HG535_0B03210"
                     /db_xref="GeneID:59234943"
     mRNA            complement(<611793..>613085)
                     /locus_tag="HG535_0B03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287115.1"
                     /db_xref="GeneID:59234943"
     CDS             complement(611793..613085)
                     /locus_tag="HG535_0B03210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143010.1"
                     /db_xref="GeneID:59234943"
                     /translation="MTIEVESYSRDLNSKRGSKVDNQIGCANSPIPIPNAPPPSPAVG
                     RIPIFRAETWRSHGHEKSEALCLIPRIVPELGKTNDLPLNVNSARSSEIRYTLNSQSN
                     GSFDRRKTSFDSTEPLSSCYPRNICGAYKVREADSIKAVRCSTFFESPSDESFTDHER
                     NAANALLELKKCSAEVSSIAHSWSKLQNIPLCDFIVVQKKCEAMLDKINALKVSKINT
                     RGHEDEKGEKISQNQNEKCSSQTKRQSLMNMFRAKSKSFNKRSSSIISIVNLNSERKD
                     NRVQLCRSDSLNSGLERSPILSSSISPASMRLQSPGNKDSSDVLWDDPTDASDLADDN
                     CNLDGLYGSLNSRNSIRFGKSSKSGKNRNTHMKCLHCSATDTPEWRKGPRGPATLCNA
                     CGLFYKKLIRKFGVVSAGVVMSQRRSKNPQDRKVPRSA"
     gene            <613496..>616273
                     /locus_tag="HG535_0B03220"
                     /db_xref="GeneID:59234944"
     mRNA            <613496..>616273
                     /locus_tag="HG535_0B03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287116.1"
                     /db_xref="GeneID:59234944"
     CDS             613496..616273
                     /locus_tag="HG535_0B03220"
                     /inference="similar to AA sequence:RefSeq:NP_009788.3"
                     /note="similar to Saccharomyces cerevisiae ROT2 (YBR229C);
                     ancestral locus Anc_6.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143011.1"
                     /db_xref="GeneID:59234944"
                     /translation="MLLPKVLTLFLLALHQLCFVNAFTDYLLKKCHQSGFCHRNREYS
                     GNIAKSFNHYYSLNEDSLKYSEAENVLHGIVEKLIPSKNADDITINLPFTLRFMQEGT
                     SVRFTIDEERAPTENLPDYISLRRYNETSKWAFDEHAPLSADFASVKKGHSWFRSDKV
                     TFLNKAGTLKIEILRKSFLLNIYYNGRLSLVINDRSFLNIEHLRSKEENFKNLLPEES
                     SFNMFKDSFEYSKDDTLPFGPESIAVDFTFKNYENLYGIPEHADSLRLRDTSEDEPYR
                     LFNVDVFEYTVKSTSPMYGSIPFMLATNPRSSVGLFWVNAADTWIDIKYDRHDSKTHW
                     ISESGIVDVVLFFGDTPADILEAYTELTGRSVLPSLASIGYHQCRWNYNDELDVLTVD
                     SEMDRAHIPYDYIWLDLEYTDEKKFFTWNPSAFPDPERLLGRLKRLGRQLVILIDPHI
                     KTGYEISKAIIERGAAVRDPLQGTFFGECWPGTSVWIDTFSRNAQILWSSFLKTLVSA
                     TNLHIWNDMNEPSIFSGPETTAPKDLLHEGGFEERSVHNVYGLTVHETTYHSMKEIFS
                     GEDLRPFILTRAFFAGSQRTAATWTGDNVANWNYLGISIPMCLSNNIVGMPFIGADIA
                     GFSGDPEPELLIRWYQAGLWYPFFRGHAHIDTKRREPYLLEEPVKSLVRDAIQLRYSL
                     LPTLYTAFQKTSTSGVPIMKPMFFEKPNFCQLYGVDDQFYIGDTGILVKPVVEKGITQ
                     VEFLLAPGIYYDLFTLEPFITSYEEPEKYSVAADLGKIPALLEGGHIIVKRDNYRRSA
                     KLLRNDPFTLVIAPNRNADAVGEIYVDDGETFAYQRGIYLKSVFQLKNGKIITCVPEH
                     VPPNQEFVGTTTINRINVALDGNDVSIKDTVNITQGAECRIATVTKKRPNTAIIENVQ
                     LRFNESWTINF"
     gene            complement(<616298..>617236)
                     /locus_tag="HG535_0B03230"
                     /db_xref="GeneID:59234945"
     mRNA            complement(<616298..>617236)
                     /locus_tag="HG535_0B03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287117.1"
                     /db_xref="GeneID:59234945"
     CDS             complement(616298..617236)
                     /locus_tag="HG535_0B03230"
                     /inference="similar to AA sequence:RefSeq:NP_009787.3"
                     /note="similar to Saccharomyces cerevisiae SLX1 (YBR228W);
                     ancestral locus Anc_6.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143012.1"
                     /db_xref="GeneID:59234945"
                     /translation="MDKLQESDRPIEKQQQSFADFYCCYLLQSIPKRQSFYIGSTPNP
                     LRRLRQHNGILNNGGAYRTRREGTRPWEMIAVVHGFPCKIAALQFEHAWQHGYSTHYI
                     KEEDRIVKNKTSGRSIHHKLALVRLLFKHAYFRYMDLIIHFFNSEMKKIWEENKFKVN
                     VDSIHLTTKISERALSIFVKNGDDAITLFEKENLKLVKQLYEHQINETRDMCQRFAKR
                     LTYGSLNCAICNQIIDYTSDQAFFKPYVAFCPSETCKLVAHLSCLNRYLVDEEQHLKE
                     RLLLIPTLGKCPECSTPLRWTQVVKYSAFLMALYGS"
     gene            <617412..>618959
                     /locus_tag="HG535_0B03240"
                     /db_xref="GeneID:59234946"
     mRNA            <617412..>618959
                     /locus_tag="HG535_0B03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287118.1"
                     /db_xref="GeneID:59234946"
     CDS             617412..618959
                     /locus_tag="HG535_0B03240"
                     /inference="similar to AA sequence:RefSeq:NP_009786.1"
                     /note="similar to Saccharomyces cerevisiae MCX1 (YBR227C);
                     ancestral locus Anc_6.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143013.1"
                     /db_xref="GeneID:59234946"
                     /translation="MLFKSKSVPRVYRIFFDRNYAIKISGSAVAASQKLGNLPLLKVP
                     PPRILKEHLDDYVIGQDIGKKVLSVAVYNHYLRINDKHRKLQLQRKREMLNREQEQKK
                     DDENEPIVASSSESQAGLKNLQSQFEFDLSKVDEDLELSKSNVLIVGPSGTGKTLLAT
                     TLAKVLDVPIAITDCTQMTQAGYIGEDVQVCIERLLINADYDVAKAERGIIVLDEIDK
                     LAKPAASIGTKDVSGEGVQQSLLKILEGHKVELTVKRPVKISKDNNNNQATSKKDESF
                     TVDTSNILFMIMGAFIGLDKHVKARITKLQDNSKSSGKSSEIDNSQNLRFSNKVEEIE
                     LQNGKKTCALNLVTPSDLVTFGLIPELIGRVPIITALEPLQKDDLYHILRKPKNALLD
                     QYEYIFQQFGVRLAITRNGLDHIARLALAEGTGARGLRGIMERLLLNINYQCPESGVS
                     YVLINEKTVESLQQTKYSLATNVDAKYYSEEQKDKFLHDVYTEDELLGVQLKKELAGN
                     AISEKSY"
     gene            complement(<619038..>621581)
                     /locus_tag="HG535_0B03250"
                     /db_xref="GeneID:59234947"
     mRNA            complement(<619038..>621581)
                     /locus_tag="HG535_0B03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287119.1"
                     /db_xref="GeneID:59234947"
     CDS             complement(619038..621581)
                     /locus_tag="HG535_0B03250"
                     /inference="similar to AA sequence:RefSeq:NP_009784.1"
                     /note="similar to Saccharomyces cerevisiae YBR225W;
                     ancestral locus Anc_6.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143014.1"
                     /db_xref="GeneID:59234947"
                     /translation="MASVIENTNENNKGEDSKRLSNALGDSSKIQMSTCGDSENREKN
                     GGIEKIGRDIGLEAANQNKELDQERQSQQQVSKLQQDIESLKGENLTDPIVIKHLHDD
                     LFPSNPQFDATKHNINSSEVPQDSSLPNSDSSKLLANAYSSKISDTSQSPPLNSHADF
                     FGTSSSNRSASSTAGNKKSVSALSSSLDSHNYFNDFLDHDPEGANEQYHFVPASGIHG
                     STSKVVANQHRRKAWDWNLLPKVGASVLVRAHSFNVVFVPIDGEIKQILYNPTYNKNF
                     RTMNIFVSFNLETTPKDSLVHSKKRLASFGNYITHYLKSRMYAYQCYPFFIQGSEEDT
                     NSKTYASVNSSYDYAEIEAIISLWNMQAQKFYTNTNSSFFSSEVVQILLQRKAHARHK
                     STIQKTVLFQEKGSTAGEEKIVTECFDDIDILLLRPLADTQLGWQIAYDEPNLNIADY
                     PLDLSPWRLREENSDKILGPHMDGTESSQVKIVSDESELDQVNRETAAEYLFDCMGRK
                     IGTLSDDFAASSNQMGLNTTEENQSKASTESTKKKHSVSRPAKRSGLANLFKRKHTAT
                     TSETLVGTAESDSTESKNRSKRTQSIQNSWLEDYFSRSLGNYKRVGLSTQYYLPEDIT
                     TSKSHAPTDDEISEAKKAFLFSKESLQIRLPFADNMIPTIYAPWVWSCLSYNKWKPLL
                     REMYRCIIPGGFALSAVYDLKIANTFTSCADDPVHEFPSTLERDKTFDAITLKAMNDG
                     VHIFPTKHFVQAFKSVGFSNVKFSLLSLKTGDFSTEMGCLNELSSQIVWDILLRKEGS
                     DPNKPPKDTNPTTLFQRYTKEHMGKIDENAGCFRVLLIVGQKLNKNIHA"
     gene            complement(<623418..>625217)
                     /locus_tag="HG535_0B03260"
                     /db_xref="GeneID:59234948"
     mRNA            complement(<623418..>625217)
                     /locus_tag="HG535_0B03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287120.1"
                     /db_xref="GeneID:59234948"
     CDS             complement(623418..625217)
                     /locus_tag="HG535_0B03260"
                     /inference="similar to AA sequence:RefSeq:NP_011390.2"
                     /note="similar to Saccharomyces cerevisiae MET13
                     (YGL125W); ancestral locus Anc_6.122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143015.1"
                     /db_xref="GeneID:59234948"
                     /translation="MKITDKLEKHQEKSAKPTFSFEYFVPKTTQGVQNLYDRMDRMYE
                     TSFPQFVDITWNAGGGMLSQLSTDLVATSQSVLGLETCMHLTCTNMPVSEIDDALQRA
                     YESGCENILALRGDPPLNSKEWTPVEGGFRYAKDLVKYIREKYGDHFGIGVAGYPEGH
                     PEDNDDRDKLVEYLKEKVDAGADFIITQMFYNADIFIKWCEAVRAAGVSVPIIPGIMP
                     ITTYAAFLRRAQWCEINVPDEFMKKLDAVKDNDQTVREIGTDLLVSMCQKLLDSGFVN
                     HLHIYTMNLEKAPIMILERLGLLPTDKDVSDAAVAVLPWRKSLNPQRRKEEVRPIFWK
                     KRPYSYVARTSQWAVDEFPNGRFGDSSSPAFGDLDLCGSSLIRQSGKKSLELWSRPKT
                     VEDIARLVIRYLERDLNCLPWCDVALNNEVDVILEDLISLNQNLIITINSQPQLNGIK
                     SSDPVFGWGPKDGYVYQKQYLEFLLPKEKLYKLQDSLKDNTMLTYFAVDYEGNLTTNH
                     PDDYKANAVTWGIFPGREVLQPTVVEKISFLAWKEEFYHILQEWKLNFQNNQIQESVV
                     LLDHLIGDYVLVNIVDNDFVSIDNKMLKLLHEI"
     gene            <625518..>627134
                     /locus_tag="HG535_0B03270"
                     /db_xref="GeneID:59234949"
     mRNA            <625518..>627134
                     /locus_tag="HG535_0B03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287121.1"
                     /db_xref="GeneID:59234949"
     CDS             625518..627134
                     /locus_tag="HG535_0B03270"
                     /inference="similar to AA sequence:RefSeq:NP_009782.3"
                     /note="similar to Saccharomyces cerevisiae TDP1 (YBR223C);
                     ancestral locus Anc_6.121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143016.1"
                     /db_xref="GeneID:59234949"
                     /translation="MNSSDCRKRVSERWSKVDYRVLGDGTSDLGESECSTDIEERDSK
                     RVRQEIIDLTALDDEEEKSEGSAVVTPFRLMRSSIYDGGINSPHFITLEEILSSKSLK
                     SCVLFSYQFGMDFLLEQFHTSVEKITIIGQRGTITPITSGRALEFVKKLDIVEIFMPP
                     YTCHHSKMIVSFFKDDSCKIYMPSNNFTYEETNLPQQVCWCSPVLQRSNGMYSRNSSK
                     FQDNLIDYLASYENNLINRRLIPVIKKLNFEPLKNVQFIYSTPSKKFASGFQLLADSL
                     PRKTGTDEGDALKHYLCQSSTIGSAISKKTHGNLFTHVFIPYLEEIMTKSSKPLQTDT
                     VLQEFNKRRIKPYILYPTVQEIQNSPAGWLSSGWFHFNRLKDVVHYDNLLKKLDAFYK
                     QNPNDLSRERKATPCHSKFYFKSTTTNGEEKQNSQFDNLDWCIYTSSNLSLSAWGNLN
                     GLPRNYEVGVLFVSDQNSLQCQSFNDVIYNRYRLKSRELKQPSVAPSTVIMVPFGLPP
                     TKYDIEKGDEAFCMSKNYDLVDINGRAYET"
     gene            <627664..>629277
                     /locus_tag="HG535_0B03280"
                     /db_xref="GeneID:59234950"
     mRNA            <627664..>629277
                     /locus_tag="HG535_0B03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287122.1"
                     /db_xref="GeneID:59234950"
     CDS             627664..629277
                     /locus_tag="HG535_0B03280"
                     /inference="similar to AA sequence:RefSeq:NP_009781.3"
                     /note="similar to Saccharomyces cerevisiae PCS60
                     (YBR222C); ancestral locus Anc_6.120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143017.1"
                     /db_xref="GeneID:59234950"
                     /translation="MSLTASFNDTFKVSDNVAVIIPETGVEVTYCDLSHQVGHFQTLF
                     HDPRSPLYDIVLRQSTVAISMRNGLEFVVAFLGATMDSKIGAPLNPNYKSEEFDFYLN
                     DLKSKVIVVSKGTVKQEKQAEVIKSAKKFNCFVVELEFDVKRFRVEYEVYSPANGYSK
                     GIFSSLDNAKFVNHDSTSFPGYARSSDVAMILHTSGTTSKPKTVPLLHLNIVRSTYNI
                     SRTYKLSENDRAYVVMPLFHVHGLIGVLLSTFRTQGSVVIPPRFSATNFWDDFVKYTC
                     NWFSCVPTISMIMLNMPKPANMPYIRFIRSCSSALAPATFHKLETEFNAPVLEAYAMT
                     EASHQMTSNNLPPGKRKPGTVGQPQGVAVYILDDSDKVLPVGNIGEVSIRGENVTLGY
                     ANNPKANEENFTKRENYFRTGDQGYFDPEGFLVLTGRIKELINRGGEKISPIELDGVM
                     LSHPKVDEAVAFGVADDKYGQVVQAAVVLKKGQNLTSKDLTKYMETKVAQFKIPVKIY
                     FADKLPKTATGKIQRRIIAAAFTKRNSKL"
     gene            <629665..>630747
                     /locus_tag="HG535_0B03290"
                     /db_xref="GeneID:59234951"
     mRNA            <629665..>630747
                     /locus_tag="HG535_0B03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287123.1"
                     /db_xref="GeneID:59234951"
     CDS             629665..630747
                     /locus_tag="HG535_0B03290"
                     /inference="similar to AA sequence:RefSeq:NP_009780.1"
                     /note="similar to Saccharomyces cerevisiae PDB1 (YBR221C);
                     ancestral locus Anc_6.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143018.1"
                     /db_xref="GeneID:59234951"
                     /translation="MSFRIPIRALAKGAVTRSAFRVQSMRFASSKTMTVREALNGAMA
                     EEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEYGLAGLAVGAALK
                     GLKPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQRCPIVFRGPNGAAAGVAAQHSQ
                     DYSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGQSFEMSEESLS
                     PDFTLPYKAKVEREGSDISIITYTRNVEFSLAAAEILDKQYGVSVEVINLRSIRPLDV
                     DAIVKSLKKTNHLITVESTFPQFGVGSEIIAQIMESEGFDYLDAPVQRVTGADVPTPY
                     AKELEDFAFPDPDTIVRACKETLSID"
     gene            complement(<631293..>632861)
                     /locus_tag="HG535_0B03300"
                     /db_xref="GeneID:59234952"
     mRNA            complement(<631293..>632861)
                     /locus_tag="HG535_0B03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287124.1"
                     /db_xref="GeneID:59234952"
     CDS             complement(631293..632861)
                     /locus_tag="HG535_0B03300"
                     /inference="similar to AA sequence:RefSeq:NP_011339.1"
                     /note="similar to Saccharomyces cerevisiae YGL176C;
                     ancestral locus Anc_8.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143019.1"
                     /db_xref="GeneID:59234952"
                     /translation="MPPEIPGFYFDSERGRYFKVASARERPTETYYHEQEIKKRKHNE
                     RKKAHGKDLSQRRRETYDKYLFQLADPFEMAFCDRNPMEFLAGMTIEENLLKNTDMYN
                     SNVDSSFGLQPENHEITKSLICGDCSSDSASIVFSTSKKIVRFRKSTSATNAGASTDE
                     VLLNLNDFDNKLENTDDIRYDTIRLEGSKFSPKGLYFHAQRRDTNTHVFALLFENPVH
                     NKIKFLNFKKREYVHDSVCLGLGFTVAVGAGLKSFEWVGNNVKISEFNSKLTPDNKSD
                     ILTLSLGKEHDIPNRLYAGYRDGSIVVLPIGRDCKFQYDHLSYYRLKKIRMILSIKCT
                     DIPGLIFASAVLEGCQSILMLDMMSPSRECDIVVLKTSFLNLTKEQEFFDVTPDGHFV
                     LYGSSSAREGKGSFELFSSHFKDNLIFEKQQRKGSFQLIYFPIKSSEKEKIAGLDLAN
                     KKIRCTSFGNARSTGKISNLTDFCDKEEQFAEQFTETHYKGSTHRLVLILEDTTQPSE
                     FYLPPMTLVSADIM"
     gene            complement(<633191..>635575)
                     /locus_tag="HG535_0B03310"
                     /db_xref="GeneID:59234953"
     mRNA            complement(<633191..>635575)
                     /locus_tag="HG535_0B03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287125.1"
                     /db_xref="GeneID:59234953"
     CDS             complement(633191..635575)
                     /locus_tag="HG535_0B03310"
                     /inference="similar to AA sequence:RefSeq:NP_011051.3"
                     /note="similar to Saccharomyces cerevisiae RSP5 (YER125W);
                     ancestral locus Anc_8.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143020.1"
                     /db_xref="GeneID:59234953"
                     /translation="MPSISVKLVAAESLYKRDVFRSPDPFAVLTIDGYQTKSTSAAKK
                     TLNPYWNETFKFDDVTENSILTIQVFDQKKFKKKDQGFLGVVNVRIGDVLGHLDEDTT
                     GGSRGREETITRDLKRSNDGMAVSGRLISVLSKQVGRSTDSTSSAPSAPTSSAQASGS
                     VSSSRGTGTHTPRPTAAAVEHTLQSGAGSSSGSNNAASNNSSTRQYSSFEDQYGRLPP
                     GWERRTDNFGRTYYVDHNTRTTTWKRPTLDQSEAERGNQLSANTELQRKQHRGRTLPT
                     GSSDNSSVTVQTSTSSQTPAVNGSAAAAFAATGATTSGLGELPSGWEQRFTPEGRAYF
                     VDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMRLTNTARVYFVD
                     HNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIKVRRKNIF
                     EDAYQEIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSA
                     HDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVL
                     QDMEGVDAEVHNSLKWMLENSIDGILDLTFSADDERFGELLTVDLKPDGRNIEVTDEN
                     KKEYVELFAQWKIVDRVQEQFRAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDVE
                     DWKKHTDYRGYQESDEVIKWFWKCITEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSD
                     GPRRFTIEKAGEIAQLPKSHTCFNRVDLPPYDDYENMKQKLTLAVEETIGFGQE"
     gene            <636768..>638495
                     /locus_tag="HG535_0B03320"
                     /db_xref="GeneID:59234954"
     mRNA            <636768..>638495
                     /locus_tag="HG535_0B03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287126.1"
                     /db_xref="GeneID:59234954"
     CDS             636768..638495
                     /locus_tag="HG535_0B03320"
                     /inference="similar to AA sequence:RefSeq:NP_011050.3"
                     /note="similar to Saccharomyces cerevisiae DSE1 (YER124C);
                     ancestral locus Anc_8.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143021.1"
                     /db_xref="GeneID:59234954"
                     /translation="MNDPIITGYYQPANVFRQPALVVKKRSQNNDTGSMLNSVSIDTT
                     QHHRKSWKNDVSRIGSPLLRKASDDFNDHYTAKKLKSEYWKLSNKNGASYLPTDLSIV
                     GDTILISNMDSKNNLKLHKLKQSKNGPFSEPTKLHEIQSVSVPGTPIMSSCLLPSKRF
                     SADYFEGHDQLLLCGHQDGVVDLISTSMESGDAKIAKRYKHGKFLKHQKSLQSNLDNW
                     LQSFPSLPVRKIKPWNDTGYTSLVNDSLFIYDLNRAKKPQYLQSFPGIESMAANEFNN
                     PYVLSLCGSQFGNSGVALLDLRTNGLKGNLYIPDCEDIAGESTSCRTKNNTSYDCTWI
                     DEYHVANCVNDIVKIWDIRSTGSQAKCEVLPMKGCIESLNYSIKSKTMYTSDDQGNIM
                     SWDLTRLNNMKKATSAQGFNSISIQDTQELLHDVSQCGNIIINGSSFQKQYSKNTVRG
                     SIFLDTTLDGSLITLDAQELGLHQVCHIECDVTNLNEKNDQVVLSADTYEDANKLQED
                     SDVTLLGHDLSSLSNQSDCSSSHTLHSIEAYENANVEKNMKHDPHSNIIYSLNDLGLS
                     GSTIYRETI"
     gene            complement(<639081..>640619)
                     /locus_tag="HG535_0B03330"
                     /db_xref="GeneID:59234955"
     mRNA            complement(<639081..>640619)
                     /locus_tag="HG535_0B03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287127.1"
                     /db_xref="GeneID:59234955"
     CDS             complement(639081..640619)
                     /locus_tag="HG535_0B03330"
                     /inference="similar to AA sequence:RefSeq:NP_011049.2"
                     /note="similar to Saccharomyces cerevisiae YCK3 (YER123W);
                     ancestral locus Anc_8.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143022.1"
                     /db_xref="GeneID:59234955"
                     /translation="MSQRSNQHIVGIHYAIGAKIGEGSFGVIFEGENILNANYNNGGK
                     DNVGDGSSADPAEVEPVAIKFEPRRSDAPQLRDEFRAYRILNGCRGIPHAYYFGQEGM
                     HNVLILDLLGPSLEDLFEWCGRRFSVKTTCLVAKQMIDRVRTIHDHDLIYRDIKPDNF
                     LISEYQRNSSGNILTKSVAVSANGDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLS
                     GTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGLTK
                     QKLNPDDLLTEFIPPQFATYLKYSRSLRFDEDPDYDYLISLMDDILNRLGMKDDGHYD
                     WMDLNSGKGWDILINKRANLHGYGNANRRNNDNGNNDTNNNTGTNTPGNINSRTNQQS
                     NHHNSLNYAKQKLKFINNNASFDGKQVPNQPVNRRTYDSMGNRILKPTVGDPNSAGNN
                     NDYRTGTGSNLDENNAPYYNWQQQQNQPSQHRGKQFNQRSSSADQDSNANKGFFSKFC
                     CCWC"
     gene            <640928..>642088
                     /locus_tag="HG535_0B03340"
                     /db_xref="GeneID:59234956"
     mRNA            <640928..>642088
                     /locus_tag="HG535_0B03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287128.1"
                     /db_xref="GeneID:59234956"
     CDS             640928..642088
                     /locus_tag="HG535_0B03340"
                     /inference="similar to AA sequence:RefSeq:NP_015348.1"
                     /note="similar to Saccharomyces cerevisiae EAF3 (YPR023C);
                     ancestral locus Anc_8.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143023.1"
                     /db_xref="GeneID:59234956"
                     /translation="MLNVSIIRTDQIHSTESMFAVGKKCLAYHGPMLYEANILRAWDP
                     EMRTVTLTVNGQLKTLSQPEYGEEFDAVPASIENEPCYFVHYQGWKATWDEWIGLDRI
                     NEYNEENIKLKTELTEQARRAKKQKQQEQQRKKKGSSVSNASIESVNGNSGSGTGLGN
                     NKKGKHDSGNTATKKSSGSNIGSNAIAGDERRMQSNGTGSAGATSNVSRIVLRMPVRL
                     KSLLVDDWEFVTKNKKICQLPSPTMTVDQVIASYESARSDELESPALQSQLTEYCSGL
                     NLYFEHSLPVLLLYRFERLQYDEILKKEKFQNKLLASIYGPIHLLRLLSILPELMSTT
                     TMDSQSCQLIVQQTENFLDWLVVHIDQLFDTSSKMEYYVNTSSQYEGVALGM"
     gene            <642393..>645518
                     /locus_tag="HG535_0B03350"
                     /db_xref="GeneID:59234957"
     mRNA            <642393..>645518
                     /locus_tag="HG535_0B03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287129.1"
                     /db_xref="GeneID:59234957"
     CDS             642393..645518
                     /locus_tag="HG535_0B03350"
                     /inference="similar to AA sequence:RefSeq:NP_015347.1"
                     /note="similar to Saccharomyces cerevisiae YPR022C;
                     ancestral locus Anc_8.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143024.1"
                     /db_xref="GeneID:59234957"
                     /translation="MKKSTDDISMDVTSLSDITSKTISTNEDGRFKCPFPNCNKSFTR
                     QEHLSRHKLNHWPKEIFRCSYIYPDTGLACNRTFVRKDLLSRHEKRHEKQGGRLSNHH
                     SAPATLVANGEDNQFLNAATSRTGTLYSVSNITSEEKQIELPLNNTTAETQQSSETLE
                     NAILDYRVTAEQQPSIGDHSGSESVNRLFSWLFEANYSQPQLGGQYHSINKNNSAGSQ
                     LLNKSGATSHSSPVDLAGNTQSSLFHGIEDIGGKQKESSKATSPVVLQKTSDETSKQF
                     SQPQHLYESNVTSLPSNQMQDLFSLEMLNNDPLDALMQELSAPSMESQNSTGLEKTSM
                     SHSRVSTRAEDKCKDSHRANIKDNFEVQKSNILELQENSPDTKKKFESSGNSASKTSK
                     NYKKKIRSTMMPSFFHPDPKSKYAISGQKCEDLYQLVPDLREIPIENLQRSLLSFWFN
                     FHPQYGLLHKPSFHVDQQPAILVLALIMIGASFLGSESRKTTSDVICIPLRWIIFSNE
                     DFQPPSKTYIIQSLLLLECYEKASTNRYLHERSYLHHGTTIQLLRRTPSLGGHPLRLK
                     PEERPDGIQDPQEVYRLWIDCEMLKRVALYAFYMDTTHAAVFGYANLFINCSQVQLML
                     PCSDIVWESYDLSYEKLLDHGFGKERMTFLSGLKELLSEVIETLQRAAKHQPQLGATD
                     VTIKSWDIKSVLGRKVLLAGVISTMFQCQETNVDLFASMSRGSFGDEDHPNRSLQDIL
                     SFTINYWLFKVQKSYQDPDHCFIESVDSAEDSIEPTKGADVTLDHTNILGLDGRARCK
                     IPEYYMAQIMLRIFHHDYYIFGGAPWRMNVKTGEEEYALASKHILQFASDSSVGDVAL
                     VYSYQFLFEMFVDEDTLQVNADSYSPNSDYIITRPNTLALLTLLIWTCSFVLYGSEVT
                     LWNNKQHESVDSISTVDGTIYTKENELLKQTYIPKESFENHLIRMYSFLRIKPSSDVV
                     TYHNSIREKAALLKSIGGRNNLCGMMKHMRNIFAQSYWDLGREFSKLFDNCFERSLGK
                     ASPTCINMYKV"
     gene            <645845..>648625
                     /locus_tag="HG535_0B03360"
                     /db_xref="GeneID:59234958"
     mRNA            <645845..>648625
                     /locus_tag="HG535_0B03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287130.1"
                     /db_xref="GeneID:59234958"
     CDS             645845..648625
                     /locus_tag="HG535_0B03360"
                     /inference="similar to AA sequence:RefSeq:NP_015346.1"
                     /note="similar to Saccharomyces cerevisiae AGC1 (YPR021C);
                     ancestral locus Anc_8.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143025.1"
                     /db_xref="GeneID:59234958"
                     /translation="MEQVNSLNGKKIQQLEIFTKFASALVEEQQKLQDPYCYISNDKE
                     ELAAGGPSQRALVERIQEKHKEDEMDSAQLILRYDDFVNLITSSKRLYSKFTDHSFNL
                     NQISQNAFGCIFFAIDENNKGYLTLNDWFHFNNLLENDNYHLIILYEFFRKFDVERIK
                     AKKEKVIEWAKRRSLPSAGLSADDIRVKSINYDNKFLSFDDLFLNLKQFKETINLLHE
                     SVQDEFAKKNNLFLDWNTLKFLKFYECSPYGNKEGPHLSLNSIVTILQNDLKNEKLFL
                     GFDKLSHIDPCRNCFTLSKNQLVYLLKLFYSHRIPADVFESLNLTNTNLIKSHNNSIA
                     FNVFKDIFYLFQNFDLLNQALIKNATMNDYSERDLREGVISKSDFMSILNTQYNRVNN
                     INEFSPSQINLLFSIVGNAKENNKIQKLRMHHQDSRIEDFIQNEYAHGISGHEKRLES
                     FNSNYQELAAGFDQDCSVKNSPSYTSNGVFSFLSSKQDNSQVTYNLTTEDFMKILNPN
                     YLNDLVHQMELHRIQQASLYTNYYFYPIFDSIYNFSLGSIAGCIGATVVYPIDLVKTR
                     LQTQRSVTQYKNSIDCFVKIFSREGIRGLYSGLGPQLMGVAPEKAIKLTVNDYMRKTL
                     GDKSGKLSLTQEIASGASAGACQVVFTNPLEIVKIRLQVRSEYVTENIGKSQETAFEI
                     VKKLGFTGLYRGICACLMRDVPFSAIYFPTYAHIKRDIFNFDPQDDTKRSRLKTWELL
                     LAGGLAGMPSAFLTTPFDVIKTRLQVDPRKGETPYGGILHAAKTILKEESFRSFFKGG
                     AARVLRSSPQFGFTLAAYELFKGLLPLPDDRNIESLEADDEIPTVTNSFTSFFSDLSL
                     SSHPTSYMPTQPEFFSPIVDPYSTNYLNYYYKSCQVAKLFIDLDNNFSKFDFRVYSKF
                     HDYLKRIGSSKN"
     gene            complement(<648728..>649828)
                     /locus_tag="HG535_0B03370"
                     /db_xref="GeneID:59234959"
     mRNA            complement(<648728..>649828)
                     /locus_tag="HG535_0B03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287131.1"
                     /db_xref="GeneID:59234959"
     CDS             complement(648728..649828)
                     /locus_tag="HG535_0B03370"
                     /inference="similar to AA sequence:RefSeq:NP_011340.1"
                     /note="similar to Saccharomyces cerevisiae SAE2 (YGL175C);
                     ancestral locus Anc_8.128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143026.1"
                     /db_xref="GeneID:59234959"
                     /translation="MKLRSNLNSLLELDLNGLIAVQRDITRLIELKVDELQSNTKKNP
                     VNRNCAGQKSSQKNATFENKENVEFQETIVGESDYWDSQDYILTQFDNKAREKSPRKP
                     YNEQQILQIASSQEAFKKTDLSSPLKESQPLEDSVKLCMGKNLNNKGNAITLTAGPKF
                     DHYQNLLNENNTNCNNHCLAGSSTSVKDKNIDSEVPKREFIEHISFNKHPLNKRAWIL
                     EDFKRNENANLGTRGRKKFKTVKLQKFYAKAGLPPDLDGIPKAKGIINGHYMLDEGDS
                     YKFDNLRERSNSPPGYGRLDFPTTQERFDDKQKSQEIIFRKTRERFIEATCTNIPTYE
                     RGYIFKSDHLNQLVDDGAIEWNEEELEIFTRK"
     gene            <650074..>650898
                     /locus_tag="HG535_0B03380"
                     /db_xref="GeneID:59234960"
     mRNA            <650074..>650898
                     /locus_tag="HG535_0B03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287132.1"
                     /db_xref="GeneID:59234960"
     CDS             650074..650898
                     /locus_tag="HG535_0B03380"
                     /inference="similar to AA sequence:RefSeq:NP_011341.3"
                     /note="similar to Saccharomyces cerevisiae BUD13
                     (YGL174W); ancestral locus Anc_8.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143027.1"
                     /db_xref="GeneID:59234960"
                     /translation="MSLHSYLNDVYGPGTQEKKRKKKDKNKNSKKESKSYLNITESAQ
                     TIFPNSTAEASYGIKNKKKGDKNIWKNLDTNEVVTENQGIQNLPTEGQLSSGAYAGLQ
                     SAEDIDKQIKRKELLDGKMSSRQYEGSTTVFRDEKGRKVNDYGNYMKKEIRDEELREA
                     VKRQEIVQLNMGELQLYMKNGSKSQPTQDTKKKQLEFEDPASMFDPKSNTRNVKMSAL
                     GRRLYEKLYPMNRFEITPGWRWDGVDRSNGFEKKWFAKQNELVEKKVQGYTLQEDY"
     gene            complement(<651025..>655413)
                     /locus_tag="HG535_0B03390"
                     /db_xref="GeneID:59234961"
     mRNA            complement(<651025..>655413)
                     /locus_tag="HG535_0B03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287133.1"
                     /db_xref="GeneID:59234961"
     CDS             complement(651025..655413)
                     /locus_tag="HG535_0B03390"
                     /inference="similar to AA sequence:RefSeq:NP_011342.1"
                     /note="similar to Saccharomyces cerevisiae KEM1 (YGL173C);
                     ancestral locus Anc_8.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143028.1"
                     /db_xref="GeneID:59234961"
                     /translation="MGIPKFFRYISERWPLILQLIEGNHIPEFDNLYLDMNSILHTCT
                     HGNSDDVTRRMSEEEVFAKIFAYIDHLFHTIKPKQIFYMAIDGVAPRAKMNQQRARRF
                     RTAMDAEKALEKAIANGDEIPKGEPFDSNAITPGTEFMAKLTKHLQYFIHDKITNDSK
                     WREVKIIFSGHEVPGEGEHKIMDFIRGLRADDSFDPNTRHCIYGLDADLIMLGLSVHA
                     PHFALLREEVVFGRRSSTQASLENQNFYLLHLSLLREYMQLEFEEIADELKFEYNFER
                     ILDDFILVMFVIGNDFLPNLPDLHLNKGAFPVILQTFKEALQHLDGYINDNGHINLGR
                     LKVWLQYLSQFELMNFERSDVDVDWFNQQLENISLEGEKQRARTGKKILLKQQKKIVG
                     LVKPWITKVMSQKCSPNLSEDDIPTLLIDDDRIKDNLDFLKEFAFQLGLFVTHSRSTD
                     KYSLKLDVDAINPHETEQECDERQRSVRKTLKMYQQAVLVEDQEELDTEKETYNERFV
                     QWKDNYYRDKFGFSINDSEKLADLTGNYVEGLQWVLYYYYRGCASWGWYYHYHYAPRI
                     SDLEKGLDQLIEFEKGKPFTPFQQLMAVLPERSKELIPSVFRPLMYDEKSPIKDFYPR
                     EVQLDKNGKTADWEAVVLISFVDQDRLIEAMEPYLPRLTPEEKSRNSRGSDLIFTYNP
                     QVDEVYKCPLSGIFSDIEHNHCVEREFVRPDFKQSQFRYGLLAKSKVGADMLAGFPSL
                     RTVTFTSELLYNETRVFQQPSKQQSMVLTIDDVYKARDLGLDELAERYLGNVVYTRWP
                     FLRESKLVSIRDRSHAKEISDKSSKPFSRQLNDSEKREFSTLAASMVRKYSSAKATSL
                     KEVTIIVAVLPVTDLIRTPQGAYVKAFASEPEHYPLQLMVEEVANVDERYVEREPVSI
                     EEEFPESSHVIFLGDYAYGEEAIIDGYSSDTRLKLTVHKKSRRSEPIIGKERAAMDRS
                     MVKYFPSFVVAKKLNLHPLFLSKITSRFLVANQSGKNINVGVPIKFEGRHEKVLGYAR
                     RNPKGWEYSTLAIQLLEEYKRLFPDFFKRLSANRSNMPTIQELFPELPTQKAADILPN
                     VTNWLKSVTEKFVTVSLESDSLTKVSIQAVEDHVQKHSGHPDETERKQLAKVPCKAVL
                     DPKKSFTLLRTQRFELGDRVVYIQDSGKIPLFSKGTVVGYTTLGTNLSIQVLFDHEIV
                     AGNNFGGRLRSNRGIGLDASFLLNITNRQFIYHSKASKQTYKERSAQQKAKSNLDKSG
                     ARAAKKNRAHDLLNHIKKADNTQTAKKDEKREVLNSEDSRQTAGGIGSNPVDSSEFIH
                     ETDQRTTSVANNIYHSVLNQYVPSGYLPQNMQFQSEVASVPAPSGLPYHLPPGILHPA
                     GIPLPGADVQLPRPFNGQLPQISHSQPPQSAADNDANSKNLNVVLNSAIEKRASRNKK
                     PEATSNGKKNGRQGSRATAQQKPRID"
     gene            <656039..>657436
                     /locus_tag="HG535_0B03400"
                     /db_xref="GeneID:59234962"
     mRNA            <656039..>657436
                     /locus_tag="HG535_0B03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287134.1"
                     /db_xref="GeneID:59234962"
     CDS             656039..657436
                     /locus_tag="HG535_0B03400"
                     /inference="similar to AA sequence:RefSeq:NP_011343.1"
                     /note="similar to Saccharomyces cerevisiae NUP49
                     (YGL172W); ancestral locus Anc_8.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143029.1"
                     /db_xref="GeneID:59234962"
                     /translation="MFSFNKPASAGAATGTQSGGLFGQQTNANTMGTNQGGSLSGQNN
                     AGGNLNSGGVSSFGGQPQNQSQGAGNVGGGLFGNTSGTGTGFSFGQQANKPSTGQPFG
                     GLQTNSSNGGTGLFGSNTTNAAPGSGLFGSGSTNASSNNTGGLFGSKPQSSSLFGQSN
                     QTAATGGGLFGSNNNASNSTVSGGTGGGLFGSNNSNMNKGIFGAKPVGGSSLFGNSTS
                     NGGGLFGSQQQQQQQQQQQQQQQSALFAISQLPVTPMTKISDLPPQLRQEIEQLDQYI
                     QRQVQISQHLKADTSEHKELIDSIPNDIAYLSKTESFGTQSLSQDMKNISSIKDITDQ
                     SITDSQTFSMILQQLLTPGSKISSMELDKFFHNKIQVYQNKLDEYFNVLSDIESAVNG
                     IDTDVVGGYSEPNDLYNPTTSASESLDAYAVKTGLNALVSTVVEEFRLFMDTAERVAE
                     LHQKVKELAPSNRQG"
     gene            <657876..>659579
                     /locus_tag="HG535_0B03410"
                     /db_xref="GeneID:59234963"
     mRNA            <657876..>659579
                     /locus_tag="HG535_0B03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287135.1"
                     /db_xref="GeneID:59234963"
     CDS             657876..659579
                     /locus_tag="HG535_0B03410"
                     /inference="similar to AA sequence:RefSeq:NP_011344.1"
                     /note="similar to Saccharomyces cerevisiae ROK1 (YGL171W);
                     ancestral locus Anc_8.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143030.1"
                     /db_xref="GeneID:59234963"
                     /translation="MDIFRVLARGANVRKNDKNVGKNVDFSMTNTAREDAATSDDHLT
                     RELDFFHNKRIAKKVENSKERQDESNNSEHEEEEESYKFEQPRITNAEEAAALRKSYK
                     GKITGEDVPLPIGSFEDLITRFSFDKRLLSNLLDNHFVEPTPIQCEGIPLALLERDIL
                     ACAPTGSGKTLAFLIPLVQQIISEGKDQSGLRGLIISPTKELANQIFSECMKLAHRVY
                     LDKKRPLQVALLSKSLSAKLRNKVVSEKKYDIIISTPLRLIDVVKNEALDLSQVKHIV
                     FDEADKLFDKTFVEQTDDILNSCNNPKIRKSMFSATIPSNVEEIAESIMGDSVRVIIG
                     HKEAANSDIEQNLIFCGNEEGKLIAIRQLVQEGQFKPPVIIFLESISRAKALYHELMY
                     DGLNVDVIHAERTQIQRNKIIESFKSGELWCLICTDVLARGVDFKGVNLVINYDVPRT
                     AQAYVHRIGRTGRGGRAGKAITLYSKLDSVAIKPIINVMKQSGCEVAEWMEKISKISK
                     KEKEMIKKGKSVKERKDISTVPKLNKMKRKQRHDMIEASKKRRFQDGEKSQDGEEQTK
                     Q"
     gene            complement(<659811..>660167)
                     /locus_tag="HG535_0B03420"
                     /db_xref="GeneID:59234964"
     mRNA            complement(<659811..>660167)
                     /locus_tag="HG535_0B03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287136.1"
                     /db_xref="GeneID:59234964"
     CDS             complement(659811..660167)
                     /locus_tag="HG535_0B03420"
                     /inference="similar to AA sequence:RefSeq:NP_015345.1"
                     /note="similar to Saccharomyces cerevisiae ATP20
                     (YPR020W); ancestral locus Anc_8.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143031.1"
                     /db_xref="GeneID:59234964"
                     /translation="MLGRVQSFTTGLITKTSALASKTVYYGKVGAELSKQVYLKEGLQ
                     PPSIADFKKVYSSLYSTALHYAVKPKEVLSIFKGIQRNDALKFGAYGIQLLGFYSVGE
                     VIGRRKIVGYRNYSSH"
     gene            complement(<660685..>663540)
                     /locus_tag="HG535_0B03430"
                     /db_xref="GeneID:59234965"
     mRNA            complement(<660685..>663540)
                     /locus_tag="HG535_0B03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287137.1"
                     /db_xref="GeneID:59234965"
     CDS             complement(660685..663540)
                     /locus_tag="HG535_0B03430"
                     /inference="similar to AA sequence:RefSeq:NP_015344.1"
                     /note="similar to Saccharomyces cerevisiae CDC54
                     (YPR019W); ancestral locus Anc_8.122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143032.1"
                     /db_xref="GeneID:59234965"
                     /translation="MPEQPSSPITGDFDSSSSPINAEDSQLPPVSSPVTGNFESTSSP
                     NRNAQSSLPPEPSSPALFYNTSSSQPDTFGQSQSAGQRQGNRNVGAAIGSSPFNYPSS
                     HQSSTGSEIHRRNDAARSGNTPRTAGISERWSDRAAPKSSSSYGGRPTGRSQARRNDI
                     HASDLSTPRRIIDFDSRTGVPASSSSDIPSDAGEPLRIIWGTNVSIQECANSFRSFLM
                     SFKYKSRKVFDEREQLIDESDEELYYIKQLNEMRELGTTNLNLDTKNLLAFKQTEELF
                     HQLLNYPQEVISIMDQTIKDCMVSLVVDNNLEYDLDDIETKFYKVRPYNINSTKGMRE
                     LNPNDIDKLISVRGLVLRSTPIIPDMKVAFFKCNVCEHAMAVEIDRGVIQEPARCERV
                     DCNEANSMSLVHNRCSFADKQVIKLQETPDSVPDGQTPHSVSLCVYDELVDSCRAGDR
                     IEVTGTFRSIPIRANSRQRVLKSLYKTYIDVVHVKKVSDKRLGVDTSTVEQELLQNKI
                     NNSEVEEVRTITDKDATKIKEVAQRSDLYELLARSIAPSIYELEDVKKGILLQLFGGA
                     NKTFSKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYIT
                     RDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITT
                     LNARASILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAQ
                     HLTNLYIEDKPDHVSVDDVLPVEFLTAYINYAKEIIKPVITERAKTELVRAYVGMRKI
                     GDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSSEVELVDVQEAVRLIRSAIKDYAT
                     DPKTGKIDMSLVQTGKSVIERKLQEDLAKEILNLLGDHSSDSMSLNELAKQINEHSQD
                     RVDFSDISDALSRLQQEDKVIVLGEGVRRSVRLNRRM"
     gene            complement(<663774..>665576)
                     /locus_tag="HG535_0B03440"
                     /db_xref="GeneID:59234966"
     mRNA            complement(<663774..>665576)
                     /locus_tag="HG535_0B03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287138.1"
                     /db_xref="GeneID:59234966"
     CDS             complement(663774..665576)
                     /locus_tag="HG535_0B03440"
                     /inference="similar to AA sequence:RefSeq:NP_015343.1"
                     /note="similar to Saccharomyces cerevisiae RLF2 (YPR018W);
                     ancestral locus Anc_8.121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143033.1"
                     /db_xref="GeneID:59234966"
                     /translation="MTTPSAVSGKRKEILAFFQGNRNKTPKDNTTEKPMGDDQSDVVV
                     DLEASEDNITTTAEKCTTVEKEGNDNIKDDETSLRRSQERHLMNNTDTAKNGPSRAES
                     NELKLGNDSALNSPASKDVKSALSKEKEEIKLQRNITRQRKEEEKRQREAQRQEEKRK
                     REQQREEERRKREERKKQKELERLEVKRQKELEKRLKEEEKLKLDEVKRLKELSKEKS
                     QLRIGNFFKKVNDSTKQLDVKSDFNKYFLPFYAKDGTILPKNSDGSKFDLAKSKSALD
                     SILIKKEGKNENNDTLLEWLDSKKCKRGYKVKFTATELLKQMASKEKEESELLNLLFL
                     IPQKYIKFYENVRPPYIGTYSKEIVLPVDNPFSTEGTGFNYEYDSDLEWVNEEGEEGE
                     EGEIDNLESEEEDEDEDEEQDEASDGEFDGFLELEEKSADGPQGKKKKFFGPLIPTVC
                     LRSEINKMDESDRRYFEEIKVTCLSDKQPFPIDPHIPFAKEQEATGIKRALPEGQSDK
                     TSASSSPSVSPQKRAKTLISDTKSLLKLFDEVEGSTFSLGTVTEIAQKNLPQYSKQLI
                     KNTVKEYAIRGTGPTRKWQIKDHKHWDDLRTITD"
     gene            complement(<665933..>667201)
                     /locus_tag="HG535_0B03450"
                     /db_xref="GeneID:59234967"
     mRNA            complement(<665933..>667201)
                     /locus_tag="HG535_0B03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287139.1"
                     /db_xref="GeneID:59234967"
     CDS             complement(665933..667201)
                     /locus_tag="HG535_0B03450"
                     /inference="similar to AA sequence:RefSeq:NP_011345.3"
                     /note="similar to Saccharomyces cerevisiae SPO74
                     (YGL170C); ancestral locus Anc_8.120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143034.1"
                     /db_xref="GeneID:59234967"
                     /translation="MQEIKVGELAAELDLLKLKCPQDKRSLTMGDEPSSHHLDISQSS
                     LSMLGDEKEESEDAQDELARIKNDNYHLKLALGEQQDELLKLKRILEDNAFLENAHRF
                     MPTKFEVEAPRTQRDPKYLVMAERDPKITVENSPSKKSISDSDFISSFSGSPYKGNRA
                     PSLKTESSLASTRISKLREEKSIFHAAIVPFVQDIINSLKCSLVFKDEANDLQNRFIE
                     YTESKLRKPEEIVQILNDVEFYCRQMVTLLNRELHFKEISQRLEFLFTIFLDPTEYGL
                     CPQEHIDKLKDEIMDSLIKIFDYHQDSSNALLDSKYEALHMKGPQSHCSGIDHSKRLR
                     HIEEGIDLCAETMQQVYGWRDTSLGIRSTAKRTQVSSRPTTKSDVEVLSHLSQFNNFG
                     KDNHKQKENFGELEFIPIGYDENILQKAYK"
     gene            <667500..>667925
                     /locus_tag="HG535_0B03460"
                     /db_xref="GeneID:59234968"
     mRNA            <667500..>667925
                     /locus_tag="HG535_0B03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287140.1"
                     /db_xref="GeneID:59234968"
     CDS             667500..667925
                     /locus_tag="HG535_0B03460"
                     /inference="similar to AA sequence:RefSeq:NP_015342.1"
                     /note="similar to Saccharomyces cerevisiae DSS4 (YPR017C);
                     ancestral locus Anc_8.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143035.1"
                     /db_xref="GeneID:59234968"
                     /translation="MRKARCSFEDCNSAIIDVNVDDVILLPSSVLRDAKLMQLSKKPS
                     ETQQTNEFLLVNDVWDFDNIGVSKEVPEGFTNEENMREVQFEHGGSFWRMDKCLKYLI
                     CSDCDKGPIGFGCSLSNQAQRGAQNKVVYLLSLESVKYV"
     gene            <668081..>668908
                     /locus_tag="HG535_0B03470"
                     /db_xref="GeneID:59234969"
     mRNA            <668081..>668908
                     /locus_tag="HG535_0B03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287141.1"
                     /db_xref="GeneID:59234969"
     CDS             668081..668908
                     /locus_tag="HG535_0B03470"
                     /inference="similar to AA sequence:RefSeq:NP_015341.1"
                     /note="similar to Saccharomyces cerevisiae TIF6 (YPR016C);
                     ancestral locus Anc_8.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143036.1"
                     /db_xref="GeneID:59234969"
                     /translation="MQKDHHCYYKPSPSLRKHQQGTGISHSTSIMATRTQFENSNEIG
                     VFAKLTNTYCLVAVGGSENFYSEFEAELGDSIPIAHTTIAGTRIVGRMTAGNRRGLLV
                     PTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPDIDRETEELIS
                     DVLGVEVFRQTISGNILVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVPLVAGTVNR
                     GSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPDSISGNLRDTLIETYS"
     gene            <669940..>670656
                     /locus_tag="HG535_0B03480"
                     /db_xref="GeneID:59234970"
     mRNA            <669940..>670656
                     /locus_tag="HG535_0B03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287142.1"
                     /db_xref="GeneID:59234970"
     CDS             669940..670656
                     /locus_tag="HG535_0B03480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143037.1"
                     /db_xref="GeneID:59234970"
                     /translation="MPTLKQRIRNSSLPRRYHNLVSLFSTLFHISPCTPFVISTPRLS
                     THSLRNASRRRHANLGMQLLPHLANLVFWYLAVVTSSVGHAFRPYSEDPHFCRTGPSQ
                     SLQVTRIRTAPLPPVRATCIDPSRASQRTTAKRVQKKKSPTVRAHTSAAGQQRLVCIC
                     LLQRILRVLFFLFCIWLLAFPTNACCSASPSNSAHRRPSVPSSWCRDFPPSTGTRSET
                     SRPIWIFFSACRGFCAYLCL"
     gene            <671262..>672305
                     /locus_tag="HG535_0B03490"
                     /db_xref="GeneID:59234971"
     mRNA            <671262..>672305
                     /locus_tag="HG535_0B03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287143.1"
                     /db_xref="GeneID:59234971"
     CDS             671262..672305
                     /locus_tag="HG535_0B03490"
                     /inference="similar to AA sequence:RefSeq:NP_015338.1"
                     /note="similar to Saccharomyces cerevisiae YPR013C;
                     ancestral locus Anc_8.116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143038.1"
                     /db_xref="GeneID:59234971"
                     /translation="MMLGVTSTVAQDYKYLAPRANGVGRDPQQYFAAPYQVRAGPLGH
                     GTPLNPEVSGGSCGSSAGYYTSSPTANYADAQPLPPAPLLQYSHQPQQLAYEYTTGSQ
                     CSSSRSRSSSISISPIVNKSHIRLPPISALVPAAVYAPEKTPLDHLMPSPCNGYHSQL
                     PQQVLVSGPAFLEHQQHLHSHSHPHLPSHPHQQLHSHLHPHPHQHLHPQHLHQTNIPA
                     QFSRPRYDSVVPEQQPQQQQQQQQQQQANGYYSKNDSFKIQSPSSLNVNINTDNLDPS
                     IRYRKQCPVCGKICSRPSTLKTHLLIHTGDTPFKCTWEGCNKSFNVKSNMLRHLKSHE
                     RKQAKKEGKKSEV"
     gene            673009..673108
                     /locus_tag="HG535_0Btrna1L"
                     /db_xref="GeneID:59235329"
     tRNA            join(673009..673047,673064..673108)
                     /locus_tag="HG535_0Btrna1L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /db_xref="GeneID:59235329"
     gene            <673359..>674342
                     /locus_tag="HG535_0B03500"
                     /db_xref="GeneID:59234972"
     mRNA            <673359..>674342
                     /locus_tag="HG535_0B03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287144.1"
                     /db_xref="GeneID:59234972"
     CDS             673359..674342
                     /locus_tag="HG535_0B03500"
                     /inference="similar to AA sequence:RefSeq:NP_015336.1"
                     /note="similar to Saccharomyces cerevisiae YPR011C;
                     ancestral locus Anc_8.115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143039.1"
                     /db_xref="GeneID:59234972"
                     /translation="MSSVIEAELDTSSIKQILKHDSNVAFIAGGIAGAVSRTIVSPFE
                     RVKILLQVQNSSNAYNQGIFNAIKQVYQEEGVKGLFRGNGLNCIRIFPYSAVQFVVYE
                     SSKKHIFGVDGVRRNEQLTNGQRLFSGALCGGASVVATYPLDLVRTRLSIQTANLKNL
                     QKSKAKSIVKPPGVWELLCKIFREEGNIKGLYRGVWPTSLGVVPYVAINFAVYEQLKE
                     FMPNSKVNGRSTWNENVCKLLIGAISGGASQTLTYPFDLLRRRFQVLSMGNSELGFHY
                     TSVTDSLITIGKTEGFKGYYKGLTANLFKVIPSTAASWLVYEFVCETMRNW"
     gene            <674646..>675075
                     /locus_tag="HG535_0B03510"
                     /db_xref="GeneID:59234973"
     mRNA            join(<674646..674678,674884..>675075)
                     /locus_tag="HG535_0B03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287145.1"
                     /db_xref="GeneID:59234973"
     CDS             join(674646..674678,674884..675075)
                     /locus_tag="HG535_0B03510"
                     /inference="similar to AA sequence:RefSeq:NP_001091638.1"
                     /note="similar to Saccharomyces cerevisiae YPR010C-A;
                     ancestral locus Anc_8.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143040.1"
                     /db_xref="GeneID:59234973"
                     /translation="MRAAQLLLNQAKKGSGLGIPVELTPLFFAMGLALASGTYFTYKK
                     FMYDDSLRVTKNPQLSDLDRVLTESAEKKD"
     gene            complement(<675327..>677207)
                     /locus_tag="HG535_0B03520"
                     /db_xref="GeneID:59234974"
     mRNA            complement(<675327..>677207)
                     /locus_tag="HG535_0B03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287146.1"
                     /db_xref="GeneID:59234974"
     CDS             complement(675327..677207)
                     /locus_tag="HG535_0B03520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143041.1"
                     /db_xref="GeneID:59234974"
                     /translation="METGLGDNYSAEDHELHEERKCGLTFLQKFRDFILWVVFKFTTK
                     EGLLGDYNYRYLFTPSYPFRNWINKKRGIELPKVDQPFFSLNEDVPVVLGFLLGLQHA
                     LSMLAGVITPPMIISGIANFDELKTQYLVSASLISSGILSSVQITRFKIPFTSYYIGS
                     GLLSVVGTSFAVIGIVSKSIPVMYTSGFCPTSSDGTRLPCEDGYGAILGTACCCALLE
                     ILLSFTPPKILQKVFPKIVTGPVVLCIAVPLIQSGFNDWVGGSGCVGAICPFEGGPQA
                     APWGSAKFIGLGFLVFFTIIICEKYGPPIMKSCAVIVGLIVGCIVAAAAGYFTPSTIR
                     IAPAVTFFWVHTFKLRVYGPAVLPTLVMFVVLAQEAIGDITATSDVSRLEVEGSLYES
                     RIQGGILSDGLSGILSPLFTVTPMSTFAQNNGVISLTKCASRQVGYWCCFFMIVMGIF
                     AKFGAALVSIPKPVLGGMTTFLFTTVAVAGLKIISTIPFTRRDRFVLTGCLLPGFGAI
                     LVPNWFDYVFTYTGDNHALSGFYDAIILVMESSFTICGIFAIILNLAIPQELDEELID
                     DIELQQENLSVLDGQRSPKISTVLSNKAREAKGLSSGNDTIGNYEMKNNANIDLSTSY
                     SS"
     gene            complement(678604..678676)
                     /locus_tag="HG535_0Btrna5K"
                     /db_xref="GeneID:59235352"
     tRNA            complement(678604..678676)
                     /locus_tag="HG535_0Btrna5K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59235352"
     gene            <680560..>684162
                     /locus_tag="HG535_0B03530"
                     /db_xref="GeneID:59234975"
     mRNA            <680560..>684162
                     /locus_tag="HG535_0B03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287147.1"
                     /db_xref="GeneID:59234975"
     CDS             680560..684162
                     /locus_tag="HG535_0B03530"
                     /inference="similar to AA sequence:RefSeq:NP_015335.1"
                     /note="similar to Saccharomyces cerevisiae RPA135
                     (YPR010C); ancestral locus Anc_8.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143042.1"
                     /db_xref="GeneID:59234975"
                     /translation="MSKIIKPPSTRTADFRTLERESRFINPPKDKSAYPLLEEAVQPH
                     IGSFNALTKADETGGLLNEAVKDIGEKVIFDGKISDDETKSDYLGNKLSVSVEQVSIA
                     KPMSNDGVSSAVERKVYPAETRQRLSSYKGKLMLKLKWSVNDGEETFSEVRDCGGLPI
                     MLQSNRCHLNKLSPLELVKHKEESDEAGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPS
                     FANRGASYSQYGVQIRCVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKA
                     LTDTNDKEIFDGIVGSDLDNSFLTDRLELLLRGFKKRYPLLHNRRQILQYLGDKFRIV
                     FQASPDKSDYQVGQEVLDRIVLVHLNKGSQQDKFRMLLFIIRKLYSLVAGECCPDNPD
                     ATQHQEVLLGGFLYGMILKEKIEEYLQTITAQIRTDINRGSAINFKDHKYMNRVLMRV
                     NENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQ
                     LKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTKQSDVSKIPSILYSLG
                     VTPASQASTAGPSFCCVQLDGKVIGWVSHEQGKVISDTLRFWKVEGKTPGLPLDLEIG
                     YVPPSSRGQYPGLYIFGGHSRMMRPVRYLPLDKEDIVGPFEQVYMNIAVTPQELQNNV
                     HTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALVHRSDNKLYR
                     LQTGQTPIVKANLYDDYGMDNFPNGMNAVVAVISYTGYDMDDAMIINKSADERGFGYG
                     TMYKTEKVDLSLNRSRGDPISQHFGFGSDEWPKEWLEKLDDDGLPYIGTYVEEGDPIC
                     AYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVTIKYRIRRTPQIGDKF
                     SSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALH
                     GIAQDATPWMFNENDTPADYFGEQLLKSGYNYHGNEPMYSGATGEELRADIYVGVVYY
                     QRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTAFLLQDR
                     LLNCSDYTQTSVCRECGAILTTQQSVPRIGSLSSLRCRRCAVKFDDAKKMLSKYKGTK
                     SVFIDDSQVWEDGQGNKFVGGGDTTTVAIPFVLKYLDSELAAMGIRLRYNVEPR"
     gene            <684732..>687554
                     /locus_tag="HG535_0B03540"
                     /db_xref="GeneID:59234976"
     mRNA            <684732..>687554
                     /locus_tag="HG535_0B03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287148.1"
                     /db_xref="GeneID:59234976"
     CDS             684732..687554
                     /locus_tag="HG535_0B03540"
                     /inference="similar to AA sequence:RefSeq:NP_011348.1"
                     /note="similar to Saccharomyces cerevisiae PMR1 (YGL167C);
                     ancestral locus Anc_8.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143043.1"
                     /db_xref="GeneID:59234976"
                     /translation="MSENPFNVPLVDNVDGEDIINSTDALSKPNSSLEYCTLTVAETL
                     EKLGTSATKGLQSFEEATRRSEAYGPNEIKVEEDDPLWKKFLSNFVEDPLILLLIGSA
                     VVSFIMGNIDDAVSITVAIVIVVTVGFIQEYRSEKSLEALNQLVPAECHLIRCGQESH
                     TLASNLVPGDLVSFRIGDRIPADLRIVDSVDLTIDESNLTGENEPVHKTSHHVNKESF
                     NDQPYSIVPVADRSCIAYMGTLVREGHGKGIVVGIGTNTSFGSVFEMMNSIEKPKTPL
                     QSAMDKLGKDLSLGSFVLIGCICLIGIIQGKSWLEMFQISVSLAVAAIPEGLPIIVTV
                     TLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLDTMANK
                     SNVINLEKSKNVNFKNYLTDDVRATLLISSVCNNASFSQEHGKYLGNPTDVALLEQLS
                     KFDIKDMRSSFKKLQEIPFNSKRKFMATKLVDSEGSCAVYVKGAFEKILQHSNSFVTQ
                     KGKTERLTDAHKETIIDTANSLASNGLRVLAFAKLELPNALGTLNEEAITDLCFAGLI
                     GMSDPPRPTVKPAIEKLLQGRVHVIMITGDSENTAVNIAREIGIPVINPEISVLSGDK
                     LNDMTDDQLANVIDHVNIFARATPEHKLNIVRALRKRGNIVAMTGDGVNDAPALKLAD
                     IGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAAL
                     SLVALATTFKLPNPLNAMQILWINILMDGPPAQSLGVEAVDHEVMKKPPRKRTDKLLT
                     SEVLKRLLISALFIIVGTVYVFIKEMNEDNKVTARDTTMTFTCFVFFDMFNALSCRHS
                     TKSIFTIGIFTNKMFNYAVGFSLLGQLCAIYFPFFQQVFKTESLSLSDLGFLLMISST
                     VFIADELRKLWARKTASIYPSVYSTV"
     gene            complement(<687697..>688956)
                     /locus_tag="HG535_0B03550"
                     /db_xref="GeneID:59234977"
     mRNA            complement(<687697..>688956)
                     /locus_tag="HG535_0B03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287149.1"
                     /db_xref="GeneID:59234977"
     CDS             complement(687697..688956)
                     /locus_tag="HG535_0B03550"
                     /inference="similar to AA sequence:RefSeq:NP_011346.1"
                     /note="similar to Saccharomyces cerevisiae SUA5 (YGL169W);
                     ancestral locus Anc_8.111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143044.1"
                     /db_xref="GeneID:59234977"
                     /translation="MIQRGLARAMSLQVAFETKILKVDPGSIQFAADAHLNGSLPTFA
                     DDESKRVIQEASKILRDSDNIVAFPTETVYGLGGSSLNDNSILNIYKAKNRPSDNPLI
                     THVSSIDQLNRKIYGENNLGKDSLLKNVPEIYHSLIDQLWPGPLTILLPVPNASRNTL
                     SKLTTASQSTFAVRIPSNPIARALIALSDTPIAAPSANASTRPSPTLASHVYHDLKGK
                     IPLILDGGPCSVGVESTVVDGLCRPPMLLRPGGFTYEQIVKLGGDLWFDCKVERRKTL
                     ESGEKVRTPGMKYKHYAPSAKVILLVPGNIGNEREKIRKLISVIDEQCLVSHGSIKKV
                     SILTTLQLANVSSSELKSALNVDLTVQSLGLTGEEIQANLFAALRKADEDDFADLIVI
                     EGVAEKDEGLAVMNRLIKAAGNEYKSF"
     gene            690879..690950
                     /locus_tag="HG535_0Btrna3M"
                     /db_xref="GeneID:59235344"
     tRNA            690879..690950
                     /locus_tag="HG535_0Btrna3M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:59235344"
     gene            complement(<691137..>691601)
                     /locus_tag="HG535_0B03560"
                     /db_xref="GeneID:59234978"
     mRNA            complement(<691137..>691601)
                     /locus_tag="HG535_0B03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287150.1"
                     /db_xref="GeneID:59234978"
     CDS             complement(691137..691601)
                     /locus_tag="HG535_0B03560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143045.1"
                     /db_xref="GeneID:59234978"
                     /translation="MNHQALSFIGLFFIVTRLMAFELLLDKNSEILQTMKELDAYYEK
                     QAWDEENVTQYLNELLEKHGPAVQKKLEISIKQDVSDFSIAQQESLQPQLEHRWIVGE
                     PSLKKLDKPLFESMVTKIKQIWPASSSQLLDGWEFQDLGIYFLSINNTNIFD"
     gene            <691970..>693034
                     /locus_tag="HG535_0B03570"
                     /db_xref="GeneID:59234979"
     mRNA            <691970..>693034
                     /locus_tag="HG535_0B03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287151.1"
                     /db_xref="GeneID:59234979"
     CDS             691970..693034
                     /locus_tag="HG535_0B03570"
                     /inference="similar to AA sequence:RefSeq:NP_012577.1"
                     /note="similar to Saccharomyces cerevisiae POL32
                     (YJR043C); ancestral locus Anc_1.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143046.1"
                     /db_xref="GeneID:59234979"
                     /translation="MDALEEETFQYINEKLFTEERPVLFTDLIFLFKIGPSRSKKIMY
                     SYYKQNTVTNFNCIIVTCQKNGIIKVVSDVNNPGDENSITDCFIYAFNPMEKFIPVNR
                     LVDQRDCLSIKNPHKLHVAKHRSKTLEEKATPKVTVPLSRSKTVPDEGDTRAKVGDID
                     TKGTKVKKAINAAKGNGLRSTAILAKMRAERENKEAQRQEELKKRRAQQQQQHNPKQL
                     SQMEDLRSLFDEDDSLMEETPVVPTPEASTPKNEDSAPIDKKELEDLLETTAEDTTIA
                     SQTSPQKQQEELSDAPSSSYVDDDGYIVTKRAVTSTPPQHAKKRPARTAPATVTSGKT
                     PPPTKKTQRTLENFFKRSKK"
     gene            <693323..>693805
                     /locus_tag="HG535_0B03580"
                     /db_xref="GeneID:59234980"
     mRNA            <693323..>693805
                     /locus_tag="HG535_0B03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287152.1"
                     /db_xref="GeneID:59234980"
     CDS             693323..693805
                     /locus_tag="HG535_0B03580"
                     /inference="similar to AA sequence:RefSeq:NP_010887.3"
                     /note="similar to Saccharomyces cerevisiae CUP5 (YEL027W);
                     ancestral locus Anc_1.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143047.1"
                     /db_xref="GeneID:59234980"
                     /translation="MSELCPVYAPFFGAMGCACAIVFTCFGAAYGTAKSGVGICATCV
                     LRPDLLIKNVVPVIMAGIIAIYGLVVSVLVSSSLKQTQALYTGFIQLGAGLSVGLSGL
                     AAGFAIGIVGDAGVRGVAQQPRLFVGMILILIFAEVLGLYGLIVALLMNSRAVQDVIC
                     "
     gene            complement(<694014..>696221)
                     /locus_tag="HG535_0B03590"
                     /db_xref="GeneID:59234981"
     mRNA            complement(<694014..>696221)
                     /locus_tag="HG535_0B03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287153.1"
                     /db_xref="GeneID:59234981"
     CDS             complement(694014..696221)
                     /locus_tag="HG535_0B03590"
                     /inference="similar to AA sequence:RefSeq:NP_012576.1"
                     /note="similar to Saccharomyces cerevisiae NUP85
                     (YJR042W); ancestral locus Anc_1.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143048.1"
                     /db_xref="GeneID:59234981"
                     /translation="MTVEMNGKNDSLLMDVDGLDFVDEGQSIKDQLDDHEDNYIGRDS
                     VSDCIVVSLSKGNEPWSYNKGGELHFKLSPLVQQNIAFLCEKDKYKIYPVALPGIDAS
                     EEYVNYVTQLFEIYSSLGEDRVNSVPTIGVVNINEAREHTMAANLAFEALVIELESFI
                     DAIKNKKNAFGRFFEVEECLTIINCLKTIYFTADTPDEQTSRNTFIKTLLGWINRSDG
                     EPNEEYIEQVFSSSSNKNVFETSFFWKLINQLLLRGLFEQAMACIERSELANYLSSKC
                     QVSSNALHDIVALLKQYPLDSSKTFREWKSLVLELSQTYNDSETEISGEIRDYLQDTL
                     LLIGGHQDKILFYSKTWYESFCGLLLFYIPSLELSEEYLQLSLKHNPLDVTNNWESAC
                     AEVIRGHLYSILPTLESLDSCTAAFTAALCEAKGLLENYNEDEDHEQSRIYREEEDLF
                     SYRNGMAAYMLNNFAFEICSLGNATLWPVAIGLITLSPICNSSAKKLAIAELLPHYPF
                     QSTDDIEWMLSVCAKWRLTQVAKSIYVTLGNKLLYESNTIEAMANYSKAGKFEWVKRY
                     SWMMFEASVLQGGPLDDIILNAIVNNYDDPVIPKNVLDTLVTSAMKQSLSPYAVLYQF
                     YVAQQNEKWSDALELLLLLLEFQYMPKCYVVLLVSKILLPIFLEDSEKVMKEDIILRI
                     MECITNKWDNDDEKTQNIYLSLREMGLSVSENLDGLHKHVRKLLDFKLCQEYM"
     gene            <696530..>700012
                     /locus_tag="HG535_0B03600"
                     /db_xref="GeneID:59234982"
     mRNA            <696530..>700012
                     /locus_tag="HG535_0B03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287154.1"
                     /db_xref="GeneID:59234982"
     CDS             696530..700012
                     /locus_tag="HG535_0B03600"
                     /inference="similar to AA sequence:RefSeq:NP_012575.3"
                     /note="similar to Saccharomyces cerevisiae URB2 (YJR041C);
                     ancestral locus Anc_1.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143049.1"
                     /db_xref="GeneID:59234982"
                     /translation="MTIPTSTQALTKQLRSKEITTGEICEIYSTLNREDYYFPNKEIF
                     AIELIHDRWNDQKLISFKTDYRIWALYNEMWSKLHDEDLILKKLFKQLKFVPHLLKTL
                     ETLENNMLEFAVELRKTCEMINSIISMNVSTENANIIMGRTLQFLIKMGDKENMCGMI
                     CDLVEQLKNLTGIKNIPEINSKIANVYCNELLLPTIQYISGLDKKIGDNSIVSFLKVQ
                     LRLYLFNNTVDTAKLLEKFINNNKAALEPKLLLVLYTTSISFLSKQNFTELEKIFTII
                     VDVQPDMTRELLLQLALSKKTMSNEFLSSILSKTLQKASEDNSYYTNFWSLLSHLLDL
                     DIEIGIKNMVTLLDLLYEHKDHSMDEITKIWKKIVNCHINAREFLQFLEKLEKYCQEN
                     AVKSTTFLANPAFTEVISQNTVSFSTSQLKDLISGHLNRIENNPRNETTFFIFRAIIK
                     GLENLSYTVLAELKELLSTVFTIDHTKESNIWEIRYLVMKIFDDIIPAEQFNSWHVEK
                     ETENLNLGSSREMYFYFFKLREYKEFDLDTVVTKFMNYLNQIAYQQRAESVRILFVNW
                     ATLINFIFPRDDLTGLLDFLLSEEDQSLLHALLNDDNIFEESNIISMLVSKLSKLHSS
                     EKNQRLILRIPIQCINKTIRVGVINSICSHKSVTSELEVKVLDHLLTNPTFKSDIECD
                     FSCLYNFVNKNLQNLKYKDVVFQRVWKNHALQIKEKKSKQFLETAIRSLSQGIENEEL
                     FKTSMQTTYLAIMTGSNISAALGEHFIKNAIHKLFNMGSVDSSVSSWLLRCLYYIFSL
                     NDTIKPTTNQAAKLSSKILELYKEKIHDTDYDFLTSLFLLYSVLYNDKLEILFAHYLV
                     LREIGIQSNLISKAMEEALDRYLQSDTDKFNRAFANIISSISSCPPGFTEGITELYQM
                     HIKRINKDNKIGVHLFAASISEFYTNFARYQNSKESVLKLLDSLQHLLITKPWLYSQH
                     SIEILFPMCLSINLIFLQCSIPCDDVFLGTISVVSNIVFAHRIKMSNRHFLINALICE
                     YLEILSQYQGKQLTSVSARGLSRLITSVCEPNVTGNQTFKTNDLNSKIGVMKKNLRKY
                     VPVILIKYVHISSSTPFRTSIRKELVPAIFSIFNLMSQSEMILLNAALDNAGVQYFRS
                     LYSDYKKIGKWNTE"
     gene            complement(<700066..>702378)
                     /locus_tag="HG535_0B03610"
                     /db_xref="GeneID:59234983"
     mRNA            complement(<700066..>702378)
                     /locus_tag="HG535_0B03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287155.1"
                     /db_xref="GeneID:59234983"
     CDS             complement(700066..702378)
                     /locus_tag="HG535_0B03610"
                     /inference="similar to AA sequence:RefSeq:NP_012574.1"
                     /note="similar to Saccharomyces cerevisiae GEF1 (YJR040W);
                     ancestral locus Anc_1.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143050.1"
                     /db_xref="GeneID:59234983"
                     /translation="MLSPNTAETGSANDEYRSKVIPETQNFDDFVTIDWLAEENRLIN
                     ESKRAHAQERSLQYWQGSFHLWARCRTLVALTCIAVVIGCIAGFLQIFTESLVNWKTG
                     HCGRNWLLNKSFCCSDKNLLSNSKRAFSLTKREEFECLENGTWVKWSGEPFPFMIFMF
                     FSVVFALTSALLVKFVAPMATGSGISEIKVWVSGFKYKDEFLNLRTLIVKSVALPLAI
                     SSGLSVGKEGPSVHYATCCGYVITNWLLKDVLTYSKQSEYLTAASGAGVAVAFGSPIG
                     GVLFGLEEIASSSEFSPSTLWKSFYVALVAVATLEYINPFRNGKIILFNVTYDRDWRV
                     EEIPVFIILGIFGGVYGKLVSKWNIHYVQFRKRYLSKWPVQEVIILTFLTALVSYFNE
                     FLKLDMTESMGILFHECKTNDNTSTFTHRLCELDENTHVVSFLRVFSSLCLATVLRAL
                     FVIISYGSRVPAGIFVPSMAVGATFGRALSLLVERFVSGANVITPGAYAFLGAAATLC
                     GITNLTLTVVVIMFELTGAFIYIIPTMIVVAITRLILTYFHTLGGIADQMVLVNGFPL
                     IEPDIREEYMEKCTAAQIMTRDLTTISEIIYLSELESMVYDSSERSVNGFPIIKAEDK
                     NEFEKRCLGYVLRRHLISKLMSLDSTSSETNRIIVSFTGEDSSNNTNGNLQEVLSFKD
                     LLIQCPVIVQPEAPVSLVYRMFKQLGCKAVIVQDGGFLQGLITRKDVIRFERNKHEEL
                     HGPQYKQNDTFNEKLWAIIQSMINKINRTE"
     gene            <702925..>703305
                     /locus_tag="HG535_0B03620"
                     /db_xref="GeneID:59234984"
     mRNA            <702925..>703305
                     /locus_tag="HG535_0B03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287156.1"
                     /db_xref="GeneID:59234984"
     CDS             702925..703305
                     /locus_tag="HG535_0B03620"
                     /inference="similar to AA sequence:RefSeq:NP_010888.1"
                     /note="similar to Saccharomyces cerevisiae SNU13
                     (YEL026W); ancestral locus Anc_1.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143051.1"
                     /db_xref="GeneID:59234984"
                     /translation="MSAPNPKAFPLADEALTQQILDVVQQAANLRQLKKGANEATKTL
                     NRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVISASI
                     TTNDASSLKNQIFAVKDKIETLLI"
     gene            complement(<703449..>706481)
                     /locus_tag="HG535_0B03630"
                     /db_xref="GeneID:59234985"
     mRNA            complement(<703449..>706481)
                     /locus_tag="HG535_0B03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287157.1"
                     /db_xref="GeneID:59234985"
     CDS             complement(703449..706481)
                     /locus_tag="HG535_0B03630"
                     /inference="similar to AA sequence:RefSeq:NP_010889.1"
                     /note="similar to Saccharomyces cerevisiae YEL025C;
                     ancestral locus Anc_1.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143052.1"
                     /db_xref="GeneID:59234985"
                     /translation="MDRIKLIDEELALFQTHAAEEVSYGISHTITSANLASSRIVGLE
                     TLIHEKRFLLCMNDAVYIIEDSEAIAHLSFNERHICCCAYISLKVLSGQTIHVFFMDN
                     NTIELHEIIDKEIICLEKLAFPKDIRFKKGTGQIFLANTGTIIYFTLDHHNVFAWNVS
                     DILMKQRIANFKKVYSVYDDELLFFAFLKERTSILTVARCAFNGMIAIERASMTNGTY
                     LGTSRSMTGSQFDCNYLYKQVNDELIVLLSTEHTILFTAAKDLTKFTNNGLPHEILVY
                     LHCVFESSDRILLEACLASGRIFQAQCSAIPKQNDQVIWTGGKSLSRVRNEKFKFITR
                     LHNEVYLTASDTKGISVHYLRENYRRKVQHCSYSEEMYFDSAILPSKDEETEYRIFCG
                     AYNRHHGFLKWRRTRRNDLPVRVLWSRKLKYVPVSNVWLSEGVLVYESFGQLYDVHSD
                     AKICEFSDGIWITKGGVTVTDVECDILSIGTLLGPVIMKNETLVQLKKCGKLEIMNYS
                     KERTECLFQCELADQIHSTSVAAAYSSDNSEFHILISQGYDYLSFFHNKNCIRKVQVS
                     RGFHVSDLLIKRVLSKLYYIATSTAGGCLVYTADSAKPILEIKGNGSAKSHIFDIGSE
                     ATYILIYSSSDQKIVDLAQKAYRKIDLPVRPYQIIRNYDEKDQESSFYILDYDWCLSL
                     ISCDISQVAHVQKLENMDETRVLDIGGFIPLQILTMNIKDQALVVMTKSPKTNISILD
                     FDSMKVVGNCTLGTNCRNIILRALWNDACEVESYIDFIMQKTVLVYFIKENVAHFKII
                     RIQKNVFVSQQDYELPCRALFIKVDHEKNQVHFDGSSKQVYNIFYDSSADRVSLKLSP
                     NTQETAAPYHGGAVKSAYKEIEGNFFQETPSHERQTHVTACAIMRSFFTSGYRNNVPR
                     AYDALIDYRNCVSLYRIFRGVLQGEDRTSFIGRFNINSKVTNISPVPYSSKEAHSTHS
                     RLESGPRRTPLFVVTCADGTIFTLTEVVKGRSHMYNED"
     gene            complement(<706658..>710032)
                     /locus_tag="HG535_0B03640"
                     /db_xref="GeneID:59234986"
     mRNA            complement(<706658..>710032)
                     /locus_tag="HG535_0B03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287158.1"
                     /db_xref="GeneID:59234986"
     CDS             complement(706658..710032)
                     /locus_tag="HG535_0B03640"
                     /inference="similar to AA sequence:RefSeq:NP_012573.1"
                     /note="similar to Saccharomyces cerevisiae YJR039W;
                     ancestral locus Anc_1.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143053.1"
                     /db_xref="GeneID:59234986"
                     /translation="MACSIILQELENSRWIVSVVLLRGGELVVVEPDVIRKGPYSKDL
                     EYGNMAQTRITGYVIAAQLYTDFLTGAEYLLILKDCGVLEVLDSNLDRLDMLDISRAG
                     NGNEQPLMVLDDRNQKIYVNTKKNQIMAIQFKVSGERFNFIRSDKNPQSIFEPVESII
                     NMEISWHVDFEFGRDFVAMSVLLFDEFSKRYYFEVIKQQQVDTRKKKQPWLSLIEKTP
                     LEVDAYRTTASMNSKRLVTFKAVSNIGFFIFSLHCNFFFELPGGSMHTLAGKQIEKLV
                     KCECLDESFNDNSCGDIELHSSVLLLQTVNDLKFTVVTTSNFAITVKIDLVQEDTEEL
                     VYHWDRFLSSKHVLCGLPTTATGCQVVQFMPLNSSQCILLTVTNGIIFIGTKNFRIYH
                     TISFPLRTAFYSAGVGENFSKHVVCGGSQDNKGFLESRWIGLKDFLSLNQTFTSPNKI
                     FKIWSTRDRVWWKTHDGRFYQDGKIVDVPSSVIHISMSDEVVSESAIIIATNIENDEE
                     GNYCFITSGGMLCWSNEDLQIKIKNFKSSKLVRYNLACFKDAEGTKVTVIAIDNVLTL
                     LRGHSVNTESLNVTSRLEAISMLCVVPSPQPKYVLLGDIGGRLLRLDMESMAIVSEIK
                     VSCGRVRFCGIPKSGDVFVYTPDDLLVWDHSDFHITRVDFKHTICHISSRNEMIDIMI
                     DDYTVISCSVHSDLLGTEMITSSITSSSHFHTKFVQLPCSTRYVVTNSLRSEYSVDYK
                     RNILHTELQLHDIQSGKTVSRHDVSKLFPQAIISDIAAVPFEEGFELGLKASEKKSFA
                     ERQTLSKCFIVSLDYETAEDDNELNNLLLFSIDDGVIEFHLGLRTRSVVTTLKNYYQH
                     LFLAAGDVLQIFKIDYSVKDNAFKIESVSNEITLLGFTKSLLLLENFSLNHDEKKMPK
                     RNDYIFPSHRVVGLNIFKGFQEYELFCNDEHCNQNLEIPYIIRIRPIPNSRRIIESIE
                     TFNDQMMTSASLINGTGIYLAVAWTNNVVTICRTSYNGLKESVEFKMPCQVTNITSFG
                     QNTFNSDVASEEGKNISDIFMVTTCQGGSYILHFESNLSIKSEQHQMLEEQNRFIAVA
                     EDGIGFIDTRILDVKKSSHDLAMDAFYQPFSHRHYC"
     gene            <710472..>713015
                     /locus_tag="HG535_0B03650"
                     /db_xref="GeneID:59234987"
     mRNA            <710472..>713015
                     /locus_tag="HG535_0B03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287159.1"
                     /db_xref="GeneID:59234987"
     CDS             710472..713015
                     /locus_tag="HG535_0B03650"
                     /inference="similar to AA sequence:RefSeq:NP_012570.3"
                     /note="similar to Saccharomyces cerevisiae HUL4 (YJR036C);
                     ancestral locus Anc_1.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143054.1"
                     /db_xref="GeneID:59234987"
                     /translation="MMLDFLKKGNGVQGSDIKLISHSKVKVASKTSESTRSVSVKRAQ
                     CTCCGTLLHFPSNVPKFKCAICQITVTLAEEEPNKVNDCTGKSSKLSLNGLNEKIGEC
                     LNNGKEWSTMSKEQRCTTLEPVTTYLSLGFRDKQTLQNSFRSSEKHESVDYVQLNSFY
                     NAVLELPSRRPFFRMLCSCNDLLKKPGELIEDFHWILVIFSNPMVRQCLVFKDSKVSE
                     SPHIRSVSYELTKRCIGYLSNIPEGKSLDRLVHYFKYSKIDIFRNHVETLNLYITFQL
                     LRILHKHDGQATNSTRNNEIFDVSEHYNNADSGNILEETKKNMWNSKSGTIINSKNFK
                     FKLFEYENDWHIRTATRLMMLLHKTNNRRKTLLNIEFSNSGEFYNMMLDFIDYKTDFD
                     KWKGLTSDRLKAFTELNLFNGKRFTLCNYPFLLSLGIKISIMEYEIRRIMEYEAEQAF
                     LSSLDKGKTVAVYLKIKVRREHIASDSLRCIKSHQSDLMKSLRVEFINEPGIDAGGLR
                     KEWFFLLTKSLFNPMNRLFTYSEESFFSWPSIKPIVFEDEGGSQQNEELYYLFGIVLG
                     LAIFNSTILDLQFPRAFYKKLTGETISFNDYLELYPKTGANLLKMLEYDGEDFFDTFG
                     VYFEITIQDNNLEIEKGNGKEQVGIGGKKKGKNFVNFELCSGGGDIKVTQQNKKEFVN
                     KWVDFHMNQSIKRQFSQFNIGFHQVFQNCVAIELFNSEELEKLVCGNQENNCYDFQML
                     RSVTKYLGGFTDKSKVINWFWDIIDGWDLTMQKKLLRFISGADRVPPTGMSTLPFRIS
                     RLGNGSDSNKLPLAHTCFNELCIWEYSSKNKLENKLWWAVTQSEGYAFK"
     gene            <713700..>714365
                     /locus_tag="HG535_0B03660"
                     /db_xref="GeneID:59234988"
     mRNA            <713700..>714365
                     /locus_tag="HG535_0B03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287160.1"
                     /db_xref="GeneID:59234988"
     CDS             713700..714365
                     /locus_tag="HG535_0B03660"
                     /inference="similar to AA sequence:RefSeq:NP_010890.3"
                     /note="similar to Saccharomyces cerevisiae RIP1 (YEL024W);
                     ancestral locus Anc_1.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143055.1"
                     /db_xref="GeneID:59234988"
                     /translation="MLSLRNSMRAPLRSPFRNLPKIPSRFISSSSITAKSTYRTPDFG
                     ECIQEDRNPDKSRTFAYFMVGSLGLLSSAGAKSTVETFVSSMSASADILAMAKVEVSL
                     AAIPEGKNVVVKWQGKPVFIRHRTDSEIQEANSVDMSALKDPQQDSDRVKDPKWLVML
                     GICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFEDDESKL
                     IVG"
     gene            complement(<714667..>716628)
                     /locus_tag="HG535_0B03670"
                     /db_xref="GeneID:59234989"
     mRNA            complement(<714667..>716628)
                     /locus_tag="HG535_0B03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287161.1"
                     /db_xref="GeneID:59234989"
     CDS             complement(714667..716628)
                     /locus_tag="HG535_0B03670"
                     /inference="similar to AA sequence:RefSeq:NP_010891.1"
                     /note="similar to Saccharomyces cerevisiae YEL023C;
                     ancestral locus Anc_1.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143056.1"
                     /db_xref="GeneID:59234989"
                     /translation="MGVNKRKQKNLVLCFDGTRENFGPQPITNVLKIYQMLENDNSDI
                     QVCYYQPGIGTEPGFDPVIDVRRRFTTSHWSNVTDAMFASTVDHHVVSGYVFLMENYE
                     NGDNIHMFGFSRGAFIARALAGMLERVGLLYRGLNDMVSMAWRIYELWEYAEQPSQPN
                     YNVTLADEFKRTFCRSQEVRVYFQGLFDSVNSVGILRDRLFPCTQRSGIVDHVRHAVS
                     VDERKGKFKQQSFAPNPNACLAHSVNTNSNYDSMSYSTSPSSDLADCETGILESSDEP
                     SLAPSHTLKPDSDANEHNARAAASGKKESNLLKRVNEFLEDTEQFPQTLNSLKNSFLN
                     KSLTENSGSKSTLTPDLVEKWFMGDHSDVGGGWGVDCKTGDSVSNMALRWMLCKAVEH
                     GVVFKKESIHEFAKRNTPIGSLISTIHDKLSFKQAIKIEAVKPPEVICTEDLEAGNGH
                     YLATSGAIPFTNMLRDFFKFKETEILSNEETTRQKYSSICGGISKLETFFWWCLELIP
                     IGLRTENESGKWRNIYVPNLGRSRFVPSYAELHWSVFWRIKHDKRYRPKNLPAYAYKI
                     LEEFQDISIDSPMLRDLETIASPFKSYPTLSGTEERLLNTSEIVYVKDSIVQAQYRKT
                     KRKLLEWESEQWLKVPDDLEKVLKSDPLL"
     gene            complement(<716776..>719985)
                     /locus_tag="HG535_0B03680"
                     /db_xref="GeneID:59234990"
     mRNA            complement(<716776..>719985)
                     /locus_tag="HG535_0B03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287162.1"
                     /db_xref="GeneID:59234990"
     CDS             complement(716776..719985)
                     /locus_tag="HG535_0B03680"
                     /inference="similar to AA sequence:RefSeq:NP_012569.1"
                     /note="similar to Saccharomyces cerevisiae RAD26
                     (YJR035W); ancestral locus Anc_1.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143057.1"
                     /db_xref="GeneID:59234990"
                     /translation="MMSDGDNGLRDLGVNILDQSLLEQKIETNAESLITQQLVDQEHN
                     RLERVENALEKCRSKRNHVRRKLDNASRISVKQRLRQQIEEIEELELPPLLKDIRDIK
                     ERLKNLKTAKNPNQKGGDNQGKRPDESQKEFLIRTGHITAFGSKTEFVLEKPNGITEN
                     EALEAKEEADQNMEMANEQMIENMSGESTNDDYDYDDDDYASDDQNDHDANDNIGNVS
                     ANEAPCILKPGVVKDDGDEASYQKRLRKWVDQRSQVGKGISQECLPEWRKAHPDIPDA
                     KLNDDFKIPGEIFSLLFDYQKTCVQWLYELYQQKSGGIIGDEMGLGKTIQIIAFLAGL
                     HHSGLLNGPVIIVCPATVMKQWCNEFHHWWPPLRVVILHAIGSGFANKKTINEDELEG
                     LIMSSDPTKFSYDDFANSAKTKSQMESNDKILSLIDMVIQKGHVIVTTYVGLRIHSDK
                     LLAINWAYAVLDEGHKIRNPDADISLTCKKLKTHNRIILSGTPIQNNLNELWSLFDFI
                     FPGKLGTLPVFQQQFVQPINMGGYANATNVQVQAGYKCAVALRDLISPYLLRRVKADV
                     AKDLPEKKEMVLFCKLTQFQRGKYLEFLHSKELEQIKGGKRQVLYGIDILRKICNHPD
                     LLDREAKQHEKSYGDPKRSGKMQVVKQLLLLWRKEHHKTLLFTQSRQMLDILEQFISF
                     KDEDLNGIKYLRMDGTTGISIRQSLVDEFNNGDYDVFLLTTRVGGLGVNLTGANRIII
                     FDPDWNPSTDMQARERAWRIGQKREVSIYRLMVTGSIEEKIYHRQIFKQFLTNKILSD
                     PKQKRFFKMNELHDLFTLGGDGGHTTEELDEEVQKHTDSLLNSRTQESDDFGQVLNMA
                     GVFKLESFYSGKEKKEKGKNEDDRLIEGLLGEKNLESVVAHDSMVRSHSKASPATIEK
                     EAERVAQEALTALKKSRKTTRKFDIGTPTWTGKFGQAGKVRKKIKKDLNGNSVGSSAI
                     LANIRAVKHEAQSVQNQDFGTTNAAKNRSLLQQIVKYLSKQENYFASSVDIVKSVGAH
                     LNDKSDIIKIRALLRTIAAFDKDKRGWILQDEFKDLDIE"
     gene            complement(720225..720333)
                     /locus_tag="HG535_0Btrna1P"
                     /db_xref="GeneID:59235331"
     tRNA            complement(join(720225..720261,720297..720333))
                     /locus_tag="HG535_0Btrna1P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:59235331"
     gene            <720956..>726281
                     /locus_tag="HG535_0B03700"
                     /db_xref="GeneID:59234991"
     mRNA            join(<720956..722263,722265..>726281)
                     /locus_tag="HG535_0B03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287163.1"
                     /db_xref="GeneID:59234991"
     CDS             join(720956..722263,722265..726281)
                     /locus_tag="HG535_0B03700"
                     /ribosomal_slippage
                     /note="Ty-like element, ribosomal frameshifting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143058.1"
                     /db_xref="GeneID:59234991"
                     /translation="MSNQVTIDNAEENILYKYGSAAKVPFSMSREAEDSLFTSREKSN
                     SSEISNNGTDPNLSDSQRDFPSLQPSIPASVDNKQEGSPKSSAYDAGYQHTGSTQGYT
                     YPYPWPSPYPPIAPPMVPPMGNGMFNWNMNADGIKYIPATSYETFMYQQKLLNDQFKQ
                     YRKFYDQRSEDDTTSESAKESNNEQVLPDLDEISNPSEFPRWMRSFKRFLEDNKLGDI
                     IPDRLNESERDATKSEKAFIINSFKTYVKETAYPKSVKDAIKRGHDLFRIILCHVSED
                     SNLRSAIWRELTTISYDGSEDSYYYTSRVKELYSQLKATNSNIPEDIICEYLLKNLHG
                     QYAKIRENHYLEYDLNTIAGISKCVLRTYDRLIKNKKHTSETSPSVTNRHCYKCSSEG
                     HFAPQCPNVKDKLPKPSINSRKEKKSYHRKGIHKIGLTRDTELLGILQNSKKKRPSMT
                     KTPQTGELVEDNQHLLIDSGAAISVIRDPGLLHNINKHPNIGIADAQDREIPISVSGD
                     LQLSFPGTSIIHTEAVASTVPHVDILSLHELQKNGITVDFNNSQVTNNKGKMVAQIKK
                     IGPYYWIPAKYIHKPHKKLNVMNVQKQPLFPMEFIHRLLGHVNIKTLRDSIKQGMLTN
                     LSMDDIDWSGYSNFQCEDCVSGKSKKHKHLVGSRLTYQKSYQPFEFLHTDIFGPVPHM
                     PTSSPSYFMAFTDEATRFRWVFGLWNKEAETVTSKFRELVNMVKTQFNTKVRSFQMDR
                     GSEYTNKTIRNFFKEYGIIPCYTSVGDSKANGVAERLNYTLLDDCRTLLRSSNLPLHL
                     WFYAVQFSTLMRNSLITSSVGTSSRAKAGLTGLDVSTILPFGQRVMVNNPPKNKLRPR
                     GIVGFALTPSAESHGYLIYIPSKHTVTDTTNYLIIRGDPHDRTDDADAVIAPLLDQLE
                     ARQDGEFDNNMSTHSGGMEMDVSIHSGGTIHQRPVSPTPTADNLSTSSGGNDPIQTGT
                     TDTTEVIPEYIPEGNNDVLGPDIHDDPPEHTNDDPPEHTSDEIADNIEEHGSNMINED
                     PRINLQSANHAVTYDNTESDDQPTQNEPTSNPINDPANDHPSSAIIDNTKTPDPIPDT
                     VSRRTINNDIDPSSAIASTVGIQASAYDDVAPTTEDERTTSSTSTAELDPLPSEEDSP
                     VPESTTVATPDSETPESISNVGGNDQSPEVNAKSLEERKNRIFQYRNGDIPRVKPPST
                     KRKSSLALGEIEDRTQRKRPKRHILYVNAVHSNPTPHVKPSLSYYEAIVNNDDKNDAK
                     GYNEAYMKEYDQLIKMKTWDPNKPIKEKTIPRQQIINSMFIFNTKRDGRKKCRFVARG
                     DQQKAGTYKEDLKANTVHHYALMTSLNIALDKKMFITQLDISSAYLYAELEEDLYIRA
                     PPHMKLKGKAFKLNKSLYGLKQSGANWYKMIGSYLTNSCNMTELTGWPCVFKDENECF
                     VCLFVDDMIVLSKDIKAANKLVKTLKKKFETKVIHDGKLDENNMATYDILGLEIEYTF
                     GKKMTIGMENSLSEKLPHLGFDIEKDNKKFLVPGTPGEHIHKDNLVVEEDDYKEKVKQ
                     MQKAIGLLSYVGYKYRFDILYYVNILAQHTLYPSEQVEKLTKQLLNFVWQSKHKKLIW
                     HANKHTKTNRITAITDASFANEEGFRSQLGHYYCLNGKVIGGRSSSEKLRVISSTEAE
                     IYAVSESVPMLQGLACLVKQIDPSSSLRSKILTDSKPTISIVEDQSEDSRAFRNRFFG
                     TRAFRLRDEARRNDLKFEYIKTEDNYADILTKPTSIAIFKKLTHSWVK"
     gene            complement(<728277..>728603)
                     /locus_tag="HG535_0B03710"
                     /db_xref="GeneID:59234992"
     mRNA            complement(<728277..>728603)
                     /locus_tag="HG535_0B03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287164.1"
                     /db_xref="GeneID:59234992"
     CDS             complement(728277..728603)
                     /locus_tag="HG535_0B03710"
                     /inference="similar to AA sequence:RefSeq:NP_012568.1"
                     /note="similar to Saccharomyces cerevisiae PET191
                     (YJR034W); ancestral locus Anc_1.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143059.1"
                     /db_xref="GeneID:59234992"
                     /translation="MGASCRDQKKAVAICLQRSPCVMIERHTPQQCFDDPVLKKELPE
                     LCIMQMKAFLDCKRGMVDMTKRFTGNAPLSTGKYDQQYEKLCSGDFDPREELNKLNAL
                     NSNDKK"
     gene            <728946..>733013
                     /locus_tag="HG535_0B03720"
                     /db_xref="GeneID:59234993"
     mRNA            <728946..>733013
                     /locus_tag="HG535_0B03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287165.1"
                     /db_xref="GeneID:59234993"
     CDS             728946..733013
                     /locus_tag="HG535_0B03720"
                     /inference="similar to AA sequence:RefSeq:NP_012567.3"
                     /note="similar to Saccharomyces cerevisiae RAV1 (YJR033C);
                     ancestral locus Anc_1.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143060.1"
                     /db_xref="GeneID:59234993"
                     /translation="MSISFLPGRPNDTQQSTCQALWQEQIIFAYCSGNNVIVFSNEYT
                     RLQTIYLERDSYAVDINPDNGFIAIASSDYIYIYKPIHEIMKRPSWEFCCKIFHDESR
                     VNTLNWGASNEIVVGSDYLSFWKITSEFGQYKPILLWNKKQSKPVYLCKISRDSQLIA
                     SFGKYDHTVKLWKRISISGEQDIFNLTLLPHPAPVTTIRWKKNSPNEQTEVFGTSQVI
                     YSFCEDKRLRIWTCYELNSVGTVQHWGSLLLEKGQEYCLIIDSWILRDTMTETRGTAP
                     DVIILGSPNGRLDVQLLTGLSDNPPRPIKRKELSGKHIAAPAFVKKPEYLYFGEVQPC
                     DKSGKTISVIVHDLRGVIRQSRIKLDSLLGQGKSEIGFLENKFTGHNKSIRKLIRSSD
                     GEALLTVSRFSENCLWCPKFEGKVSLHMRNIIQTEVPIELAVVHEKGDLVICLLKNRK
                     IQAWHCPKEDCCAKKSFLKAEHQLSEAPNLGKPILMLNTPEPNHSHERHFIALIYENG
                     DVRAFEVSFSRGIVEVHSESLELSKDQLCHFSVIDPVHGSFYANRPLISVISQKGVAS
                     FYKAIVDFENTNIRWLKQYELNTGLLDIRKARGSSTGKLCTVTSTGKEMALWDMKRGV
                     LEYEESFDDIIQDIDWTSTTFEQAIVSIGFKGYVLLYTQLRYDYTNNSPSYLPVEKID
                     IRSHTDHEIGDSIWLKNGTFVVASGNQFYIKDKYLDLNDNFTSRSIGSRKILSNDLLH
                     LCSVLNGPLPVFHPQFLIQALYVGKFELVKELLMRLFVELRNFNFRSEDLMKLDSNLG
                     IELQKIFIHNQKNYPKQQFPDPYPEYNTTVSSLLVEQLTKVSLPYLTRHQQVTLITAI
                     EAVDEIMKNEAIVDYNGIRFLLGAKLFLSHRNIQKSLLMRDVTWALHSDNKELILSIF
                     DSHIISWQKAREYKISFWAKDTDLIKKFEQIAKYEFSRDESRDPNRCAIFYLALKKKH
                     ILIGLWRMSTGHPEKQKLLTFLSHDFSEKRWKSAALKNAFVLLSKHRFMEAACFFLLA
                     SSLNDCANVLMKQIGDLDLAIAVCRVYEGDNGPVLGKILLTNVLPDAILNNDRWMTSF
                     IYWKLRKQSVSIKALITPPIDLEDNATLVRKESCVNRSFLVEDPALLVLYNHLRKRNL
                     KYFLGSLEIENSIEYNVVSKVTDIFQRMGCDYLALSLTRNWEFIDEKDSFRRKLLESP
                     KKDEIISGINSMDTEPTMTNKVRPSLFDRFSEEYETKKASAITQHNKNTTTPKKNLLD
                     DFMTPQESAKPISLLDGFTSQEAVPTVAKNLLDDFISTPPASSRVSTSSENQTNGKNE
                     YGKKLQGDSFTGSSVEEKVINKTNGAPRNILDEFM"
     gene            complement(<733043..>734230)
                     /locus_tag="HG535_0B03730"
                     /db_xref="GeneID:59234994"
     mRNA            complement(<733043..>734230)
                     /locus_tag="HG535_0B03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287166.1"
                     /db_xref="GeneID:59234994"
     CDS             complement(733043..734230)
                     /locus_tag="HG535_0B03730"
                     /inference="similar to AA sequence:RefSeq:NP_012566.1"
                     /note="similar to Saccharomyces cerevisiae CPR7 (YJR032W);
                     ancestral locus Anc_1.456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143061.1"
                     /db_xref="GeneID:59234994"
                     /translation="MVSNPQIYLDISIAGEKIGRIVCELFAEKAPTTVKNFRSLCLED
                     HCIEEDKVLTYRGNYFHRIIKNFVVQCGDIIHCSGEFVKSDDAGKGGCSIFATREEIH
                     NGNNSELQCFGNFLDENLGDFNASFYLAMANMGTPDSNSSQFFITTAVSPHLNGKHSI
                     FGRVTHGKSVVRSIEYSKVDSDGFPLECIKIDQCGDWDILKGLPLFNASNDSIGGDTY
                     EEYPDDNEDLDSEDFSAAYEAANIIKESGTLLYKKKDYKNAYFKYNKSLRYVNEFIPD
                     IEVDAENNRKFTHLKIKLYLNMSLVSLKMKRYDEAIKFSSFLLDMNEVPNIDQCKALY
                     RRGEAFVAKKHYENALQDYKSCQEINPDDRAVMDKILSLEKTLEDKKEKTKRNIAKFF
                     SSS"
     gene            <734541..>738809
                     /locus_tag="HG535_0B03740"
                     /db_xref="GeneID:59234995"
     mRNA            <734541..>738809
                     /locus_tag="HG535_0B03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287167.1"
                     /db_xref="GeneID:59234995"
     CDS             734541..738809
                     /locus_tag="HG535_0B03740"
                     /inference="similar to AA sequence:RefSeq:NP_010892.1"
                     /note="similar to Saccharomyces cerevisiae GEA2 (YEL022W)
                     and GEA1 (YJR031C); ancestral locus Anc_1.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143062.1"
                     /db_xref="GeneID:59234995"
                     /translation="MVPENYMAAVDPVTIVIKECINISTAMRKYSKFTSQSGVAALLG
                     GGSDIFSNQDDSLADTFNNLSVNKKNDPLLSGFIQLRLMLNKLQSLEDIDSLTLLQPF
                     LVVVSTSSISGYITSLALDSLQKFFTSNIVTEKSANHVIAYRETVNALTHCRFEASEQ
                     VSDDSVLLKVVNLILTIIQSPRGDLISDSIMYDVLQTVLSLACNKRRSEVLRRAAEFA
                     MISITVKIFSKLKTIEPTKSQKYINDESYAKNELKDDVIGTTTVNETLEPGSNVEEQN
                     GEDSKSIEANVGKKITKGEDKGSNYSEHIDDNYGLPVIKQYLNLLLSLVVPENQTKHT
                     NSARIFGLQLIDTAIELSGDKFLLHPRLFSLVSDPIFKYVLFIIQNNNKLSLLQAALQ
                     LFTTLVIILGDHLPMQIELTFSRIFSILSPAPLKVGDEPKGRPAAVKELIIEQISILW
                     TRFPSFFTSTFIEYDCNLERADISINFLTALKTLALPESALSTSDSVPPICLEGLICF
                     VDDVYEHLQHIDKETFSGYKGNVPLLKQRERKTEFIRCSKAFNEKPKKGIPLLVEKGF
                     IKSDNDPNVARFLFENNSRMNKKTIGLLLCDPKKTSLLKCFIDLFDFKGLRVDEAIRI
                     LLTKFRLPGESQQIERIIEAFSSRYAECQSVEGLTASADSDYEHVQPDSDSVFVLSYS
                     IIMLNTDLHNPHIKEHMSFDDYSSNLRGCYNQKDFPFWYLDRIYCSIRDKEIVMPEEH
                     HGNDRWFEDAWNNLISLTTVMTESAESTSSTIGKLNTMDLAQFDGAIFEQVGSYIVKT
                     LFRIYNVASDDHISTRMLTSLDKCSFIAAFFNLEKLFTDILCRIAKITTLIDTEEDTH
                     TSSVGHAEIPLVEIVVEDTDSKIIVSSDCVKLGRSFKGQLCMVVFFRILQRNTDGDLV
                     HSKLWEVAIKMLLVLYENLLISPDIFPDLQQKLKLGTLPRPKPEVSIKKSKENKGILS
                     AFASYLKGDEEPTDEEVEKSLKALQCIKSCNIASSLFGNKFNVNPALVNTLLNSIKVE
                     KSVENERFYESEILFLIELSVSLFLFCKNEKELGQLVLNKIYEVSQSGSLSKQSIRRL
                     MAYKLLLISVMEKEEKNLLQLINDELLGKNEVFTHQYFATPAGGEILTRILELTKIDN
                     YRELLVQDEGFWKLLRSVVVIKEHTADVYQFLESSLKMSHSIETKENFMWILGLLDEI
                     SSIGAIGSQWEKKCAKKGVDEKENPYSGLVDLSIKSINLTSNVLKGGLNAFQPTKNDK
                     IALIQALAHQCLNPCLQISSYSLETLEVALTKDIELPTAEITTVEELIEGGLLPLLGS
                     SEVEDNKSIPVPEILSVISKIYLYHLKEGITTNDTFLRMLNIFNKYVDIPEVEKELQQ
                     LITEKKSIENCASSNDKIEKAEKVAAEVETERQEDRKGTSDGTL"
     gene            complement(<738938..>740278)
                     /locus_tag="HG535_0B03750"
                     /db_xref="GeneID:59234996"
     mRNA            complement(<738938..>740278)
                     /locus_tag="HG535_0B03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287168.1"
                     /db_xref="GeneID:59234996"
     CDS             complement(738938..740278)
                     /locus_tag="HG535_0B03750"
                     /note="ancestral locus Anc_1.454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143063.1"
                     /db_xref="GeneID:59234996"
                     /translation="MAVSKNTDDVGGAIVTDSNQASSVLNNRNSSIIGALTAGGRSMV
                     YQLTSFYLRTPLKLFRPARFDYLHYVRVILTGEESTMPASKRRHSVLGKLLNSFNPKY
                     VYFLENSSLGILTKALNKYGWKVIPDRILPPLLVNSATGVVLYTTYLTTLGHFSKHED
                     LGTVIKNPFDVWRSGFIAGSVQALVSTPIDAIYTRSSASELLSSAKKYDNLWLYGRDK
                     LREIGPIGCFGGFGITFIKESFAFAVYFTTFELIKGQLCQGMISLINHYHQLKYTISN
                     TSITGILSPEDPSSTNTSHMEYITQKEKKWITRAFVFIGGISAAFLLQVVQYPFNKIQ
                     KIHLSRLEAFDIYNRSLLNQSRGSQIHTQTPVMSRMWVKSPGSRRLHIYYSSYIDTFE
                     HIHFIHKSTKSLVRWLYKGFARNTLAIIPGTTAGLLMLDYMRSSVENSLITNNH"
     gene            <740540..>741355
                     /locus_tag="HG535_0B03760"
                     /db_xref="GeneID:59234997"
     mRNA            <740540..>741355
                     /locus_tag="HG535_0B03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287169.1"
                     /db_xref="GeneID:59234997"
     CDS             740540..741355
                     /locus_tag="HG535_0B03760"
                     /inference="similar to AA sequence:RefSeq:NP_010893.3"
                     /note="similar to Saccharomyces cerevisiae URA3 (YEL021W);
                     ancestral locus Anc_1.453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143064.1"
                     /db_xref="GeneID:59234997"
                     /translation="MTAATATYEERAAKHPSPVASKLLHLMQDKQTNLCASLDVRTTA
                     ELLALADTLGPYICLLKTHVDILSDFSMEGTVKPLKELSAKHRFLIFEDRKFADIGNT
                     VKLQYSSGVYEIAKWADITNAHGVTGPGIVAGLKQAAEEVTEEPRGLLMLAELSSKGS
                     LAHGDYTKGTVEIAKTDKNFVIGFIAQQSMGGRDEGFDWLIMTPGVGLDEKGDALGQQ
                     YRTVDDVMSTGSDIIIVGRGLFAKGRDPNVEGERYRKAGWNAYLKRCNLVSQD"
     gene            <741584..>741847
                     /locus_tag="HG535_0B03770"
                     /db_xref="GeneID:59234998"
     mRNA            <741584..>741847
                     /locus_tag="HG535_0B03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287170.1"
                     /db_xref="GeneID:59234998"
     CDS             741584..741847
                     /locus_tag="HG535_0B03770"
                     /inference="similar to AA sequence:RefSeq:NP_010894.1"
                     /note="similar to Saccharomyces cerevisiae TIM9 (YEL020W-
                     A); ancestral locus Anc_1.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143065.1"
                     /db_xref="GeneID:59234998"
                     /translation="MESLNGKEQQEFQKLVEQKQMKDFMRLYSNLVERCFADCVNDFT
                     SAKLTSKEHSCIMKCSEKFLKHSERVGQRFQEQNAALGQGLGR"
     gene            complement(<741975..>743780)
                     /locus_tag="HG535_0B03780"
                     /db_xref="GeneID:59234999"
     mRNA            complement(<741975..>743780)
                     /locus_tag="HG535_0B03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287171.1"
                     /db_xref="GeneID:59234999"
     CDS             complement(741975..743780)
                     /locus_tag="HG535_0B03780"
                     /inference="similar to AA sequence:RefSeq:NP_009952.2"
                     /note="similar to Saccharomyces cerevisiae YCR023C;
                     ancestral locus Anc_1.451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143066.1"
                     /db_xref="GeneID:59234999"
                     /translation="MVHKTLTFKEQMNGFPWRQLLAVSIVRVSEPIAFTSLFPYVYFM
                     VKDFHIAPDDAQVSKYSGYLSSSFALCQVLSAYYWGSFSERHGRKLALILGLMGSIVS
                     LLILGFSRNFYQAMLARILMGLLNGNVGVIRTMIGEIATERRHQALAFSTMPLLFQLG
                     SIIGLMIGGYLVFRPTGSSGDYIPKWVPHCLKAVVRSYPYALPNLVVTSFLFIGLVNA
                     ALFLEETHPVKKLRRDYGVELGDYIRTKIFGLKPILRPWQRHEDTDSVGTTAEVEPTA
                     ESMTTEPTETSQLLQDDNSSCDSIPSIPHTLTRRQSIALIRTYSSYEPTDLNKSERIS
                     ADDGCSELSIWHHVFHTKVFYPISVNFIMSLHLTVYSEFLPVFLAYDLEKDPQNPHQL
                     ASKFPWKISGGISYLPQQTGTLLSTTGIFGVFVVIFIFPIVDRKFDCLKIFRSLVLLY
                     PIIYVMVPYVIFLQQENIPKWWTSVYLYFITGTKTLCGALTFPQIMLLIHNSSPLSCR
                     AVINGATISISAAARFIGPLIWGFLISWSEEKDVAWVSWWSLGLICMIALYQSYKIEP
                     LNDYEDITVEREDQTSRQFSHKLRRSSLNSLANRR"
     gene            complement(<744448..>746127)
                     /locus_tag="HG535_0B03790"
                     /db_xref="GeneID:59235000"
     mRNA            complement(<744448..>746127)
                     /locus_tag="HG535_0B03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287172.1"
                     /db_xref="GeneID:59235000"
     CDS             complement(744448..746127)
                     /locus_tag="HG535_0B03790"
                     /inference="similar to AA sequence:RefSeq:NP_010895.1"
                     /note="similar to Saccharomyces cerevisiae YEL020C;
                     ancestral locus Anc_1.450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143067.1"
                     /db_xref="GeneID:59235000"
                     /translation="MVTVSACEYFTNVLQGYNVDTIFGIVGIPIVELADVMINKGIKF
                     IGCRNEQAASYAASAYGYLTGRPGVLLVVGGPGLIHALAGVYNSMSNRWPLIVIAGSS
                     EDNHKGGFQELDQISLLNGYLKFTGRLQADKNVIDLITYNAVRHASLGASGVTYIDFP
                     GNIIGETVKVDKHLNSPSFDKIKCSPDPAVIQRVTDLILKNGDKKILVVMGKGAVENS
                     DEIRTLIDLFGLPFLPTPMAKGIVPDSHPLNVSSARSQVLRESDIVIVLGARLNWILH
                     FAEPPKWKADAIFIQVDENAEAIGQNNARGLQYGLFGDVGLTVDALTVSLKSGNFRYD
                     GLPPEWQRTIEKNQRKLLLKELQPPNSQKLNYNQVYHTLRPLIEDENSILVTEGANTM
                     DIARISFPTDYPKHRLDAGTNATMGIGLGYGIAAKVAHPHKDVILVQGDSAFGFSAME
                     LETSVRYNLGLVVIVMNNSGIYHGVAPELQPLRAPSTALSSECRYDLVGKGLGANGFL
                     VRNLDELEKAFKQALLSSRSTHRSSVINVIIEPGKQSKLSFGWQTKRTQHL"
     gene            complement(<746476..>747915)
                     /locus_tag="HG535_0B03800"
                     /db_xref="GeneID:59235001"
     mRNA            complement(<746476..>747915)
                     /locus_tag="HG535_0B03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287173.1"
                     /db_xref="GeneID:59235001"
     CDS             complement(746476..747915)
                     /locus_tag="HG535_0B03800"
                     /inference="similar to AA sequence:RefSeq:NP_009953.1"
                     /note="similar to Saccharomyces cerevisiae SLM5 (YCR024C);
                     ancestral locus Anc_1.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143068.1"
                     /db_xref="GeneID:59235001"
                     /translation="MLSFVRNYSILPKTIKSLSKEVSSSTNHVQHVKGWIKSVRLLKN
                     IAFIDLQDGTCTDALKVCIPIENSKETEYVRRLKTGQSVSITNAQCKMTPEREQSFEL
                     KISEPLKSISIIGNVTLDYPLQKKAHSLSFLRTQPTLKHRSSYLSSLMRFRSHLELSL
                     FNFFQEHDFTKVSPPVLTSSDCEGAGELFKVQSSSRDNDSYFGKPTYLTVSTQLHLEI
                     MAMALSRCYTLTPCFRAERSDTNRHLSEFWMLESEISFVDSVLELTRFVEEMLKNSIK
                     SCYEQKNELLPIITPDNSLTREEILKRWESLLHKAWATISYTEAIGILKKQHAMVPFP
                     NYEPKWGESLQTEHEKWLAGEHFESPVFVTDYPRDCKAFYMKANSEELPGNETVACFD
                     LLVPEMGEIVGGSMREDNYDSLSREMARRKMNSSGELTWYLKLRSEGTIPHGGFGLGL
                     ERLASYLFGSHNIKDAIPFHRSASGSIEL"
     gene            complement(<748026..>748817)
                     /locus_tag="HG535_0B03810"
                     /db_xref="GeneID:59235002"
     mRNA            complement(<748026..>748817)
                     /locus_tag="HG535_0B03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287174.1"
                     /db_xref="GeneID:59235002"
     CDS             complement(748026..748817)
                     /locus_tag="HG535_0B03810"
                     /inference="similar to AA sequence:RefSeq:NP_010896.3"
                     /note="similar to Saccharomyces cerevisiae MMS21
                     (YEL019C); ancestral locus Anc_1.448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143069.1"
                     /db_xref="GeneID:59235002"
                     /translation="MSSYPASLPLHPHARPLLHRIHTKDLSSVYENAKRQLLETFNLL
                     IEDPRTENVQDHIGLLLRNYQQLQKFEAQSKSLASSLQVSKNDYITESEKYEPISLDT
                     WDSHKNGSIPNPPTLFGIFESSSISNDEPSNQLSNDDGILKALPFIWRDPTCIIPDQN
                     SAAAEDDLQIEGGKIELICPITYKTFENPMISTKCSHVFDKEGLIIYFNDQDTRDCPQ
                     GGCSQKLKLTDFVPDLTMKLRCKIAKFQQHLQSSSSTNQQELDII"
     gene            <748960..>749751
                     /locus_tag="HG535_0B03820"
                     /db_xref="GeneID:59235003"
     mRNA            <748960..>749751
                     /locus_tag="HG535_0B03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287175.1"
                     /db_xref="GeneID:59235003"
     CDS             748960..749751
                     /locus_tag="HG535_0B03820"
                     /inference="similar to AA sequence:RefSeq:NP_010897.1"
                     /note="similar to Saccharomyces cerevisiae EAF5 (YEL018W);
                     ancestral locus Anc_1.447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143070.1"
                     /db_xref="GeneID:59235003"
                     /translation="MESQINELAVLQIIYTILLVQNNASNVNEYKVSLVKLTNEFQNN
                     ILINQIVNHDMKLDINDILAIIKRIFPNQRISLIDGQLSFHNLSLRELVADISTRVNR
                     FIKEQTEVVRRLEVEILEPSTTRAIQSPPPAQPQPQSQQSHQQRSVATVDPKKAKLLE
                     LYRDTVLNKLQNKSNQSNNKNLEWLYDTLSRNKDMATIVRDIIKIDSLRNDTPTSVHE
                     LQLTLQKSICDGLMCSYTGDNTWKSARQLQADFDDTVQFMRRALE"
     gene            complement(<750100..>750219)
                     /locus_tag="HG535_0B03830"
                     /db_xref="GeneID:59235004"
     mRNA            complement(<750100..>750219)
                     /locus_tag="HG535_0B03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287176.1"
                     /db_xref="GeneID:59235004"
     CDS             complement(750100..750219)
                     /locus_tag="HG535_0B03830"
                     /inference="similar to AA sequence:RefSeq:NP_010898.1"
                     /note="similar to Saccharomyces cerevisiae PMP1 (YCR024C-
                     A) and PMP2 (YEL017C-A); ancestral locus Anc_1.446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143071.1"
                     /db_xref="GeneID:59235004"
                     /translation="MLPGGVILVFILVGLACIAIISTILYRKWQAKQKGIQRF"
     gene            complement(<750715..>751281)
                     /locus_tag="HG535_0B03840"
                     /db_xref="GeneID:59235005"
     mRNA            complement(<750715..>751281)
                     /locus_tag="HG535_0B03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287177.1"
                     /db_xref="GeneID:59235005"
     CDS             complement(750715..751281)
                     /locus_tag="HG535_0B03840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143072.1"
                     /db_xref="GeneID:59235005"
                     /translation="MSINRPGAATRPQHALLPGPPSAALLPGSHRRFQCAVTRPADCA
                     SKTQRPVCPPPDAHWHLGGYIHFKVNRSPRQLLCPCRSLLAARHPRRPVQRLCPVSSN
                     FCVPLLSFVPICHRPPKREITEQKRTQRRNDVIKTDHRPPEKTAHITAILFSWSVQHG
                     QSDKENPQLFELARRLFFLILRSYLWFG"
     gene            <751499..>752419
                     /locus_tag="HG535_0B03850"
                     /db_xref="GeneID:59235006"
     mRNA            <751499..>752419
                     /locus_tag="HG535_0B03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287178.1"
                     /db_xref="GeneID:59235006"
     CDS             751499..752419
                     /locus_tag="HG535_0B03850"
                     /inference="similar to AA sequence:RefSeq:NP_010899.3"
                     /note="similar to Saccharomyces cerevisiae GTT3 (YEL017W);
                     ancestral locus Anc_1.445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143073.1"
                     /db_xref="GeneID:59235006"
                     /translation="MSSTFSRWRKVELLDLADKLHISGIPGSIRKNDLISVIESHLTR
                     LGEPLDVDVEYPELKSFYDSVVKSAEESSDVETESQIDDLENDVQLDIEAVLDSESAD
                     NFNDLNLTQESETQTESDAEGNETETEGEPFRFNFQNYLSDIKDNVMSANDAAQEFLS
                     TTKTIETLFGSIELYYITKPLIESQNRGLSFSTLVTWLSFSYFLPVIFGYYINFCRYD
                     FTIKVDPMIYYLTKGLLSLTISNLNVDSFAQSYATTVLNFNLISGLSLNLDLKFVNYI
                     QLGLQSWQNSLGQLPLIFSIVGIILTLYII"
     gene            complement(<752422..>754593)
                     /locus_tag="HG535_0B03860"
                     /db_xref="GeneID:59235007"
     mRNA            complement(<752422..>754593)
                     /locus_tag="HG535_0B03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287179.1"
                     /db_xref="GeneID:59235007"
     CDS             complement(752422..754593)
                     /locus_tag="HG535_0B03860"
                     /inference="similar to AA sequence:RefSeq:NP_009955.2"
                     /note="similar to Saccharomyces cerevisiae NPP1 (YCR026C)
                     and NPP2 (YEL016C); ancestral locus Anc_1.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143074.1"
                     /db_xref="GeneID:59235007"
                     /translation="MAGGGDEDDIESFDISDNQSVQRASLDDEDFLGSQVRNGPDNAG
                     GVWRKLKIWWYRRSLRLPNTGSFKWQERSIPLYDMDRTGIAVGGTEEEGATDMGRASW
                     SKRVPWRRVVSIILALSLVGIAASLLVSIAKTKSGQGLLSHRFDPYIKYNNGTHDFYP
                     LTVMVSLDGFHPSLISKKFTPFLYGLYTLSYAENITAAPYMLPCFPTQTFPNHWSIVT
                     GKYPRDHRIVSNFFYDSTVDKEFSPGNVDPLLWANSSEPIWQVLQTAFSHGGDDVDWP
                     FKVATHMWPGSDVNFSSVPSVPKERMPFYSDEFDLDESLDDKLGSIVKFMDMDSLDSR
                     PQFILSYVPQIDSFGHKHGYPINSQQEYHQLFAKELEKVDNFVKNLTESIETRNIQNF
                     TNLIIVSDHGMSNIEFPKNVLIWEDLIDDKFNTKRLQNVYNEGPMLAITTVERDDINE
                     LKRVVQNSLNELEIEIGSKFKIFLNGNFPDSFNFDNLDEPRIAPIWIIPEPGYAIMTK
                     KNFKNTGKRKDKKVIGSHGYNNSVPEMRSAFIGMGPFFTKGYVKPFENIEIFDMILDI
                     FGVSNNDRFGDNEDTFFYKNFLRNDTIETNVEYLKKIYGSDNAYNELWGDGTMMTETS
                     TSTSTSTTATTGASSSVRATQTSPSSSSSTTSMGLSTVISTNRISSASLTSSASLTSS
                     ASSASETKAGNWLEDILEDTKDIIDEIIDDIEDIVKGDNNT"
     gene            <755530..>756612
                     /locus_tag="HG535_0B03870"
                     /db_xref="GeneID:59235008"
     mRNA            <755530..>756612
                     /locus_tag="HG535_0B03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287180.1"
                     /db_xref="GeneID:59235008"
     CDS             755530..756612
                     /locus_tag="HG535_0B03870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143075.1"
                     /db_xref="GeneID:59235008"
                     /translation="MDGNSRSTATMTRENQQHIIEGPTSVGATDRSAFKASENELKAA
                     NEAAANNNGMVRGATPDTPTIPSIENIVPSHRLDGHVTIVTGGSGGLAHTLSQALAAQ
                     GSQIALVDLVVEKLATVEFELQEFIKVNKLKPVTISTWACDVSDAAQVEELVTAVPKE
                     HGGIIPDKLVHTAGYCQNIPATEYPAGRAEHLVKVNLMGSLYICQAMTRQLLSHRKRR
                     KSISHNINSVGEALPFFPNASFVLIGSMSGLIVNTPQPQVAYNMAKAGVIHLVKSLAC
                     EWARYGIRVNAISPGYIATPLTKQVISASPEGAALQEAWTSKVPMGRMAEPKEFIGAM
                     LYLLSRGASSYTTGENLVVDGGYTCW"
     gene            complement(<756781..>757422)
                     /locus_tag="HG535_0B03880"
                     /db_xref="GeneID:59235009"
     mRNA            complement(<756781..>757422)
                     /locus_tag="HG535_0B03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287181.1"
                     /db_xref="GeneID:59235009"
     CDS             complement(756781..757422)
                     /locus_tag="HG535_0B03880"
                     /inference="similar to AA sequence:RefSeq:NP_009956.2"
                     /note="similar to Saccharomyces cerevisiae RHB1 (YCR027C);
                     ancestral locus Anc_1.443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143076.1"
                     /db_xref="GeneID:59235009"
                     /translation="MEYNRELATPASSHSSQSARSFQRKIAILGARNVGKTTLTVRFV
                     ESHFVESYYPTIENEFTKIIRFKNHNYTLEILDTAGEDEFSLLNMKSLIGIKGIVLCY
                     SVTNRSSFELIPIIWDKLVDQLGRDNLPVVVVANKIDMRVDSTKDYVTREEGIKMIQS
                     IVSSDKKTRGGFIESSAKQDINVNEAIMMLLKKMESIESGSNSDSGDGKCVMM"
     gene            <757687..>759348
                     /locus_tag="HG535_0B03890"
                     /db_xref="GeneID:59235010"
     mRNA            <757687..>759348
                     /locus_tag="HG535_0B03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287182.1"
                     /db_xref="GeneID:59235010"
     CDS             757687..759348
                     /locus_tag="HG535_0B03890"
                     /inference="similar to AA sequence:RefSeq:NP_010901.1"
                     /note="similar to Saccharomyces cerevisiae EDC3 (YEL015W);
                     ancestral locus Anc_1.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143077.1"
                     /db_xref="GeneID:59235010"
                     /translation="MLQFIGFGVQVELRDGKLIQGKIAKATSKGLTLNDVKFGDGGTS
                     QAFKVRASRLKDLKVLTVPPSKKEFEAHKQEQQQGQQQEEQTKELDWQDDEVSKIKLQ
                     DDFDFEGNLRMFNKKDVFAELKQKDEIDPQNRLVSHNVRQTSAHSQTKLQIDEMVIPN
                     AKNDAWDQLSFEADNGDDEVDDEDDDDDEDEDDYDTNETTSAQYMPVTKSINITHLLH
                     KASSGNKEKDKDQEQMLSQLEHLLMNQSRSNSFSNVPSPSSKPALLKTKDTKRVVPMA
                     TPVQLLEIERVNSEQYGISSSIMLECFALNASFFLKQKLGGRARLRLNNSNPGPLVII
                     LASDSTRSGSRAMALGRHLCQSGHIRVIALLTCTSNDLQDSHVKEQLEIFKKCGGKTV
                     NSISALENAIEKLNSPVEMIIDAMQGFDCNLSDLYENSYLAEDYDNFASSVKGRITAM
                     ISWCNQTLNKNAKQIWSLDIPSGYDSGSGLRNFDLAVQATGILSTEWPLTSILNIKAD
                     LLLRLQECVVINMGTPQRIYSQRTSLRKFQACDLFATEGYQSLEL"
     gene            <759906..>761606
                     /locus_tag="HG535_0B03900"
                     /db_xref="GeneID:59235011"
     mRNA            <759906..>761606
                     /locus_tag="HG535_0B03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287183.1"
                     /db_xref="GeneID:59235011"
     CDS             759906..761606
                     /locus_tag="HG535_0B03900"
                     /inference="similar to AA sequence:RefSeq:NP_010903.3"
                     /note="similar to Saccharomyces cerevisiae VAC8 (YEL013W);
                     ancestral locus Anc_1.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143078.1"
                     /db_xref="GeneID:59235011"
                     /translation="MGACCCCLKDSSDEASILPIADNEREAVTLLLGYLEDKDRFDFY
                     SGKPLKALTTLVYSDNLNLQRSAALAFAEITEKFVRPVSRDVLEPILILLQSQDPQIQ
                     VAACAALGNLAVNNDNKLLIVDMGGLEPLISQMMGNNVEVQCNAVGCITNLATQDDNK
                     HKIATSGALVPLTRLAKSKHIRVQRNATGALLNMTHSEENRRELVNAGSVPVLVSLLS
                     SSDPDVQYYCTTALSNIAVDESNRKKLAQTEPRLVSKLVALMDSTSSRVKCQATLALR
                     NLASDTSYQLEIVRAGGLPHLVKLIQSNSMPLVLASVACIRNISIHPLNEGLIVDAGF
                     LKPLVKLLDYKESEEIQCHAVSTLRNLAASSERNRKEFFESGAVEKCKELALDSPVSV
                     QSEISACFAILALADVSKLDLLDSNILDALIPMTFSNNQEVSGNAAAALANLCSRINN
                     YSRIIDAWDQPKDGIRGFLIRFLHSGYATFEHIALWTILQLLESHNDKVAELVKSDSE
                     IVAAVKRMADVTFNRLQVLSSDSKMNDNELSNSRSSEQVEDASAELYNITQQILQFLN
                     "
     gene            complement(762072..762143)
                     /locus_tag="HG535_0Btrna2Q"
                     /db_xref="GeneID:59235337"
     tRNA            complement(762072..762143)
                     /locus_tag="HG535_0Btrna2Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:59235337"
     gene            complement(<762544..>762996)
                     /locus_tag="HG535_0B03910"
                     /db_xref="GeneID:59235012"
     mRNA            complement(<762544..>762996)
                     /locus_tag="HG535_0B03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287184.1"
                     /db_xref="GeneID:59235012"
     CDS             complement(762544..762996)
                     /locus_tag="HG535_0B03910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143079.1"
                     /db_xref="GeneID:59235012"
                     /translation="MTSVKPTYDSQRARWLRHIEFFYGLYFLIYVLETLTPKIRRWSL
                     LPGLPLLWIHIYVKNIDFRMPIFLWVIRFFYYGIILLDLSYSLLNRKATIILVKAVVT
                     FCAMVLVEVCDHRSRWITFKKQTDEEVDLEQFYSERQTHEATFENNMD"
     gene            765694..765765
                     /locus_tag="HG535_0Btrna4M"
                     /db_xref="GeneID:59235348"
     tRNA            765694..765765
                     /locus_tag="HG535_0Btrna4M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:59235348"
     gene            <765895..>766959
                     /locus_tag="HG535_0B03920"
                     /db_xref="GeneID:59235013"
     mRNA            <765895..>766959
                     /locus_tag="HG535_0B03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287185.1"
                     /db_xref="GeneID:59235013"
     CDS             765895..766959
                     /locus_tag="HG535_0B03920"
                     /inference="similar to AA sequence:RefSeq:NP_009946.1"
                     /note="similar to Saccharomyces cerevisiae MAK32
                     (YCR019W); ancestral locus Anc_1.440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143080.1"
                     /db_xref="GeneID:59235013"
                     /translation="MGAPLLTTNGMFIVDEIHIRDGSNYKDVPGGGGMFAMLGGCIAC
                     LDERLSLGLKWIIDCGYDFPLSLTETIQSWDTGAVFRHDTSRKTTKGWNYYRDNDFRD
                     FKYLTPKKQIDVKDWCEVFGKDQLREMKCLHLLCSSTRCIDMIKQLERIQCRNETYVW
                     EPIPDLCNQEYFNEIKQIVQKTNGPVIIFSPNAEEGARIFGDKEPLTLEACLKYIWKF
                     DTFIGDKNICVLRCGKLGSISLGAKDSVTGRRSVLHLPAYHYETPNSVVDPTGGGNSF
                     LGGFCVGYTITRDLYIANICANIAAGCVIEQIGIPTFDPIEKKWNGLTFEQRLEIYVK
                     TNKLNYDTERICKLLENYAL"
     gene            complement(<766947..>767594)
                     /locus_tag="HG535_0B03930"
                     /db_xref="GeneID:59235014"
     mRNA            complement(<766947..>767594)
                     /locus_tag="HG535_0B03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287186.1"
                     /db_xref="GeneID:59235014"
     CDS             complement(766947..767594)
                     /locus_tag="HG535_0B03930"
                     /inference="similar to AA sequence:RefSeq:NP_009947.1"
                     /note="similar to Saccharomyces cerevisiae PET18
                     (YCR020C); ancestral locus Anc_1.439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143081.1"
                     /db_xref="GeneID:59235014"
                     /translation="MQSTTDVLLAKNEALFKKATEHNLTKELCQGTLKDRTLYIYLAQ
                     DVQFFETGLRLLCKLTSLAPSTFSLITLAKKIGFFASDENTYFENALKLLGGSVAEEQ
                     REAFKAQKIGDIKSYVDFLEEMTNSTKYTYAELVTYLWVAEQVYWTWARDSPRKENLH
                     WKYQTWIDLHDGEHFQVWCEFLRDEVNKYSVAEVEEMFKKVLQMEYEFFETSYSA"
     gene            complement(<767850..>768119)
                     /locus_tag="HG535_0B03940"
                     /db_xref="GeneID:59235015"
     mRNA            complement(<767850..>768119)
                     /locus_tag="HG535_0B03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287187.1"
                     /db_xref="GeneID:59235015"
     CDS             complement(767850..768119)
                     /locus_tag="HG535_0B03940"
                     /inference="similar to AA sequence:RefSeq:NP_009948.1"
                     /note="similar to Saccharomyces cerevisiae MAK31 (YCR020C-
                     A); ancestral locus Anc_1.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143082.1"
                     /db_xref="GeneID:59235015"
                     /translation="MEKLQLYDFIGSTLYINLGNDRILRGTLMAVDAQLNLLLDHVRE
                     RNGGQSERLMGLVSVPEQTVKSIKITEQSLNHICQLKQDLLRQIV"
     gene            <768308..>768550
                     /locus_tag="HG535_0B03950"
                     /db_xref="GeneID:59235016"
     mRNA            <768308..>768550
                     /locus_tag="HG535_0B03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287188.1"
                     /db_xref="GeneID:59235016"
     CDS             768308..768550
                     /locus_tag="HG535_0B03950"
                     /inference="similar to AA sequence:RefSeq:NP_009949.1"
                     /note="similar to Saccharomyces cerevisiae HTL1 (YCR020W-
                     B); ancestral locus Anc_1.437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143083.1"
                     /db_xref="GeneID:59235016"
                     /translation="MSVSNTASTNYTNSVLERKYNHVTLKTLTAYELLQQRESMCELF
                     NLTDDSERHGTIVNIETQKRTLEEMKDRVKRLQEEQ"
     gene            <768848..>769528
                     /locus_tag="HG535_0B03960"
                     /db_xref="GeneID:59235017"
     mRNA            <768848..>769528
                     /locus_tag="HG535_0B03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287189.1"
                     /db_xref="GeneID:59235017"
     CDS             768848..769528
                     /locus_tag="HG535_0B03960"
                     /inference="similar to AA sequence:RefSeq:NP_010904.2"
                     /note="similar to Saccharomyces cerevisiae UBC8 (YEL012W);
                     ancestral locus Anc_1.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143084.1"
                     /db_xref="GeneID:59235017"
                     /translation="MQLPSHSSDDSKRRIETDVMKLLMSDHEVELVNNSMQEFHVKFH
                     GPKDTPYEGGAWRLHVELPDNYPYKSPSIGFVNKIFHPNIDVASGSICLDVINSTWSP
                     LYDLKNILEWMIPGLLKEPNGSDPLNNEAATLQLRDKVLYEDKIKEYIEKYASNEKYI
                     QFFGTDDEDDESDSDDEDQDQDSNDEDNDENDYDDDLDDDNIEDGNELSELEELSDIE
                     MSDEETQK"
     gene            <770032..>772143
                     /locus_tag="HG535_0B03970"
                     /db_xref="GeneID:59235018"
     mRNA            <770032..>772143
                     /locus_tag="HG535_0B03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287190.1"
                     /db_xref="GeneID:59235018"
     CDS             770032..772143
                     /locus_tag="HG535_0B03970"
                     /inference="similar to AA sequence:RefSeq:NP_010905.1"
                     /note="similar to Saccharomyces cerevisiae GLC3 (YEL011W);
                     ancestral locus Anc_1.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143085.1"
                     /db_xref="GeneID:59235018"
                     /translation="MSQIPENVRGAVEFDSWLTPFADVLSQRRFFADKWAYDITHATP
                     DGSFQSLSKFARDSYKSYGFHADPHTREIRYKEWAPNARQAFLIGEFNGWNETSHELK
                     FKDEFGNFHITISPTSSGEYAIPHDSKIKVMFVLADGSKIYRIPAWITRATQPDKETA
                     KMFGPVYEGRFWNPPNPYRFVHKRPEFNELEDSLRIYEAHIGISSPEPKIATYKEFTA
                     NVLPRIKYLGYDAIQLMAIMEHAYYASFGYQVTNFFAISSRFGTPEELKELIDTAHGM
                     GILVLLDVVHSHASKNVEDGLNKFDGSDHQYFHSLSSGRGEHPLWDSRLFNYGNFEVQ
                     RFLLSNLAFYIDIYQFDGFRFDGVTSMLYLHHGVGENGSFSGDYNEYLSPERSNVDHE
                     ALAYLMLANDLAHEMLPQSAITIAEDVSGYPTLCLPRKIGGTGFNYRLAMALPDMWIK
                     ILKETSDEDWDLGKIVHTLTNRRHGEKVVAYCESHDQALVGDKTLAFWLMDAAMYTNM
                     SILSSATPVIDRGVALHKMIRLLTDSLGGEAYLNFEGNEFGHPEWLDFPNANNNNSYH
                     YARRQFNLVDDELLRYKFLYEFDGAMQHCEKQYKWLNTPQAYVSLKNESDKIIAFERN
                     GLLFIFNFHPTKSFTDYRIGVESPGTYSIVLNTDHKVFGGHERIDESSKFVTTDLPWN
                     NRKNFIQVYIPSRVALVCALK"
     gene            complement(772304..772376)
                     /locus_tag="HG535_0Btrna6K"
                     /db_xref="GeneID:59235355"
     tRNA            complement(772304..772376)
                     /locus_tag="HG535_0Btrna6K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59235355"
     gene            <773577..>776591
                     /locus_tag="HG535_0B03980"
                     /db_xref="GeneID:59235019"
     mRNA            <773577..>776591
                     /locus_tag="HG535_0B03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287191.1"
                     /db_xref="GeneID:59235019"
     CDS             773577..776591
                     /locus_tag="HG535_0B03980"
                     /inference="similar to AA sequence:RefSeq:NP_009943.2"
                     /note="similar to Saccharomyces cerevisiae CWH43
                     (YCR017C); ancestral locus Anc_1.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143086.1"
                     /db_xref="GeneID:59235019"
                     /translation="MVALSGKIIPLAHTICASAAFLAALAAGYKLHFHKIVRNAHYGY
                     PDEWFPSVSATIGDRYPERSIFQILIALTSFPRFLLLLGHLYLNGSIACFVIGVIRTV
                     TCGGWVYITSTDDHDIHDIFMISYIVLTLPWDIMITRKTTQAKLAKGITASAFFATLV
                     PLLYWYYQHQVKHIAGAYSVYAYFEWSLIGLDIAFDALSYSDFENLIVDLSYEISDNG
                     TTFFKFDKLKSPKPQSISQGDTSLSCDEQEYVEDSEAEITADTTIADVIRSNDEEIEI
                     VFEKTEKITVLPDMSRAPSYDSFLYILTNTFNSFMFWTAMTSLTCSIWYFPLWYMGIS
                     GYEAAMLFFLGPIVLYIPFMPTVIYQYGVLLSGIIGIGSHFIGSPETRLIVQGVGTAI
                     TVATFVLNLKSLLNRQINGSFTITWVFGLVLSVAIKMGCYSNNPLWPIMNAENGGYNK
                     TGLVLVTFFGLLSPYVNSVHFMEAEDIEAEVTASEKKVSFLTRLFLSLGFGSLIFSIH
                     QLLTDASTVIYWSWEGWGENSQGPLSWPWSGLTCTVMLLAGISSLRFSNFSLFPAFLL
                     SVSTAILCIRDITQWTKYIFGGLLYATSIIWLLPSYFVALPLTGSLAVFVWGCLLYII
                     LVLAHVWVVAYAFVPGGWLLRERIEYVLAFSSFCIVLGALSIQFSGPFTKLRNFDRDL
                     SPKFYKIVSYFAFTIISLIGFFTYNLRPTGIPQPYHPDSKLITAGIWTIHFGLDNDMW
                     ASEDGMQFLIKEMELDVVGLLETDTQRITMGNRDFSSKLGHDLNMYSDFGPGPNKHTW
                     GCMLLSKFPIINSTHHLLPSPNGELAPAIYATLKTYDDILVDVFVFHGGQEEDDEDRR
                     LQSEKLAELMGNTDRPAILLSYLVTHPHRGYYNNFVSEASGMHDIDPADDDRWCEYIL
                     YKKLKRTGYARVTRGTITDTEMQIGKFQVLTEEQVTQYGDSLYEFNKSDYTPNGDLEF
                     PNKFNDEGERGHRYHVFDKPLYYEVPDGSVKK"
     gene            complement(<776635..>777123)
                     /locus_tag="HG535_0B03990"
                     /db_xref="GeneID:59235020"
     mRNA            complement(<776635..>777123)
                     /locus_tag="HG535_0B03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287192.1"
                     /db_xref="GeneID:59235020"
     CDS             complement(776635..777123)
                     /locus_tag="HG535_0B03990"
                     /inference="similar to AA sequence:RefSeq:NP_014401.1"
                     /note="similar to Saccharomyces cerevisiae YNR004W;
                     ancestral locus Anc_1.433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143087.1"
                     /db_xref="GeneID:59235020"
                     /translation="MTLEHTSEKLQSLLNSFTNTQVIPKSYSELLLPFYKSIALNEKL
                     RGIALSKCRQTFSQWENYDANLTDPEAVQRCLDLWLTIKGQDYNLTRSLPSSSNIIIE
                     DIEVTNYVGPQEFERLEFHPVTHELLSNPLSNLIVEEVEATQFVDMNKLTKNDNDISM
                     SN"
     gene            complement(<777448..>778281)
                     /locus_tag="HG535_0B04000"
                     /db_xref="GeneID:59235021"
     mRNA            complement(<777448..>778281)
                     /locus_tag="HG535_0B04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287193.1"
                     /db_xref="GeneID:59235021"
     CDS             complement(777448..778281)
                     /locus_tag="HG535_0B04000"
                     /inference="similar to AA sequence:RefSeq:NP_009942.2"
                     /note="similar to Saccharomyces cerevisiae YCR016W;
                     ancestral locus Anc_1.431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143088.1"
                     /db_xref="GeneID:59235021"
                     /translation="MTDQHIPAWQRIVIKQQQGKTEDNDFIDEDPLNVTTHLATGTLT
                     KKEKKRIINGRSLETSKKITKKKADANRRRDKLTKEEREDKRAKTVLKDQLRYLIEFH
                     LHKISDEIPKELHALPNVQSNYPKHMLDDRKKKDTVIEIWKFSKQKQNWLIKHFFTIS
                     EIPVEYDDILMNYFADLKSDFLRNSLTSKCWDKVKEWNDFAEKEEENIKHIVEADEKE
                     DSTEEQKNESDGKKEQKSDAEKEELIVPPNKDIVSRCVKLLGIWKLDEKDGKLIELKN
                     F"
     gene            complement(778982..779065)
                     /locus_tag="HG535_0Btrna2L"
                     /db_xref="GeneID:59235334"
     tRNA            complement(778982..779065)
                     /locus_tag="HG535_0Btrna2L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /db_xref="GeneID:59235334"
     gene            <781060..>782127
                     /locus_tag="HG535_0B04010"
                     /db_xref="GeneID:59235022"
     mRNA            <781060..>782127
                     /locus_tag="HG535_0B04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287194.1"
                     /db_xref="GeneID:59235022"
     CDS             781060..782127
                     /locus_tag="HG535_0B04010"
                     /inference="similar to AA sequence:RefSeq:NP_009941.2"
                     /note="similar to Saccharomyces cerevisiae YCR015C;
                     ancestral locus Anc_1.430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143089.1"
                     /db_xref="GeneID:59235022"
                     /translation="MDLLVFHCVPLGVDIEVCEYILTCVNFFRSIEVVSRDLSHEMKD
                     IIISDFDDTITSRDTISLLGELPYLINPLLNPKWSYFQDAYMSNYHKFQKNPQAFGAQ
                     FAGGRTFPLLCSSNETVTSANFYTLFATEIRYQQDRRLLEMTSTEEMTKRGLFKGITH
                     SDICRYVEYDPRIGASLLRNGFMEFISSLDSSEFYIISINWSKEFIHEVVGTSNIEAS
                     NIFCNELISQNGIYTGKFSNQILAGSDKLHELEKLLRKHQSDETDNRFWYIGDSETDL
                     LSILHPKVNGLLLLDPESEKKKLMKLATEVLGIPLNELKLYVQDKNVLHMKCFSKENG
                     NGFFLVKSWFAIQELVRPRST"
     gene            <782668..>784443
                     /locus_tag="HG535_0B04020"
                     /db_xref="GeneID:59235023"
     mRNA            <782668..>784443
                     /locus_tag="HG535_0B04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287195.1"
                     /db_xref="GeneID:59235023"
     CDS             782668..784443
                     /locus_tag="HG535_0B04020"
                     /inference="similar to AA sequence:RefSeq:NP_009940.2"
                     /note="similar to Saccharomyces cerevisiae POL4 (YCR014C);
                     ancestral locus Anc_1.429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143090.1"
                     /db_xref="GeneID:59235023"
                     /translation="MLLFKGTKFVILPNRNASSLKFLAELLVKEGGMLVNEEKEIDCD
                     TIVLINDSFITNTNTIMKNELFFKEFDLDPSTVWNNVNTYKLKCVRATCISEWLRKSS
                     FQINPELVLSVEDNLEDNSEDHSGVKFVTHSATPLYNYDLITAKLLKNSEKAARQIPE
                     VYSSSQNKSENSELAGKSMETEVSNKMGEEVKRTVDISQTTSVPKGNEKLIQALGRLA
                     KRYEMKGDQFRARGYKLARIGIEQYPFKIESGAQAQEEISNVGASIAKKIQTLLDNGS
                     LPGLQELFESEKRVDYFTRCHDIGIYTAKKWEIMGLKSFSEACTIFPEDFTRDWPILF
                     GWSYYEDWLKPIRRDECEKLASVVQQELHLIDPQMKVEILGSYHRGAEKCGDIDLFFY
                     KAGCDDISEIGRIMEDLSISLYRKGYVQCFLQLTRKIYKAFNKIIINRLEKCHLKTTP
                     TLQYTARDDNPRKFMLGVKLPDKEKRQFESITFVDNYKLKPEDMFMSLNSDRSPCRRM
                     DFFCCKYSELGAARLQWIGPKEFNRWIRLKAMHNGLKLTQHGLYDNHNVLLESFDEQR
                     IFQLLNEDYISPSERNHVVKKRRKV"
     gene            complement(<784572..>785930)
                     /locus_tag="HG535_0B04030"
                     /db_xref="GeneID:59235024"
     mRNA            complement(<784572..>785930)
                     /locus_tag="HG535_0B04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287196.1"
                     /db_xref="GeneID:59235024"
     CDS             complement(784572..785930)
                     /locus_tag="HG535_0B04030"
                     /inference="similar to AA sequence:RefSeq:NP_009938.2"
                     /note="similar to Saccharomyces cerevisiae PGK1 (YCR012W);
                     ancestral locus Anc_1.428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143091.1"
                     /db_xref="GeneID:59235024"
                     /translation="MQFTLATIFKRLLVKWIRLSLLCNKNIKRYKFFTPFTMSLSSKL
                     TVKDLQLKDKRVFIRVDFNVPLDGKTITSNQRIVAALPTIKYVLEHKPRYVVLASHLG
                     RPNGERVEKYSLKPVAAELQKLLGQDVTFLNDCVGPDVNKAVEASKPGSVILLENLRY
                     HIEEEGSKKVDGKKVKASPEDVAKFRKELKSLADVYINDAFGTAHRAHSSIVGFDLPE
                     RAAGFLLAKELAFFGKALENPTRPFLAILGGAKVADKIQLIDNLLDKVDSIIIGGGMA
                     FTFKKVLDNTEIGDSIFDKAGAEIVPKLIAKAKKNNVEIVLPVDWVIADAFSADANTK
                     IVSEKEGIPAGWQGLDSGPESRKLFADTVAKAKTIVWNGPPGVFEFAKFAAGTKALLD
                     EVVKSCQAGNTVIIGGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKVLPGVDFLS
                     AK"
     gene            <786890..>789997
                     /locus_tag="HG535_0B04040"
                     /db_xref="GeneID:59235025"
     mRNA            <786890..>789997
                     /locus_tag="HG535_0B04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287197.1"
                     /db_xref="GeneID:59235025"
     CDS             786890..789997
                     /locus_tag="HG535_0B04040"
                     /inference="similar to AA sequence:RefSeq:NP_009937.2"
                     /note="similar to Saccharomyces cerevisiae ADP1 (YCR011C);
                     ancestral locus Anc_1.427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143092.1"
                     /db_xref="GeneID:59235025"
                     /translation="MRLSLCFVFIWLYISFAHAGARTTLQLTYENNQSLGRVNEEDDQ
                     CPPCFNCMLPIFECKQYAVCNSNTGRCECIEGFSGDDCSIPVCGGLSDDNSRRPKRSN
                     VTNECDCSDGWGGINCNICQDDFVCDAFMPDIELKGTCNKNGMIANKLYQGCNVTNEK
                     IIQILKGQIPQVTFSCDKKKKNCNFQFWIDQLESFYCGLDNCSFEYDLKSNSSHYSCE
                     DVHCKCLPDTMLCGAHGSIDISDFLTETVKGPGDFVCDLNSKNCKFTEPSMNDLIQTF
                     FGDPYISLHCESGECLHYSEIPGYNPPSKDAAMSLQTKIILSLTSVALLGLITFVIFY
                     ISKSPLFKQGSIHLPLDSSDTQDQIAEDDNFLKSDTLATLSFENISYKISDPSINGSI
                     LKDINGLVKPGEIMALLGSSGAGKTSLLDILAMKKKSGKVTGDIKVNGISMGKTDYTK
                     LIGFVDQDDYLLPTLTVYETILNSALLRLPRALSFESKQARVYQVLEELRILEIKDRI
                     IGDEFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDANNANNVVECLVRLSKNF
                     NRTLVLSIHQPRSNIFQLFDKLVLLSNGEMVYSGDAIRVADFLRNNGYNCPSDYNIAD
                     YLIDITFENKYPKRKPLSSGNDLEAGGVFSRNADPHKHTSSGLMASLDEGRGSVGSFT
                     QREWEHFAEHRDEIRTLLNDSENPAEETLGSMNRKLLNHRFKEGPYFAELENDIKVLV
                     EARKGSNMVLPTTYKAASFLQQLSILCSRTFKNTYRNPRLLLANYLLTLILGSFLGIL
                     YYDVSNDISGFQNRMGLFFFLLTYLGFVTFPGLSSFALERIIFIKERSNNYYSPLAYY
                     MSKILSDVLPLRVVPPVILALVVYPLVGLNMGEQAFFKFIGVLILFNLSISLEVLTIG
                     IFFEDLNNSIIFSVLVLLGSLLFSGLFINTKDITNVAFKYLKNLSLFYYAYESLLINE
                     VKTLMLRETKYGLKIEVPGATILSTFGFIVKNFVFDVKILILFNIIFLILGYMALKII
                     VIEQK"
     gene            <790229..>791149
                     /locus_tag="HG535_0B04050"
                     /db_xref="GeneID:59235026"
     mRNA            <790229..>791149
                     /locus_tag="HG535_0B04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287198.1"
                     /db_xref="GeneID:59235026"
     CDS             790229..791149
                     /locus_tag="HG535_0B04050"
                     /inference="similar to AA sequence:RefSeq:NP_014400.1"
                     /note="similar to Saccharomyces cerevisiae RPC34
                     (YNR003C); ancestral locus Anc_1.426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143093.1"
                     /db_xref="GeneID:59235026"
                     /translation="MNSLLETSIELSDTAKELHLKMVRGGPGVMFTQIELQGFIGVSS
                     LGDLMLIIQELLDKNLIKLVKQNNELKFQAVGIDEAQKKSTMSAEESLVYSYIEASGR
                     EGIWTKTIKAKTNLHQHVVLKCLKSLESQRYVKSVKSVKFPTRKIYMLYNLQPSIDVT
                     GGPWFTDSELDVEFINSLLTIVWRFVSEKTFPDGFKNFSGSNIEKLYSPDVKNYSTTQ
                     DILDFIIGAQVANVELTTTNIRSLCDVLVYDDKLEKVHHDCYKVTLQSVLQMTQTASK
                     DAEFCIFDYYNSIAPSQNDKDAVYFDEWPL"
     misc_feature    792112..792489
                     /note="pseudogene similar to Saccharomyces cerevisiae ADY2
                     (YCR010C) and ATO2 (YNR002C); ancestral locus Anc_1.425"
     misc_feature    794016..794208
                     /note="pseudogene similar to Saccharomyces cerevisiae ADY2
                     (YCR010C) and ATO2 (YNR002C); ancestral locus Anc_1.425"
     gene            <795901..>796698
                     /locus_tag="HG535_0B04080"
                     /db_xref="GeneID:59235027"
     mRNA            <795901..>796698
                     /locus_tag="HG535_0B04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287199.1"
                     /db_xref="GeneID:59235027"
     CDS             795901..796698
                     /locus_tag="HG535_0B04080"
                     /inference="similar to AA sequence:RefSeq:NP_009935.1"
                     /note="similar to Saccharomyces cerevisiae RVS161
                     (YCR009C); ancestral locus Anc_1.424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143094.1"
                     /db_xref="GeneID:59235027"
                     /translation="MSWEGFKKAINRAGQSVIIKEVDKTIDKEYDIEERRYKVLQRAG
                     DALQKDAKGFLDSLRAVTASQVTVAEVISNLYDDSKYVSAGGYNVGNYYLQCVQDFDS
                     ETVKQLDGPFREAVLDPVSKFSAYFKEIDEAVKKREHKKRDYDAAKAKVRRLVDKPAK
                     DASKLPRAEKELALAKDIFDNLNDQLKQELPQLIALRVPYFDPSFEALVKIQLRFCTD
                     GYTRLAQIQQYLDQQSRDDYANGLLDDKINDLLHQMQSLDICALGFK"
     gene            <797285..>800977
                     /locus_tag="HG535_0B04090"
                     /db_xref="GeneID:59235028"
     mRNA            <797285..>800977
                     /locus_tag="HG535_0B04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287200.1"
                     /db_xref="GeneID:59235028"
     CDS             797285..800977
                     /locus_tag="HG535_0B04090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143095.1"
                     /db_xref="GeneID:59235028"
                     /translation="MHSNQLKSGSYKKNVFDLSLVQFEIWCTRAIKHPRISIILPLLI
                     TFLFSYPLLWILQEPWEAFSSAKHHNYVSKMEIINLREPALFESHVDLNLLQVWVKPL
                     MKTNILNKRMLLDSLAFQARLLKGVDDTAILSSPFHIWNHSLDALKKDPLPLRTISSN
                     ILKIPRYSLLGTWKINGVVSSASGFVISLLVNRENFANVSSLLNKNIIQLDEISNITG
                     YHILQDANQIQRRDVDEVLKYTMISSNMWDNGVFIILCLLLMIYFIFSIQRTKNSVKS
                     ASGIAIAIVVQVVLVVISSSTITDFLFKASDENLPFHLLYLPLGVILVNNRLRVIRDV
                     SGSTLHSYSLSERKGKSQKKISEAYDDLHERDFVCNIALSHYNSTKGVVLISLATIFA
                     VPFSRKASCFLLISLWIGHFLQCEFFTAVLSLDFRRFESDNILVVSKSKSEAYLDQDV
                     QPSPTSKNSLKKWCSYDQLCSVSCSIAFFLLYTVCFNRRFALTRTSTSIFYKIFTFKF
                     SSIIPSSRPSPNAVFDHRLAADLMSDPAFVGSLEGKIDLLLSFIQPVFVLKVDKGGNE
                     GNLSDIKVSQMFDNSSFTSAYKFEFTYALESILLVLLVISCTLLLLQKIMVKLDSING
                     LKTPELHQGIIPQDNEKRKEEKDHVTNQTEKLHNPENSVDQFHIKELYNQGHTLDIID
                     ITDSKSPFVVSVGLDYKVFVWSPLVEPIPPPASIPLHRKFWPLSKVIISNDGYHIAFF
                     SKHGNITAWSRRHMKFMWELQMKQNLSKNNAAPLEAFFRKITVPSFKRNRQQASGSKQ
                     PLKNDRVSLNTLDFITVTSVAGIDASYEQITNNPNDEDENEELVFVTAAGLIYSIDIS
                     GKIRLVNATSSDHPLISCKKLTSPRVNDRLVMCNKVGDLYVSTAVNNKWRPRKLSVNY
                     SNVIAPKEKFCKIVSNDASLPSNDTSEMPLETDYTIELVPFVGMLVRVIGTNAELIDA
                     QTGTLIRTISISHFKPNSLRVFHDAPTHCRFCGSASVASFSIAYTDSDHSRVVLHTFR
                     LESRTKTSICLRVERDAREIRCLGMESAVETIHYFYNVENWCVTESNMLIGIRRVPEN
                     IVNKIGTTSISINASDEPVSLQNRKHKNSDGSSMVNSASFKIHNIWEGWTMSANGTVK
                     LHKIPVGVNGLIVNKLGPLVSFGAKAMVVGFANIMSLFYLGHEDLLFTTENDGANSEE
                     SSLKFVNKRRDRFSHRKVPINYTNAC"
     gene            complement(<801303..>803210)
                     /locus_tag="HG535_0B04100"
                     /db_xref="GeneID:59235029"
     mRNA            complement(<801303..>803210)
                     /locus_tag="HG535_0B04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287201.1"
                     /db_xref="GeneID:59235029"
     CDS             complement(801303..803210)
                     /locus_tag="HG535_0B04100"
                     /inference="similar to AA sequence:RefSeq:NP_009934.1"
                     /note="similar to Saccharomyces cerevisiae SAT4 (YCR008W);
                     ancestral locus Anc_1.423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143096.1"
                     /db_xref="GeneID:59235029"
                     /translation="MLSASRNTPHSASNASTGGTGSSVNNSGGVSRKNTLSKMAKLFG
                     SNSKSVSQIDVRSGTDVSNSVSHSNLSSQSSAPSAKVQTSHNGSNKQKKSPLEALRPS
                     SPSPPPMLSSNIYHNSASSSHSNIQFGYKKQIVSPQSSSSSSITSSVSATSLSSNSPT
                     SGATSNSKIRSSSENNNNNGSSATASSIAIPATLTSAPSSGRFIVHADGTHEHHLKSA
                     KRQEKLSSMIKNMVGAQKIRGQAKSAVPDIMIDSKLNQSQVSQLSQNAPQQRMDPPTL
                     FAGLMKQMANQNAQNDLDKFDENEHVPISGASNEKRQFKNTTSDSSNNVTESFSVAPL
                     FKKKDSLCFAEKYGRCQEVLGKGAFGVVRICHKKSQNSANGLRSETLFAVKEFKRRAT
                     ESSEKYSTRLTSEFCISSSLRHTNIITTLDLFQDAKGDYCEVMEYCAGGDLFTLIIAA
                     GKLEYLEADCFFKQLIRGVVYMHDMGVCHRDLKPENLLLKGDGTLKIIDFGNSECFKM
                     AWEKDVHLSAGICGSSPYIAPEEYSHDEFDPRPVDIWACGVIYMAMRTGRQLWRVAQK
                     EDEFYAKYLKGRKEKGGYEPVENLKRARCRNVIYSMLDPVPHRRINAKQILNSEWGRE
                     IKCCNDGHALK"
     gene            complement(804087..804160)
                     /locus_tag="HG535_0Btrna1N"
                     /db_xref="GeneID:59235330"
     tRNA            complement(804087..804160)
                     /locus_tag="HG535_0Btrna1N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:59235330"
     gene            805806..805877
                     /locus_tag="HG535_0Btrna2P"
                     /db_xref="GeneID:59235336"
     tRNA            805806..805877
                     /locus_tag="HG535_0Btrna2P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCU"
                     /db_xref="GeneID:59235336"
     gene            <806848..>808293
                     /locus_tag="HG535_0B04110"
                     /db_xref="GeneID:59235030"
     mRNA            <806848..>808293
                     /locus_tag="HG535_0B04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287202.1"
                     /db_xref="GeneID:59235030"
     CDS             806848..808293
                     /locus_tag="HG535_0B04110"
                     /inference="similar to AA sequence:RefSeq:NP_015325.1"
                     /note="similar to Saccharomyces cerevisiae CIT1 (YNR001C);
                     ancestral locus Anc_1.422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143097.1"
                     /db_xref="GeneID:59235030"
                     /translation="MSTVLSASSRSLLGRKIFKNSFSSCDKIVLSTMESRRCYSNAEK
                     TLKERFAEIFPAKAEEIKELKKNYGKTVIDEVKLEQAYGGMRGIKGLVWEGSVLDPEE
                     GIRFRGKTIPEIRKDLPKASADSDEPLPEGLFWLLLTGEVPSEAQVKALSADLASRSE
                     LPEHVSNLLDNLPKDLHPMAQFSIAVTALESESKFAKAYAQGVAKKDYWNYTFEDSLD
                     LLGKLPVIASKIYRNMFKDGKLCEIDPNADYGKNLANLLGFSNKEFVELMRLYLTIHS
                     DHEGGNVSAHTTHLVGSALSSPYLSLAAGLNGLAGPLHGRANQEVLEWLFKLREEVNG
                     DYSKETIEKYLWETLNAGRVVPGYGHAVLRKTDPRYTAQREFALKHFPDYELFKLVST
                     IYEVAPKVLTKQGKTKNPWPNVDSHSGVLLQYYGLTEASFYTVLFGVARAIGVLPQLI
                     IDRAVGAPIERPKSFSTEKYIELVKGIKAKM"
     gene            <809104..>809958
                     /locus_tag="HG535_0B04120"
                     /db_xref="GeneID:59235031"
     mRNA            <809104..>809958
                     /locus_tag="HG535_0B04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287203.1"
                     /db_xref="GeneID:59235031"
     CDS             809104..809958
                     /locus_tag="HG535_0B04120"
                     /note="similar to Saccharomyces cerevisiae YCP4 (YCR004C);
                     ancestral locus Anc_1.421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143098.1"
                     /db_xref="GeneID:59235031"
                     /translation="MTAKIAIVISTLSPHLATLAEAEKKGIESAGGSADIYQLPETLT
                     SNDSEESLDEKEEAVQETKKDEESEKEEAVPETKKDEEPEKKEYPLADKDILLKYDFY
                     LFGIPTNLGSIPASWASFWDRTGGLWAKGAYDGKAAGFFVTSAVYGDGQEATIKSALN
                     YLVHHGIIYIPLGYKNAFAEIANIEEIHGGTAWGAGSLCGPDGSREPSELELKIAEIQ
                     GKSFYGSVKKFIKYAEKKAAEKKAAEKKATDNKKADAPKRATEKPAANAADKSKTSGL
                     KDACCTLM"
     gene            complement(<810344..>812044)
                     /locus_tag="HG535_0B04130"
                     /db_xref="GeneID:59235032"
     mRNA            complement(<810344..>812044)
                     /locus_tag="HG535_0B04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287204.1"
                     /db_xref="GeneID:59235032"
     CDS             complement(810344..812044)
                     /locus_tag="HG535_0B04130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143099.1"
                     /db_xref="GeneID:59235032"
                     /translation="MTGEFKRQSRLPAYRINVYAISPRHPLGVKPSGNVLLVTENLEE
                     TKKRRAMLLGDFAKFSEELLLEVLTYLNDQDLKNLSHCSRILYAYAYSEDLWRNMYMK
                     EYCRLGKAHSCGEIVPFASQKWRGSWRKSVLGIAHEALPQSNDLIFSDILYRPYQCSK
                     INYRMLFKDIIELEEKSYHCCHSLNKQFGIERFREEDILQEGFKTKYVEKPFILQSAT
                     VRDRWPNWDLDHLLKMFPEKCFRQEAVQWKLSKYIDYARNNMDESPLYLFDCNGSPIK
                     QIAEQYVSPSLFKSDFFKLFKKEGIKCRPDHRWLIAGPERSGSTFHKDPNQTSAWNTV
                     LSGMKLWIMLPPEVKPPGVSTDKDEDEVTAPVGISEWILSGFYNDSVQLALQGQCLIG
                     ITFPGECIYVPSGWWHSVINLTDTVALTENFVPEPVLGKVLYFLKNKKSQISGFHAKD
                     VVRSVRAFINESRDNVSTDDEDNYIQILQDFLDNSENYELDNEDCGVKSYSELELPIF
                     EFFIELIKKSPHRDALPAALKCLHEMEGRVNNIAKKSAMWQKLKGSDEMTFSFGLSVE
                     "
     gene            complement(<812376..>812939)
                     /locus_tag="HG535_0B04140"
                     /db_xref="GeneID:59235033"
     mRNA            complement(<812376..>812939)
                     /locus_tag="HG535_0B04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287205.1"
                     /db_xref="GeneID:59235033"
     CDS             complement(812376..812939)
                     /locus_tag="HG535_0B04140"
                     /inference="similar to AA sequence:RefSeq:NP_009929.1"
                     /note="similar to Saccharomyces cerevisiae MRPL32
                     (YCR003W); ancestral locus Anc_1.420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143100.1"
                     /db_xref="GeneID:59235033"
                     /translation="MSVAIIPRLLDRYYAATATTLLPWVTALGEVVNRLPKDYPVGLQ
                     QWLKKREEKRTSEQNMGSDTFWNNGILLAVPKKKVSHQKKRQKLYGPGSKQLKMIHHI
                     NTCPSCGHFKLANTLCTHCVGEVSRIWRSQTVKPSVEPLQEQQLSELDKRVIYPGKKD
                     TAYVEKLKDKESYLERRMRSLPVDKEE"
     gene            <813231..>814220
                     /locus_tag="HG535_0B04150"
                     /db_xref="GeneID:59235034"
     mRNA            <813231..>814220
                     /locus_tag="HG535_0B04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287206.1"
                     /db_xref="GeneID:59235034"
     CDS             813231..814220
                     /locus_tag="HG535_0B04150"
                     /inference="similar to AA sequence:RefSeq:NP_009928.1"
                     /note="similar to Saccharomyces cerevisiae CDC10
                     (YCR002C); ancestral locus Anc_1.419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143101.1"
                     /db_xref="GeneID:59235034"
                     /translation="MSHAPLTTAVEGIQPTSYVGFDTITSQIEHRLLKKGFQFNIMVV
                     GHSGLGKSTLLNTLFSSHLIDSSSGVDITTIPITKTTEIKVSSHSLLEDRVRLNINVI
                     DTPGFGDQINNDKVWEPIVKYIKEQYSQYLRKELTAQRDRRITDTRVHAVLYFIEPNG
                     KGLTDLDVATLKRLTQIANVIPVIGKADTLTIDERTSFREIIQNEFKKHDFHIYPYDT
                     DDLNEEELELNESIRSIIPFAVVGSEKEVEINGETFKGRKTRWGAINVEDINQCEFVY
                     LREFLIRTHLQDLIESTAFIHYEGFRARQLIALKENASSRTSAQMSSNGLSQR"
     gene            complement(<814714..>815868)
                     /locus_tag="HG535_0B04160"
                     /db_xref="GeneID:59235035"
     mRNA            complement(<814714..>815868)
                     /locus_tag="HG535_0B04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287207.1"
                     /db_xref="GeneID:59235035"
     CDS             complement(814714..815868)
                     /locus_tag="HG535_0B04160"
                     /inference="similar to AA sequence:RefSeq:NP_014397.1"
                     /note="similar to Saccharomyces cerevisiae DOM34 (YNL001W)
                     and YCL001W-B; ancestral locus Anc_1.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143102.1"
                     /db_xref="GeneID:59235035"
                     /translation="MKVLSVTKPAGSSDGAIISLLPQDKEDLFVLYQLIDKNDEVIFK
                     KMVTTSMDEAGKKKNTSLARLKLQILSNEFDMRNESLRYKGVTTVDDTGKSNVNVPVG
                     KFFSFTVNYSYPFTIIKHDHNRYTQKLLDEAVNTEAKADTAAVVLEEGIAHVCLLTPS
                     STLLKQKIEYSLPKKKRATDIIKFDEKTKKFYKAIYDAMKKYFDLTKLKMIILCSPGF
                     YAKTLFEKTMQFAEEEQNKQILSSKDHFLVAHCSTGYLQGITEVLKNPSYSSKLKDTK
                     YTQEALIMDEFLQHLNNDDDKAWYGENEVTTAANLGAINYLLITDSMLRSDDIDQRKR
                     CLALVDSIEQTGGKVAVFSSFHTSGEELNKLTGLACILKYPLPDLDETDE"
     gene            complement(<816211..>816777)
                     /locus_tag="HG535_0B04170"
                     /db_xref="GeneID:59235036"
     mRNA            complement(<816211..>816777)
                     /locus_tag="HG535_0B04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287208.1"
                     /db_xref="GeneID:59235036"
     CDS             complement(816211..816777)
                     /locus_tag="HG535_0B04170"
                     /inference="similar to AA sequence:RefSeq:NP_009925.1"
                     /note="similar to Saccharomyces cerevisiae RER1 (YCL001W);
                     ancestral locus Anc_1.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143103.1"
                     /db_xref="GeneID:59235036"
                     /translation="MNFEDGYDAQSGSQNVVLEQLHNAKRMYQFYLDKSVPHSRERWI
                     ALGVLIILFMLRITFSQGWYVVCYALGIYLLNQFLAFLTPKFDMSLQQDEENKELEAG
                     EKSDEFRPFIRKLPEFKFWYNAVRATFVSICLTIFSVFDIPVFWPILLMYFVILFLLT
                     MRRQIQHMMKYKYIPLDVGKRRYKGTAV"
     gene            <816974..>817831
                     /locus_tag="HG535_0B04180"
                     /db_xref="GeneID:59235037"
     mRNA            join(<816974..817018,817088..>817831)
                     /locus_tag="HG535_0B04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287209.1"
                     /db_xref="GeneID:59235037"
     CDS             join(816974..817018,817088..817831)
                     /locus_tag="HG535_0B04180"
                     /inference="similar to AA sequence:RefSeq:NP_009924.4"
                     /note="similar to Saccharomyces cerevisiae YCL002C;
                     ancestral locus Anc_1.416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143104.1"
                     /db_xref="GeneID:59235037"
                     /translation="MMYSSLLQFSSGLIDVVAISYQRRYNKLHRSIYGLSYDLYVLEL
                     AGSSLSVYSTLNYLWSPLVRVQLSRRYPLFYPLDGQGIPLSVLLLIKDVLIGVSCLAV
                     LRQLVIYRYTKHIHQSISKLCIVVLLAASTFGILTYAFSSAHLPNNNSGLFGVFFIEH
                     VNYTSVIGHILSALRFLPQLSLNWFGSSTSGLSSKFVLVSFVNKVLYLLIRNFVPHSA
                     EFYRIPFNTTPFSVLLLELFSIVGILYQAQLLYLNNKPHLPKGK"
     gene            complement(<817926..>819467)
                     /locus_tag="HG535_0B04190"
                     /db_xref="GeneID:59235038"
     mRNA            complement(<817926..>819467)
                     /locus_tag="HG535_0B04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287210.1"
                     /db_xref="GeneID:59235038"
     CDS             complement(817926..819467)
                     /locus_tag="HG535_0B04190"
                     /inference="similar to AA sequence:RefSeq:NP_009923.2"
                     /note="similar to Saccharomyces cerevisiae PGS1 (YCL004W);
                     ancestral locus Anc_1.415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143105.1"
                     /db_xref="GeneID:59235038"
                     /translation="MKSSTSAVLKFGGICRRTSVTASKVKLTRSMSSSTYLESVKQKL
                     SSLKTQFLFKKGEIDIIYSPSAFYDTLRKKISTARRKIFIASLYIGKSETDLIDCVRN
                     ALEKNSDLKVYFLIDGLRGTREAPLRCSTSLLTELLKDYESRVDIRLYRTPAIVGLKG
                     LIAPKRINEGLGLQHMKIYGFDDEVLLSGANLSSDYFSNRQDRYYLFRSASFSDYYFK
                     LHQTISKLSYKVKSANNAQKFHVSWPTSNNAIDPAENRKMFIKHASKVLNDFLNTSSF
                     DNNHHPLHHQDFPTVVYPVSQFTPLFPRGHDNSTEKQSILKLISSMSISSSRWVFTAG
                     YFNMLPEIKRSLILSSSKNGTVITASQFANGFFESKGISAHLPSAYLHLSKLFLEKVK
                     MYGKESVITLKEWKKGIVNKPGGWSYHAKGIWISEQESDSFLPVATCIGSSNYTKRAY
                     SLDLESNAIILTSDMELRGKMQKELDHIMKDTRSVNLEDFRNDTERHVSAGVKVATKI
                     LGTRL"
     gene            820535..820606
                     /locus_tag="HG535_0Btrna5R"
                     /db_xref="GeneID:59235354"
     tRNA            820535..820606
                     /locus_tag="HG535_0Btrna5R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:59235354"
     gene            complement(<820962..>821930)
                     /locus_tag="HG535_0B04200"
                     /db_xref="GeneID:59235039"
     mRNA            complement(<820962..>821930)
                     /locus_tag="HG535_0B04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287211.1"
                     /db_xref="GeneID:59235039"
     CDS             complement(820962..821930)
                     /locus_tag="HG535_0B04200"
                     /inference="similar to AA sequence:RefSeq:NP_009922.2"
                     /note="similar to Saccharomyces cerevisiae LDB16
                     (YCL005W); ancestral locus Anc_1.414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143106.1"
                     /db_xref="GeneID:59235039"
                     /translation="MEVMRSLLQITNDILYLFVSAAGFCIAVAINCAKTSFNFFHYVF
                     YQQVLLLLRTFMWLPISIAISVLLQLLFLPLNIPLKLFGGTSLQKIIIGHTNSKTNTY
                     VLITIFQYALVLLLFGVIIGLCCGAALGIIHFIVVIPDMKFDISFSFFKRISSYMHLP
                     KLDLGLVAHISKFLQPKVSGEDGGGLTTPPSTILRADELEEILAKTATTPYRVNSKKS
                     WQRRPSSSKESVMEVASKLPSDFFQKRGSISAERQTIYQTPSQSPSSKTVDDSSYASS
                     NLWDQFDELPSTLRTEGGISTLYSRRPMGSASREETLYAPKIKNRI"
     gene            complement(<822632..>823018)
                     /locus_tag="HG535_0B04210"
                     /db_xref="GeneID:59235040"
     mRNA            complement(join(<822632..822761,822874..822954,
                     823011..>823018))
                     /locus_tag="HG535_0B04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287212.1"
                     /db_xref="GeneID:59235040"
     CDS             complement(join(822632..822761,822874..822954,
                     823011..823018))
                     /locus_tag="HG535_0B04210"
                     /inference="similar to AA sequence:RefSeq:NP_958835.1"
                     /note="similar to Saccharomyces cerevisiae VMA9 (YCL005W-
                     A); ancestral locus Anc_1.413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143107.1"
                     /db_xref="GeneID:59235040"
                     /translation="MSFYTVLAAFLVVSLVSAVFWVAAPKKNQTVWRSTVILTLAMMF
                     LMWAITYLSQLHPLVAPRRSDLRPEFAE"
     gene            <823237..>824592
                     /locus_tag="HG535_0B04220"
                     /db_xref="GeneID:59235041"
     mRNA            join(<823237..823317,823396..>824592)
                     /locus_tag="HG535_0B04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287213.1"
                     /db_xref="GeneID:59235041"
     CDS             join(823237..823317,823396..824592)
                     /locus_tag="HG535_0B04220"
                     /inference="similar to AA sequence:RefSeq:NP_009919.3"
                     /note="similar to Saccharomyces cerevisiae STP22
                     (YCL008C); ancestral locus Anc_1.412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143108.1"
                     /db_xref="GeneID:59235041"
                     /translation="MSSLDRTSGIVSIPQPVVNWLFNVIQAIYHDARTTFHDSVAVLS
                     RFDQFRPRTRVFTNENGISELLLCIYGTLQDILPVPLLLWIPRSYPLVHPLIYLDLEQ
                     LEDSRPSVGDYVNPNGLISLPIFSRWSADTNNILQVIQEAAGICQYNCFLRPSGAPMQ
                     DSIDPRTLPPQGTSRSPDLPIKPPRPPSISLPLKSASTSTSDIPPVSSKVPLAESDYN
                     NTVSPPPVPPKPPTKALDVITNIDLLDTEIANYEDPLYHKALLKLQWKVNELCLEDEQ
                     LLQKNLYNRKDTVKSAVAQFERMLDYESLTHKSVSDSIRVRKTALDKETANLAQRSKD
                     IEEYERQNGCRADILSLIVAESVMINQLYELVAKDCAISDTIHALSRLLCSESIKLDS
                     FVKKTRELARQQFLTRMQIQKVGSIIDSGTTSH"
     gene            <825407..>826870
                     /locus_tag="HG535_0B04230"
                     /db_xref="GeneID:59235042"
     mRNA            <825407..>826870
                     /locus_tag="HG535_0B04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287214.1"
                     /db_xref="GeneID:59235042"
     CDS             825407..826870
                     /locus_tag="HG535_0B04230"
                     /inference="similar to AA sequence:RefSeq:NP_013276.1"
                     /note="similar to Saccharomyces cerevisiae CBF5 (YLR175W);
                     ancestral locus Anc_1.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143109.1"
                     /db_xref="GeneID:59235042"
                     /translation="MSKEYIIKPESSGPSADTSEWPLLLKNYDKLLVRSGHYTPIPVG
                     SSPLKRDLKSYISSGFINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLI
                     VCIDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRSLENLTGALFQRPPLISAVK
                     RQLRVRTIYESNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRV
                     RSGAMSENDNMVTLHDVLDAQFVYDNTRDESYLRKIIQPLESLLLGYKRIVVKDSAVN
                     AVCYGAKLMIPGLLRYEDGIELYDEVVLITTKGEAIAVAIAQMSTVDLATCDHGVVAK
                     VKRCIMERDLYPRRWGLGPIAQKKKQMKADGKLDKYGRVNENTPADWKKSYVPLDNSD
                     ASAEKSQEADTETSTPLISEVKKNDEEEKEEEKEEVKENESEEEKKDKKEKKDKKEKK
                     EKKEKKDKKEKKDKKEKKRKSDDLDEDSEKKKKKSKK"
     gene            complement(<827245..>828381)
                     /locus_tag="HG535_0B04240"
                     /db_xref="GeneID:59235043"
     mRNA            complement(<827245..>828381)
                     /locus_tag="HG535_0B04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287215.1"
                     /db_xref="GeneID:59235043"
     CDS             complement(827245..828381)
                     /locus_tag="HG535_0B04240"
                     /inference="similar to AA sequence:RefSeq:NP_014391.1"
                     /note="similar to Saccharomyces cerevisiae SIS1 (YNL007C);
                     ancestral locus Anc_1.398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143110.1"
                     /db_xref="GeneID:59235043"
                     /translation="MVKDTKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEK
                     FKEISEAFEILNDAQKREVYDQYGLEAARNGGPSFAGAGPGGASGGFPGGASGGFPGG
                     ASHSFTNEDAFNIFSQFFGGSSPFGGAAGGSGDDGFGFSSFPSGGSSARFSSGGFPGG
                     MPGGMPGGMPGGMPGGMHGGMPGGMPGGMPGGFRSGSASPPHAEEEVVSVNLPVSLED
                     LYSGKKKSFKIGRKGPNGTSEKTQIDIQLKPGWKAGTKITYKNEGDYNPRTGGRKTLQ
                     FILQEKTHPLFKRDGDNLIYTLPLTFKESLLGFTKTIQTIDGRTLPISRIQPIQPSET
                     STYPGQGMPVTKKPGQRGDLIVNYKVDYPISLNDAQKRAINDNF"
     gene            <828874..>829785
                     /locus_tag="HG535_0B04250"
                     /db_xref="GeneID:59235044"
     mRNA            <828874..>829785
                     /locus_tag="HG535_0B04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287216.1"
                     /db_xref="GeneID:59235044"
     CDS             828874..829785
                     /locus_tag="HG535_0B04250"
                     /inference="similar to AA sequence:RefSeq:NP_014392.3"
                     /note="similar to Saccharomyces cerevisiae LST8 (YNL006W);
                     ancestral locus Anc_1.399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143111.1"
                     /db_xref="GeneID:59235044"
                     /translation="MSVILVSAGYDHSIRFWEALTGVCSRTIQHSDSQVNRLEITNDK
                     KLLAVAGHQNVKLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVW
                     DVRAPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDT
                     PLQSLSLASDGSMLVSANSKGNCYVWEMPNRTDASNLKPVTKFRAHATYITRVLLSSD
                     VKHLATCSADHTARVWSVDKNFELETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRL
                     WDLSTREIVRQYGGHHKGAVCVALNDV"
     gene            complement(<830001..>832790)
                     /locus_tag="HG535_0B04260"
                     /db_xref="GeneID:59235045"
     mRNA            complement(<830001..>832790)
                     /locus_tag="HG535_0B04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287217.1"
                     /db_xref="GeneID:59235045"
     CDS             complement(830001..832790)
                     /locus_tag="HG535_0B04260"
                     /inference="similar to AA sequence:RefSeq:NP_013277.1"
                     /note="similar to Saccharomyces cerevisiae RFX1 (YLR176C);
                     ancestral locus Anc_1.400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143112.1"
                     /db_xref="GeneID:59235045"
                     /translation="MDKTSNMLHSTAAAQSPQQPRMNPNNQNDANDSGNGMNQPNKRS
                     KLNMISIPPIHQSSVYNLLQPPTSAMNTGGNAGVSASGERAANLPMAARSPIMPSSNA
                     DASQRGAVPSMVSFPEYTFPGHLSQDYLGANNNANANTNVVNAGGTQYTLPHFLPSPH
                     SQQPHPHSHAHASTPSANTASYSYHDSAQKAAVDNYYHKNFDDQRKNYFVYNNANDMH
                     QPPQQQQQQQYYWSQHQHPHPHQQPIMRPNIPPTPKFHTHPEETSLLSHEVNSSIDNA
                     VVKPSHIKHESRNTISFHSNNNNNNNNNNNNGRVIFDMKQESMERSKSQDTPIRRNTQ
                     ESMAKMIAEKHKDNPISEYATIVRQAELVVLNMDQQTHSKTTIQAAEQNRERERQVYA
                     LLWLMKNCVAQPDSYVPRGRIFAQYAASCAQSNLKPLSQASLGKLIRSVFPDLTTRRL
                     GMRGQSRYHYCGLKLLPNDTHENSNLNIHSDNNSNDSTTISLDKKDLSLKDTDNSNSN
                     NDNYSNNSKNDNDNKSDDSSNNNNNNTNTNTNDNNNNDHNSNSKSNNETNIVITRNSS
                     DNERSNGTDQNVSSNTKVNISRTPSPSLTKLKTSSKLSIGQSTNEYEIVFMSDLYKQV
                     FDNETPLSSDYSLKFPPIPTDRLPSGVDEVIAYALESLYHIHCNTIFEHIRFMKFDQL
                     PNCLTLFGSGSISPQMFSLFISEELYEWIYECDLITHVASIKYLSRLVMDYNNVSSTT
                     ISKLETFSNSYEEEVAKATIDLPVPMVNKKKEIVGDFSGLLRKFVKLLRYCCVLTEIL
                     PNFKSMKRDWENYSNLDEVLDIVKRDGYGGMIEMFRTFMTKHVTGFLNELANGEVHLE
                     IFVKNYCELLTAVKGMPAYKMVDGIAMYSRAFMTDISLVMKQNGVPWYFLDMLSSLLV
                     AYCFEINRFIFRVSC"
     gene            <834706..>835713
                     /locus_tag="HG535_0B04270"
                     /db_xref="GeneID:59235046"
     mRNA            <834706..>835713
                     /locus_tag="HG535_0B04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287218.1"
                     /db_xref="GeneID:59235046"
     CDS             834706..835713
                     /locus_tag="HG535_0B04270"
                     /inference="similar to AA sequence:RefSeq:NP_014396.3"
                     /note="similar to Saccharomyces cerevisiae RLP7 (YNL002C);
                     ancestral locus Anc_1.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143113.1"
                     /db_xref="GeneID:59235046"
                     /translation="MSFTRKPSSEQPGRKPGHRSTMSSSNEPQVLNSNPEVLLRKRRN
                     ADRTRNDRQAEIQKRRETRSKQRKLNKKRFLRAESIVAKTLATDRENERIKRISKLEA
                     QKSKSQLDHLPSDKNFLLKITERGDYAEDDHDEDDDGLIKEKSVYNGEPTLLFVMRVK
                     TNGATSIPHRAFKILTLLRLVELNTGIFIKLTGKVYPLLKFIAPYIVIGKPSLSSIRA
                     LIQKRSRISYQKSEDEEPVEMPLNDNNIIEEKLGELGIICQEDIVHEISVLGDSFKKC
                     SNFLLPFKLNREISGFSAINKVRRIKQRENAKRTQKYMTNSSTAPIIEVDINSLIAKL
                     N"
     gene            <836096..>837193
                     /locus_tag="HG535_0B04280"
                     /db_xref="GeneID:59235047"
     mRNA            <836096..>837193
                     /locus_tag="HG535_0B04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287219.1"
                     /db_xref="GeneID:59235047"
     CDS             836096..837193
                     /locus_tag="HG535_0B04280"
                     /inference="similar to AA sequence:RefSeq:NP_009911.2"
                     /note="similar to Saccharomyces cerevisiae LEU2 (YCL018W);
                     ancestral locus Anc_1.402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143114.1"
                     /db_xref="GeneID:59235047"
                     /translation="MASVTKKIVVLPGDHVGQEIVLEAIKVLKAISEAHPNIKFDFEN
                     HLIGGAAIDATGVPLPDEALEASKKADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQ
                     LYANLRPCNFASDSLLELSPLKEKYAKGTDFVVVRELVGGIYFGERKEDNGDGVAWDS
                     EQYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTL
                     SVNHQLIDSAAMILIKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLP
                     DKNTAFGLYEPCHGSAPDLPKGKVNPIATILSAAMMLRLSLNMAEEAAAVEAAVKKVL
                     DSGIRTGDLGGSNSTSEVGDAVAKAVKEILK"
     gene            complement(<837363..>838865)
                     /locus_tag="HG535_0B04290"
                     /db_xref="GeneID:59235048"
     mRNA            complement(<837363..>838865)
                     /locus_tag="HG535_0B04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287220.1"
                     /db_xref="GeneID:59235048"
     CDS             complement(837363..838865)
                     /locus_tag="HG535_0B04290"
                     /inference="similar to AA sequence:RefSeq:NP_009912.2"
                     /note="similar to Saccharomyces cerevisiae NFS1 (YCL017C);
                     ancestral locus Anc_1.403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143115.1"
                     /db_xref="GeneID:59235048"
                     /translation="MTRSTSVELLSRLSRVCSLRTRSSAVTILASQLARSYSSAAAAA
                     VKLSDDVSLETHTDIQRAAREQAKTRAAASFTSPDAASSGTSALQHAYQENTGFGTRP
                     IYLDMQATTPTDPRVLDTMLKFYTGLYGNPHSNTHAYGWETNKEIENARDHIAKVINA
                     NSKEIIFTSGATESNNTVLKGVSRFYKKTKKHIITTRTEHKCVLEAARAMINEGFEVT
                     FLNVDSQGLISMKELEESIRPDTCLVSIMAVNNEIGVMQPLKEIGALCREKKVHFHTD
                     AAQAYGKIPIDVNEMNIDLLSISSHKIYGPKGIGALFVRRRPRVRLEPIISGGGQERG
                     LRSGTLAPALVTGFGEAARLINQEYSSDIAHVSRLSKKLVDGLLSIDHTSLNGSPDHR
                     YPGCINVSFAYVEGESLLMALRDIALSSGSACTSASLEPSYVLHALGKDDAMAHSSIR
                     FGIGRFSTEQEVDYVIKAISERVKFLRELSPLWEMVQEGIDLNSIEWSGH"
     gene            <839281..>840138
                     /locus_tag="HG535_0B04300"
                     /db_xref="GeneID:59235049"
     mRNA            <839281..>840138
                     /locus_tag="HG535_0B04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287221.1"
                     /db_xref="GeneID:59235049"
     CDS             839281..840138
                     /locus_tag="HG535_0B04300"
                     /inference="similar to AA sequence:RefSeq:NP_014395.3"
                     /note="similar to Saccharomyces cerevisiae PET8 (YNL003C);
                     ancestral locus Anc_1.404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143116.1"
                     /db_xref="GeneID:59235049"
                     /translation="MDSDGFLVSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFANG
                     GYHGVYRGLGSAVVASAPGASLFFVSYDFMKQELKPYFRRYLPNASEQFIETSVQMCA
                     STIGEISACMVRVPSEVVKQRTQTHKTNSSWQTLKNLLKNENGEGIRRNLYRGWSTTI
                     LREIPFTCIQFPIYEFLKKKWAQATGVTRVAPWQGAICGSFAGAVAAAVTTPLDVLKT
                     RLMLNHRSVPILKLAKTIYIEEGAKVYFSGIGPRTMWISAGGAIFLGVYETVHSLLTY
                     KSDLNDRLL"
     gene            complement(<840178..>841314)
                     /locus_tag="HG535_0B04310"
                     /db_xref="GeneID:59235050"
     mRNA            complement(<840178..>841314)
                     /locus_tag="HG535_0B04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287222.1"
                     /db_xref="GeneID:59235050"
     CDS             complement(840178..841314)
                     /locus_tag="HG535_0B04310"
                     /inference="similar to AA sequence:RefSeq:NP_009913.2"
                     /note="similar to Saccharomyces cerevisiae DCC1 (YCL016C);
                     ancestral locus Anc_1.405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143117.1"
                     /db_xref="GeneID:59235050"
                     /translation="MSANLYSKLIHDSSYKLVQLAPDLLETLENTSQSEIKFKAVNNE
                     KSDVVLCSKNKTWLIKEKHHSNTVMLLREFVATGQQTLDEKSLFGMPQPINDLLAFSR
                     TTSEYETRPAKGLLNIDHLPIYNGDVGFPTEPAKLKFKTLDDVLDNSPASELESFTRW
                     NLLGGCIVNGFPCLLSAEFLSNALHVTLMSVMAESLDLDSLTIKDTFEAVNKDMSEGS
                     NPYTKKVIETVLRKYGTKLDKGEKEDKENWKLDRQEISRWYGIRALRKYATKPSLPME
                     EFLVKWKSTFPPFSPFNIEMKMLGGWYFQPIARNIQYVSKDTLPTDIKERFKMLFRLQ
                     SQWDLENIIPFVDELNTKGLKPDIFVMKYARKKRVGKRYIVSSR"
     gene            <841563..>846305
                     /locus_tag="HG535_0B04320"
                     /db_xref="GeneID:59235051"
     mRNA            <841563..>846305
                     /locus_tag="HG535_0B04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287223.1"
                     /db_xref="GeneID:59235051"
     CDS             841563..846305
                     /locus_tag="HG535_0B04320"
                     /inference="similar to AA sequence:RefSeq:NP_009914.2"
                     /note="similar to Saccharomyces cerevisiae BUD3 (YCL014W);
                     ancestral locus Anc_1.406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143118.1"
                     /db_xref="GeneID:59235051"
                     /translation="MLERRENSLEMTAADLSSAYLHEVRHEMGHADPDAATDIILFGN
                     LLEHEVERRQWVKDRTPKEWIQQVFRDSAVFHGIDELIWGEFLVCIYKDPITNMISAL
                     FIDKLGVTHFNPVDITNKSQFYPAIENLTDNDKDSNVKKSIAVSLLRKYAQLSSKDVS
                     RLQPDGLRFNYDPTHAGDLASRCKLVESCAPETMGTRILSQGSLQRRCNKSILLDVIY
                     ERKESLTEINNKLVFHLGEQLEQLFNPLTEYSPEQTEYTYKPPDYDPMSHRTSSKVVS
                     IIDELLQLQTNFTFSLVEFLQGFLISLRIKVLNEQIKDLSTVKLNRLFPPTIDEVTRI
                     NCIFLDSLKAATPFGALEILKACSATIPYFYKAYTRHEAATKNFVKNFKLFLKSFEYC
                     IPRDNGYSNMKIESIINGPQEKLVKLKLIIDRLYRTEEWPPNEQEEAKSNFDNIALAI
                     DSFGKMKSPLSSYNTRVFTPSGKILTELAKGWPEELQYKWLKRRVVGVFDVVGNDENK
                     ERQVLVIFSDYIVFLEVVNGSQYYSGTNNNKPKIADILMNSLINEVPLPTRIPKLKVH
                     NYCYIDDIIVTELENQSLRFDAYRGVNSFSVTCRLSTKSASASTVAGLVTKAKILEKE
                     TAFHLFKANLEENEIYSTAHELEAYKNETLKSKFGLFLNMNPSRQVLAGSRSHVAIFA
                     SFISDMDASDVQLTILTSDGRENASVVSPEDMILRIFEVLKHEVPICYSSLYSPLLPA
                     LLKINEQIVHKVLYSADPSDKFTNNTEGDALTFTQDHEKKKSFGTITTFRSYTSDYKD
                     VESNQSRVSRSGTAKNETLGVEKSHKIEVKAPKAINSKNKGRINSKKRKSIIDVFKGL
                     FEIKRSGKKEADIAGTVKISKPIVKRGTNERLPKKKAASQEVKDPLKQREHKTGGDRI
                     TSVIKHKEFASNEGIDIASQNTSKNEPNEHIRNNILKEQKSFESISRDPAEKSSKDRS
                     IATAQDEDSTAQGPSGVAQATSLRESVHSILSQTLKLPETPESRKVGDCAAPNGVQIH
                     SAGQNGFYRGQSRQSQLFNDDLYGELAVEAAKEKSSDSSAETVSGHNTKEVDAQKNHP
                     DTTAPIQIIESPTIKQITPSEQIGSEKRISTVENFEVNISQYDGKETTEKNRIFPIIP
                     TLDPPKLGFERSTSFVELFRGMRLILDENDAQYNWKRLSSESSLNEKQAFIAPIQNAH
                     IFKTLAQDPDRRLGPPQEGNQIEMVKIPSSPTGKLSTEDSSGIPDLANDTSARKLNNS
                     NQSVVLQNIPGLPLDDSESKLNTQPKPSFLAAPNFKVLRTSPTRIVNKLTKLHEVNRD
                     SLNYDISLPLDLDMVSNKRWVELELPSQEDLQGDKFYTPAEQHNSEFPKEALEIDDHS
                     TASEFAKEANETSQETSIEDSSKLIDAEDLLEDMEFSSFHMTFDASVSKDDISNYTSS
                     PVQHDNNVNPQCPTTRHVRQEPVLYRLPKDIFSTSRTISQLNDGGIGERIGHGRNPSL
                     DDDPIWVSPSKIDFYNLSKDSEESTMANRKAAALLEYPYDNKTYEHHNEDTNSLRELS
                     YAYLASFVGSDQESERFDDKPVRLHFCD"
     gene            complement(<846366..>846847)
                     /locus_tag="HG535_0B04330"
                     /db_xref="GeneID:59235052"
     mRNA            complement(join(<846366..846676,846757..>846847))
                     /locus_tag="HG535_0B04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287224.1"
                     /db_xref="GeneID:59235052"
     CDS             complement(join(846366..846676,846757..846847))
                     /locus_tag="HG535_0B04330"
                     /inference="similar to AA sequence:RefSeq:NP_976246.1"
                     /note="similar to Saccharomyces cerevisiae YCL012C;
                     ancestral locus Anc_1.407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143119.1"
                     /db_xref="GeneID:59235052"
                     /translation="MSSLPLSKLTAFLFLICCLVAVVYYNKQKIVYKIREWYFRMKRS
                     FGYSINLNDSFVDDLESGLSSHNFDIISQNEEDSRSGLDELAKAEISKIMREDHLNFD
                     KARLLYIERKFHQHGIAADGTPTDPRAVMFN"
     gene            complement(<847114..>848768)
                     /locus_tag="HG535_0B04340"
                     /db_xref="GeneID:59235053"
     mRNA            complement(join(<847114..848373,848739..>848768))
                     /locus_tag="HG535_0B04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287225.1"
                     /db_xref="GeneID:59235053"
     CDS             complement(join(847114..848373,848739..848768))
                     /locus_tag="HG535_0B04340"
                     /inference="similar to AA sequence:RefSeq:NP_009916.1"
                     /note="similar to Saccharomyces cerevisiae GBP2 (YCL011C)
                     and HRB1 (YNL004W); ancestral locus Anc_1.408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143120.1"
                     /db_xref="GeneID:59235053"
                     /translation="MSELDRSGGYDDQRSRSRSPVHRHVSDERSYGGNQREYGYSRSR
                     GGYGGRYEGRRSDFGRGDFTSGRGRGRGRGGFRDDGRRGRFRAARGDYGPVLARELDS
                     TYDEKVNRNYGNSIFVGNLTYDCTPEDLKDHFSEIGEVVRADIITSRGHHRGMGTVEY
                     TNSEDVDEAIRKFDASYFMDRQVFVRQDNPPPESSRERLPVRQRSGRAARQPYPDQHQ
                     QPQATFEVFVANLPYSINWQALKDMFKECGRVIRADVEMDRNGYSRGFGTVIYGTLEE
                     MEEAIQRYNGYELEGRPLDVRQGRNIAGNERKEPFESSEAPVETEPAAVEFTTSTAPP
                     SGSEFTKGVTGSGERSSLIYCANLPFSTATSDLYDLFETIGKVINAELTLNADGSPTG
                     IAVVEYANIEDADVCIERLNNYNYGGCDLDISYAKRN"
     gene            complement(<848936..>849706)
                     /locus_tag="HG535_0B04350"
                     /db_xref="GeneID:59235054"
     mRNA            complement(<848936..>849706)
                     /locus_tag="HG535_0B04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287226.1"
                     /db_xref="GeneID:59235054"
     CDS             complement(848936..849706)
                     /locus_tag="HG535_0B04350"
                     /inference="similar to AA sequence:RefSeq:NP_009917.1"
                     /note="similar to Saccharomyces cerevisiae SGF29
                     (YCL010C); ancestral locus Anc_1.409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143121.1"
                     /db_xref="GeneID:59235054"
                     /translation="MDGQWDIVISSLQDIYNANEVLAFDDDVNSKRINFANLPEEQVQ
                     SHLTHFEEHLENVKRAQRLLDAVRSNLQAVIEHVSNKELAEIQVLEEADSSRSDNGEG
                     DYGKCYWVSQYNPSGPIRVGSEVAYKPRKGGEGEWFQCEVVRVSPDGMKFEVRDPEPD
                     ELGNTGKLFKCNWKDLIFIPPAHLTKPQVPNYPPGTKVLARYPETTTFYPAMVIGTKR
                     DGICKLRFDGEEEVDKETEVTRRLVLPYPSISSTPAKR"
     gene            <850069..>851193
                     /locus_tag="HG535_0B04360"
                     /db_xref="GeneID:59235055"
     mRNA            <850069..>851193
                     /locus_tag="HG535_0B04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287227.1"
                     /db_xref="GeneID:59235055"
     CDS             850069..851193
                     /locus_tag="HG535_0B04360"
                     /inference="similar to AA sequence:RefSeq:NP_014393.1"
                     /note="similar to Saccharomyces cerevisiae MRP7 (YNL005C);
                     ancestral locus Anc_1.410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143122.1"
                     /db_xref="GeneID:59235055"
                     /translation="MSISTLSALSSCIGSARRNACLILTQVRTATKRAAGSRTSMKDS
                     AGRRLGPKKYEGQQVKVGEIIMRQRGTKFFPGENVGIGKDHTIYAKEPGVVRYYLDPF
                     HPKRKFIGVSLSRELRLPLPHFEPRVRRFGRQVIKAASRAKQEDLVLPRKKNMVRDDI
                     IAQLDTRETRRKELAKEYITILRDNLKIDIKSDEIATSYLIRLRSCVKNGMTLEESQF
                     NAKYYLEYEARLQSKREKWEEQKSEDYLNQIKETIQLLNKSISFDNKLNLIRYISDEE
                     KKSMKDQFIEELNERASVIQTKKQKNDTRKLFSTASDFLSFSEEVRLRRKYLKPIQPE
                     NQFTVAEKPTKSGFVLRRFNYEKSRVEIIPRRKEAFLNKL"
     gene            complement(<851342..>852244)
                     /locus_tag="HG535_0B04370"
                     /db_xref="GeneID:59235056"
     mRNA            complement(<851342..>852244)
                     /locus_tag="HG535_0B04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287228.1"
                     /db_xref="GeneID:59235056"
     CDS             complement(851342..852244)
                     /locus_tag="HG535_0B04370"
                     /inference="similar to AA sequence:RefSeq:NP_009918.1"
                     /note="similar to Saccharomyces cerevisiae ILV6 (YCL009C);
                     ancestral locus Anc_1.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143123.1"
                     /db_xref="GeneID:59235056"
                     /translation="MIGSVCRRDLKRCLVRHGSSSTSALAYKQLHKNTIRPPLPTLET
                     PSWSANSAVSSILYETPAPSRQPKKQHVLNCLVQNEPGVLSRVTGTLAARGFNIDSLV
                     VCNTEVKDLSRMTMVLQGQDGVIEQARRQIEDLVPVYAVLDYSNSEIIKRELLLTRVS
                     LLGAEYFEDLLLHHHKSTVDVSNSGELVSEIREKQFHPTNLPMSEVLRLKHEHLNDIS
                     NLARNFGGKVVDISDSSCIVELSAKPSRISAFMKLIEPFGVLECARSGMMALPRIPIQ
                     NGAETEEDIEKVNEIVDVSQLPPG"
     gene            complement(<852751..>853989)
                     /locus_tag="HG535_0B04380"
                     /db_xref="GeneID:59235057"
     mRNA            complement(<852751..>853989)
                     /locus_tag="HG535_0B04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287229.1"
                     /db_xref="GeneID:59235057"
     CDS             complement(852751..853989)
                     /locus_tag="HG535_0B04380"
                     /inference="similar to AA sequence:RefSeq:NP_013275.1"
                     /note="similar to Saccharomyces cerevisiae IDP2 (YLR174W)
                     and IDP3 (YNL009W); ancestral locus Anc_1.396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143124.1"
                     /db_xref="GeneID:59235057"
                     /translation="MKKVQVLNPIVEMDGDEQTRIIWQLIKEKLIFPFLNADLKYFDL
                     SVTNRDDTDDKVTVESAEATLKYGVAVKCATITPDEARVEEFHLKKMWKSPNGTIRNI
                     LGGTVFREPIVIPRIPRLVPQWEKPIIIGRHAFGDQYKATDIVIPGEGELRLVYKSKD
                     GSHDVDLKVFDYPEKGGVALAMYNTTESIEGFAKASFELALERKLPLYSTTKNTILKK
                     YDGKFKDVFEGMYAAKYKDKFEKAGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDV
                     ESDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHFRQHQQGKETSTNSIASIF
                     AWSRGIIQRGKLDNTPDVVKFGELLERATIDTVQEDAIMTKDLALILGKTDRSSYVTT
                     EQFIESVEVRLLKQYAAAFR"
     gene            complement(<854662..>855390)
                     /locus_tag="HG535_0B04390"
                     /db_xref="GeneID:59235058"
     mRNA            complement(<854662..>855390)
                     /locus_tag="HG535_0B04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287230.1"
                     /db_xref="GeneID:59235058"
     CDS             complement(854662..855390)
                     /locus_tag="HG535_0B04390"
                     /inference="similar to AA sequence:RefSeq:NP_014388.3"
                     /note="similar to Saccharomyces cerevisiae YNL010W;
                     ancestral locus Anc_1.395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143125.1"
                     /db_xref="GeneID:59235058"
                     /translation="MVKAVIFTDFDGTVTVQDSNDYLTDNYGFGKEKRLKIFEGVLDG
                     SKTFRSAFWDMLESIPKPLPECIEILEKHIDLDPGFKTTFEWAQENDVPVVVVSSGMT
                     PIIKHLLTSLVGKDSIHKIDIISNEVKIDKDDKWSIVYRDDSSFGHDKSKSIDAYKAK
                     YEASLKEGEERPCYFYCGDGVSDLSAAKECDLLFAKKGKDLIKYCDKQNVPYHEFDSF
                     KDILRSMKQVLAGEKTVKELMDNK"
     gene            <855658..>857088
                     /locus_tag="HG535_0B04400"
                     /db_xref="GeneID:59235059"
     mRNA            <855658..>857088
                     /locus_tag="HG535_0B04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287231.1"
                     /db_xref="GeneID:59235059"
     CDS             855658..857088
                     /locus_tag="HG535_0B04400"
                     /inference="similar to AA sequence:RefSeq:NP_014387.1"
                     /note="similar to Saccharomyces cerevisiae YNL011C;
                     ancestral locus Anc_1.394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143126.1"
                     /db_xref="GeneID:59235059"
                     /translation="MNLVVFSGGTATNNLTPCFSELSIAKGCELSFILPISDNGGSTS
                     EILRVLGGPAIGDIRSRVVRLVTDDQVEELLSYRLPNDKSRAKQEWDEILEGNHPIWD
                     KTPMEVKEICRAFFIHVQSELLKRKRTSNPFRFEKASIGNFFLTGARLFLGSLDASVE
                     LMMRIGRCDPNVHVIPCINSNHTHHISALLSNGDIIAGQSQISHPSKPIAAAKARSGS
                     IPILSGKSGAIHLDIPEERSSYSFEASEDVYGKQEGEEEEEEEEREEEEDAEEEEEYA
                     NPIYILPELKNSQLHFDKLDVEEVLPAPIERLFYINPYGEEVKPSGNSRAIAKLKKSN
                     MVIYSIGSLFTSLLPIAILGNIAEAISSSKNIHKVLLINNKYDRETSWLNGLGYVQVF
                     IESMTRANRKYKEAREGIPGSSAHEKMCWKKFVTDIVYLTGSEVKINKIDFLKKGIKC
                     HEINSDKINNENLMEILKKIHITGSS"
     gene            complement(<857195..>857896)
                     /locus_tag="HG535_0B04410"
                     /db_xref="GeneID:59235060"
     mRNA            complement(<857195..>857896)
                     /locus_tag="HG535_0B04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287232.1"
                     /db_xref="GeneID:59235060"
     CDS             complement(857195..857896)
                     /locus_tag="HG535_0B04410"
                     /inference="similar to AA sequence:RefSeq:NP_013351.1"
                     /note="similar to Saccharomyces cerevisiae SSP120
                     (YLR250W); ancestral locus Anc_1.393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143127.1"
                     /db_xref="GeneID:59235060"
                     /translation="MKILQLISISYLAYVSYAAATPQIDEHINVEVEKLPEGLTWEQW
                     HMEHEHQLKKFTPDLFFSLHDTKNRGFLDRDDILSLYGLNRNEVVGKGDGMGQHDESE
                     LVDKEIAEKAVKLIMDIMEVDEDGKIMKQEYLDFVKRGGSFPDLGVGVGHHAGFESEY
                     EIHHWNKYHQESDPDVKVVHREDVEHELLHHEHEIEHEEDVQRDVSRATVITDDELES
                     RIAPKKIPMKYRNGL"
     gene            complement(<858032..>859990)
                     /locus_tag="HG535_0B04420"
                     /db_xref="GeneID:59235061"
     mRNA            complement(join(<858032..859816,859877..>859990))
                     /locus_tag="HG535_0B04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287233.1"
                     /db_xref="GeneID:59235061"
     CDS             complement(join(858032..859816,859877..859990))
                     /locus_tag="HG535_0B04420"
                     /inference="similar to AA sequence:RefSeq:NP_014386.2"
                     /note="similar to Saccharomyces cerevisiae SPO1 (YNL012W);
                     ancestral locus Anc_1.392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143128.1"
                     /db_xref="GeneID:59235061"
                     /translation="MPIAIVSFIFAQLICTSALRQYPYEVDCPKSNLVREANNNICLD
                     ESNYIENKMPYISSSLRRFLDGLEMVQCGDAVIRKIEERPPIMGLAISGGGYRSMLTS
                     SGFIKEMKKYGLFDCLSYISGLSGGSWVLMDLVIHDFDVDQILDSWDLNDPLLQGIPD
                     LDFKQKDLISEMDEQSLDELRRLSARDFTEIDALMQRNLDFFMNTRNHDKTDITGVCK
                     RDYNPFTRLRELLFPTDIDSVPNAKEELPPSSLTNLQRILNFYISLHLDVRPKRFRGF
                     RVSFTDYLGKAFIKRLKQNGMLQINTTSFSELMKHSPNFLNYRAPVPIFVANCKNKSL
                     KNIIFEFTPFEFGSWESIVRLFVKMPFLGSKFEKGVASKCFNGFDDIGFIAATSSSIF
                     NNVLIYIWELTAKSSKETIKAIRSILSVFGLKNIRIKTDEQLRSSVLEQLKTDYAVVH
                     PNPFFKFPGKKNAVTVDDFLYLVDGGEDGENIPLRPLTIPERKLDLIFVIDSSSDSHN
                     YATGIKLRNVLHQMQIGRKYLAPEEDISLQNPIALGCYEKDIPIIIYQVNSKHSYSSN
                     TSTFKITYNESEISGMLQNGRDIFSTDNNDYYKNCLGCLVLKRLFDELPNSELPIFCS
                     KCYRDFCR"
     gene            complement(<860278..>863412)
                     /locus_tag="HG535_0B04430"
                     /db_xref="GeneID:59235062"
     mRNA            complement(<860278..>863412)
                     /locus_tag="HG535_0B04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287234.1"
                     /db_xref="GeneID:59235062"
     CDS             complement(860278..863412)
                     /locus_tag="HG535_0B04430"
                     /inference="similar to AA sequence:RefSeq:NP_013350.1"
                     /note="similar to Saccharomyces cerevisiae YEF3 (YLR249W)
                     and HEF3 (YNL014W); ancestral locus Anc_1.391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143129.1"
                     /db_xref="GeneID:59235062"
                     /translation="MSDSEQSIKVLNELLEKLAIATPENRTDVAVEVATFVNGNIIEH
                     DAPEHFFNGLFKAIKDKKTAANALETVTHIASKSDLSPSVEPFIITAVPAICEQTANK
                     DQAIQAAASQALLALVNAINPVAVKALLPHLNTALSNTNKWQEKVVVLEAITALVDAA
                     KEQVALRMPELIPVLSEAMWDTKKEVKNAATATITKATETVDNKDIDRFIPKLIECIA
                     NPNEVPETVHLLGATTFVAEVTPATLSIMVPLLARGLAERETSIKRKAAVIIDNMCKL
                     VEDPQVVAPFLSKLLPGLKNNFATIADPEAREVTLRGLKTLRRVGNVGDDDTLPEVSH
                     AGDVETTLGVINELLKSESVAPRFKPVVEYVAAIAGDLIDERVIDQLAWFTHVTPYMT
                     IFLHERKAKEIIDEFRKRAVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAKILLNKTQ
                     LRLKRARRYGLCGPNGAGKSTLMRAVANGQVDGFPTQEECRTVYVEHDIDGTHAETSV
                     LDYVFSGDVGTKEAITEKLREFGFSDEMISMPIASLSGGWKMKLALARAVLRNADILL
                     LDEPTNHLDTVNVAWLVNYLNTCGITSIIVSHDSGFLDNVCQYIIHYEGLKLRKYKGN
                     LSEFVKKCPTAQSYYELGASDLEFKFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTSKP
                     QISDISFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTTGEVYTHENCRIAYIKQHA
                     FAHIESHLDKTPSEYIQWRFQTGEDRETMDRANRQINEDDAQAMNKIFKIEGTPRRIS
                     EIHARRKFKNTYEYECSFLLGENIGMKSERWVPMMSVDNAWLPRGELVESHSKLVAEV
                     DMKEALASGQFRPLTRKEIEEHCAMLGLESELVSHSRIRGLSGGQKVKLVLAAGTWQR
                     PHLIVLDEPTNYLDRDSLGALSKALKAFEGGVIIITHSAEFTKDLTEEVWAVNNGVMT
                     PSGHNWVSGQGAGPRIEKKEDEEDKFDAMGNKISGGKKKKKLSSAELRKKKKERMKKK
                     KELGDAYVSSDEEF"
     gene            complement(<863885..>864445)
                     /locus_tag="HG535_0B04440"
                     /db_xref="GeneID:59235063"
     mRNA            complement(<863885..>864445)
                     /locus_tag="HG535_0B04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287235.1"
                     /db_xref="GeneID:59235063"
     CDS             complement(863885..864445)
                     /locus_tag="HG535_0B04440"
                     /inference="similar to AA sequence:RefSeq:NP_012317.1"
                     /note="similar to Saccharomyces cerevisiae YJL218W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143130.1"
                     /db_xref="GeneID:59235063"
                     /translation="MSKSEKEKMLAGELYLAGGTELAADTKRISEWMDRFNSKHSRSQ
                     EEYQQLLAEGLGRVGANVHIRPPLYCDYGYNIEIGNNVFINFNTVMLDVVKIVIGDKT
                     QIGSGVQILTADHPRDPRQRHKGLEFGRPITIGSNVWIGSAAVILPGVTIGDSAVIGA
                     GSIVTRDVPAGATAFGNPARIRRKEY"
     gene            complement(<864973..>866796)
                     /locus_tag="HG535_0B04450"
                     /db_xref="GeneID:59235064"
     mRNA            complement(<864973..>866796)
                     /locus_tag="HG535_0B04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287236.1"
                     /db_xref="GeneID:59235064"
     CDS             complement(864973..866796)
                     /locus_tag="HG535_0B04450"
                     /inference="similar to AA sequence:RefSeq:NP_011357.1"
                     /note="similar to Saccharomyces cerevisiae RCK1 (YGL158W)
                     and RCK2 (YLR248W); ancestral locus Anc_1.390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143131.1"
                     /db_xref="GeneID:59235064"
                     /translation="MFKIKNIFGKKKDQLPDQVPLARQRQEEASSRKVGAVDLEQGQN
                     LYSDTKVYGGSGSETETDAFPSIPVDTLIAKARDIQRTASMSGTTKVSSQRSLSDDSN
                     NRFIASESFAISSEQIERVPLSDDIDEDEDYEDSSVTNESQMEEEEIPETTFPEQKEL
                     KGYFLINKIGEGAFSAVFRGIPDKNSSQSFLAKSFHEVAVKVILKKEVMETKGAQKHG
                     TKGATKEQVLKEVKIHRLVSSGEGSEKVVQFVDFQETEHYYYIIQEILSGGEIFGEIV
                     KYTYFSEDLSRHVIKQLALAVRHLHSMGVVHRDIKPENLLFEPISFIPSKTNKLRKSD
                     DPNTKVDEGEFKPAVGGGGIGVVKLADFGLSKQIYETNTKTPCGTVGYTAPEVVKDER
                     YSMKVDMWGVGCVLYTLLCGFPPFYDEKIDILTEKIARGEYTFLRPWWDEISSGAKNC
                     VRRLLEVDPHKRYSIDDLLNDEWLNSYDSIKINNDSKLHQKRKSRNHLYHKKKMALMQ
                     RDSSLLYSPAANAMRDAFDVSNAVQRIEGEKRENHTTNLSSLQEDEEDLLTSSNNNQK
                     YNINLEENMFQLSLNSSTILKRRNENQTIGTNRIAIPTLIE"
     gene            <871379..>875836
                     /locus_tag="HG535_0B04460"
                     /db_xref="GeneID:59235065"
     mRNA            <871379..>875836
                     /locus_tag="HG535_0B04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287237.1"
                     /db_xref="GeneID:59235065"
     CDS             871379..875836
                     /locus_tag="HG535_0B04460"
                     /inference="similar to AA sequence:RefSeq:NP_013348.1"
                     /note="similar to Saccharomyces cerevisiae YLR247C;
                     ancestral locus Anc_1.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143132.1"
                     /db_xref="GeneID:59235065"
                     /translation="MEGVSFIDISSERSDVEFYENGIMILSGGGPVKGGEVPQCRPTK
                     RLKIAKKQVPLVNVRVNSGSIEQQSFFNEVKVMLEYNQIEGHDILVVLWEGVRIFKIQ
                     LKLEERLRELFTIVHHKCLESQVLSVNNSVKNVKNKKNSHANNNTKRLISKLYKDVIS
                     SDIRLSYSDPHVWQITFDFSLLYIPQSINKFSKETCSFLDRMFSRGRCDTSHSNLENS
                     SPFIQQNFVKQTISYTKSSVDSKESTVTKVDGLKVHLLPFQSKSVSWMFDKERKCFPD
                     IDLNNALQALSFLNDYVSYGYEMISPTCFWNKFTNFILTLSDLKEIYNRFTSVQKQQN
                     AIGCRGLLSEEMGLGKTIEILALILKNKRSVCQDNTFIDNDGKTIYKTKTSLIICPNA
                     ILQQWINEIENHTTENLKIFHYKGFLHVKKYFNCENIQEIVKTLSNCDIIITSYNVVS
                     TEIHYAEYNASLRPRRKISPIKYDYSSPLSLMQFFRIILDEVQMLHSDSTKAAKCTSL
                     LHRVHTWGVSGTPIQLVRDYQTALSYLKISPFFELPEIISTINLNVIYKRNQLINGIA
                     FSLKELMNFFIERNLCIRHSKKDVFEQIQVPKQHNYIIPLEFAPVEWDNYLDLWNCFL
                     EASGYHPNGSGSTRLSSAQLNQWLTRLRYLCCHAVFPDQNYNQKNNQNSNINSGSNSL
                     LNIDDVLKLMTSEAIEKLDSLYRDNYQIQIKSAQAKMELQNKPMEAIGALNSIKQSLI
                     NDLKVKCNVDDPFNTNALSEDKNIPDATNQRLENNSRMRTRAYLDLLHQCYFFVATGY
                     YLMGSNRLEQLDHENEKLTLMKTDVKPKTYVEFFSEEDMKSIEENQQFEQQYYTYAEK
                     LRERILLGRVQKVEIIISETNVLFMDVNEVAESTHHSRELKIIQFHEEEDFSSNILVS
                     RCFKMLASLISSLNKQAHQFNTLFEELEQLLYKPIRKEYNEDNEEEKANEYATSIDDQ
                     DKMFAIFACLEQLLSNRDLILTSDEIVKNPKKALKPQPGQQFSEFHSKLISKLNVING
                     SPMKQVFDDLKNSRIVRNVSGTTGGAKNVDDFENYLLAYEDKMSDMTKENNVLRDSLK
                     KLNNIYNAKLEYYSHLQKISDSLVSLLHMETPARNLILKAVRDGTQNQKYLERIGTAE
                     SRVKYLNSLNALKEGIVMKKSFHCPICLGTIHMGAMIKCGHFFCRTCIGNWLKRHTTC
                     PMCKTSASLTEAYNFKFQNEDKDEFMKDKTLEKNVQKMANKNMEPTTNDSEQVFEEKY
                     SRYPRLKEVHQMRIKESFGAKIDFVIKLILFLKMKSEANNEDPPQIVLYSQSFDYLRV
                     ISKVLHIHDISQLTCWANIASIGETISKYKKDNTITCILLNVRALGAGLNLLNARHVF
                     LLDPIINQGDELQAMSRNNRIGQTQETYVWNFMIRNTVEENILKYKCVLESKKRLIEG
                     NKEIQQSMDDCIEADEDRKEFEMNESTGEQVAGKHLWHCFFQNTEQVTS"
     gene            <876380..>876742
                     /locus_tag="HG535_0B04470"
                     /db_xref="GeneID:59235066"
     mRNA            <876380..>876742
                     /locus_tag="HG535_0B04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287238.1"
                     /db_xref="GeneID:59235066"
     CDS             876380..876742
                     /locus_tag="HG535_0B04470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143133.1"
                     /db_xref="GeneID:59235066"
                     /translation="MLTLPVVLPIIIRANIRKMRSFSTGTNRLEEFRDWKNLTQNDKK
                     KFIQEYVDLYKETHPCSKSNVMYRSLAEGMDEYDDTPYVFGVVYNEIRAVAQGKSKDN
                     VSGQGIMGDPAFKRLLLK"
     gene            complement(<876779..>877276)
                     /locus_tag="HG535_0B04480"
                     /db_xref="GeneID:59235067"
     mRNA            complement(<876779..>877276)
                     /locus_tag="HG535_0B04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287239.1"
                     /db_xref="GeneID:59235067"
     CDS             complement(876779..877276)
                     /locus_tag="HG535_0B04480"
                     /inference="similar to AA sequence:RefSeq:NP_013271.1"
                     /note="similar to Saccharomyces cerevisiae APS1 (YLR170C);
                     ancestral locus Anc_1.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143134.1"
                     /db_xref="GeneID:59235067"
                     /translation="MEKPLRDIQMTHIKYLILASRQGKVRLTKWFSPYSPKEKQKIVK
                     ELTPMILARKAKMCNIVEYSDHKVVYRRYASLYFICGVMPDVDNELLTLEIIHRYVET
                     MDSYFGNVCELDIIFNFSKAYDILNEILMCDGSMAESSKADVLKHVMTMDSMEGNDNL
                     DRVLS"
     gene            complement(<877497..>878387)
                     /locus_tag="HG535_0B04490"
                     /db_xref="GeneID:59235068"
     mRNA            complement(<877497..>878387)
                     /locus_tag="HG535_0B04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287240.1"
                     /db_xref="GeneID:59235068"
     CDS             complement(877497..878387)
                     /locus_tag="HG535_0B04490"
                     /inference="similar to AA sequence:RefSeq:NP_013273.1"
                     /note="similar to Saccharomyces cerevisiae DPH5 (YLR172C);
                     ancestral locus Anc_1.387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143135.1"
                     /db_xref="GeneID:59235068"
                     /translation="MLYLIGLGLSYKSDITVRGLEAIKRCDRVYLEHYTSILMAASKE
                     ELEEFYGKPVILADRELVESCSEEIIRNSDKENVAFLVVGDPFGATTHTDLVLRAKKQ
                     NTPVEIIHNASVMNAVGSCGLQLYNFGQTISMVFFTDNWRPDSWYDKILENRKIGLHT
                     LVLLDIKVKEQSIENMARGRLIYEPPRYMSISECCEQLLEIEEKRNTQAYTADTPVVA
                     ISRLGSATQTFKSGTIEELATYDSGEPLHSLVILGRQCHELEIEYLLEFCDDRDRFKQ
                     DVLKDQQFFKPAPWVPPQEE"
     gene            <878782..>880575
                     /locus_tag="HG535_0B04500"
                     /db_xref="GeneID:59235069"
     mRNA            <878782..>880575
                     /locus_tag="HG535_0B04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287241.1"
                     /db_xref="GeneID:59235069"
     CDS             878782..880575
                     /locus_tag="HG535_0B04500"
                     /inference="similar to AA sequence:RefSeq:NP_013274.1"
                     /note="similar to Saccharomyces cerevisiae YLR173W;
                     ancestral locus Anc_1.386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143136.1"
                     /db_xref="GeneID:59235069"
                     /translation="MNDDLETQPLVQHQSNETATAPTEISEERHGRLPSGVKLSAISL
                     AIFALIIVVIAGIRLSHNLPSEQDIEDSVLSVSNWKVQKVHLDGWTNGHDLNNEGGKA
                     LQITMELDYWIDYDSWLQANDTELSHSEKKRYRFVSERLVRNACFAVNNLTTFDGEIN
                     NNNTVGSLSVHQPICIDLHNNISTRLNLTLYLEPNMDNIFRVLKKIWRHQYDELDLSS
                     VVDVTLSKQATFFAYQWGFPLARLRNLQVNWKSIIDWNDITPTLGQLRHHLNQLTIKR
                     LFVTDSVNGFRVHAEAELVEKIELLEWIELPQDSIFPLINWELKIQDCNNEYSIELPN
                     AFCFTDAFKISDAPKLSAYSDIEGPLPDSLLSDVCWSDEENAITPMTNLLNKIFNGTE
                     LITMEVKGHTTTMGNDDLKSIIPLDILDKALSKISFFPIGTNFTLNSDTLIQDVTING
                     LKIKWVTSFLGEKRLSIAGKVVALISLPFYETNKNRLMIQHIKGDSRLYHDGKHFVTI
                     PMKYWSRASSRIFRDEEIGTAVIEVSFDIKDDEVQVVNSVELTRVLNEILLKGKAIVD
                     LSSNLDVLLTSPLGEMALMGLKGKGKALVRS"
     gene            complement(<881173..>883125)
                     /locus_tag="HG535_0B04510"
                     /db_xref="GeneID:59235070"
     mRNA            complement(<881173..>883125)
                     /locus_tag="HG535_0B04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287242.1"
                     /db_xref="GeneID:59235070"
     CDS             complement(881173..883125)
                     /locus_tag="HG535_0B04510"
                     /inference="similar to AA sequence:RefSeq:NP_009502.1"
                     /note="similar to Saccharomyces cerevisiae PIN4 (YBL051C);
                     ancestral locus Anc_7.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143137.1"
                     /db_xref="GeneID:59235070"
                     /translation="MSEVDATPAPTGVGTTFPAALDEGSLYKNETEDAFADDEARQHE
                     DQQQQSADDGENGSGNDDDVIPTAIVIKNIPFAIKKEQLLDVIAKMSLPLPYAFNYHF
                     DNGVFRGLAFANFTNTNETTQVLNSLNGKEIGGRRLRVEYKKMLPQAERERIEREKRE
                     KRGQLEEQHKSLSNLSLHSLNKSSTNANPSNTQLFSTFFGDAAGSSNQTNNKNTGGLL
                     SAQNTASSFFQTQLSQSHQQLQLSSQQIQPSNSQQSQQIQQQQSAMPAGVLSNERYYA
                     PLPSSSTLPLPPQQLDFNDPDTLEIYSQLLLFKDRERFYYELAYPLGLSAGHKRIINV
                     LCSFLGLVEVYDPTFIVIRRKLLDHATLQSHLQQQDQNSMMNPLQPSSTGGSMNRSHS
                     YTSLLQAHAAASVAAASGNPVNNAISHPNLGASGSASTTPKLSSQAKMVPQTSSQNGA
                     TPLVQSSSNSPSQLMQPIALHNTEIQSNQQQQQSFLRQQAALTPSSRIPSGYTTNHSQ
                     INTVNPLLRNNGISPPTTNVQPNTPQHRVPTSFFASSSTNLQMTEVQQQQQQQQQQQP
                     KGQLLPQHTNGSMHSNFSIQSIHDDSLSGVNNNDMMYTSLGHTGFGNGLEEGLSRSLS
                     GLDLQGNAAGSNTLSNGNANARKTLW"
     gene            <883593..>883865
                     /locus_tag="HG535_0B04520"
                     /db_xref="GeneID:59235071"
     mRNA            <883593..>883865
                     /locus_tag="HG535_0B04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287243.1"
                     /db_xref="GeneID:59235071"
     CDS             883593..883865
                     /locus_tag="HG535_0B04520"
                     /inference="similar to AA sequence:RefSeq:NP_011011.3"
                     /note="similar to Saccharomyces cerevisiae SBH2 (YER019C-
                     A) and SBH1 (YER087C-B); ancestral locus Anc_7.369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143138.1"
                     /db_xref="GeneID:59235071"
                     /translation="MSTTATPPGGQRTLQKRRQAQNAKDKQLKQTPASSRQAGHGGSS
                     SSILKIYTDEANGLRVDPLVVLFLAVGFIFSVVALHVIAKVTGKIF"
     gene            complement(<884007..>885725)
                     /locus_tag="HG535_0B04530"
                     /db_xref="GeneID:59235072"
     mRNA            complement(<884007..>885725)
                     /locus_tag="HG535_0B04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287244.1"
                     /db_xref="GeneID:59235072"
     CDS             complement(884007..885725)
                     /locus_tag="HG535_0B04530"
                     /inference="similar to AA sequence:RefSeq:NP_011010.1"
                     /note="similar to Saccharomyces cerevisiae YER087W;
                     ancestral locus Anc_7.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143139.1"
                     /db_xref="GeneID:59235072"
                     /translation="MFKISIIRRSYHLFQPNALTKETLKSHPTHDLLQTLGFVRQSQS
                     GLVQWLPLGLRSLRKVEDIIRYRMNTDGDALEVSLSSLSPKLLWEQTGRWSNKELFKL
                     KDAKKAEHCLTATCEEDITSLMGNFITSHKDMPVLVYQISRKYRDELRPRGGLLRGRE
                     FLMKDAYSFVSSKEEAIKMFERVNDVYDKIFGDLRIPFVSAWADSGSIGGDLSKEYHY
                     MHESGEDTLLKCSNCGAISNVEKAESYPIKEGEYFGDVSVKYSLSADRKTLLCFYYPR
                     NRELNWNLALEAVDHDMDSVFNMKRNEEILQIFKQENEDIMLTRVLRIMDCRLNSRSN
                     FPDFPLNQYLKNNFGQIDDVSIVQAQENEICGSCHEGHLSGMKTIEVGHTFYLGTKYS
                     EPLHATFVGKDNQRGIPIEMGCYGIGVSRLIGAIGELTRDDNGFKWPTSVAPYLLSLC
                     ISPHMKNEQEIISLLQCQFKGTNLSGEIMHSFSKKLGLGARIRLSHAIGIPLCLIVGP
                     KNWPLVEIELRGALIGTDWEKEFLDLKEKYRWEIVKSTSGYVEKHIVPVEYAKDVVKI
                     LLKYLS"
     gene            complement(<885950..>887656)
                     /locus_tag="HG535_0B04540"
                     /db_xref="GeneID:59235073"
     mRNA            complement(<885950..>887656)
                     /locus_tag="HG535_0B04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287245.1"
                     /db_xref="GeneID:59235073"
     CDS             complement(885950..887656)
                     /locus_tag="HG535_0B04540"
                     /inference="similar to AA sequence:RefSeq:NP_011009.1"
                     /note="similar to Saccharomyces cerevisiae ILV1 (YER086W);
                     ancestral locus Anc_7.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143140.1"
                     /db_xref="GeneID:59235073"
                     /translation="MLTFPVRSIVGRRSGNALVLQLRAKFHQQHLSPSLVKLHSELKL
                     DELQPDNTPDYVRLVLRSSVYDVIDESPISHAVGLSSRLNSSVQLKREDLLPVFSFKL
                     RGAYNMIAKLEDGQRNQGVIACSAGNHAQGVAFAAKHMNIPATIVMPVSTPSIKYQNV
                     SRLGSQVVLYGNDFDEAKAECTRLSEERGLTNIPPFDHPYVIAGQGTVAMEILRQVHN
                     SNKIGAVFVPCGGGGLISGVGSYLKRIAPHIKIIGVETHDSPTLYTCLKHGKRVPLTT
                     VGTFADGTSVRIIGEETFRVCQEVVDEVVLVNTDEICAAVKDVFEDTRSIVEPSGALS
                     VAGMKKYITQLHPEIDHSKHTYVPILSGANMNFDRLRFVSERAVLGEGKEVFMLVTIP
                     DVPGSFKKLQKVIHPRSVTEFSYRYNEHRHESTSEVPKAYIYTSFNVVDREKEIKQVM
                     QQIHALGFEAVDISDNEMAKSHGRYLVGGASKVPNERVISFEFPERPGALTNFLLGLS
                     DSWNLTLFHYRNHGADIGKVLAGISVPPRENLTFQKFLDDIGYQYQDETDNMVYQKFL
                     KY"
     gene            <889494..>890969
                     /locus_tag="HG535_0B04550"
                     /db_xref="GeneID:59235074"
     mRNA            <889494..>890969
                     /locus_tag="HG535_0B04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287246.1"
                     /db_xref="GeneID:59235074"
     CDS             889494..890969
                     /locus_tag="HG535_0B04550"
                     /inference="similar to AA sequence:RefSeq:NP_013291.1"
                     /note="similar to Saccharomyces cerevisiae MMR1 (YLR190W);
                     ancestral locus Anc_7.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143141.1"
                     /db_xref="GeneID:59235074"
                     /translation="MNTPPMRAEQLSPQMSPIAFSLDDPKCTGASSFQHLLASPTKFK
                     LDSGSNDPAANSSASNIYRTSLSKLSELSRTGRSRQRSDSDTLRSVSPIRFQLFNNAP
                     KMLRQEYMTQQPSPSPLLSTLMKSTVTQSNTSNGSTRNNQSTYCKMGIRETLEQIQRE
                     QKELLQKQSQLKKEEPNKEKLRAKPSKVRDSVTKETPQPSAKNEKSKINGSQVDIGEV
                     SKAQTCLPNMKDSADVRVNSKSSTISSNMGVDLSDISKELDIELLASNKSVFASFEDS
                     KSNRYSFISSSSTDYDGGDWGNNQPEPRNIHLEETARLDNRIKQLEIEIDNLKLQNVK
                     LIESITTTRTVEDKYMLEALRETRSSKKMVQQGMEKKVKQLEKKVESYRKAIQTCEDG
                     LPELPTITGSGIIDYKGVTTKRRITRISSGELRKIDEQTDSSGTSSDDEKDEQFIKHE
                     KYDDSTLTKELFRQQCSDQSSMRRKQGLQLNIQLQMQKTKR"
     gene            <891516..>892661
                     /locus_tag="HG535_0B04560"
                     /db_xref="GeneID:59235075"
     mRNA            <891516..>892661
                     /locus_tag="HG535_0B04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287247.1"
                     /db_xref="GeneID:59235075"
     CDS             891516..892661
                     /locus_tag="HG535_0B04560"
                     /inference="similar to AA sequence:RefSeq:NP_013292.1"
                     /note="similar to Saccharomyces cerevisiae PEX13
                     (YLR191W); ancestral locus Anc_7.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143142.1"
                     /db_xref="GeneID:59235075"
                     /translation="MSTNSKPRPKPWEANQPLHDSSALADDVSMTKRTKSIDETSSGQ
                     NISLEVPPRPTSLNSDPINEINNNAYRNPHFGSNLYGNTMSGSGPYGAGSMFSGGYGS
                     MYGGYGSMYGGGYGSLLGNGYGGGYLNPGAPGGGATGFGESTQATFQLIESLIGAVAG
                     FAQMLESTYMATHNSFFSMISVAEQFSYLKEVLGSFFGIFAMMKFLRRILHYVTRGRL
                     GIAPKYSHDKNKAGKDSDGSLLIEEFEKFNSNGNSESKKRKKLSWKPLILFLAAVFGF
                     PYILNKFIYTVQNSQNARTGRITSQQVDPSKLEFARALYDFTPENPQIEATLKKGDLM
                     AIISKQDPAGQDSEWWKVRTKQGITGYVPYNYIEIIKRQKKIEDVSE"
     gene            complement(<892879..>893274)
                     /locus_tag="HG535_0B04570"
                     /db_xref="GeneID:59235076"
     mRNA            complement(<892879..>893274)
                     /locus_tag="HG535_0B04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287248.1"
                     /db_xref="GeneID:59235076"
     CDS             complement(892879..893274)
                     /locus_tag="HG535_0B04570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143143.1"
                     /db_xref="GeneID:59235076"
                     /translation="MFNRSAVTSSIIRYRPSRVFAPQAAFISCHSSIHTCTIAQKSAK
                     EVVKENLEKLNKKIGKVAAEGIEKTQEASHRVSEAASHAGDKADNALGHAEEKANQKS
                     ADVNENVETAKDKVKDTVQDLKKKVDDST"
     gene            complement(<893938..>895656)
                     /locus_tag="HG535_0B04580"
                     /db_xref="GeneID:59235077"
     mRNA            complement(<893938..>895656)
                     /locus_tag="HG535_0B04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287249.1"
                     /db_xref="GeneID:59235077"
     CDS             complement(893938..895656)
                     /locus_tag="HG535_0B04580"
                     /inference="similar to AA sequence:RefSeq:NP_010107.1"
                     /note="similar to Saccharomyces cerevisiae DLD1 (YDL174C);
                     ancestral locus Anc_7.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143144.1"
                     /db_xref="GeneID:59235077"
                     /translation="MMKKSAFSTIRVCRRFLNLRSCRSRYYSSSTSPKSIANDSSRTF
                     KVIGFGLAGFTGYMLGDKLHKPEREHTDEGSTLPLDKLQPAIYCTDPKKLDIVVQQLK
                     DVFNNDPAHFSDTKSDLDSHSDTYFSTHHPTPDQRPHIVLFPSTTEEVSKVMKICHDN
                     KVPVVPFSGGTSLEGHFLPTRGRSTVVIDVSKYMNHILKLDTKDLDVQVQAGVPWEDL
                     NDYLNDKGLLFGCDPGPGAQIGGCVANSCSGTNAYRYGTMKENVINLTLVLPDGTIIK
                     TKKRPRKSSAGYNLNGLFIGNEGTLGVVTEATVKCHVKPKLETVIVAAFPSVGEAAEC
                     SSNITQEGIQLNAMELLDDEMMKLINNSGATFRTDWNETPTMFFKVGGKNENIVHQTI
                     KELEKIAKRHKASSFEFATDDDEKLELWEARKVALWSVIDAGKSKNKNANIWTTDVAV
                     PLSNFAQIIEETKEDMNKSPLINAIVGHAGDGNFHAFIVYSNDEEQKICEDIVERMVR
                     RAIDLDGTCTGEHGVGIGKRKFLLEELGNEPVDLMRKIKLAIDPNRILNPDKIFKIDP
                     EDQIEH"
     gene            complement(<896015..>896833)
                     /locus_tag="HG535_0B04590"
                     /db_xref="GeneID:59235078"
     mRNA            complement(<896015..>896833)
                     /locus_tag="HG535_0B04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287250.1"
                     /db_xref="GeneID:59235078"
     CDS             complement(896015..896833)
                     /locus_tag="HG535_0B04590"
                     /inference="similar to AA sequence:RefSeq:NP_013293.1"
                     /note="similar to Saccharomyces cerevisiae HCR1 (YLR192C);
                     ancestral locus Anc_7.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143145.1"
                     /db_xref="GeneID:59235078"
                     /translation="MSWDDDLIGGSAAQGEDAVLMDSWDAELTDEPVMDSWDAEEEVE
                     DKPKAKPKATSKASGKKKPNGKEVVNPLMAIDTLDEKTRKELIKKAEIESDLNNAADL
                     FSGLGVAEEHPRAAALRREQEAMEIAKISRPALTKESPIEDHPLFKDAETKADYQDLR
                     KSLTTAIVSMHEKSSLNYASSLAVDLIRDIAKPMSIENIRQTIATLNIMMKDKERQER
                     QARLAKVKGGTATGGAGKKKAKGGQPNLGGAFKKDQQFDMGGAEYDDFNDDDFM"
     gene            <897859..>898398
                     /locus_tag="HG535_0B04600"
                     /db_xref="GeneID:59235079"
     mRNA            <897859..>898398
                     /locus_tag="HG535_0B04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287251.1"
                     /db_xref="GeneID:59235079"
     CDS             897859..898398
                     /locus_tag="HG535_0B04600"
                     /inference="similar to AA sequence:RefSeq:NP_010108.1"
                     /note="similar to Saccharomyces cerevisiae YDL173W;
                     ancestral locus Anc_7.362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143146.1"
                     /db_xref="GeneID:59235079"
                     /translation="MTVETTATKYKISTGRGGAGNIHTTDSQISPKVVPRGSQAPNIL
                     QPVFSTGRGGAGNMRRNVDAKLTRKAQDIGEDDDDADLESFSHSDEDYIGPVAQNGEE
                     EEAFDRLASTVSGKSNTSNRLHKSRTKGTETRPKTIMLGRGGAGNIISPTTSKKSTKR
                     KSRKNEKKGFWGNLKGIFS"
     gene            complement(<898605..>905024)
                     /locus_tag="HG535_0B04610"
                     /db_xref="GeneID:59235080"
     mRNA            complement(<898605..>905024)
                     /locus_tag="HG535_0B04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287252.1"
                     /db_xref="GeneID:59235080"
     CDS             complement(898605..905024)
                     /locus_tag="HG535_0B04610"
                     /inference="similar to AA sequence:RefSeq:NP_010110.1"
                     /note="similar to Saccharomyces cerevisiae GLT1 (YDL171C);
                     ancestral locus Anc_7.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143147.1"
                     /db_xref="GeneID:59235080"
                     /translation="MVLTSERFDPLEESYEGGSPQDFSTNHKHKSWANVLPDKCGLYD
                     PEYEKDACGVGFVANIKGEHSHKIVSDARFLLCNMTHRGAVSSDGNGDGAGILLGIPH
                     EFMKREFKLDLGIDIPEKGQYAVGNVFFKKDDPSVLEDSKNFFEKLALSLNLQVLGWR
                     DVPHDSSILGEVALSREPQILQPLIVRKQTSAESVGSEFNEREFQTQLYILRKQASNE
                     IGIENWFYACSLSNRTIVYKGQLTPAQVYNYYYDLTNAHFESHMALVHSRFSTNTFPS
                     WDRAQPLRWLAHNGEINTLRGNKNWMHAREGVLVSETFKDQLDKLYPVIEEGGSDSAA
                     LDNVLELLTINGVLSLPEAIMMMVPEAYHADMDSNLKAWFDWAACLMEPWDGPALLTF
                     TDGRYCGAMLDRNGLRPCRYYVTSDDRVICASEVGVIHIENKLVIQKGKLKPGDMFLV
                     DTEKSEIVDTKKLKLNFAKKKDFKSWLSKVIKLDDLLSKNKKFIPNDFVSNLSSLKVQ
                     TDPRLLANCYTFEEVSLLLTPMALTGKEALGSMGNDAPLACLNEDPVLVYDYFKQLFA
                     QVTNPPIDPIREANVMSLECYVGPQGNLLEMHPSQCDRLFLKSPILHWDEFYALKNIE
                     KTHPTWSIANIDITFEKSEGLLGYTSTIERITQEASDSIDNGKKILILSDKKMGSQRV
                     SISSLIAVGAIHHHLIRNKQRSHVAIILETGEARQIHHFCVLLGYGCDGIFPYLAMET
                     LVRLNQEGLIRNVDDDDVTVDNDTLLENYKHAIDGGILKVMSKMGISTLASYKGAQIF
                     EALGIDNSVTDVCFAGTASRIKGVTFEYLAQDAFSLHETGYPSRPIVTKTVTLPERGD
                     YHWRDGGFKHVNDPTAIASLQDSVRNKNEAAWDMYVKKETEAIRDCTLRGLLELDFEN
                     CTPIPLEQVEPWTEIARRFATGAMSYGSISMEAHSTLAIAMNRLGAKSNCGEGGEDAE
                     RSIVHDNGDTMRSAIKQVASARFGVTSYYLSDADEIQIKVAQGAKPGEGGELPAHKVS
                     KEIAKTRHSTPHVGLISPPPHHDIYSIEDLKQLIYDLKCSNPRAGISVKLVSEVGVGI
                     VASGVAKAKADHILVSGHDGGTGAARWTSIKSAGLPWELGLAETHQTLVLNDLRRNVV
                     VQTDGQLRTGFDIAVAVLLGAESFTLATIPLIAMGCIMLRRCHLNSCAVGIATQDPYL
                     RSKFEGQPEHVINFFYYLIQDLRKIMATLGFRSVDEMVGHSEKLKKRENVNTKAINID
                     LSPILTPAHTIRPDVATRFTKKQDHKLHSRLDNKLIDEAEVTLDRGLPVTIDAEIINT
                     DRALGSTLSYRISKRFGENGLPQDTVVVNIQGSAGQSFGAFLAPGITFILNGDANDYV
                     GKGLSGGILVIKPPKDSKFKSDENVIVGNTCFYGATSGTAFISGSAGERFAVRNSGAT
                     IVVERVKGNNAFEYMTGGRAVVLSQMESLNAFSGATGGIAYCLTSDYDDFVGKINKET
                     VELESLTDTVEIAFVKNLILEHYNYTQSELAAKILGNFNYYLKNFVKVIPSDYKKVLV
                     KEAADKIKEKELLTTQFLKKFQRSANNKADATNGEIAAMVSEKKKQSTVSFKSTLVEP
                     GVVDLEDSVPNSKQLEKSAEKVEKLEKIRGFMKYKKLYEPKRSAAARTKDWKEFANSL
                     SKKEAKVQAARCMECGTPFCQSDTGCPVSNIIPKFNDLVFKNQWKLAYDKLMETNNFP
                     EFTGRVCPAPCEGACTLGIIEDPVGIKSIERLIIDNAFKEGWVEPVIPEFRTGYSVAI
                     IGSGPAGLACADQLNKAGHSVTVYERADRCGGLLMYGIPNMKLEKSIVQRRVDLLAAE
                     GIQFITNTEVGKDITTEELKSQFDRIVYAIGSTIPRDLPIKGRELKNIDFAMTLLKDN
                     TSAFLNKDMEAIRQSIAGKKVIVIGGGDTGNDCLGTSVRHGASSVLNFELLPQPPKER
                     SRDNPWPQWPRVMRIDYGHAEVKEHYGRDPREYCILSKEFIGNEEGEVTAIKTVRVEW
                     KKSESGVWQMVEIPGSEEIFEADIVLLSMGFVGPELFEDPSVKKTRRGTIDTLNDASY
                     SVDGNKVYAAGDCRRGQSLIVWAIQEGRKCATSIDEELMGSTNLPGNGGIVKRNYELL
                     KELAATV"
     gene            <906472..>908286
                     /locus_tag="HG535_0B04620"
                     /db_xref="GeneID:59235081"
     mRNA            <906472..>908286
                     /locus_tag="HG535_0B04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287253.1"
                     /db_xref="GeneID:59235081"
     CDS             906472..908286
                     /locus_tag="HG535_0B04620"
                     /inference="similar to AA sequence:RefSeq:NP_010111.1"
                     /note="similar to Saccharomyces cerevisiae UGA3 (YDL170W);
                     ancestral locus Anc_7.360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143148.1"
                     /db_xref="GeneID:59235081"
                     /translation="MMNEEFDALNRAKSRKHSRTGCITCKVRKKRCSEHKPICADCRR
                     LGFSCMYLPKSTDRRTLQHYKELIERELFDHKFSKKGHRRFDEVQECEQELGLEAELG
                     EQEEEQREEAHEEENEEENEEENEHEHEHEEEHEILNGAQLIHIGAEQLHLDLDDEFS
                     LSLSPRYSQPLTDPICLELDGVGMHLYNYYRDHLAKIISIAPTKQNYYLQVFLPMAHQ
                     HKGILYGLMAWSAHHLSITESNHDVQSKDENYLTIANEYTLNSLTRLKSEYSESNFLW
                     SLAQVLILCGAEICQGDVNKWKVLLKHGAELIEKNCGKDISEILFSNKHTNLDSTTRY
                     WLIANFMYHDIMCSRQTFFPMNQYQRILDNQSSHDLRSLDDSNLQLDPLNGINRPILL
                     LIGDITNLTRKMKSDCEQFNKDHPKFDKYMKTAMDIQSKLYHLVPNVMEMKFYEEFSN
                     DYQLSIELFQLMQTAALIHLKTICLKYSKDSIEIQYLWKILSQKLTLILGTKLEGSLC
                     FPLFICGINAVSEEQKSLVESMFDDMMKRYKCYNFQRARTIMRKVWKQNSDNESISNR
                     SSISSTSTGTGAEDNWYELKNKDWYDIVDDMGWDISFA"
     gene            complement(<908364..>908900)
                     /locus_tag="HG535_0B04630"
                     /db_xref="GeneID:59235082"
     mRNA            complement(<908364..>908900)
                     /locus_tag="HG535_0B04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287254.1"
                     /db_xref="GeneID:59235082"
     CDS             complement(908364..908900)
                     /locus_tag="HG535_0B04630"
                     /inference="similar to AA sequence:RefSeq:NP_013294.1"
                     /note="similar to Saccharomyces cerevisiae UPS1 (YLR193C);
                     ancestral locus Anc_7.359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143149.1"
                     /db_xref="GeneID:59235082"
                     /translation="MVLWHKNRHVFESDFATVSLAFFNRYPNPYSNHVLSIDTLSRDL
                     GDDGKLRTTRLIKKSGKLPRWVKPFLSAVSDSWIIEISIVDPETMHMQTYTKNLDHTK
                     IIQVEEYTTYMADKQLGNTIVKSDVKFSSGFQMGVKNKIEHWSRSKFDENIKMSRLGM
                     TFVMKQLEERGEKGRLFI"
     gene            <910105..>910521
                     /locus_tag="HG535_0B04640"
                     /db_xref="GeneID:59235083"
     mRNA            <910105..>910521
                     /locus_tag="HG535_0B04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287255.1"
                     /db_xref="GeneID:59235083"
     CDS             910105..910521
                     /locus_tag="HG535_0B04640"
                     /inference="similar to AA sequence:RefSeq:NP_012751.1"
                     /note="similar to Saccharomyces cerevisiae MRPL38
                     (YKL170W); ancestral locus Anc_1.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143150.1"
                     /db_xref="GeneID:59235083"
                     /translation="MIYLKSMLKVIDNSGAQMAECIKVLKKGSPKSPARIGDRIICVV
                     QKAKPLNQNITGTSNTNRVKKGDIVHGIVVRTKQKNMSRGDGSIVSFGDNACVLVNKN
                     TGEPLGTRIMANDGCVGRELREKGFNKICSLASRVV"
     gene            complement(<910615..>912894)
                     /locus_tag="HG535_0B04650"
                     /db_xref="GeneID:59235084"
     mRNA            complement(<910615..>912894)
                     /locus_tag="HG535_0B04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287256.1"
                     /db_xref="GeneID:59235084"
     CDS             complement(910615..912894)
                     /locus_tag="HG535_0B04650"
                     /inference="similar to AA sequence:RefSeq:NP_012370.1"
                     /note="similar to Saccharomyces cerevisiae HAL5 (YJL165C)
                     and KKQ8 (YKL168C); ancestral locus Anc_1.180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143151.1"
                     /db_xref="GeneID:59235084"
                     /translation="MGGRDEKSSVRRNRSLSESIKGLFKPVGIGIGGSNGEANNNANG
                     PSNGNKQNSAQENTKAQQPARPSEMPQLGTKKNSGRLGNIATNKEAELSSSRGAPIQA
                     PASPLQSPVLQRPHHGLPNVSKLSITPLSPPGSDRDSIASEESHPRSKKGSSGDEGEM
                     PDQRKDPRNNQKMQENKLHTPQMSSESQESGTLIDSILENDESDEHIHSKEHSKDQAQ
                     SGPYVNGRRSRANSHVGRSGSLKRNDSLSSNNVQGNKDYLRARNRADTFSASSLPKFS
                     EIESKCVLQVENFKVYENGFHEHNLKVSSLVTDGNDNLSSSDIAKQKSSFSLSGMFKH
                     HKEDSKQLENALSLIPASRLSLYQRIDRSRSQAVEDEQNGIVGIMENGFQADDEQDES
                     KPKDKATPRIVNTNAAVGSEELKLINTLSEKIHSALNGESLKIEGQKKDIPKFYEQYG
                     KPVGLIGHGAYGVVKVCSRPKTPKDIAPFATYSSGKKLFFAVKELRPKANDQIDRFST
                     RITSEFIIGHSLSHCHKKGTKVSPNILTIFDLMETNDAFVEVMEFCPSGDLYSILTRK
                     SKNGTALHPLEADCFMKQLLHGVQYMHNHGVAHCDLKPENILFYPNGLLKICDFGTSC
                     VFQTAWEKHVHFQTGTMGSEPYVAPEEFITDNEYDPRLTDCWSCGIVYCTMVLDHYLW
                     KIALRDEDVLYDSFYEEMKEHKQFYVFEEMRHVNNEISRLRRAALYSILQIDPKRRIT
                     IDSLLQSPWMKHTRCCVFY"
     gene            complement(<913391..>915427)
                     /locus_tag="HG535_0B04660"
                     /db_xref="GeneID:59235085"
     mRNA            complement(<913391..>915427)
                     /locus_tag="HG535_0B04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287257.1"
                     /db_xref="GeneID:59235085"
     CDS             complement(913391..915427)
                     /locus_tag="HG535_0B04660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143152.1"
                     /db_xref="GeneID:59235085"
                     /translation="MKLKQAKNLPEAVLHRHWLVFKQFLKVNHRDLIRTYLFVPLGVI
                     IIMCLLYGVDRLIRNCIKVTFPASVAVMLINFAFMCCLSALKKPYNNFYISIIDVPLS
                     WALRWMNLFFTPAFVTLPLSPWISYKEALLIVAVFIFGYLIAFVLLAYITILGQKLIG
                     LRGLKSIFIRQEELQNGVTEGSRFTPMPLKHRKNGSVSSSSSKNEENNNIKNASDGSD
                     VSDIHYQYADEYYDHHNNNEQEANNNFNDPLISLASNSGLFLSRLNSRATQGNTSLLA
                     CDSHNLDSRAHVADENSGAHQMDSVYMLYQTPSGNSAGQSSDTHSSREGINNRSNILS
                     KIIPAVHRSSVNSTDTSDVPSEALESRAICQRAITKQFSREFDHYFSISMWENHSHHV
                     IFSVGLFATIFTYYFQWYIAPYQLFTAIVMFMIVVDSPFIVNRPRLKKFAHPVICSVA
                     LTWIVMLISVMIKHREVSFFISELRQYKTGRTYLFLFDDQRFGHHQWPGAGDIFSSCM
                     DVSIVALSLPMYTYRKDLQKHFFAMVPPILLFTAACLLLYPLICYHIGISPTRAIGLS
                     GRSITLALGTPMIANLGGDQTVMAVATVMSGVVGALTGGPMLDFIRVPEEDYVTRGLT
                     LGCNCGAIATAYLLGVDRRAAAISSLSFVFYGALLVILSAIGPVKSFVHMLVGL"
     gene            complement(<915781..>916173)
                     /locus_tag="HG535_0B04670"
                     /db_xref="GeneID:59235086"
     mRNA            complement(<915781..>916173)
                     /locus_tag="HG535_0B04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287258.1"
                     /db_xref="GeneID:59235086"
     CDS             complement(915781..916173)
                     /locus_tag="HG535_0B04670"
                     /inference="similar to AA sequence:RefSeq:NP_012754.1"
                     /note="similar to Saccharomyces cerevisiae MRP49
                     (YKL167C); ancestral locus Anc_1.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143153.1"
                     /db_xref="GeneID:59235086"
                     /translation="MSSVKKQLEFLNKISYNTKKAQIFVNSEKVTGLKLLFQWQNHDG
                     HMGARKFWHEYLPTLQYYNPALKIDLLRLKNDKRDVEVPCKIEILGRESKILDTINMQ
                     YKKDNEIMDDLLLKLDHEVVPQDQLVKV"
     gene            complement(<916478..>917797)
                     /locus_tag="HG535_0B04680"
                     /db_xref="GeneID:59235087"
     mRNA            complement(<916478..>917797)
                     /locus_tag="HG535_0B04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287259.1"
                     /db_xref="GeneID:59235087"
     CDS             complement(916478..917797)
                     /locus_tag="HG535_0B04680"
                     /inference="similar to AA sequence:RefSeq:NP_012371.2"
                     /note="similar to Saccharomyces cerevisiae TPK1 (YJL164C)
                     and TPK3 (YKL166C); ancestral locus Anc_1.182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143154.1"
                     /db_xref="GeneID:59235087"
                     /translation="MYVDPQKNNTIRKLSLPGMIKKEFSQEDKHGGFGSRGQGSEEEH
                     RQGHGQGQEQGQEQQDAGGKEVAHLTMQELNEHVRESERNRLAHQQQQRELQEEHGSE
                     ADEETERKRNFILRGRNTSGKYCLNDFQILRTLGTGSFGRVHLVRSNHNGRFYALKVL
                     KKQTIVKLKQVEHTNDERTMLSIVSHPFLIRMWGTFQDAEQVFMVMDYIEGGELFSLL
                     RKSQRFPNPVAKFYAAEVCLALEYLHANEIIYRDLKPENILLDRNGHVKITDFGFAKY
                     VPDVTYTLCGTPDYIAPEVISTKPYNKSVDWWSFGIYIYEMLAGYTPFYDANAMKTYE
                     NILNAELKFPSFFHPDAQDLLSKLIMRDLSKRLGNLQNGTADVKNHPWFSEVVWEKLL
                     CRNIETPYEPPIQQGQGDTSQFDRYPEEEINYGVQGPDPYADLFRDF"
     gene            complement(<918361..>920178)
                     /locus_tag="HG535_0B04690"
                     /db_xref="GeneID:59235088"
     mRNA            complement(<918361..>920178)
                     /locus_tag="HG535_0B04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287260.1"
                     /db_xref="GeneID:59235088"
     CDS             complement(918361..920178)
                     /locus_tag="HG535_0B04690"
                     /inference="similar to AA sequence:RefSeq:NP_012372.1"
                     /note="similar to Saccharomyces cerevisiae YJL163C;
                     ancestral locus Anc_1.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143155.1"
                     /db_xref="GeneID:59235088"
                     /translation="MTGQEETASLISSSRLDYQTTDHVNGAREVLDEGLEFVAEQASV
                     AVFENAMANDQSEEEDDTVEVGWTRAMRTRHQDLSFYQRPSMLVLCTLLVLLCVTESL
                     CFTPAIALTMKKICDGLLEVNDAAADLAKRECDPKKVQAIMSGITSLLSISTGLIGTF
                     MSAKWGELSDRIGRVRVFGYIAFIKIFGNAIQLYALSPAVRYHKWGIILGLSISPFSG
                     GILAAVAIGNSYVADIMESEHRALSMSIMMSAIYASIGLGPMLSGILINMFNGNNAAP
                     IYFSLLTGSLSAILCLTAIHEPRHEDALKLSHTHFMERKDSLSSSKPNVKVAATLFSR
                     TREYLRFCSLQAIDVLSPVKILWLKPTASGSLIPRYTVVLLLIIDVLFLCMTSASMST
                     IVLYATYKFDWRAVKLGYFISISGLGKAAVLMLLSPAMLYALKKHYRSLNNSIDQIDV
                     FCIRLSMVLLTLSTLIVLLDNENESSLFVLAVLHALSAFCSPTLQSSIIKYCSKKFTG
                     QCFGGMALIRSAVMLALPPVFLMIYGSTVSFRPEIFLYVISACGVLAIALTFFLRIVE
                     DNNVLRRPSEVALNAPGRQDVSQVASRRASTAQSLRQNR"
     gene            complement(<921131..>923890)
                     /locus_tag="HG535_0B04700"
                     /db_xref="GeneID:59235089"
     mRNA            complement(<921131..>923890)
                     /locus_tag="HG535_0B04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287261.1"
                     /db_xref="GeneID:59235089"
     CDS             complement(921131..923890)
                     /locus_tag="HG535_0B04700"
                     /inference="similar to AA sequence:RefSeq:NP_012756.1"
                     /note="similar to Saccharomyces cerevisiae MCD4 (YKL165C);
                     ancestral locus Anc_1.184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143156.1"
                     /db_xref="GeneID:59235089"
                     /translation="MWNRHRLALIFVGVLFHLFYLWSIFDIYFVSPLVHGMQQYRSTE
                     SPPAKRLFLIVGDGLRADTTFDKVTHPETGETDFLAPYIRSLVLNNATYGVSHTRMPT
                     ESRPGHIAMIAGFYEDVSAVTKGWQENPVDFDSFFNQSTHTYAMGSPDILPMFKTRDS
                     SDKMDTWMYGHEYEDFTQSSIELDAFVFRHFDQLLKNATHDPDLNEEIRQEGNVFFLH
                     LLGCDTAGHSYRPYSAEYYDNVKYIDDQVSTLVYKVNNFFNDQDSAFIFTADHGMSAF
                     GSHGDGHPNNTRTPLVAWGAGLNKPVQNKVPIFDNYTETWELGDIKRNDINQADLTSL
                     MSYLIGVNYPVNSVGELPLNYVDGEESQKLHGLYNNAKSVLEQYLVKEKEVINSQFVY
                     KEYGGFVEKNHSQYLIEIEKLLSRIAMGETALEPKAILLTEELMKNTLDGLHYLTTYN
                     WRFIRTIVTLGFIGWITYAFTIFLRLFILNKANEFTGTSLLNYVTFGALGIILNWVLY
                     YQKSPFNFYMYLQFPLYLWSRIFSNHKILSAGFREFFKGISLIQKVLVAILIVGVYES
                     IVYGFFHRWIFAVIFNLLAFYPLYCGIKSLKSNLGWILTSAFMSTFTLYDAVKIESLN
                     QISLAVLLMLITSLYGVVKINKTISNYTLSILLTQIALVLGMLLVTQKSVISLQNRQG
                     LPRDCQVGAWAIMGISLFIMPMLHYLKPNNDYKLRLLVIYLTFAPTFVILTISFESLF
                     YVSFTSYIVQWIEIESEIKQTKTHENWLQLLRVSVIGFFLLQVAFFGTGNVASISSFS
                     LDSVYRLLPIFDPFPMGALLMLKLIIPYILLSTGLGILNLKLNIKDYTISSLIISTND
                     ILSLNFFFLLKTEGSWLDIGITISNYCLAILSSLFILILEVLSHLLLRNVTINDPVLR
                     AKKHV"
     gene            complement(<924130..>925764)
                     /locus_tag="HG535_0B04710"
                     /db_xref="GeneID:59235090"
     mRNA            complement(<924130..>925764)
                     /locus_tag="HG535_0B04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287262.1"
                     /db_xref="GeneID:59235090"
     CDS             complement(924130..925764)
                     /locus_tag="HG535_0B04710"
                     /inference="similar to AA sequence:RefSeq:NP_012373.2"
                     /note="similar to Saccharomyces cerevisiae JJJ2 (YJL162C);
                     ancestral locus Anc_1.185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143157.1"
                     /db_xref="GeneID:59235090"
                     /translation="MTQTLKIKLDVTTFYSSLGLTSSATDAEVQKSYRKLARELHPDK
                     SKSDSAAELFKVINNAYSILMDREKKLRYDSTLVAKGLTEYKPRNNCHRYDGLTGGAG
                     EDFHKDENNLKTPQKNRPSKNYNHRPYEQQPYGFGTGNEAHPTFNSHSRVPIFQSFNL
                     KNYQRNQRSPHKSETKTEKSSSIFNNKNNGTPPHHINTEDISEKRSEPPKSEEKESSD
                     ENGTAVRSKLHKANSSDPFEHLPGSPFANNRHRHYARTKHEARTHERRSVSPVKRASN
                     TEGADMSESWDTLKNILSNFKDEEKKLKTEKNEIELTVDSIKAAKIRKAESQSIKLDD
                     LKDSLPIDNDLFDMRKVSDTLNTVPVIKKAKLNFKEESPEIDMNSSESKGHHHSRQNE
                     SAASKIPTNLEENLYMPVNQPLPKIYRPEIIPLHQYKITSKAIDLDLPAMPNFQCNVL
                     NKSQMERCKQYVKEFNAKSNFLKQELLQSLSERLEADKILGDKLLKVENAGNWVSCKD
                     FDFEVVSKLAEINSRQRIVAQSFANLLNNLYKGSPQ"
     gene            complement(926286..926357)
                     /locus_tag="HG535_0Btrna5E"
                     /db_xref="GeneID:59235351"
     tRNA            complement(926286..926357)
                     /locus_tag="HG535_0Btrna5E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:59235351"
     gene            <926913..>927449
                     /locus_tag="HG535_0B04720"
                     /db_xref="GeneID:59235091"
     mRNA            <926913..>927449
                     /locus_tag="HG535_0B04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287263.1"
                     /db_xref="GeneID:59235091"
     CDS             926913..927449
                     /locus_tag="HG535_0B04720"
                     /inference="similar to AA sequence:RefSeq:NP_012374.1"
                     /note="similar to Saccharomyces cerevisiae YJL161W;
                     ancestral locus Anc_1.186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143158.1"
                     /db_xref="GeneID:59235091"
                     /translation="MKQSLLSRIQQGIHLPHNSVPRQHSPYAPTAKNLTVNAIIAYLY
                     GYGAFAMYKDYSRTKSSAMRLPRNPEASLPSTFEGRKESVHDKPNRVFNSDEMKEAQI
                     STPMRVLKSLTYGDISEISVAWGVLIQLCNTAHATYGVKSWIFRSSVLGVLGFPPLAY
                     YWFRSTLFEKESAGVIIN"
     gene            complement(<927762..>928967)
                     /locus_tag="HG535_0B04730"
                     /db_xref="GeneID:59235092"
     mRNA            complement(<927762..>928967)
                     /locus_tag="HG535_0B04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287264.1"
                     /db_xref="GeneID:59235092"
     CDS             complement(927762..928967)
                     /locus_tag="HG535_0B04730"
                     /inference="similar to AA sequence:RefSeq:NP_012375.2"
                     /note="similar to Saccharomyces cerevisiae YJL160C and
                     PIR1 (YKL164C); ancestral locus Anc_1.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143159.1"
                     /db_xref="GeneID:59235092"
                     /translation="MQYQKTLLTLTLAATALASSLPNQTWSTMTPNATYSGGATDHAT
                     AFGIAVQPISTGSVSMAKRDAVSQIGDGQIQATTKTAAPVSQIGDGQIQATTKTAAPV
                     SQIGDGQIQATTKTAAPVSQIGDGQIQATTKTAAPVSQIGDGQIQATTTTLSPTPRNA
                     TSAAPVSQIGDGQIQATTKTAAPVSQIGDGQIQATTTTLSPTPRNATSAAPVSQIGDG
                     QIQATTKTAAPVSQIGDGQIQATTTTLSPAFHNATTAAPVSQITDGQIQATTQTTKVA
                     SQITDGQVQATTSSAPSDNSDPVKSTACKTEGTLEMNLKGGILTDNKNRIGSIVANRQ
                     FQFDGPTPQAGAIYAAGWSITPEGNLAIGDNDVFFQCLSGSFYNLYDESLGEQCHPVH
                     LEVIDLVDC"
     gene            <930229..>931530
                     /locus_tag="HG535_0B04740"
                     /db_xref="GeneID:59235093"
     mRNA            <930229..>931530
                     /locus_tag="HG535_0B04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287265.1"
                     /db_xref="GeneID:59235093"
     CDS             930229..931530
                     /locus_tag="HG535_0B04740"
                     /inference="similar to AA sequence:RefSeq:NP_012376.3"
                     /note="similar to Saccharomyces cerevisiae HSP150
                     (YJL159W) and PIR3 (YKL163W); ancestral locus Anc_1.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143160.1"
                     /db_xref="GeneID:59235093"
                     /translation="MRISGQPSLFRKTYIKDWGGRKRGCRRWEFSVGAFGRTPRITFS
                     CSDPVEALSNTFHTEMQFKKTIITTAFAATALSAYVPSEPWSTLTPTATYSGGATDHA
                     TAFGIAVNPVANSSSASLAKRDGVSQIGDGQIQAATTTRSTAAPVSQISDGQIQATAA
                     TRSTAAPVSQISDGQIQATTATRSTAALVSQISDGQIQATTATRSTAAPVSQISDGQI
                     QATTATRSTAAPVSQISDGQIQATTATRSTAAPVSQISDGQIQATTATSSADAISQIS
                     DGQIQATTSAHTTDAASQVSDGQVQATSTTSGASQVSDGQVQATSGASADSSNPVRAV
                     SCKTDGTLEMNLKAGILTDNRGRIGSIVSNRQFQFDGPPPQAGAIYAAGWSITPEGNL
                     AIGENDVFYQCLSGSFYNLYDESLGEQCHPVHLEVIDLIDC"
     gene            complement(<931949..>932722)
                     /locus_tag="HG535_0B04750"
                     /db_xref="GeneID:59235094"
     mRNA            complement(<931949..>932722)
                     /locus_tag="HG535_0B04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287266.1"
                     /db_xref="GeneID:59235094"
     CDS             complement(931949..932722)
                     /locus_tag="HG535_0B04750"
                     /inference="similar to AA sequence:RefSeq:NP_012377.1"
                     /note="similar to Saccharomyces cerevisiae CIS3 (YJL158C);
                     ancestral locus Anc_1.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143161.1"
                     /db_xref="GeneID:59235094"
                     /translation="MQFKNITLLSVATLAATTSAEGYTPGSPWETLTPTATYSCGATG
                     YSSSFGIAIQTIGSQKAKRDAVSQIGDGQVQATSTTASETAAPSSATPASETAAATET
                     TQVATSGVSQISDGQLQHSTVSTAPTGSTTTLEPSSSKTTLSNSVCPTAPLSLDSSSC
                     KNDGTLEISLKDGVLTDGRGRIGSIVSNRQFQFDGPPPQAGAIYAAGWSITPEGNLAI
                     GENDVFYQCLSGNFYNLYDQSLGAQCSAIHLEVINLVDC"
     gene            complement(<933583..>936186)
                     /locus_tag="HG535_0B04760"
                     /db_xref="GeneID:59235095"
     mRNA            complement(<933583..>936186)
                     /locus_tag="HG535_0B04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287267.1"
                     /db_xref="GeneID:59235095"
     CDS             complement(933583..936186)
                     /locus_tag="HG535_0B04760"
                     /inference="similar to AA sequence:RefSeq:NP_012378.1"
                     /note="similar to Saccharomyces cerevisiae FAR1 (YJL157C);
                     ancestral locus Anc_1.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143162.1"
                     /db_xref="GeneID:59235095"
                     /translation="MSVKTPIQASYEKKVHTPPSIERHDSARPKLVKSFSGKLFRRQL
                     ELESNSCHTFDSTGLFVPAYSLSSGKKRTPKPLNLSHPITPPPSLRKTSTTSASTYSS
                     SLNTNLFHSGLSQLESPIKLAPSVEIKNLEILSNSEATYSLNSGISPRHRGHPIVWTE
                     TANDPFLEEGSPTYLCDVSENISRVRTNGGHRRFISSTCALCDEKMSSIFCGEKVIEM
                     TCSHACHYECYLTMLESLYFKKTYPCCTICHKLVKPVDEEILEEMISSLLTKRRFSDE
                     NYTIEPQNFFSRAHTTSAVGLFTPQDQLIKTSDVSCNGFRTPLYTPPLDRKLTHNRTD
                     SDELDINFPDDWSQTFSGLLDKEQCTNQRSLSNPSLKQLPMDLNGILPSDQCGPLVEI
                     CQNSDEDLSSFTIRVKTSGNYTPAMVQLNANEAQLERGETTCLGVQLEEYLKDKINIC
                     DQVGSLLIFDAIDYSTDGEQWIANIIAYLFQDILILFDHETMTTVGKIPMKQICQVLK
                     LDRDTLLIDLKSTVLPEVYLSCRSFDSKQSLMEKWMYYMSGGTELPHLEHITLTAWHI
                     LPVEIHSAINLHLETLKQNCSFTEKSQPWESEKSNVPLQLIICLSICNYGVNEQKTLA
                     DNMKKILNSLNDDDLLGLVIVGRDGRGNIGEYGTFTGTIGKTWDCWLEIFDGLKATSN
                     KVFQSEVRELDKMLETCHHLVTTSDTMLAESHRSRYLKQVLLIRNGEPPNRNSKYYNI
                     IKKHYKFDFLQMPSFSSIGFESSNDSNAKNAVNDLVSTLHDKRIKDLTVTINGLKISL
                     GNFQPGEEKTMTISSSEPDFNQHREYVAEWFDRKIKLNRSFQGALKVLKPGGITGAHF
                     YSYDADSSYSN"
     gene            complement(<936852..>938951)
                     /locus_tag="HG535_0B04770"
                     /db_xref="GeneID:59235096"
     mRNA            complement(<936852..>938951)
                     /locus_tag="HG535_0B04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287268.1"
                     /db_xref="GeneID:59235096"
     CDS             complement(936852..938951)
                     /locus_tag="HG535_0B04770"
                     /inference="similar to AA sequence:RefSeq:NP_012379.2"
                     /note="similar to Saccharomyces cerevisiae SSY5 (YJL156C);
                     ancestral locus Anc_1.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143163.1"
                     /db_xref="GeneID:59235096"
                     /translation="MVRQIFGFSKKLSKSKREPERQRDNKGSEDNNDSEPSGNDSVRS
                     HDVNEATAYDDRSSKVVSSLGSSVFSKSKLTYSTGGTSSNISGSRNSKRHMTDISERC
                     DGSSADVGKPLRVVNLEKFNLLNPVFEDEGNTEGDSTVDDTSNTNASFTTYAGNASSD
                     TASRSLGSLEQLNSELCILEDNLVTLMDDIHQNVTNISKAVIQAIEYFKKFLPHSTDR
                     LPFKVTFDRFPSLRCITKIVLHFSDNLLSSEVFSNSRSILLRRYLHFLKKLNIVISDE
                     AGSGSGILPCLSNFCIDSEQNLPNIENIEKIIEEISKSDPGSISDQDGAFVAPIMRGL
                     SRKVGILTVMFGIPNPQQEHFDIVKALYTLFPDVHFFCAKDYIKPCADILQSHIPTPM
                     ESHLSAPEKTMSFHFEPPYRLAVDAERPPISMSLSSDNSSKMTGTLGGYLFPQIEKGS
                     KLSQFAGASFAITCSHVVLSESHDYPYVSIPSKVLQTAYKNTLLEEARRYPKHSKEES
                     AFIDESSRIENNIKWQEENKFGQVVWGERSIINQKLSDFAIIKVNSKYKCENCLGLGL
                     SSVPDPTLKFQNLFIKEKILKLKSGMRVFKIGASTNYTSGEVNAAKLVHWADGKLQSS
                     EFVVSSPLPLFASAGDSGSWILTKLENQLGLGVVGMLHSYDGEQRQFGLFSPIGDILE
                     RLHDVTGVLWDIDPQIE"
     gene            complement(<939742..>941088)
                     /locus_tag="HG535_0B04780"
                     /db_xref="GeneID:59235097"
     mRNA            complement(<939742..>941088)
                     /locus_tag="HG535_0B04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287269.1"
                     /db_xref="GeneID:59235097"
     CDS             complement(939742..941088)
                     /locus_tag="HG535_0B04780"
                     /inference="similar to AA sequence:RefSeq:NP_012380.1"
                     /note="similar to Saccharomyces cerevisiae FBP26
                     (YJL155C); ancestral locus Anc_1.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143164.1"
                     /db_xref="GeneID:59235097"
                     /translation="MGVYTVSSVENLRICVVMVGLPARGKSFISQKIVRYLSWLSIKA
                     KCFNVGSYRRQIGAAHPSADFFDFKNEEAFRIRENAVTQAVEDMMKWYEDDNGVVGIL
                     DATNTTRSRRDWILKLCRENAIEPMFLESWCDDQEMILRNISDVKTCSPDYEGVDPEK
                     ATSDFLQRIGKYEKVYQPLDLDHDKNLTFVKLVNVAQEVIVNQIQTYLESRIVFYVMN
                     LHIRPRFIWLSRHGESIYNVEKKIGGDSSLSPRGMQYAAKLPELVRESAGDADLTVWT
                     STLCRTQQSAQYLPYKQLQWKALDELDAGVCDGMTYEEIEEKYPEDFKARDEDKYEYR
                     YPGGESYRDVVIRLEPIIMELERQENILIVTHQAVLRCIYAYFMNVPQEESPWMSIPL
                     HTLIRLEPRAYGTEVKRIKANIPAVSTYKEKGTSQLGESVNDATKYRNLLTGEGGN"
     gene            complement(<941653..>944370)
                     /locus_tag="HG535_0B04790"
                     /db_xref="GeneID:59235098"
     mRNA            complement(<941653..>944370)
                     /locus_tag="HG535_0B04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287270.1"
                     /db_xref="GeneID:59235098"
     CDS             complement(941653..944370)
                     /locus_tag="HG535_0B04790"
                     /inference="similar to AA sequence:RefSeq:NP_012381.1"
                     /note="similar to Saccharomyces cerevisiae VPS35
                     (YJL154C); ancestral locus Anc_1.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143165.1"
                     /db_xref="GeneID:59235098"
                     /translation="MSYSETLEQAISTVKHQAVQMQRCLQQRKLMDALKYASIMLTEL
                     RKPDLSPKQYYELYILIFDSLSILSSYLVENHPKGHHLADLYELVQYAGNVIPRLYLM
                     ITVGTSYLKCPDSPREEILKDMIEMCRGVQNPIRGLFLRYYLSQRTKNLLPPDLFEFN
                     ANFVITNFIEMNKLWVRLQHTGPLRQREQRTRERKELQILVGSQLVRLSQIVDDNIQL
                     YKDQILPTVLEQAVQCRDVVSQEYLLDAICQVFPDEFHLVTLDQLLNSTLHLNPEVSI
                     NKVILTLTDRLKGYMDRNEDDDSKKIDNNLFEVFWNYLKNLDEERPDLSLEQFVPLIE
                     SILGLSLRWYPNDLQKLNILYKFTTKKCKDYGKVIPSELEYLFLNLLTLKNENESGLL
                     NANFYYEIVLQCDSFRDLLSIQSVALQRNIVSKLLDIFLQTSSETDTQANPSLVIDSK
                     TKLDSLLSICETFIMDKSSVSAADKRKPQNDENNSNGIRTKNGSFDKPVLVNNNEENN
                     ENESSWKLDPDQEKLAKLCHLIIRSINKSLPEKKNIELQIELLFSIKAWFLKGGKNIK
                     YTFPAIVTNFWKLIRMCHLLSIRSKSKKKLFYENLIKQLFKYASRCINDLFNICGSSF
                     ADSLYKLNIQSASLADQLSLGEIAYDFFSQAFTIFEEFLNDSRTQFQALVYMAQALQK
                     TRSLHEDTYYNSLVVRCTLHSSKLLKKQDQCRAVYLCSHLWWATEIALIGEEEGITTD
                     FYREGKRVLECLQRSLRIADSTMDNVQSSELMVEILNRCLYYFIHGNEHQTHVSVKYI
                     NGLIELIKTNLRSLKMEQTDIDIDPQRLSELHLDDPTLPLDTTFIIGMDGSYINVSQK
                     SGPAPSITSKLNSTFLNEMIQIPIQHFNRTCEYIYDQREVDDRFKVIVI"
     gene            <944996..>946138
                     /locus_tag="HG535_0B04800"
                     /db_xref="GeneID:59235099"
     mRNA            <944996..>946138
                     /locus_tag="HG535_0B04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287271.1"
                     /db_xref="GeneID:59235099"
     CDS             944996..946138
                     /locus_tag="HG535_0B04800"
                     /inference="similar to AA sequence:RefSeq:NP_012992.1"
                     /note="similar to Saccharomyces cerevisiae CCP1 (YKR066C);
                     ancestral locus Anc_1.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143166.1"
                     /db_xref="GeneID:59235099"
                     /translation="MCILYIYMYVWSYELAYILETSDSLQPQRQSKMATLTRALYRTR
                     FFLIGAATAALTVNLKSTTDFKNQGNNNWGWGFRNGGTLLGSAAIVHAATTESGKKFE
                     DFQNVYNAIAKKLREEDEYDNYIGYGPVLVRLAWHSSGTYDKNDNSGGSYGGTYRFKK
                     EASDPANKGLENGAKFLAPIHKEFPWISYGDLYTLGSVTAVQEMQGPKIPWRPGRVDT
                     DEETTPDNGRLPDATKDANYVRNYYNRFGFDDQEIVALLGAHCLGKTHLKNSGFEGPW
                     GASPNIFNNAFYVNLLNEDWKLEKNDAGQEQYDSPSGFMMLPTDYALVQDPKFSRYVK
                     KYADDESAFFEDFKKVFVKLLENGISYEKSSPAFVFKTLDELESNE"
     gene            complement(<946353..>947939)
                     /locus_tag="HG535_0B04810"
                     /db_xref="GeneID:59235100"
     mRNA            complement(<946353..>947939)
                     /locus_tag="HG535_0B04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287272.1"
                     /db_xref="GeneID:59235100"
     CDS             complement(946353..947939)
                     /locus_tag="HG535_0B04810"
                     /inference="similar to AA sequence:RefSeq:NP_012382.2"
                     /note="similar to Saccharomyces cerevisiae INO1 (YJL153C);
                     ancestral locus Anc_1.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143167.1"
                     /db_xref="GeneID:59235100"
                     /translation="MTASNFFKPTIRVATDRCHYTETELTTRYTHVNPVVSEIEGSDC
                     FEVKPVVQDYEFKLDLKTPKLGVMLVGLGGNNGTTFLAAVLANKSKVAFHTKDGLIAA
                     NYYGSVTQSSTIKIGCNESGADCYVPFNSVLPFVAPNDFVVSGWDINGANLYDAMVRS
                     QVLEYDLQNKLKGDMSKVIPLPSVYYPDFIAANQSRRADNCFNRTSLEDKSSTKGKWS
                     HVEHIRKDIRDFKANNDLDKVIVLWTANTERYAEVLPNVNDTADNLLAAIRADHEEIA
                     PSTIFAVASILEGVTYINGSPQNTFVPGVVELAEKEKTFIAGDDFKSGQTKLKSVLAQ
                     FLVDAGIRPTSIASYNHLGNNDGYNLSSERQFKSKEISKRSVVDDIIASNQILYNDRL
                     GNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLI
                     VIAEFCSRISYKKVGSEQYDNFYSVLSFLSYWLKAPLTRKGFKAINGLNKQRSGLENF
                     VRILIGLPPLDELRFEERLQ"
     gene            complement(<948716..>952054)
                     /locus_tag="HG535_0B04820"
                     /db_xref="GeneID:59235101"
     mRNA            complement(<948716..>952054)
                     /locus_tag="HG535_0B04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287273.1"
                     /db_xref="GeneID:59235101"
     CDS             complement(948716..952054)
                     /locus_tag="HG535_0B04820"
                     /inference="similar to AA sequence:RefSeq:NP_012643.3"
                     /note="similar to Saccharomyces cerevisiae CPA2 (YJR109C);
                     ancestral locus Anc_7.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143168.1"
                     /db_xref="GeneID:59235101"
                     /translation="MTSIYKSSEPTISTFNTPYYKPQLVEGVESVLVIGSGGLSIGQA
                     GEFDYSGSQAIKALKEAKKKTILINPNIATNQTSHSLADKIYYLPVTPEYITYIIERE
                     RPDAILLTFGGQTGLNCGVALDKMGVLKKYNIKVLGTPIKTLEMTEDRDLFAQALTEI
                     NIPIATSFACETIDDALKAADEVGYPVIVRSAYALGGLGSGFSNNGDELRELAAQSLS
                     LSPQILVEKSLKGWKEVEYEVVRDRVDNCITVCNMENLDPLGIHTGDSIVFAPSQTLS
                     DEEYHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATG
                     YPLAYTAAKIGLGYTLPELPNPITKTTVANFEPSLDYIVAKIPKWDLSKFQYVNRDIG
                     SAMKSVGEVMAIGRNFEEAYQKALRQVDPSFLGFQGSNEFGDKLDEALASATDRRALA
                     VGQALLHENYTIERVHELTKIDSWFLQKCMNIVRMYKQLEAVNSLDALEKDLLRNAKK
                     LGFSDKQIAISISKDSKTVGELEVRKLRKSFDIIPFVKRIDTLAAEFPANTNYLYTTY
                     NAIKSDVEFDDNGMLVLGSGVYRIGSSVEFDWCAVNTAKTLREQGKKTVMINYNPETV
                     STDFDEVDRLYFEELSFERVMDIYELENSEGCVISVGGQLPQNIALKLYENGCNTLGT
                     NPNDIDNAENRHKFSSILDSINVGQPDWTEVTSIEEAKLFSRRVTYPVLVRPSYVLSG
                     AAMSVVNSEHELEDKLTLASDVSPDHPVVLSKFIEGAEEIDVDAVAYNGQVLVHAISE
                     HVENAGVHSGDATLILPPQTLSEETKAALKDIAHRVAHAWKITGPFNMQVIKDGDKLK
                     VIECNIRASRSFPFVSKVLGVNFIEIAVKACLGGDKVPEPVDLMAKKYNYVATKVPQF
                     SFTRLAGADPYLGVEMASTGEVASFGTNALESYWTAIQSTLNFHVPLPPSGILFGGDV
                     KKDFLGEVIKSVSNLGFNFYVANEEVKKYLQSYTDENISVIEFPKNDKRKLREVFQKY
                     DIKAVFNLAAKRAENTLDEDYVMRRNAIDFAIPLFNEPQTAILFAKSLKAKLAEKIKI
                     LESNDVIVPEEVRSWEEYVGFRPV"
     gene            <952906..>953854
                     /locus_tag="HG535_0B04830"
                     /db_xref="GeneID:59235102"
     mRNA            join(<952906..952935,952994..>953854)
                     /locus_tag="HG535_0B04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287274.1"
                     /db_xref="GeneID:59235102"
     CDS             join(952906..952935,952994..953854)
                     /locus_tag="HG535_0B04830"
                     /inference="similar to AA sequence:RefSeq:NP_009503.1"
                     /note="similar to Saccharomyces cerevisiae SEC17
                     (YBL050W); ancestral locus Anc_7.493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143169.1"
                     /db_xref="GeneID:59235102"
                     /translation="MSDPVELLQRLIRQAEKKGTPSSGFLKMFSGSDSYKYEEAAELC
                     IQAANLYRLRRELKLAGDSFLKAAEYQLKAKNDDEAANTFVETYKSYKSSGEYTNAVD
                     ALGSAIEIFTKRGQFRRGANFKFEMGELLENELSDYPKAIESYETAGEWYAQDQALAL
                     ANKCLIRCADLKALDANYIEAGEVYAKLIKNSVGNRLSQWSLKDYYFKMALCQLAATD
                     IVAATRTVQEGKNTDANFADSREAALAQDLIECVREGDSEALSEKVFNFDKFNKLDKW
                     KTTILLKVKETITEADDDLL"
     gene            <954514..>954987
                     /locus_tag="HG535_0B04840"
                     /db_xref="GeneID:59235103"
     mRNA            <954514..>954987
                     /locus_tag="HG535_0B04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287275.1"
                     /db_xref="GeneID:59235103"
     CDS             954514..954987
                     /locus_tag="HG535_0B04840"
                     /inference="similar to AA sequence:RefSeq:NP_009504.1"
                     /note="similar to Saccharomyces cerevisiae MOH1 (YBL049W);
                     ancestral locus Anc_7.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143170.1"
                     /db_xref="GeneID:59235103"
                     /translation="MGLRYSAYIESPSPHSEVDSSDYLRTNSSLYHLLADSRRMHFSH
                     SSQGRCHRECSNSKFITYGCRRCRTHLSSSTQIMSKDYRGKTGDAYLMGEVVNVIQGE
                     VETRPMITGDYIVCDILCHWCKSLLGWKYLESERKDQRYKEGKYILELQTICRCE"
     gene            <955551..>957581
                     /locus_tag="HG535_0B04850"
                     /db_xref="GeneID:59235104"
     mRNA            <955551..>957581
                     /locus_tag="HG535_0B04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287276.1"
                     /db_xref="GeneID:59235104"
     CDS             955551..957581
                     /locus_tag="HG535_0B04850"
                     /inference="similar to AA sequence:RefSeq:NP_012644.1"
                     /note="similar to Saccharomyces cerevisiae YMR1 (YJR110W);
                     ancestral locus Anc_7.491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143171.1"
                     /db_xref="GeneID:59235104"
                     /translation="MEYIKIAKVDDVLLHRKGNVIKGSLHLTTHHLIFTSTSLNREFW
                     VSYPTIGSVFKNHGSALLAKMDKMEPSGITNSYTDYYKEEDLWSFTNIKIVGKDYTVF
                     SIDFCDAVEARGVYESLIKLTVLNDITQLYAFIFKPNNAEKNIDSWRIYNVVKEFERQ
                     GLNLDFEGGPWRICNINEDYRFSPTYPSKIIVPSQVSDTLLTHAVKYRSQGRIPALTY
                     YYKKTGCTITRSAQPLTGLTKQRSVQDERLASEIFQASRVIATEFATQQKNIIVDARP
                     ITNAMAQAALGGGTESMENYNFNKTCSRTFLGIDNIHVMSETLNNVVDNFLVDGDLNI
                     PIDKVLLNSGKSSNWLKYVKLLLSSTDKLTKSIIFNNSNILIHCSDGWDRTAQVCSLV
                     QICLDPYYRTMEGFMVLVEKDWLSFGHRFQERTGVLSSESIFHDNTVGFSGVSNPLSQ
                     SNTTDFNSSSTLFGKDGNELSEMESTINISPSSVLNTDIVNKVSEHFKRKKKNRKIMK
                     FTSPIFQQFLDCVYQLLHQNPDLFQYNERFLRRLVYHLYSCQYGTFLYNSEKARVEGD
                     AFIKTRSVWDYFRSRKEEFTNKNYSPEISLKSENDAEVVEDWILPDLQKIQWWSQLYG
                     RKDSEMNGIAVKDDSSHGSITNAMGNDQVKKEVSRSSGIKFPTFGFDFFGKK"
     gene            complement(<957700..>958551)
                     /locus_tag="HG535_0B04860"
                     /db_xref="GeneID:59235105"
     mRNA            complement(<957700..>958551)
                     /locus_tag="HG535_0B04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287277.1"
                     /db_xref="GeneID:59235105"
     CDS             complement(957700..958551)
                     /locus_tag="HG535_0B04860"
                     /inference="similar to AA sequence:RefSeq:NP_012645.1"
                     /note="similar to Saccharomyces cerevisiae YJR111C;
                     ancestral locus Anc_7.490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143172.1"
                     /db_xref="GeneID:59235105"
                     /translation="MNQLLNAQRLVQVSQFHPKLQNIWYLVAAVTFSVCNQPQEIPKI
                     YHYVMLLNNNNSDHHDPSTLANRTIETLQNDRMNLRKVIDEKFPQPTQLQRQLTEKFR
                     EALLKTGPLAGLPKAINVLSNLRDVTPTALLPSSQEIDPFKAERGEGPLYSDSVMEIH
                     AADSNKSKERDLKGIEHWNHLYTKVSKRIVNNINSACPDLWYYIMEHVYGPLLSCDDI
                     LSKQETSFIVIASLVPQDVNPQLRGHLKGALNIGCDPNTIEAVRALAVLISQWCGVSW
                     KGEIVKL"
     gene            <958690..>959292
                     /locus_tag="HG535_0B04870"
                     /db_xref="GeneID:59235106"
     mRNA            <958690..>959292
                     /locus_tag="HG535_0B04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287278.1"
                     /db_xref="GeneID:59235106"
     CDS             958690..959292
                     /locus_tag="HG535_0B04870"
                     /inference="similar to AA sequence:RefSeq:NP_012646.3"
                     /note="similar to Saccharomyces cerevisiae NNF1 (YJR112W);
                     ancestral locus Anc_7.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143173.1"
                     /db_xref="GeneID:59235106"
                     /translation="MVEAQHIRFLRLNQVFNKALSQSVAKLENWEKLCSCFPEYCATK
                     EGAANLSNCQRQVIEFWTELCKREFEDILVERDVKAKLDDLDDLVFEANERLRTTSTG
                     DEPHCTPLDKLSSEQLVACTVYGERRAAVEELQERLNTINSLNKGLQEELQELEQNLN
                     AGRKDIEVLCDKYLGKTIESPLDETLVQGLSDMLLELRDA"
     gene            complement(<959443..>963486)
                     /locus_tag="HG535_0B04880"
                     /db_xref="GeneID:59235107"
     mRNA            complement(<959443..>963486)
                     /locus_tag="HG535_0B04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287279.1"
                     /db_xref="GeneID:59235107"
     CDS             complement(959443..963486)
                     /locus_tag="HG535_0B04880"
                     /inference="similar to AA sequence:RefSeq:NP_009506.1"
                     /note="similar to Saccharomyces cerevisiae EDE1 (YBL047C);
                     ancestral locus Anc_7.488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143174.1"
                     /db_xref="GeneID:59235107"
                     /translation="MSSITFKTPLTSDESKFFVDEFRKLDKEDLGIVTGEAAKPLFAA
                     SKLSAQILSQIWALVDINNKGFLNQDEFSAALRTMAHLQQYPNLPVTADLYAQPSPRL
                     LVLNGSVPPLVQTPTANLSTSAAQAPGQIPAVSGQDISKFSQLYERAANGAPTLAGDK
                     AKEIFLKARLPNQVLGSVWGLCDRNASGSLDKPEFIMAMHLIQLLMTNNPAVNPLPSS
                     LSPQAWSSVEANNIAVPATPLSANSTGRSSLARQGTITRLSSGVFTNASTDWLLTPEK
                     KQQFDAFYDSLDKSRAGALSSEVLVPFFLSSRLNQETLASIWDLADIHNNAEFSKVEF
                     AIAMFLIQKKNAGVQLPDVIPDQLLQSPALGLYTQQQPAHIAVPSRDTKPSFQESPQQ
                     HPQQRPQQTRNNSNNGSLSDLLALNSSFASPTQPQLQQRHSSFSGNQDLSVGSTPSAL
                     GNHSAMRSYPGQPDWGQDAIKEADEDLAFHQQPPQQIPQQVPQQVPQQVPQQVPQQVP
                     QQVPQQVPQQAPQQVPQQAPQQALPEQQQAQSVMQSNSAPQQAPRTSSVNLSSVPNFA
                     SLNMPMAAASAVGGLVGGAIGSVTSGLHRQTQNNNQDLFADSEASAQLSSATTEMANL
                     SNQVNSLSKQATITNDKKNRAEQELRRVNEMKASIENKLATLRNTHENNVKKTEQMEA
                     QLVEANRTTESLNQQLSVTEGNYHATESKLSALSSELDEAQQRNAKLKEQISGLNTMA
                     AGMQTQLSEKQQDVKQQRSLVDVNTKQLEVSQLTVANLESEIQGLTEKVEVYLTKRKE
                     LNDYQKTVEEQHSQLEAKYKELEAKNNDLNARTQALDERNQEVEEQEKLYEQHVSQLQ
                     AMFEDLTKRKNTLDAAEEDLKQQHIEYARNIQSLTENQIRIGMGEIPEEAAISNSNSR
                     EKETANHGLNEGEVSKFVEDSVVNSKLGRGQNDEEERPESEVFDKDVPTTGSQTEADD
                     DSEAADRINETERAVNLADRFEGDLNEYGIPRTQSLTSSVANNAPQSVVDDIELPQTL
                     EEAAGQNVNAIKGDSKTYPQIPGQWDSSVGERQVDQQSKMETLKNDGAQDENPNSSGD
                     SIKQSPLIVSPVPHGGDLPDSQDFRTPTNTDDIDEEFPPIKELDIHESDSSSSEEEFE
                     DTKDHIPNDNAATIVNPTVPVTTKDEFDDAFAGLEQAADEEDFNSAGDEDQNEGSMEE
                     FEKIEHQDLDEELQHNGFTGTSLGNDSNAKTHAGTMEGFAPHVTTTEDVTNDEWDEIF
                     AGFGNSKQPTGKTTSSGLEVQQPVGTKPGKISANSPINRKVATTPKSLAVEELSGMGF
                     TEEEAHSALEKCKWDLEAATNFLLDSA"
     gene            <963727..>964165
                     /locus_tag="HG535_0B04890"
                     /db_xref="GeneID:59235108"
     mRNA            join(<963727..963795,963797..>964165)
                     /locus_tag="HG535_0B04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287280.1"
                     /db_xref="GeneID:59235108"
     CDS             join(963727..963795,963797..964165)
                     /locus_tag="HG535_0B04890"
                     /inference="similar to AA sequence:RefSeq:NP_878107.1"
                     /ribosomal_slippage
                     /note="probable ribosomal frameshifting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143175.1"
                     /db_xref="GeneID:59235108"
                     /translation="MLWSLNKKFLIIFSASSLVCLYLGVSTDSKYISSINEHDKILHL
                     VSFLIESLLFVKLFDGENVVIVNPMCPSEFDLNSGQLQHRRRVEIKKYKLAFIVCTVS
                     AAIGSEFLQSIVSSGKRVFDYKDILYNMLGSALGITLARYQER"
     gene            complement(<964251..>965048)
                     /locus_tag="HG535_0B04900"
                     /db_xref="GeneID:59235109"
     mRNA            complement(<964251..>965048)
                     /locus_tag="HG535_0B04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287281.1"
                     /db_xref="GeneID:59235109"
     CDS             complement(964251..965048)
                     /locus_tag="HG535_0B04900"
                     /inference="similar to AA sequence:RefSeq:NP_012647.1"
                     /note="similar to Saccharomyces cerevisiae RSM7 (YJR113C);
                     ancestral locus Anc_7.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143176.1"
                     /db_xref="GeneID:59235109"
                     /translation="MMWRLSRINLLQRVVVRNIGQCHVRPITAGAVGIRFQSTHTANN
                     DTTEQERTSHLEDSEVEKWLAAIQSLKAEFSEQAFLPETSLAPPGQSRIDIVDEVMSK
                     GKQFEPTKEQLEELESLKDFAIPERHDAILGHITNMIMRHGKKQRAEKILSRALYLVF
                     CQIRKDPVEVLKKALDDLAPLMMVKTFNTGVAKAAVIPVPLNQKQRHRIAWKWIVEGT
                     QKRASSDFAVRLGEELVSVYKGNSSGFEKRDQLHKTAIAHRSYIRLK"
     gene            <965346..>966668
                     /locus_tag="HG535_0B04910"
                     /db_xref="GeneID:59235110"
     mRNA            <965346..>966668
                     /locus_tag="HG535_0B04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287282.1"
                     /db_xref="GeneID:59235110"
     CDS             965346..966668
                     /locus_tag="HG535_0B04910"
                     /inference="similar to AA sequence:RefSeq:NP_009507.1"
                     /note="similar to Saccharomyces cerevisiae PSY4 (YBL046W);
                     ancestral locus Anc_7.485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143177.1"
                     /db_xref="GeneID:59235110"
                     /translation="MRDMTLPGPKLEGSVSDVDINMMGIKSPQLYHFLKTVIEERGLE
                     ALQKVKANEILPDLVHHMSVTIPNDILGNYSNRNENDFRHLKETLAKFGEYLLKNFSV
                     EQKYPFTILRICELCYDPLKYYKIHELRKFVGAISKCCIVRSSWQYFEESDGFYTDRE
                     NDEEQGEDVSLTKIPWVDEEAEKELAPFLKEIDALVSPNLGYEEDEEDEDMDVDTNDS
                     TNGSGDFRIEEYYENLPRSSNGVADDDFDDDYDDDDYDDDYVETPTSDDNEQWTEDSI
                     EENLNELDDNNEDERDNCHEDTGSEVVASGFNDPVEESDNIPPSKRKPTELDDFEYKE
                     SPNAVETHLLATPKKVKHDKGNRILESPSIIDSDNDENTTPLQSQETLPDKRSRSQSP
                     SSEHHVPILVSPRENYDDKQVPQEGKLRDLMDETYDRDTGSPLSNKNR"
     gene            complement(<967019..>968368)
                     /locus_tag="HG535_0B04920"
                     /db_xref="GeneID:59235111"
     mRNA            complement(<967019..>968368)
                     /locus_tag="HG535_0B04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287283.1"
                     /db_xref="GeneID:59235111"
     CDS             complement(967019..968368)
                     /locus_tag="HG535_0B04920"
                     /inference="similar to AA sequence:RefSeq:NP_009508.1"
                     /note="similar to Saccharomyces cerevisiae COR1 (YBL045C);
                     ancestral locus Anc_7.484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143178.1"
                     /db_xref="GeneID:59235111"
                     /translation="MLRTSNLRSVSQLLKRSIATQAAPKAQITELSNGIVVATKPNAA
                     SLTSSVGIVFGSGSTAENPYNNGVSNILSSAFTSSGNLAEAEKLGFSLESAVGRDYQS
                     YIVNSTPGKVAKSLDFLQSKISAPLSDKSFETTKSIVLRNVGQFETNDHAIRVMEHLH
                     ATAFQNTPLSLPTRGTTETLETLVKSDLEAFAKQHFSSANAVVVGSGNLEHDELVKSV
                     EKQISLQSGSKLYPKAPSSFLGSEVRLRDDTLPKAWISIAVEGEPVTSPDFFTAQLAA
                     QIFGTYNSFEPSSRLQGTKLIDEVQEYQICDSFNHFSLSYQDAGLWGFSTVTSNITSI
                     DDLVHFTLKQWNRLTTSITETEVSRAKALLKLKLASEATDNSSIATHLGVATLAKFPQ
                     LDYNEVFAKINGLTVKDVKQWAGKRLWDQDIAISGSGQIEGLLDYARIRNDMSMMRW"
     gene            <969825..>970502
                     /locus_tag="HG535_0B04930"
                     /db_xref="GeneID:59235112"
     mRNA            <969825..>970502
                     /locus_tag="HG535_0B04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287284.1"
                     /db_xref="GeneID:59235112"
     CDS             969825..970502
                     /locus_tag="HG535_0B04930"
                     /inference="similar to AA sequence:RefSeq:NP_009510.1"
                     /note="similar to Saccharomyces cerevisiae ECM13 (YBL043W)
                     and YJR115W; ancestral locus Anc_7.483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143179.1"
                     /db_xref="GeneID:59235112"
                     /translation="MSATVSISQQYLLASKARAKLMRCAATDSNKDYNLRVLVGHANL
                     LDRVMESVDSYNTRITKSSMCQGHSVRSRSDSGHNDGRTQVDYFSSDDDDDDYSSSSS
                     DSEYDDDDDSSASDSDCREDEYDFSQPPKYIHSSSATRPQQPAVSVVTVTIDQCLDDK
                     DYDDYNSDTDSDSEGSPISSNMEQDLSMMPLTLQAKVAHEHPRHYHILHTSLDNHELG
                     EVTPIQV"
     gene            <970864..>972603
                     /locus_tag="HG535_0B04940"
                     /db_xref="GeneID:59235113"
     mRNA            <970864..>972603
                     /locus_tag="HG535_0B04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287285.1"
                     /db_xref="GeneID:59235113"
     CDS             970864..972603
                     /locus_tag="HG535_0B04940"
                     /note="ancestral locus Anc_7.482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143180.1"
                     /db_xref="GeneID:59235113"
                     /translation="MEEKSDLSPLDGKPYRKDEGKKLVLVKMALLAAILFLVHTFFCQ
                     TLNSHNYSGEVELFKCQEFESVFGASAENISNIIFNEKLQNETMTKLANAVRVPTEIY
                     DTFPNPQDEAEYAGWQPFIKLHKQLAKDFPLVWSKCKIEHVNHYALLITWEGSNNDLK
                     PALFAAHQDVVPVDRKTWGSWKHEPFGGEWDGQFLWGRGSFDDKNMLIGILQAFEYII
                     QNEPDFNPERSLLLASGFDEEASGVYGARYLSDVLVERYGHDGIYSIIDEGVVGIKEV
                     EGVLIAAPGTGEKGFINLVFDIRTPGGHSSVPPDHTSIGVAASIIHDIEGEKFPAQFT
                     PENPVTQYYQCIAQYSETMENDVKIDFLKAMDDEKANKRVLDYLFEHGGKKTEYLFRS
                     TQAFDIINGGIKANALPESVSFLLNSRVSIESNVNKTLEKFSESSCNVAKEYGLGCIL
                     DGEVILESTNKGTVYMDVQRTLEPAPVSPNNEVWREFAGSIKGFYESVVFPKKFGDEQ
                     KSLVVAPSIMTANTDTCHYWRSSKNIYRYQPGFAMDDTLSTIHSVNEHVDAETVMHVV
                     GFIYNYIHLVNKL"
     gene            complement(<973074..>974918)
                     /locus_tag="HG535_0B04950"
                     /db_xref="GeneID:59235114"
     mRNA            complement(<973074..>974918)
                     /locus_tag="HG535_0B04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287286.1"
                     /db_xref="GeneID:59235114"
     CDS             complement(973074..974918)
                     /locus_tag="HG535_0B04950"
                     /inference="similar to AA sequence:RefSeq:NP_009511.1"
                     /note="similar to Saccharomyces cerevisiae FUI1 (YBL042C);
                     ancestral locus Anc_7.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143181.1"
                     /db_xref="GeneID:59235114"
                     /translation="MSITSSSLRRTNGSSDEYTGEKFPSAAKAQVVGVSSETNSNDDN
                     DSVCSDVSKKGKVKTAWDKIIDLIEVKHPDGEGRVASKSVLESFVYNGELTPVEAKRR
                     QWSWKQYVFFWISGTFNVNTWQISATGLQLGLNWWQTWICIWVGYLCVAVFIVLASRV
                     GNMYHLSFPSSCRVAFGTYFSVWVVLNRVVMACVWYSTQAYLGGICLQLCFRSIFGNN
                     LNQRMGDTIPSENLTNFELMCFILFWAVSLPFLWFPPHSLRYLFAAKSFITPIGAFAF
                     LIWCVRKCNGTLSMSALNDNSGMNQAATAWAVIRSIMSSMDNFSTLVLNAPDFSRFGK
                     TPRSSMLSQFIVIPVCFAVISLLGIICVSAAYTLYGINYWSPLDILSRFLGGFSKGDR
                     AGVFLIAFSFAFDQLGANLSNNAIPAGTDMTAILPKFINIRRGAFICACISLAICPWN
                     LLASSSKFTTALSAYAVFLSAIAGVIFADYYIVRKGYVNIYHCYSNLPGTFYMYNRYG
                     TNWRAVVSYVIGIVPNFPGFLGSVGLSVPIGAMRVYYLNYFVGYLISAITYVTLVYFF
                     PVNGIPGNPKITDKVWLEEWVEVEDFAYEREQFEKNFNSLSYQEPKFA"
     gene            <976066..>976794
                     /locus_tag="HG535_0B04960"
                     /db_xref="GeneID:59235115"
     mRNA            <976066..>976794
                     /locus_tag="HG535_0B04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287287.1"
                     /db_xref="GeneID:59235115"
     CDS             976066..976794
                     /locus_tag="HG535_0B04960"
                     /inference="similar to AA sequence:RefSeq:NP_009512.1"
                     /note="similar to Saccharomyces cerevisiae PRE7 (YBL041W);
                     ancestral locus Anc_7.480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143182.1"
                     /db_xref="GeneID:59235115"
                     /translation="MASTIASEYSSEVASTPIEHQFNPYTDNGGTILGIAGEDFAVLA
                     GDTRHTTDYSINSRHESKVFDCGDNIIMSANGFAADGEALVKRFKNSVKWYHFDHNDK
                     KLSLSSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGSVYSFDPVGSYEREQCRAGG
                     AAASLIMPFLDNQVNFKNQYEPGTDGKVKRPIKYLSLEEVIKLVRDSFTSATERHIQV
                     GDGLEILIVTKDGVRKEYYDLKRD"
     gene            complement(<976970..>977626)
                     /locus_tag="HG535_0B04970"
                     /db_xref="GeneID:59235116"
     mRNA            complement(<976970..>977626)
                     /locus_tag="HG535_0B04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287288.1"
                     /db_xref="GeneID:59235116"
     CDS             complement(976970..977626)
                     /locus_tag="HG535_0B04970"
                     /inference="similar to AA sequence:RefSeq:NP_009513.1"
                     /note="similar to Saccharomyces cerevisiae ERD2 (YBL040C);
                     ancestral locus Anc_7.479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143183.1"
                     /db_xref="GeneID:59235116"
                     /translation="MNPFRFLGDLSHLASILILIHTIRTSNSIEGMSLKTQALYVLVF
                     LSRYMDLLVLHWVSLYIFVMKIFFIASSIYILQLLQRTKTTNRIAYKEMLLRDNFNIR
                     YLLIPCVILALVFNREFTIIEIFWSFSVWLESVAILPQLFMLSKSGKAKSLTIHYIFA
                     LGLYRTLYIPNWVWRYFAESKFDKLAFLTGVIQTLVYSDFFYIYYQKVIKRKGADLLH
                     "
     gene            complement(<977877..>978917)
                     /locus_tag="HG535_0B04980"
                     /db_xref="GeneID:59235117"
     mRNA            complement(<977877..>978917)
                     /locus_tag="HG535_0B04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287289.1"
                     /db_xref="GeneID:59235117"
     CDS             complement(977877..978917)
                     /locus_tag="HG535_0B04980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143184.1"
                     /db_xref="GeneID:59235117"
                     /translation="MRLMCQWMVLVMAVKCAAGMLHEFSTTKDLYGELLSTDRYSFVY
                     IYSPKCPWCKELMPKFEMLSSFFNGALNFIMIDGRKCRILDKDFNVDTYPYLMLFEAK
                     ENLAGFQVEPELTPKNLLKGVYHGAGDVYRMAHYLTQLTGETPALPQPVHENIIELDK
                     LGPHADSDSLDYLDATSGASLVNILSFTSPWMDFYYQELFQSSRPSSLLVQNSQFFDD
                     KLKTFDIDGSQRSTSHLTNLFRVSHFPSLMLLPRNCGGSNSTVVRIEFHQYDSELLKK
                     EIQTVRRLTKLCIDGDQTALSNFVSDFHSISIYPSLEDMQQKVNDAAGKAYEIHEDES
                     DMEYISHAINDL"
     gene            <979019..>979402
                     /locus_tag="HG535_0B04990"
                     /db_xref="GeneID:59235118"
     mRNA            <979019..>979402
                     /locus_tag="HG535_0B04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287290.1"
                     /db_xref="GeneID:59235118"
     CDS             979019..979402
                     /locus_tag="HG535_0B04990"
                     /inference="similar to AA sequence:RefSeq:NP_878045.1"
                     /note="similar to Saccharomyces cerevisiae YBL039W-B;
                     ancestral locus Anc_7.478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143185.1"
                     /db_xref="GeneID:59235118"
                     /translation="MLDGRKGTMQGVQRIPSPFSSCTSRPAASLQVRMAKLTLGKTSD
                     IRDKNLVHLHSNHSSRAGATSQLSRMGFFVDNPLIEFFHRIVRKPSTIMMWLFTSVIV
                     ASTTYLMFLPGAKQQPRPPSQDDNM"
     gene            <980087..>980551
                     /locus_tag="HG535_0B05000"
                     /db_xref="GeneID:59235119"
     mRNA            <980087..>980551
                     /locus_tag="HG535_0B05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287291.1"
                     /db_xref="GeneID:59235119"
     CDS             980087..980551
                     /locus_tag="HG535_0B05000"
                     /inference="similar to AA sequence:RefSeq:NP_012638.1"
                     /note="similar to Saccharomyces cerevisiae SOD1 (YJR104C);
                     ancestral locus Anc_7.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143186.1"
                     /db_xref="GeneID:59235119"
                     /translation="MAKAVALLKGDSGVSGVVYFEQEKEEDLTNISWEITGNDANALR
                     GFHIHEFGDNTNGCTSAGPHYNPFGKTHGAPEVEQRHVGDMGNVSTDASGVARGSMKD
                     RLIKLIGPTSILGRTVVIHGGQDDLGKGGNEESLKTGNAGGRNACGVIGITK"
     gene            complement(<980666..>982396)
                     /locus_tag="HG535_0B05010"
                     /db_xref="GeneID:59235120"
     mRNA            complement(<980666..>982396)
                     /locus_tag="HG535_0B05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287292.1"
                     /db_xref="GeneID:59235120"
     CDS             complement(980666..982396)
                     /locus_tag="HG535_0B05010"
                     /inference="similar to AA sequence:RefSeq:NP_009514.1"
                     /note="similar to Saccharomyces cerevisiae URA7 (YBL039C)
                     and URA8 (YJR103W); ancestral locus Anc_7.476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143187.1"
                     /db_xref="GeneID:59235120"
                     /translation="MKYVVVSGGVISGIGKGVLASSTGMLLKTFGLKVTSIKIDPYMN
                     IDAGTMSPLEHGECFVLDDGGETDLDLGNYERYLNVTLTKDHNITTGKIYSHVIARER
                     KGDYLGKTVQIVPHLTNAIQDWIERVSRIPVDDTGLEPDVCIIELGGTVGDIESAPFV
                     EALRQFQFRVGKENFALIHVSLVPVIHGEQKTKPTQAAIKDLRQLGLTPDMIACRCSE
                     ELEDPTISKIAMFCHVGPEQVVNVYDVKSTYHIPLLLLEQKMMNYLLKRLQLDNITLT
                     AEDKQRGEELLEKWKSMTVNIEQSDKIVKIALVGKYTNLKDSYLSVIKALEHSSMKCR
                     TQLEILWVEASDLEPDSQETDKTKFHDAWNKVSTADGILVPGGFGIRGTEGMVLAAKW
                     ARESNVPYLGICLGLQIATIEFSRNVLGIKNGNSSEFLPDLPESDQVVVYMPEIDKDK
                     MGGTMRLGLRPTYFQDDCDWSQIKKLYGNRSSVEERHRHRYEINPELVPQLEKEGLIF
                     VGKDESGERCEILELKNHSYFVATQYHPEYTSKVLDPSSPFVGLVAASAGVLDRLYNG
                     EFEFHGKADF"
     gene            complement(<982759..>983394)
                     /locus_tag="HG535_0B05020"
                     /db_xref="GeneID:59235121"
     mRNA            complement(<982759..>983394)
                     /locus_tag="HG535_0B05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287293.1"
                     /db_xref="GeneID:59235121"
     CDS             complement(982759..983394)
                     /locus_tag="HG535_0B05020"
                     /inference="similar to AA sequence:RefSeq:NP_015371.1"
                     /note="similar to Saccharomyces cerevisiae MCM16
                     (YPR046W); ancestral locus Anc_7.475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143188.1"
                     /db_xref="GeneID:59235121"
                     /translation="MERAFALEQEHVQAYNELLRTLDTLYLLNNDLGTVTPEMKKTLE
                     IRRQLQVNLEKSASILRTIERVAARVDEDGNEIPQRVSTEDILADRLVKVMQENYEID
                     YKVKESLALEQQLATELREEKVKYLNSVQQYRQVCAHVKHQSGPKSDNASLSANSTDE
                     SHQSRQGDQVDKAGQVDEVDEVDEQIIINQNETLRQLLLALKIHAGYDPFI"
     gene            <983532..>984128
                     /locus_tag="HG535_0B05030"
                     /db_xref="GeneID:59235122"
     mRNA            <983532..>984128
                     /locus_tag="HG535_0B05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287294.1"
                     /db_xref="GeneID:59235122"
     CDS             983532..984128
                     /locus_tag="HG535_0B05030"
                     /inference="similar to AA sequence:RefSeq:NP_012636.1"
                     /note="similar to Saccharomyces cerevisiae VPS25
                     (YJR102C); ancestral locus Anc_7.474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143189.1"
                     /db_xref="GeneID:59235122"
                     /translation="MSSSATLPAIYSFPPFFTRQPNALIRKQQITSWIEVILQYCKLK
                     KCWSMTVEGSPVEGNPNDSNINPLTGGTDNSIFTNSEIQRSVPQVFVEEIWCQMCEEN
                     KAVGADQGPKDSSRYYILWRNFDSWASLVLQWFEDAGKLNQVVTIYELTQGDETMTWE
                     FHGMPEQLMAYCLKPLEQRNRATLINDERGKPIAVKVV"
     gene            complement(<984199..>984972)
                     /locus_tag="HG535_0B05040"
                     /db_xref="GeneID:59235123"
     mRNA            complement(<984199..>984972)
                     /locus_tag="HG535_0B05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287295.1"
                     /db_xref="GeneID:59235123"
     CDS             complement(984199..984972)
                     /locus_tag="HG535_0B05040"
                     /inference="similar to AA sequence:RefSeq:NP_012635.1"
                     /note="similar to Saccharomyces cerevisiae RSM26
                     (YJR101W); ancestral locus Anc_7.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143190.1"
                     /db_xref="GeneID:59235123"
                     /translation="MLRTLLSKRGIHTVPKLPNAAQLRQQGIPNVLSPAGLNVAWDQH
                     QKYICDKLTVATSGTSLESYLPFHLILNTAKKPFLTHVFNLASAAHNNHIFIENILPA
                     TNSATTQPSRLFLSSIEESFGFDWETLKTEMVRRAEADVLGQGWLFLVENSNKELHIL
                     TIQNNGTPYYFPRNQLFDLNSALTLEEFSHLEEIKKMINQSGKKKLEDWTIPLICVNL
                     WDQAYLHDYGVQNRSKYVENALNNLNWSVVNKRQYSDQS"
     gene            complement(985148..985247)
                     /locus_tag="HG535_0Btrna3L"
                     /db_xref="GeneID:59235343"
     tRNA            complement(join(985148..985192,985209..985247))
                     /locus_tag="HG535_0Btrna3L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /db_xref="GeneID:59235343"
     gene            <986698..>987714
                     /locus_tag="HG535_0B05050"
                     /db_xref="GeneID:59235124"
     mRNA            <986698..>987714
                     /locus_tag="HG535_0B05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287296.1"
                     /db_xref="GeneID:59235124"
     CDS             986698..987714
                     /locus_tag="HG535_0B05050"
                     /inference="similar to AA sequence:RefSeq:NP_012634.3"
                     /note="similar to Saccharomyces cerevisiae YJR100C;
                     ancestral locus Anc_7.472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143191.1"
                     /db_xref="GeneID:59235124"
                     /translation="MSLTGTIKRSLSSFTHNAVKNGAFRRLAAKKAQPTRIVRPWESP
                     ENSNTETTFIQPHHPIATRILNEPTIIVERQLEMMNVFLGFEQANKYAILDVMGNRIG
                     YMQERDFSFMKSIMRQVYRLHRPFTVDVFDNWGNVILTIKRPFSWINSHIKAFLPPVT
                     TVEQNYLESPAKSSAVSSKTFGGSSGVPIPQVIGESASEGILVGESIQNWHLWRRRYE
                     LFQREKGSDGSFSEFGQIDAPFLSFDFPVSDEKGKIIAGVDRNWVGLGREMFTDTGVY
                     IVRFDSSQSFDGVHPPEVIGDSVLNLDQRAVLLANALSIDFDYFSRHSGHGGGLLSFG
                     SYDD"
     gene            <988057..>989610
                     /locus_tag="HG535_0B05060"
                     /db_xref="GeneID:59235125"
     mRNA            <988057..>989610
                     /locus_tag="HG535_0B05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287297.1"
                     /db_xref="GeneID:59235125"
     CDS             988057..989610
                     /locus_tag="HG535_0B05060"
                     /inference="similar to AA sequence:RefSeq:NP_015370.1"
                     /note="similar to Saccharomyces cerevisiae YPR045C;
                     ancestral locus Anc_7.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143192.1"
                     /db_xref="GeneID:59235125"
                     /translation="MGSTYNEVSPLALGKSRNQRRSKDQKTRDDDSSYVPAPPPESPP
                     LRVEPPGFNTASIMGGSDPLQTAPTKRNRNGINNATSFMASVPAFSLPNAQLQRSLPI
                     PSASGTILEPQAGKSMNIYGGAGPLMSSTKAANNKFQVPLDSSVETRENFGLARVQEA
                     HLIKGNNKKRKMSNNMKSSKQLKEDASASSIEEQERRKKRAEKFRTSRDNSNNYNFDN
                     DENFANLNAISTKSHKFDKNNRIIGLCQDLEKSYLRLTSEPNPNLVRPLTVLKKTYAL
                     LMNKHKKKKASYQYLCDQFKSMRQDLRVQMIENQFTVKVYESHARIALENGDIGEFNQ
                     CQSRLIVLFELSSIKASFLEEFTSYRILYYTLTEDNGNINMLRLELIKKNPAVFSNRM
                     VKTAFDLAHARLMGDYHNFMKIYVSLETLGKKLVDAFIEKEYLRSLVTICKSYNQINL
                     DFLVSELKFEDKEALIEWFRKRELNKFLHIKNQGEENEYQLLDTKACRHAIVRQYSGS
                     KAIDIRGQQ"
     gene            complement(<989691..>990428)
                     /locus_tag="HG535_0B05070"
                     /db_xref="GeneID:59235126"
     mRNA            complement(<989691..>990428)
                     /locus_tag="HG535_0B05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287298.1"
                     /db_xref="GeneID:59235126"
     CDS             complement(989691..990428)
                     /locus_tag="HG535_0B05070"
                     /inference="similar to AA sequence:RefSeq:NP_012633.1"
                     /note="similar to Saccharomyces cerevisiae YUH1 (YJR099W);
                     ancestral locus Anc_7.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143193.1"
                     /db_xref="GeneID:59235126"
                     /translation="MSSERSVVPLESNPDIFTEFAHDLGLNENYSFIDVYSLTDRDLL
                     GFVPRPVKALILLFPLNAFFEDSKNKTPANKGDSEDNRGEATTNDQPVWFKQTIRNAC
                     GLYGLLHSLCNNADLLSKQSKLLEFLKAEPREDNKYCDSLTDDFVVKLSEKHSDKFSL
                     GQTVAPDAVDDVNLHFITFVRKEGEVYELDGRRADGAHLISSRTDPATDLIGQQSVID
                     RVQWYMENADEDSKLNFSLLGLAPSWD"
     gene            complement(<990845..>991705)
                     /locus_tag="HG535_0B05080"
                     /db_xref="GeneID:59235127"
     mRNA            complement(<990845..>991705)
                     /locus_tag="HG535_0B05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287299.1"
                     /db_xref="GeneID:59235127"
     CDS             complement(990845..991705)
                     /locus_tag="HG535_0B05080"
                     /inference="similar to AA sequence:RefSeq:NP_012630.1"
                     /note="similar to Saccharomyces cerevisiae YJR096W;
                     ancestral locus Anc_7.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143194.1"
                     /db_xref="GeneID:59235127"
                     /translation="MKMSSVPRYYKFSNGVKVPSLALGTYDIPRNSTASIVYQALKCG
                     YRHFDTAVLYGNEMEVGEGIYRWLKEDPVNNKREDVFYTTKLWNSQNGYTQAKKGIAE
                     CLDKIKKIGYIDLLLIHSPLSGPQKRLETYKAMQEAVEMRSVKSIGVSNYGKHHIEEL
                     LSWKDLVYKPVVNQIEISPWCMREELATWCQSKGIIVEDYAPLTHGYKLKDPELVKVA
                     HEVGRNTGQILIRWSLQKGYLPLPKTKNPDRLPGNIDVYNFELSPQQMEAIEHPEDYQ
                     PTDWECTDAP"
     gene            complement(<992405..>993358)
                     /locus_tag="HG535_0B05090"
                     /db_xref="GeneID:59235128"
     mRNA            complement(<992405..>993358)
                     /locus_tag="HG535_0B05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287300.1"
                     /db_xref="GeneID:59235128"
     CDS             complement(992405..993358)
                     /locus_tag="HG535_0B05090"
                     /inference="similar to AA sequence:RefSeq:NP_012629.1"
                     /note="similar to Saccharomyces cerevisiae SFC1 (YJR095W);
                     ancestral locus Anc_7.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143195.1"
                     /db_xref="GeneID:59235128"
                     /translation="MSQKKKASHPVVNLLAGGTAGLFEALCCHPLDTIKVRMQIYRRV
                     ADSGTRPPGFIKTGKNIYSEEGFLALYKGLGAVVIGIIPKMAIRFSTYEFYRTLLADK
                     QTGTVSTGNTFIAGVGAGISEAVLVVNPMEVVKIRLQAQHLSPAEPGMGPKYRNAVHA
                     CYTIVKEEGISALYRGVSLTAARQATNQGANFTIYSKLKEFLQDYHKTDVLPSWETSC
                     IGLISGAIGPFSNAPLDTIKTRLQKDKSASTDSGWKRIASIGAQLVKEEGFRALYKGI
                     TPRVMRVAPGQAVTFTVYEFVRRQLEDLGVFTPKDPPKPLK"
     gene            complement(<994044..>994632)
                     /locus_tag="HG535_0B05100"
                     /db_xref="GeneID:59235129"
     mRNA            complement(join(<994044..994320,994631..>994632))
                     /locus_tag="HG535_0B05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287301.1"
                     /db_xref="GeneID:59235129"
     CDS             complement(join(994044..994320,994631..994632))
                     /locus_tag="HG535_0B05100"
                     /inference="similar to AA sequence:RefSeq:NP_015368.1"
                     /note="similar to Saccharomyces cerevisiae RPL43B
                     (YJR094W-A) and RPL43A (YPR043W); ancestral locus
                     Anc_7.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143196.1"
                     /db_xref="GeneID:59235129"
                     /translation="MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHAVYDCSFCGK
                     RTMKRGAAGIWTCASCKRTIAGGAYTPSTAAAATVRSTIRRLREMAEA"
     gene            <996404..>997240
                     /locus_tag="HG535_0B05110"
                     /db_xref="GeneID:59235130"
     mRNA            <996404..>997240
                     /locus_tag="HG535_0B05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287302.1"
                     /db_xref="GeneID:59235130"
     CDS             996404..997240
                     /locus_tag="HG535_0B05110"
                     /inference="similar to AA sequence:RefSeq:NP_012627.1"
                     /note="similar to Saccharomyces cerevisiae IME1 (YJR094C);
                     ancestral locus Anc_7.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143197.1"
                     /db_xref="GeneID:59235130"
                     /translation="MMADECMAADCFDETFNEKWNMDTHDDDSSMLDYESFLQTDVGD
                     YDDLDDFDDDEFFESSQLHRLIHTQPIHMINQNALFSCTADSMNTQPQELHTTIDTLF
                     PSNTSQSATTSRSSSLFSATLPPEEESRTASASYDFFDSIEEANDNFDEPLLDHKHDH
                     KPPACSNTNLQIQLNTLIPRSVPQKKVDLKLCLDMGSFSKQHETGTFYSGSNYHYSIK
                     SSHKQQNPPQALGEDSLLIRTLNAKLSRYAGYYTADSKDQEYSDKVRFQEISYKFSKT
                     YF"
     gene            <998013..>998927
                     /locus_tag="HG535_0B05120"
                     /db_xref="GeneID:59235131"
     mRNA            <998013..>998927
                     /locus_tag="HG535_0B05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287303.1"
                     /db_xref="GeneID:59235131"
     CDS             998013..998927
                     /locus_tag="HG535_0B05120"
                     /inference="similar to AA sequence:RefSeq:NP_012626.1"
                     /note="similar to Saccharomyces cerevisiae FIP1 (YJR093C);
                     ancestral locus Anc_7.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143198.1"
                     /db_xref="GeneID:59235131"
                     /translation="MSSSDDEDEQFLYGSDSENKSVDAKGQKRGLQTDDADNDKSVVK
                     KPKVSEKSTTSGVGTNQSDLSNDSSEADDDESVSSEEESDSDVEFIISTGADSTRLDS
                     ASTSTSAVGAQSSGISVATAPAETIPEAAQVADVNMVERSTTEAVPNGSIDLEAEGTF
                     EGQPITTLDPEVLKEKPWRQPGANLSDYFNYGLNEYTWMEYLHKQEKLQQEYNPHKIL
                     MGLLTLQQQGKLNGPNKMEQSTNNTGDMNNINSMHGNNMMNQHNGNRSMPPTGFPPLP
                     MFGGFPPFGMPGMMPPMNPNSNPNLQKK"
     gene            complement(<999038..>1003285)
                     /locus_tag="HG535_0B05130"
                     /db_xref="GeneID:59235132"
     mRNA            complement(<999038..>1003285)
                     /locus_tag="HG535_0B05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287304.1"
                     /db_xref="GeneID:59235132"
     CDS             complement(999038..1003285)
                     /locus_tag="HG535_0B05130"
                     /inference="similar to AA sequence:RefSeq:NP_012625.5"
                     /note="similar to Saccharomyces cerevisiae BUD4 (YJR092W);
                     ancestral locus Anc_7.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143199.1"
                     /db_xref="GeneID:59235132"
                     /translation="MTGELLGESEKAGEAGEAGEAINTLLTEIDNEMSVITEDEERRS
                     GWRIPLHEIGDETMEMIISHNTQSNTPLQAKSSVITGDIQLNDEAQGDKPLPTKKSVV
                     FSEGVSLHEWPAEKSDVKHNVAYESDENSEYCKSSCHEEPKQSNNTQWKQSKFSLNST
                     NSAEYKENQLLMYDTESEDEQEGDKKDTVLTKEELQEHTITERDQKLSHILDSKVNIH
                     KLKQLTDELNLRSNTAEDEESKSFKFILPPTEPLVASSTVDSQETSMIQFEGSERIGN
                     QYYSDDNESDSFSTNSVDGYVNEINHSPSKIPLTNTMDINNFQLDGTENEAQTRISSG
                     SSWGDSVTNLATIRHDRYDLLEYSSDIPKELQFKSNERKGSFNTSPIAANRNISQVFS
                     IATTADGYKSAKEVPSDLASIASDTKSNSDYKSAFRSVEDLGISMNLPREEETLQDIH
                     SRVENTIETCDFESTDEQNPDLYESRDVPQIPLLPLDFPSNFEHSKNSITENDCNETE
                     DDHMTHDEGERAELEFTDLHDLSDTVNENEQFSSEASLRKESKNVTDMQKEEEKNDNE
                     IESPTSDVDCPNIDAKAGETQVDQKDTRDQILLGTANRDDSKRCDMRFSESESKPILP
                     PVQRVASIFIDDPFGDEGDTSGESLDLTKSVKPSNYLSIWHMQEEDIKYSSPAMSSNS
                     QFSQYSVTTGTSAESSSHTPSTTPIESKYNKNTFKFKPRVISRSRFYSPDSKLEIPDY
                     ENDYVIANFETALDPLRRNTIISKRIQENIRNRRILHPRSASINEKLTYFPEAVATPE
                     EEPAKKTDTSITQESFHEENSFDRTTQDLSEQNLALSSTSDQLDLLPCTVDSELGKGF
                     VSFLETFDCDNKSTFSWQTHKEGSLNIWEDDHDLQWEIGDGRRKNASLEGINKLLADD
                     NLQIDNSSFVENPMTPKKNSAILKSPVKEVSVGRGLSVKGYEADVAENGESDRESVKF
                     TSFLASPNHRSSPQSGMKDTHVDSPFKILKAKKLEEHYCDLEEPPMEKEQASTPPTNA
                     DISAQFPLEKPQTVPLQTDNTASIKSETLAFPDKGTLYVKLKTVVNLPLHGLVHHNAK
                     FSVEFDNGENVVRTPWAAASNEKSIGVEKEFEIVLDSKVENLNTVVITLKCRYEKPQA
                     ELTEVVEKVPIPKKFMFGKNKYEYKKRYVQKQVKHDEWDYLFAQDGSFGRCEIRLDEA
                     FLNAIRFQEKFFSFNLTNEWSRKPDFNNLKKPIYELPRREPSTAATLNMEMCYLERSA
                     PLEKFPKTLQIAHNIVKKFQTQQAITKEGFMLQEGGDVHSRIQRRYFKLQGNNMVGYH
                     EITREPKVDINLLKVVNVFEPGNIPREGERNLTDLVLFGGSIRLTFENGEEIYFNSDT
                     ERDTESWYQVLRDVVDLNQCHQPWVKQLHEFTLLNSL"
     gene            <1004765..>1008106
                     /locus_tag="HG535_0B05140"
                     /db_xref="GeneID:59235133"
     mRNA            <1004765..>1008106
                     /locus_tag="HG535_0B05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287305.1"
                     /db_xref="GeneID:59235133"
     CDS             1004765..1008106
                     /locus_tag="HG535_0B05140"
                     /inference="similar to AA sequence:RefSeq:NP_012624.1"
                     /note="similar to Saccharomyces cerevisiae JSN1 (YJR091C)
                     and PUF2 (YPR042C); ancestral locus Anc_7.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143200.1"
                     /db_xref="GeneID:59235133"
                     /translation="MSDRKIASDERDDSVANGVNNSSNGGVLSNIPEIIDPGITIPIY
                     EEDYMSVSEGGNGSQLDQQQPQKLGSYRARAGKFSNTLSNLLPSISAKLHHSKKTSSQ
                     IKGGEGITNSTNVESTVGAKNPHTTPAKNKSYMPSFASVSLDGTGNLTPPQEMDKLVY
                     FPDSSYLMNAPRTSNDSYTFGQNASNKISRTRNNTVTSQITSMSSTAPNATSSSAIWS
                     TNQSPSDPLQQHIFQQFSGNTVNSNNMTSTSPLHEYSTNTAYFDTMMSASTAPTTAKI
                     PISNNNTASVTAMSNNGILSGHPSNTNGKNLTIPGSMWSHNNNINNRSRSHSNASSIY
                     TDASLYEQPARSRATSTYTLSQPAPHSSQDIPLIEDDVDPRSINWVTTDPAVQPINQI
                     SNLLPTNTISISNVFSLQQQQPQLLNTINLTSASLATLCSKYGTVISARTLSCLNMAL
                     VEFESTESAIRAYEALQGKEVSVIGAPSTVSFAKVLPMHPQAPNLVVSPINEAEIMQQ
                     PLLQEQLFNGTVSFHQQGNIALPVFNQQQHQQQQQQQPQQQEQQHQPLHMSQNLSYSL
                     THVSPNEKEQCPFPLPPPCFKEQEKAVCATLDLFGETYDQSQTAHVINNALKHKGTAE
                     TNNFGPLPDPIPARDFGAPKLRELRKNIDANLLSDLEIEQLAMAMLDELPELSSDYLG
                     NTIVQKLFMHSSDIIKDIMLRKTSKFLTSMGVHKNGTWACQKMISMARTPRQIMLVTK
                     GVENHCTPLFNDQFGNYVIQCVLKFGFPWNSFIFESIIANFWIIAQNRYGARAVRACL
                     EAHDIITTEQALVISAMIVQYAEYLATNSNGTLLVSWFLDTCTLTHRHSILAPKLSSH
                     IVELCRHRLASLTVLKVLNYRGDDSVRNDILKGIFGDVASDEPVQALHQILCDTNYGP
                     TFIYKVLTMSSLEGDVKTNVFKKVRQVLLDATPSQQHRRLMEEVGLMPANASSQTGQG
                     KHRSSISQVFNQDGNHLRGLSVSSVRSSGSRHNNLAPTTSGQGSTHTSSSATNTNINT
                     NNTGWNPSATSYMNYPGMFPNYHSNGYPVNSDELSNQFDSLTLNNNTHLSLPQLSLTN
                     QNNTTNLIYPVKSNTSQEMPHNMHG"
     gene            <1008748..>1012050
                     /locus_tag="HG535_0B05150"
                     /db_xref="GeneID:59235134"
     mRNA            <1008748..>1012050
                     /locus_tag="HG535_0B05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287306.1"
                     /db_xref="GeneID:59235134"
     CDS             1008748..1012050
                     /locus_tag="HG535_0B05150"
                     /inference="similar to AA sequence:RefSeq:NP_012623.1"
                     /note="similar to Saccharomyces cerevisiae GRR1 (YJR090C);
                     ancestral locus Anc_7.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143201.1"
                     /db_xref="GeneID:59235134"
                     /translation="MASNRGNETSNNVPAGLPASWFTSALPSRDSLTLQGRESLSHAH
                     RQRVSRITQNENVLRDIFRSNTRRTNTRSQGHGIEISFQSEPQNITNSLPIEFEDAES
                     NSQLAAANETSGAEEIAERDVDMLDGIPGILDLQAEDLRKLQTFQITLQQKVQAYLTV
                     IEKRRNGILGEIGIDNSKLEKMQLADSPQAINFLNKLQRIRLRAIETETMELQRLRMK
                     FLTVVEEYRKAMNEYCQARVEGREMQNPTDFFQHWIESLDPNEVSVSEGLQELSSCSK
                     LLMTNLLAATQFTKKPNFKNAVFPLNHLPSEILHLVLEKLSHKSDIGSLLTVCKLWAH
                     IIVKILYYRPHINKKLPLDLFMRTMSISSQQTVFGYRSMIKRLNFSFVGDHMHDEELY
                     HFVGCKNLERLTLVFCKHITSKSISEVLKGCKFLQSVDITGIKEISDDIFDTLAENCP
                     RVQGFYVPQAKNVTPRALKNFITHAPMLKRVKITANNNMNDEIVDLFAEKCPMLVEVD
                     ITLTPNVHDHSLLKLFSKLSQLREFRITHNTNVSDKLFVDLVKTVSLLPSLRLLDLSG
                     CENITDKTIERVVSLAPKLRNVFLGKCSRITDDSLHHLAKLGKNLQTVHFGHCFNISD
                     QGVRVLVQSCPRIQYVDFACCTNLTNRTLYELSDLTKLKRIGLVKCSQMTDEGLLNMI
                     SLRGRNDSLERVHLSYCSNLTIYPIYELLMACPRLSHLSLTAVPSFLRPDITAFCRLA
                     PSDFSENQRQIFCVFSGKGVHKLRHYLMSLTTPTSGPQTDLREILTKYIASKSMLHEN
                     EDMEEGINRITRELNQDTAAILAATGLSQINGVNNDFLFQNIDFDRLDNVFSWYEKTS
                     VNTRMTMEEIDRLVSMVDRKFCEDPFEEEYDDMDSIVAPGANPFFNKELCYIVRKLHE
                     VDDRVNDFEVNVASLARVQFQFTGFLLHEMAQIYMQMVELNRQTSQIQDRVYASENSS
                     DINGYSIWRLMFIEKFVDLLKKYKLSTVVLRLYLKDSITLLTRQREILLAQQRTSWHE
                     NGETNDPNLWQQFGDRIQISPDQMRIIQFGLRGQTALGANGLQDLPGTNNNDNTEDRA
                     ETPEDDTVLEES"
     gene            complement(<1012178..>1014308)
                     /locus_tag="HG535_0B05160"
                     /db_xref="GeneID:59235135"
     mRNA            complement(join(<1012178..1012867,1012869..>1014308))
                     /locus_tag="HG535_0B05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287307.1"
                     /db_xref="GeneID:59235135"
     CDS             complement(join(1012178..1012867,1012869..1014308))
                     /locus_tag="HG535_0B05160"
                     /inference="similar to AA sequence:RefSeq:NP_012622.3"
                     /ribosomal_slippage
                     /note="probable ribosomal frameshifting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143202.1"
                     /db_xref="GeneID:59235135"
                     /translation="MYANQLLDDEVISSMFNLETRLKSFKNTFVLEGKKYRWRYTVIP
                     YEAMARAGFFYYPIRHKDSGELHKDAVGCIFCKTCTYNFGDCRSKRKDTVETMISVIQ
                     QHLTTGCATCLLSRLKLFTLTDFAEEKPPREGENCDFFKDPLSEIMIDLRKFTFMGNW
                     PYSTGTLSPDNMAKAGLIRYDSSYTGFEEVVESNVRDASLCIFCKKVINSWQVDDDPL
                     WEHYKSCNGGQCYFFQMLQDSPAYNEILDNLRIRYAALETNKLSPPKACSSSTEQTPM
                     DFKSTLGIASTLGEREETNTELDIVKTGNDMEASKSTAASPKRKKRKLKASHTETFSE
                     RNNEEELDDNHANEELVIKFKEHIERAKDVGRKNKILDDSKDEFSFSIDGHSTFEIPT
                     ASAGFRARAHQGSKTVLENIEDHSISDSQSNNALAGQRAFELNGSLDILPMDVSLSSN
                     TSSLDTGESTPIHSPKSGIKEGSPPTTHNLGISESLKSAKLTLKHQESLGTRSESRSD
                     PKGFTSPFQGGLTAERAAIDNIPNFDRPYSSYEEPIDVSELDVDEEQQKREYSVITKI
                     ESQTPALHGNETITSSKSTTKIIPQADQLDDDPNFDESGEDKKLIRDYLHELLVYINR
                     NDATLAVDKNGDLSFFINKMPCNELDLSFANWLARRLEAVSHEFREETERKLETLRLQ
                     FESMRELILSVEDDQKLILMAKKFGIT"
     gene            complement(<1014820..>1016052)
                     /locus_tag="HG535_0B05170"
                     /db_xref="GeneID:59235136"
     mRNA            complement(<1014820..>1016052)
                     /locus_tag="HG535_0B05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287308.1"
                     /db_xref="GeneID:59235136"
     CDS             complement(1014820..1016052)
                     /locus_tag="HG535_0B05170"
                     /inference="similar to AA sequence:RefSeq:NP_015366.1"
                     /note="similar to Saccharomyces cerevisiae TIF5 (YPR041W);
                     ancestral locus Anc_7.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143203.1"
                     /db_xref="GeneID:59235136"
                     /translation="MSVNICRDNNDPFYRYKMPLIQAKVEGRGNGIKTAVLNVADIGR
                     SLNRPTPYIVKYFGFELGAQTSISVDKDRYLVNGVHEPAKLQDVLDGFINRFVLCGYC
                     KNPETVIIVTKDGDLVRDCKACGRRTPMDLRHKLSSFILKNPPDSMNGSKKTKKAATA
                     SANIRGGGVSISDIAQGKSQTSNGANGSSDGIPQVEDDDDDELARQINAAASTLQKIE
                     MKDDEWAVDMSEEAIRQRAKELQANIDAANGEMTKLEEFGEWILKEKEIEMPTDVEIY
                     KKAADFDILKDPKIACVLAQSMFDKDIVEEISEHSAFLAKVFVSAEYEKEFLGGLERF
                     LGIEHTALIPSLPKILVQLYNNDVISEEEIITFGSKCSKKYVPKDISKKVRRAAKSFI
                     DWLKNAESDEEDESDDDE"
     gene            <1016393..>1017268
                     /locus_tag="HG535_0B05180"
                     /db_xref="GeneID:59235137"
     mRNA            <1016393..>1017268
                     /locus_tag="HG535_0B05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287309.1"
                     /db_xref="GeneID:59235137"
     CDS             1016393..1017268
                     /locus_tag="HG535_0B05180"
                     /inference="similar to AA sequence:RefSeq:NP_012621.1"
                     /note="similar to Saccharomyces cerevisiae YJR088C;
                     ancestral locus Anc_7.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143204.1"
                     /db_xref="GeneID:59235137"
                     /translation="MANLAAIRERFLSLRETMSYTQFEGEYLRRLHDELKFYMGSGDP
                     GLSNSAHLGLMEMLFYIDVYLSKDVDAQVLYNTLRDRFGEDSPKLYAMKATLLQINDG
                     DQIAIEYIEKMLNEKLEYDTDSVSYVLLQKRLIAIKAPAHNNEWLLSQLLELSEKFPL
                     DSEIWWMLGNTYMELGQFESASYCYEEVVILLPFNYVAFAQLAEALYYKANRVDKLQA
                     KVNSTLQMALNNALRSVEISELYLKGWCFIAKITSLLNEKKELRNLSLSKISEIAKYS
                     NKQDQVTAKLILNKL"
     gene            complement(<1017339..>1018502)
                     /locus_tag="HG535_0B05190"
                     /db_xref="GeneID:59235138"
     mRNA            complement(<1017339..>1018502)
                     /locus_tag="HG535_0B05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287310.1"
                     /db_xref="GeneID:59235138"
     CDS             complement(1017339..1018502)
                     /locus_tag="HG535_0B05190"
                     /inference="similar to AA sequence:RefSeq:NP_015365.1"
                     /note="similar to Saccharomyces cerevisiae TIP41
                     (YPR040W); ancestral locus Anc_7.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143205.1"
                     /db_xref="GeneID:59235138"
                     /translation="MAEKRDIRRGPGIRTVEINAARQVHARTVRARIPIDIGAIDSQE
                     PATSTAISAPRFVQPALPQSSRQPSAAHSHVRHTCNNPRNPPCAHCGTMIVPSPVATL
                     PLEDHPSLTINNWTISTKKKPILNSQELEDWENNKLKGLTLPEMIFGNSFVRIQEKTR
                     NWSIEFNALDALREVKLKDSGIRVSYSKKWMDSKQQKQRQQQRLSIALGSSQPLSDID
                     DSALQIARHYDWTYTTKYKGTETSGSKKYKFKKDDSQTLPIDKLARPDHILFYDDMIL
                     FEDELADNGISIFNIKIRVMNERLLLLSRFFLRVDDVLIRVVDTRIVVEFDENKVIRE
                     YKEMEGDYKTLLTKHKMSHSHDPKAALRDSNWVAANIPLITRECEILNLNDPN"
     gene            <1018702..>1019388
                     /locus_tag="HG535_0B05200"
                     /db_xref="GeneID:59235139"
     mRNA            <1018702..>1019388
                     /locus_tag="HG535_0B05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287311.1"
                     /db_xref="GeneID:59235139"
     CDS             1018702..1019388
                     /locus_tag="HG535_0B05200"
                     /inference="similar to AA sequence:RefSeq:NP_015362.1"
                     /note="similar to Saccharomyces cerevisiae ERV2 (YPR037C);
                     ancestral locus Anc_7.456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143206.1"
                     /db_xref="GeneID:59235139"
                     /translation="MFQKIKNTAKHKQNTGILRYFITCDSRRRGTMKKSAGRNTFLLR
                     ISAALFIVGLWLYFSSVDLSYNKPTDGIRSPSTYQIKGGKESGIDSIMPSMPEQEAKE
                     ALGRASWKYFHTLLARFPDDPSEEEKQKLRSFLQLYAELYPCGECSHHFVKMLEKYPP
                     QVSSRVTAAIWGCHIHNKVNEYLKKPEYDCSTVLENYDCGCGDEDGKVREDLKLNNKV
                     TLEKEGIQRG"
     gene            complement(<1019463..>1019762)
                     /locus_tag="HG535_0B05210"
                     /db_xref="GeneID:59235140"
     mRNA            complement(<1019463..>1019762)
                     /locus_tag="HG535_0B05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287312.1"
                     /db_xref="GeneID:59235140"
     CDS             complement(1019463..1019762)
                     /locus_tag="HG535_0B05210"
                     /inference="similar to AA sequence:RefSeq:NP_012619.1"
                     /note="similar to Saccharomyces cerevisiae STE18
                     (YJR086W); ancestral locus Anc_7.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143207.1"
                     /db_xref="GeneID:59235140"
                     /translation="MSQNAAANGELRLKIKYLKLKRVNELNSKLRNELSRERITASNA
                     CLTLVNYVSTHRDYTLPELWGYPQPGSNRFANGLQQRNGQNLASSSDSMGCCTLM"
     gene            <1020336..>1020653
                     /locus_tag="HG535_0B05220"
                     /db_xref="GeneID:59235141"
     mRNA            <1020336..>1020653
                     /locus_tag="HG535_0B05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287313.1"
                     /db_xref="GeneID:59235141"
     CDS             1020336..1020653
                     /locus_tag="HG535_0B05220"
                     /inference="similar to AA sequence:RefSeq:NP_012618.3"
                     /note="similar to Saccharomyces cerevisiae YJR085C;
                     ancestral locus Anc_7.454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143208.1"
                     /db_xref="GeneID:59235141"
                     /translation="MDHLAFTLGLLTTTGGIMGYARKGSVPSLAAGLVFGGVYGYSGY
                     LLHENRDNGLELALGASALMLITGVIRGIPSRFKKPVPLVLTVLGAVGSSYYYKKYKE
                     FYP"
     gene            complement(<1020885..>1021070)
                     /locus_tag="HG535_0B05230"
                     /db_xref="GeneID:59235142"
     mRNA            complement(<1020885..>1021070)
                     /locus_tag="HG535_0B05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287314.1"
                     /db_xref="GeneID:59235142"
     CDS             complement(1020885..1021070)
                     /locus_tag="HG535_0B05230"
                     /inference="similar to AA sequence:RefSeq:NP_690847.1"
                     /note="similar to Saccharomyces cerevisiae YPR036W-A;
                     ancestral locus Anc_7.453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143209.1"
                     /db_xref="GeneID:59235142"
                     /translation="MAFLTLTSDIQEPFVIPGLSPVSQPSTRKNSSASVTDLEVAMAF
                     ATANAASTGRKNSITLL"
     gene            complement(<1021730..>1022881)
                     /locus_tag="HG535_0B05240"
                     /db_xref="GeneID:59235143"
     mRNA            complement(<1021730..>1022881)
                     /locus_tag="HG535_0B05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287315.1"
                     /db_xref="GeneID:59235143"
     CDS             complement(1021730..1022881)
                     /locus_tag="HG535_0B05240"
                     /inference="similar to AA sequence:RefSeq:NP_012617.1"
                     /note="similar to Saccharomyces cerevisiae CSN12
                     (YJR084W); ancestral locus Anc_7.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143210.1"
                     /db_xref="GeneID:59235143"
                     /translation="MSINLNHYFTEKCYDGNFLNFLSIHDNGRSYYLTMPNDGKLDEL
                     YNVTMELKSRQLTGTKQQVFEVSEQQLKLLNRIAEQETNWIVYPLFIVAEQFYQISKT
                     INSISELERCGRTIHRSFNLCLNDRNPTLPKNRRIGCYMFANLEFQLYHKLKNRDMMK
                     NLVKVLQSRRQEIPTLRQSLARYHKSHMVKYNYYMGEYYGCYEGDFSRGHEYLSDALM
                     DCSRDPRLTKKRQRIVILLVPMAVLMKKRPVKVPEIYHNMLKALKTGNLSQYDAQVHK
                     NEIFYLENGLYVAMSLIRELVLLRLIKQCYRYYGSRNILPLSIIAIGYTKSTQRGKQR
                     AKKLTPQAERELLDSLECQLANLIAKDHIKGYLSHSNRCIVLSKKNPFP"
     gene            <1023079..>1023900
                     /locus_tag="HG535_0B05250"
                     /db_xref="GeneID:59235144"
     mRNA            <1023079..>1023900
                     /locus_tag="HG535_0B05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287316.1"
                     /db_xref="GeneID:59235144"
     CDS             1023079..1023900
                     /locus_tag="HG535_0B05250"
                     /inference="similar to AA sequence:RefSeq:NP_012616.1"
                     /note="similar to Saccharomyces cerevisiae ACF4 (YJR083C);
                     ancestral locus Anc_7.451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143211.1"
                     /db_xref="GeneID:59235144"
                     /translation="MELPKFTVGDEQNREHSPTRLSAAAQIDRSNASSPRRQGIQLSI
                     PIQSSPMKNYEINDGSSINNSVTTPRNSFGSDFDRTGQMEQNQDLLYKLAAKKRQIVE
                     LQQGLELAKKELHILESRYKLTLSPDANPNYSAHNDGAYSNSSTKAKNEKLQPWQKRM
                     QQTLVDVNNSPNVLKSKQSISSFFNNDAGSTKQLKQDLNENTAKPTFFQSILDKFNEF
                     SVAEEEEEEFDRTQNQQKDSFYLKDKLDYDEEEEIENEETGHTLIGNKSRSKNLM"
     gene            complement(<1023965..>1025368)
                     /locus_tag="HG535_0B05260"
                     /db_xref="GeneID:59235145"
     mRNA            complement(<1023965..>1025368)
                     /locus_tag="HG535_0B05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287317.1"
                     /db_xref="GeneID:59235145"
     CDS             complement(1023965..1025368)
                     /locus_tag="HG535_0B05260"
                     /inference="similar to AA sequence:RefSeq:NP_015361.1"
                     /note="similar to Saccharomyces cerevisiae VMA13
                     (YPR036W); ancestral locus Anc_7.450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143212.1"
                     /db_xref="GeneID:59235145"
                     /translation="MILLDSTHFNDIRSAIRSRPVAWDALARSAEISELDASTAKTLE
                     SILVKHANEPTSSVDPNFKINEQTIAPLIHLLSSANNSDAKKSVQNLIAELLSSERFS
                     GDTIDFFIKNPKKVKELFDVSLVGDRQTVLISSFNLVTLLIQPKLMNKKLVSQLVNSE
                     NFLNILNNLDLMDTCYVCIRLLQELASLEPYRSMIWESHKKYLPTLFVIIKRALEPTT
                     RIVATNSNNLGIQLQYYSLLLIWLLTFDRNIAFELTQFYLQDFLNLLKLVKVTIKEKI
                     SRICISIILQCTSSGVKSHKKVIKNLLLLGNALPVLQSLSERKYSDEELRDDMATLKE
                     ILEKEYQELTSFDEYVAELDSKLLCWSPSHVDNGFWSDNIDKFKSQNWKLFRQLISVL
                     IEAKESDLNDKQHKTILEVALSDITHVIELLPESTHVLNESNGKVVIMELLNHPDPRV
                     KYEALKATQSVIGYTFK"
     gene            complement(<1025743..>1026849)
                     /locus_tag="HG535_0B05270"
                     /db_xref="GeneID:59235146"
     mRNA            complement(<1025743..>1026849)
                     /locus_tag="HG535_0B05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287318.1"
                     /db_xref="GeneID:59235146"
     CDS             complement(1025743..1026849)
                     /locus_tag="HG535_0B05270"
                     /inference="similar to AA sequence:RefSeq:NP_015360.2"
                     /note="similar to Saccharomyces cerevisiae GLN1 (YPR035W);
                     ancestral locus Anc_7.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143213.1"
                     /db_xref="GeneID:59235146"
                     /translation="MSGIEKTQILQKYLDLPQNGRVIAEYVWIDGTGNLRSKGRTLKK
                     KITSLDQLPEWNFDGSSTNQAPGHDSDIYLKPVSFYPDPFRRGDNIIVLAECYNNDGT
                     PNKFNHRHEAAKLFAAHKDEEIWFGLEQEYTLFDEYDQVYGWPKGGYPAPQGPYYCGV
                     GTGKVHARDVIEAHYRACLYAGIEISGINAEVMPSQWEFQVGPCTGISMGDELWMARY
                     LLSRVAEEFAVKISLHPKPLKGDWNGAGCHTNVSTKSMRAPGGMKYIEQAIEALSKRH
                     IEHIKLYGTDNEQRLTGRHETASMTSFSSGVANRGSSIRIPRSVAKEGYGYFEDRRPA
                     SNIDPYLVTGIMCETVCGAIDNADMTKEYEREFS"
     gene            complement(<1028144..>1029979)
                     /locus_tag="HG535_0B05280"
                     /db_xref="GeneID:59235147"
     mRNA            complement(<1028144..>1029979)
                     /locus_tag="HG535_0B05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287319.1"
                     /db_xref="GeneID:59235147"
     CDS             complement(1028144..1029979)
                     /locus_tag="HG535_0B05280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143214.1"
                     /db_xref="GeneID:59235147"
                     /translation="MKNLSSLVNRVQSEADNQDAVVRGTSSSSNLPSIELEEEVIQKG
                     KKDAGLDPEHLEFTTDTFPADGVQEEENDTLRIMNETDDAEEANEEEKNMTLLEALRR
                     YPKAAFWSILVSSTLVMEGYDTALLNSLFALPVFQKTFGSVTKTGSYEITSKWQIGLN
                     MCVFVGEIIGLQLTGFMVEWTGNRRTMITALSFFTVFVFILYYCNSLAMVAVGQILCA
                     MPWGCFQSLAVTYASEVCPLALRYYLTTYSNMCWLFGQLIAAIVMKNSERNFSDSELG
                     YKIPFAIQWVFPVPLALGIYLAPESPWWLVRKSKMEDAKKSLKSILSGSGQEKDIQVN
                     ITLEQIKLTIERERIEEKGEGSFRDCFKGVNARRTRISCLTWVAQNSCGSVLLGYSTY
                     FFTRAGLATSKAFTFAIVQFCLGIVGTICSWLASGRIGRWTILAAGLAFQMVTLFVIG
                     ALGFSSSSKASYGVGGLLLALSFFYNAGIGAVVYCIVAEIPSAELRTQTIVLARNSYN
                     LMAIFNSILTPYMLNEDDWNWGAKTGLYWGACTAVTLLWVVIDLPETSGRTFSEINEL
                     FAQHVPARKFKTTKVDPFRNAPAATDLPNDEQRSLQERQPLVPKT"
     gene            <1031044..>1032825
                     /locus_tag="HG535_0B05290"
                     /db_xref="GeneID:59235148"
     mRNA            <1031044..>1032825
                     /locus_tag="HG535_0B05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287320.1"
                     /db_xref="GeneID:59235148"
     CDS             1031044..1032825
                     /locus_tag="HG535_0B05290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143215.1"
                     /db_xref="GeneID:59235148"
                     /translation="MSTLSAHPETEPKWWKEATIYQIYPASFKDSNNDGWGDMNGILS
                     KLEYIKDLGIDAIWISPFYDSPQNDMGYDIADYEKVWPTYGTNEDCFKVIEKTHELGM
                     KFIADLVINHCSDEHEWFKESRSSKTNPKRNWFFWSPPKGFDEKGVPIRPNNWKSYFG
                     GPAWTFDEETREFYLHLFAPSQPDLNWEIEDCRKAIYESSVGFWLDHGVDGFRIDVGS
                     LYSKVPGFPDAPVVLEDSVWQPSDPYTLNGPRIHEFHQELNTFMRNRVRDNREIFTVG
                     EMQYTSDEIKKMYTSASRHEVNELFNFSHTDVGTAPDFHYNLVPFVFKEWKLALAELF
                     RYINGTDCWSTVYLENHDQPRGVTRFGDDSSENRVISGKLLSVLLSVLTGTLFIYQGQ
                     ELGQINFKNWPIEKYEDVSVKNNYNAIKKEHGENSVQMKKFLEGVSLMSRDHARTPMQ
                     WTRVEPNAGFCGSDTKPWFELNDSFKEGINVEDETKNANSVLNFWRDAIKFRKEHKDI
                     AVYGYDFEFIDLDNEKLFSFSKKYGNKIMFAALNFSSGHIVFQTPGNFASYSLAFGNY
                     PEGDVDASSNILQSWEGRIYIQENPLP"
     gene            complement(<1033422..>1034852)
                     /locus_tag="HG535_0B05300"
                     /db_xref="GeneID:59235149"
     mRNA            complement(<1033422..>1034852)
                     /locus_tag="HG535_0B05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287321.1"
                     /db_xref="GeneID:59235149"
     CDS             complement(1033422..1034852)
                     /locus_tag="HG535_0B05300"
                     /inference="similar to AA sequence:RefSeq:NP_015359.1"
                     /note="similar to Saccharomyces cerevisiae ARP7 (YPR034W);
                     ancestral locus Anc_7.448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143216.1"
                     /db_xref="GeneID:59235149"
                     /translation="MTNASRKCVVIHNGSCSTVAGFSNMELPKCIIPSSYVKRNNDEK
                     RIFGTFEMLDETEKNESTSNVYTLIDGRGYPYNWEDLEAQWRYIYEEHLKVSPAELPL
                     VISVPASNGDTDMKIMEKFFDLAFNKLKVPILQILIEPLAIALSMGKSSALVVDIGAR
                     GCNVTPIVDGTVVKSGVMKSKFGGDFLDYQITNSEFFNKEYDATNLSSCEMWFSSNTW
                     LQQFKSTMLQVSDKNYSELERYYELQRQQQQQQQQAFPNFALNPLTQKKNFLFKKSKT
                     VTLELRDSYKLAESLFEPKDALKAQGESQVQSHSQPHLQQPASNIGLSELMSKSIRKA
                     GAGVSSTGTLGGGGTGASLTLNEKGSQHNTNASSNSQLTNGVANPATSGITSEQVYSL
                     LLTNVIITGATSLIAGMEQRIINDLSIRFPQYKLTTYANQIMMDRKVQSWIAMNSMSN
                     LPNWELGKWYTKQDFDLLKQSQSHKN"
     gene            <1035040..>1035363
                     /locus_tag="HG535_0B05310"
                     /db_xref="GeneID:59235150"
     mRNA            <1035040..>1035363
                     /locus_tag="HG535_0B05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287322.1"
                     /db_xref="GeneID:59235150"
     CDS             1035040..1035363
                     /locus_tag="HG535_0B05310"
                     /inference="similar to AA sequence:RefSeq:NP_012615.3"
                     /note="similar to Saccharomyces cerevisiae EAF6 (YJR082C);
                     ancestral locus Anc_7.447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143217.1"
                     /db_xref="GeneID:59235150"
                     /translation="MEGNLKEYEKLKSELIKNIEAKKGLEEEFDRLQQDIYDNETEYL
                     SGNQGTSKNNNIGNIIKGFDSFNKVSRHGSDLSNHGFTNDDRLFSLSSAVFVKQQLDD
                     MQEQE"
     gene            <1036274..>1037476
                     /locus_tag="HG535_0B05320"
                     /db_xref="GeneID:59235151"
     mRNA            <1036274..>1037476
                     /locus_tag="HG535_0B05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287323.1"
                     /db_xref="GeneID:59235151"
     CDS             1036274..1037476
                     /locus_tag="HG535_0B05320"
                     /inference="similar to AA sequence:RefSeq:NP_012614.1"
                     /note="similar to Saccharomyces cerevisiae YJR080C;
                     ancestral locus Anc_7.446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143218.1"
                     /db_xref="GeneID:59235151"
                     /translation="MSGKVCRIFPSKRFISLIRPTETTCIPTQVELKNATDASTQSLF
                     SEGDNDEFLSTSRFQVLGQPATMASALIPPSIDLYVRRGCLVSLHGSRSISLSHEWQS
                     VWFNLTRYFTLKPSIYYKLISTAKFNALIAPNFTSNRLGPILGLSSSPFRTLCLLSLD
                     GTKDWNIWGKDSIVAYEANTSLDIKPSKFSIFKSQRPVFSSKYQILQGRGNVLLSGSG
                     SVYTIELKDASDEIIIKSEHLLGLNGSSQLNIKDSVEVQTLAPLQKKDEKLLSKRPPA
                     GEIRDFDVRMFFEISRDIFANTWNWLKRVYSTQLNGPSKFLRIKGPRTLLLQSSYNVY
                     LPASAKGKSLLQVDSNPALSSSIPLTKSPSKDYLSYASVLKDGQVDFRSTEDFSETLK
                     HTNSKQQN"
     gene            <1037710..>1039305
                     /locus_tag="HG535_0B05330"
                     /db_xref="GeneID:59235152"
     mRNA            <1037710..>1039305
                     /locus_tag="HG535_0B05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287324.1"
                     /db_xref="GeneID:59235152"
     CDS             1037710..1039305
                     /locus_tag="HG535_0B05330"
                     /inference="similar to AA sequence:RefSeq:NP_015358.1"
                     /note="similar to Saccharomyces cerevisiae HTS1 (YPR033C);
                     ancestral locus Anc_7.445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143219.1"
                     /db_xref="GeneID:59235152"
                     /translation="MLSRISRLKLFHLQLVREMSQVPAEVSANAKAEKSKLQVSLKTP
                     KGTKDWADSDMVIRESIFRVLSDMFKRHGGVTIDTPVFELKEILAGKYGEDSKLIYDL
                     KDQGGELCSLRYDLTVPFARFAAMNNVQNIKRYHIAKVYRRDQPAMTKGRMREFYQCD
                     FDIAGNYESMVADAECLSIAVEGITGLGIKDFKIKLNHRKILDGIFQISGVKDEDVRK
                     ISSAVDKLDKSPWDVVRKEITVEKGQSDETADKIGEYVKLNGSLKQVHSVLSQDPAIL
                     ENSLAKEGLDEIETLMRYTAAFDIDSYISFDLSLARGLDYYTGLIYEVVTSDSAPPEN
                     AGELKKKSKNSEDASAYVGVGSIAAGGRYDKLINMFAEASGKKSVQIPCVGISFGVER
                     LFSIIKQRIASASIKPTATQVMVMAFGGGKDWTGYLPERMKVAKELWNAGIETEYVYK
                     SKANPRKQFDAAEKTGAQLAVILGKEEYLDGKFRIKKLGPQFADDDGELIEAADLIKV
                     VKEKLSEINENDVNEVTRLVQGI"
     gene            complement(<1039698..>1041182)
                     /locus_tag="HG535_0B05340"
                     /db_xref="GeneID:59235153"
     mRNA            complement(<1039698..>1041182)
                     /locus_tag="HG535_0B05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287325.1"
                     /db_xref="GeneID:59235153"
     CDS             complement(1039698..1041182)
                     /locus_tag="HG535_0B05340"
                     /inference="similar to AA sequence:RefSeq:NP_012612.3"
                     /note="similar to Saccharomyces cerevisiae BNA2 (YJR078W);
                     ancestral locus Anc_7.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143220.1"
                     /db_xref="GeneID:59235153"
                     /translation="MNKELPLPTLEEYEISAVNGFLPKEMPIAKLSDSYYKKWEAVVA
                     QLPSLLLTKKIREVVDRLPILEVKQSLLQNVGELRRAYSVLCFITNAYVWGVDQPCEI
                     LPDCIAVPLLRISDELGLPPLATYSSLVLWNYQPIITNPDLIDDVMDLSNLTTLNTFT
                     GGIDESWFYLVSVMTEKVGSKCVMAGMNAMKTARQNDIDSVVKELQLLAEGIDNLGSI
                     LMRMEEMCDPHIFYYRMRPYLAGWKNMAEVGLPRGVKYGSKGEYKYFAGGSNAQSSLI
                     QTLDIILGIEHFPTGKKNGENQKTISANSNKNSFINEMRNYMPKKHREFLQHLSLVSN
                     IRTFVLDQKVEKLTLAYDACLAMLKSFRDKHIQIVTRYIILQSNKNKSKSRALRSGLS
                     KDQESKQLKGTGGTALIPFLKQCRDETGSIAASDWGKKVLSTAVLDVHRHSVIPTLHK
                     RSAEKEMDESAGKSKKSKLGLAGDWIVDASSDEESGIGRSAGHW"
     gene            complement(<1041522..>1042169)
                     /locus_tag="HG535_0B05350"
                     /db_xref="GeneID:59235154"
     mRNA            complement(<1041522..>1042169)
                     /locus_tag="HG535_0B05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287326.1"
                     /db_xref="GeneID:59235154"
     CDS             complement(1041522..1042169)
                     /locus_tag="HG535_0B05350"
                     /inference="similar to AA sequence:RefSeq:NP_009443.1"
                     /note="similar to Saccharomyces cerevisiae YBL107C;
                     ancestral locus Anc_7.443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143221.1"
                     /db_xref="GeneID:59235154"
                     /translation="MRYTKQTKAHPRHMSTDKITLRTPDVLLDPNLEFSTEEPPIREL
                     VLTRKRCIDSSIVDSFLKLLRNGSDDILRQKLSSYSQAQDNGRANSSKKTSCEQYLKK
                     ELYPNWQTRDQIISFCEGQSEQLKHELDAGTSKSIRSNVIPEIDPRLDPYSARRIIYD
                     REAAYKDWKRLNSWIENNKKVESILRNSSAKTLKQNCDQNADYMAQFFSFINKTT"
     gene            complement(<1042310..>1045411)
                     /locus_tag="HG535_0B05360"
                     /db_xref="GeneID:59235155"
     mRNA            complement(<1042310..>1045411)
                     /locus_tag="HG535_0B05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287327.1"
                     /db_xref="GeneID:59235155"
     CDS             complement(1042310..1045411)
                     /locus_tag="HG535_0B05360"
                     /inference="similar to AA sequence:RefSeq:NP_009444.2"
                     /note="similar to Saccharomyces cerevisiae SRO77 (YBL106C)
                     and SRO7 (YPR032W); ancestral locus Anc_7.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143222.1"
                     /db_xref="GeneID:59235155"
                     /translation="MFSSRRLKKAFKNDRSKSENERTNPENEPIRNGLSPPVKSPKKF
                     SLKVPELGVKGQYSKLFSVSEVSRYGMNGKVTTSAFNFTQSLLALATDTGEIHVYGQQ
                     QVEVVFTLEGKSHIKFLKFVKGIYLVAIDSRDVIMVFSLFSKRMLTSVFSPGKIACVE
                     TDPSLDWLMIGLQSGIILFYDVDRNVISNFKIENLQKTRFFPKDRISAVISMQWNPRD
                     IGTVLISYDQVTVTYSLVEADIKQHFIYELLPGAPGGDFLDKQGKLRRPGVKQSLYHP
                     NSLHILTVHEDNSLVFWDANSGQLIQARTLFETDVHISQEGFQKPLITAPPRITQVAW
                     ICQKNPEYTSLVVSTQSKEVGQSLTLIELGGTPLYSITSYENMSKYYANTRSQRIVPL
                     SNSAPIIEFLPLPSQSPYFSGCHDPKVILVLLSDGQIETLLYPSSHFSYKASLFSQSL
                     AWVRPTATRSLAVSVPKKLWLGMMSAAKSSDNILKGGEPLKKNVTKSDACSALATGHK
                     DGSVRIWDASRGEISGGSVFEVNLSRILNMTSKAIDNISFSTQTLELAVSIESGDVVL
                     FKFDVNQFYNPNPQKSERELEMNFRRFSINSSKELLVDIRDRSPENIRQGFMPITAVH
                     ANKGKVTSLTNSNVGFVGIGYQDGTLLILDRRGPAVIYMQAVDKLPNVHSQYITAIEF
                     VIMEYADDGYSSILMLCGSDTGEVLVYKIIPENGGRFAAHFVESRKTNDEGPITMIDS
                     FSKSQNESCSANISQMRNLSSGLAIPGYVIVSGKKDIRVWKIGKSFESHKSFKYPVAA
                     SGLAFIPFVNNGEVKVVTVVIVLLLGGDIKVLSIPDAGEISSMVSTVPIQARFIRDSS
                     VLKNGDILIRTNEFQASLLSTVNEQATGISGNSTLEEKAKTDSLYIPGKKIAYRPQVN
                     SLQWARGTINCTTDQLDTLLGGEHRPPRKYEESEMATQTISVKPNEPDDESREHSYRR
                     PTRSGTRSSRYGVFRSVSRAVESRYDSLEGTFNDYATAVGESVNELVEETTKDMAKGA
                     FGL"
     gene            complement(<1045778..>1049266)
                     /locus_tag="HG535_0B05370"
                     /db_xref="GeneID:59235156"
     mRNA            complement(<1045778..>1049266)
                     /locus_tag="HG535_0B05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287328.1"
                     /db_xref="GeneID:59235156"
     CDS             complement(1045778..1049266)
                     /locus_tag="HG535_0B05370"
                     /inference="similar to AA sequence:RefSeq:NP_009445.2"
                     /note="similar to Saccharomyces cerevisiae PKC1 (YBL105C);
                     ancestral locus Anc_7.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143223.1"
                     /db_xref="GeneID:59235156"
                     /translation="MFTQVEHEIHKKIERERNIIQGASNLKKRTSNNMVIQKCNTNIR
                     EARQNIQYLEETLEKLQLSSERELQTGSNDVNKKESYGVNGSGQVSTLRSSEHVFSRL
                     DLVKYDCPSLSQRIQYLLQQLEFKLQVERQYQEANAKLTKLYQIDGDRQSSSAAEGGA
                     LESKTRIQLLTKALKKYQAINVDLDQYKPHNDDIMATQPKFRRKQLTGELSIGITAIR
                     DVDHIQSPMFSRTPESYITIKIDDTVKARTRPSRNDRWHEEFQIQVGKGNEVEITVYD
                     KVNDIMTPVAVMWLLLSDIAEEIRKKKVGKTSGQQGWVDASKVRSSHYVEPNTSVIAA
                     PTMEDKASPYPNSAGGSSDDNSSSTDYSNSVTTNSWFVLEPAGQILLTLGFHKSSQPQ
                     KKSLVGGLHRHGAIINRQEEIYEQHGHHFVQKSFYNIMCCAYCGEFLRYTGFQCQDCK
                     FLCHKKCYEKVVTKCIAKTTTDMGPDEAKLNHRIPHRFEPYSNRGTKWCCHCGYILPW
                     GKNKVWKCSECSIMCHKECAHLVPDFCGMSMEMANKILRTIEDTKKIQEKKKRLPPIS
                     SVDSSATTAVSKVNPSVPSLTNTTLGDPSLHVQQATAKRGSFYEPSDNIDSSPYYDGD
                     TTRPNTQADSHEKLHKYINENETYLNFTESAQKNVQSLESAEIGTLDPLAPGISQAAE
                     EQIASKRNSVLYTRQDLENWKLHEKALHEQSRRRESKDQNNLEINRPETFLTKEEIEP
                     VIQNPASLDVAQSLEGTQDFEKSHINPFRDMNTETFQLEQQNQMVSEAVSDGTLLTQT
                     ATTVSKESIQISPRKSQGAGKHRKKSPKRRKVSLDDFILLKVLGKGNFGKVLLSKSKN
                     TGHLCAIKVLKKDHIIQNHDIESARAEKKVFLLATDAKHPFLTNLYCSFQTENRIYFA
                     MEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLALKYFHSNGVIYRDLKLENILLTPQG
                     HIKIADYGLCKDEMWYGSTTSTFCGTPEFMAPEILKDQAYTKAVDWWAFGVLLYQMLL
                     CQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGPQDALDV
                     MKEPFFRSINFDDLLNLRIQPPYIPDIKSPEDTSYFEQEFTVAAPTLTPLSSVLETSQ
                     QEEFRGFSFMPADLEL"
     gene            complement(<1049653..>1052670)
                     /locus_tag="HG535_0B05380"
                     /db_xref="GeneID:59235157"
     mRNA            complement(<1049653..>1052670)
                     /locus_tag="HG535_0B05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287329.1"
                     /db_xref="GeneID:59235157"
     CDS             complement(1049653..1052670)
                     /locus_tag="HG535_0B05380"
                     /inference="similar to AA sequence:RefSeq:NP_009446.2"
                     /note="similar to Saccharomyces cerevisiae YBL104C;
                     ancestral locus Anc_7.440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143224.1"
                     /db_xref="GeneID:59235157"
                     /translation="MGLIKKVTSWSYEGLIDYLSVNPTRDEVTHYKVDPENDNDESIM
                     RLHTAKDFGNITCLDYSYLDVGLIAVGEKNGFVRLFNIITKDDPEIDTIDMKTRAKQQ
                     RCVNTLGINSNGLVAMGLDRNKTDASLQIWDINYQSTDSSAVNSTFSYCVNENIVSSK
                     FFSDTGLIIASTKFLKEIDLRSPQAAYQHPSRLSYDVKINPFNDLQFSSYGDDGTLAI
                     WDRRKLAASSYSGDVITSAPLLSFEKLVGMGAASKKYMNSCFRWSTTRNKEFATLHRG
                     DTIKRWWIGSCGEEGLEENETEELFVSKVHDINTTFDKVVTFDYIPQNDNKMSLLCMR
                     QSGTVYRMPVHQSYSTVAFNNYNSLMFSNFEVPYIDEIRMTAQKQNSNFQNKALRNLS
                     FEDLDISDDYSPSLEDEQKVIENKEYLDSSISENKEYSGTEDNFNLLWKPEKLLQSDI
                     RVIMKSRAVLGYGLDPANTVAMIDSSKTLQNNAYIRNTWRWLAIAKSSVDDGTMVSGD
                     LDLGYEGVLGIWSGLSGISNQNRFREENILPNEQLDKEMEKIIKLRKRQKSHQKSRGT
                     TTNFSNSPKSIQRRLCLILSGWDLSPTDLEEKYKTIIQTGSYEKAAAWAVFFGDIPKA
                     VEILGSAKKERLRLIATAIAGYMAYKDTTENNSWRDQCRKMSSELDDPYLRVIFAFIA
                     DGDWWDILYEPAISLRERLGVALRFLNDFDLTKFLERTSSTVIKNGELEGLILTGITP
                     SGIDLLQSYVNKTSDVQSAAMISIFGCPRYFHDRRVDEWVQTYRTMLNSWNLFTMRAK
                     FDCARTKLSRTSSCQIRADIKPRQAYMQCINCKKNINEPTSNLSSTSAMIPDSLNNPE
                     SMNHRAMNSFAKPKKYGMTNTPSSLNVQRKKYSCPHCGTPFPRCVICLLPLGTSNLPF
                     VIKGVQPDPIRDGQSLHEDNVTETNDSNSQRNSITYEQNDEDSIKNKKLKMNEWFSFC
                     LRCNHGMHAGHAEEWFEKHDTCPAPGCFCKCNK"
     gene            complement(<1052807..>1055041)
                     /locus_tag="HG535_0B05390"
                     /db_xref="GeneID:59235158"
     mRNA            complement(<1052807..>1055041)
                     /locus_tag="HG535_0B05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287330.1"
                     /db_xref="GeneID:59235158"
     CDS             complement(1052807..1055041)
                     /locus_tag="HG535_0B05390"
                     /inference="similar to AA sequence:RefSeq:NP_015356.1"
                     /note="similar to Saccharomyces cerevisiae NTO1 (YPR031W);
                     ancestral locus Anc_7.439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143225.1"
                     /db_xref="GeneID:59235158"
                     /translation="MLRGTSDDGPKLREEKQFQEFYSDLEKDTLFPVLVPKDGGFQEN
                     GIEISEADHIHHADSSNGSSEPKIHMKQIMFNGTVTLEPINLHVKKKSFKKTSIPISQ
                     LDSTQRVRSSRERASEKRKGPPGNSKRSKVDGQYITKFSKVGQHDERSILDPTLLVAV
                     SKNLKNFQTEYDMDEQDDLYLQFLNDKYSKNKLSHEIFELLMSVLEREWCHLEKRIPP
                     RKITTNTCSSDDHLHTGRLHYELYGSDDGTGKTSDQACAVCGGTDSDSSNAIVFCDGC
                     DVAVHQECYGIVFIPEGQWLCRRCLVSKNRRVNCLFCPSHTGAFKQTDTGSWAHIVCG
                     LWIPELYFANVHYMEPIEGVENISRSRWKLVCSICKQRMGACIQCAHKNCFTAFHVTC
                     AKRAGLYLDYGGSSIAEVASNQIHSSHLPTAYCDKHAPANWARATEGILKTRRYFTEY
                     NDINAESNLRERKGGSQYTQKKNIWKTNRGTPIAPHIFAEMLQRILVLLKIPNVQILS
                     YNLCKYWSMKREMKRGASLVRKFDPSSYNILDEHQLLERLKVTDILLPDLFKLQKLTD
                     LVRRRTLASNGISVADHNIQALIRYPDEYVTKHIVVDKFISSEPFQVLKNTLVNEEFR
                     MKLLKWESCTLEDVTSFKEEIFKLLADLESSSTLSRAALGSVRKLNSVLIELLKHANF
                     TNAKKFLIQDFAFSETQPELIEPRKWKGPYLKEEEGLSDVDELSAQDQRKLRQILIEK
                     TDTK"
     gene            complement(<1055304..>1057292)
                     /locus_tag="HG535_0B05400"
                     /db_xref="GeneID:59235159"
     mRNA            complement(<1055304..>1057292)
                     /locus_tag="HG535_0B05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287331.1"
                     /db_xref="GeneID:59235159"
     CDS             complement(1055304..1057292)
                     /locus_tag="HG535_0B05400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143226.1"
                     /db_xref="GeneID:59235159"
                     /translation="MAILNSLRMKFRFIGHFLRRKNAKMLRVGIILFISLCLVFAAMH
                     KGGDYMPNLPYFRINDKEAPERVPDWGSLSDTVVEPARELISEDEDFETINTRLRDVL
                     SATMKRIEEFSPKEKFDRKNGADCKIGDIHIDDTKSFDRLTKSELLKCIQLPDTVQDE
                     MKSLHKSFLSALKEEIIPSYGPQLYKGKGIVMVAGGKFTLIGMPAIKAIRENGDEDIP
                     IEIMVPPDNTDESYFCEQILPELDPSGKSRCVYMEKLFDPSTFQKVKGYQLKPLALLA
                     SSFENALLLDADNYVINSISNIFNTSPFKKHGLVLWPDYWRRLHHPSLYDVTGIKVET
                     DNQTRYSFDDVSPPEIYKNENPKNAPFHDLEGTIPDSSTESGQLLVNKSKHLETIILS
                     LYYNYNGPSHYYPLLGQGYAGEGDKDTFALAAKAVHSNQSYYQVKSPVGAMGYWAHKK
                     DETLVLEGDAAPEKEFRGVAMLQHDLEFDYKTHEEVKEEISTKYTRALNKYREQKDTE
                     GTDDGIALSIEFWNIQKKLGYHLADFRSYFKDVPVTFVHSHLPKYNPWEFGKEQDLTF
                     DGRKVMNRHKDEPGFSPIHHGHYRMYNDDFAKLTSYDLELENWSCFKKFICERDNGFE
                     SFSYLKQQVESTIDGRKQYDDMCDYINDRVEMLRESTW"
     gene            complement(<1057828..>1059384)
                     /locus_tag="HG535_0B05410"
                     /db_xref="GeneID:59235160"
     mRNA            complement(<1057828..>1059384)
                     /locus_tag="HG535_0B05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287332.1"
                     /db_xref="GeneID:59235160"
     CDS             complement(1057828..1059384)
                     /locus_tag="HG535_0B05410"
                     /inference="similar to AA sequence:RefSeq:NP_009447.1"
                     /note="similar to Saccharomyces cerevisiae RTG3 (YBL103C);
                     ancestral locus Anc_7.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143227.1"
                     /db_xref="GeneID:59235160"
                     /translation="MGNFEGNFNHQQSLDSLLEESQLHLAQYDNNELQFPNMWGQLQS
                     QELNRPLQHSSEQSQVYSKDTPAQQHEKLSYMKNKANHLPERNGEKHNPVSQDTFKKS
                     SSFLDDQFSSTVLNDSFDITNNVGNNSESFSTRGSITNSQNFGDGDHSHNYREVSLDQ
                     PDIILKQEDHRNTGPDFLFQQGDDAMFSFADELSSSVGSSINSEWLGSSLSSSFSFQP
                     QSLNGPSSSANANISSHLSPNLKSPASSVRASSYLSTSLRNGYTPGTPKSRHASLSSN
                     INGETLYSSSVPRNLSHLSAEEKLRRKRDFHNAVERRRRELIKQKIKELGKIVPPSLL
                     NFNVKGKQVKPNKGIILNRTVEYLEYLLYVLEVQDRKKTQLMSKVEELEKKKRTQQIS
                     TSEDRNMHAPPSPKDVEIHKHLTMENKYEGVDTDVSQGRIIDGRAKPQPFSNTDRWDS
                     ETSIYNSLTNGNFGSNNDSNNHINEDLPTMNDDLKQFLSGDLIEAEDNAKLLFNSGQS
                     SADYLLEFDT"
     gene            <1059868..>1060512
                     /locus_tag="HG535_0B05420"
                     /db_xref="GeneID:59235161"
     mRNA            <1059868..>1060512
                     /locus_tag="HG535_0B05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287333.1"
                     /db_xref="GeneID:59235161"
     CDS             1059868..1060512
                     /locus_tag="HG535_0B05420"
                     /inference="similar to AA sequence:RefSeq:NP_009448.1"
                     /note="similar to Saccharomyces cerevisiae SFT2 (YBL102W);
                     ancestral locus Anc_7.437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143228.1"
                     /db_xref="GeneID:59235161"
                     /translation="MAENTEAQVSSLRDSLNRWNESRGQHSKGFNESAKTLFSSWADS
                     INNSAQDVYQRLPLTRQDLVQDQEPSWFTLSRTERLLLFICSILGSIACFTICIFLFP
                     VLAVNPRKFGLLWSMGSLLFVLAFGVLMGPSSYVKHLISRERLPFTIFFFTSCLLTIY
                     FAAIAKSTLLTIPCAILELIAVLYYGISYFPMGATGLKMISSVGVNTARGALHI"
     gene            complement(<1060581..>1063889)
                     /locus_tag="HG535_0B05430"
                     /db_xref="GeneID:59235162"
     mRNA            complement(<1060581..>1063889)
                     /locus_tag="HG535_0B05430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287334.1"
                     /db_xref="GeneID:59235162"
     CDS             complement(1060581..1063889)
                     /locus_tag="HG535_0B05430"
                     /inference="similar to AA sequence:RefSeq:NP_009449.1"
                     /note="similar to Saccharomyces cerevisiae ECM21 (YBL101C)
                     and CSR2 (YPR030W); ancestral locus Anc_7.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143229.1"
                     /db_xref="GeneID:59235162"
                     /translation="MPYSIPRPIPAKHSAYQSGSRERDRDNQSHSQAMNSKSSAVGSA
                     PVHFSPTKRAQTFVQSQQQGMGRRRSSTIKSALSSLLGSSPPQQQQQHVPQNVHRSFS
                     LPKTGSSLSVGAENPPSHANSSVLSPGLRRYSTTSAEVTSDGHRNSGYYTTNEEDEDA
                     VTESVHGDTSLDEDSTIGESTSASGSSASNPGVLSKSLKSLGKIYLTEYLAERGLLAP
                     TTVMENQSLKVSLATSGESVFLPTMSSNDDEYLARLNGLREDEDEGEDEDEDEDEDEV
                     DDLGFEAATSESRPQPHVRSPGSSDRGNRTTAVNATARSTSERAGVSEPVDESVSTSS
                     IGSTLEIDSSMATYTIAMILSVSHPITLSNLRTELCSRIRVYWPNGVPPTKVFHEEFY
                     CAGHLDWDLSMDNVNLFVPANVSSSEKIINNCKNLKPMEIFQNSNDSRKRYLDKNNAK
                     KQMMNKIKSSKNQLYQSGDYVFIIPIVFSNTIPESLYLPSARVNYRFRIGMKLIEPYN
                     QQNKNPDNQESLSAKNPESDATSLKKLNLFKKLKNNLHLNNPHVGKEELDDNNNLYAE
                     YPVNIVRTPPQYSISTANKPVYINRVWSDSLSYEISFAQKYVSLDSKVPIKIKIVPLV
                     KNICLKRIRISVLEKITLVSKDCEYEYDQIDPVAKDPYNPYFAEFSSKRKKERNLSIL
                     EIRSKEKGSRALREEVVNNCIDDNLLAYNCLQDDKGEKGLGMTEPLVITTNLEFPKYI
                     DMDKDTARVVPPYGIDVYSPVSNPELAKNSNTANRGGVIGFLAGRRSSLSATAGTKNT
                     GQNHQYLSTPSPVFNPKFHETSFQSDSEVPVEFQTRLNEARRGLYLDSLHFSNIYSRH
                     KLEIMLRISKPDAKDPARLRHYEVLIDTPIFLVSDLCNSGNMELPTYDMATSDRFSPE
                     MIAGAAPPTFEEAISIPGSPLNSPMNSPVGSPILRGSFEQDDLYMNNINLSRSASIGG
                     MLPLEGMTQGSTPVPLSTSVDANQRYNNLDGLLSPTFAAEVSDISSQSRSNTKNAIGE
                     HQNNYMPTYGRQSVFKDNYSIARESPASGSSQTKQNIESNNDNVHPSDVNRADVTHYP
                     PRYDDIVSMTSGKH"
     gene            <1064628..>1067075
                     /locus_tag="HG535_0B05440"
                     /db_xref="GeneID:59235163"
     mRNA            <1064628..>1067075
                     /locus_tag="HG535_0B05440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287335.1"
                     /db_xref="GeneID:59235163"
     CDS             1064628..1067075
                     /locus_tag="HG535_0B05440"
                     /inference="similar to AA sequence:RefSeq:NP_015354.1"
                     /note="similar to Saccharomyces cerevisiae APL4 (YPR029C);
                     ancestral locus Anc_7.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143230.1"
                     /db_xref="GeneID:59235163"
                     /translation="MAGSSLNNFIKDVRGAKTLAEERSIITKASAKIRTKLRDDHLPL
                     EKRRKNIQKLLYLYILGEKTHFGQVECINLIASEEFADKRLGYLAATLLLDESEDLLT
                     LLTNLLNNDLNHPNKYVVSLALTTLGSLGSSELARDLYMDVENILKGSRDPFIIKKAL
                     QCIGKLITKDFTLLDIFDTKLITSILENHSLCTHGVLLGINKVLQSILLNHETFQLSL
                     SNDGYADDSKPLLNELVKIIPELLSLLQSLSIKNFEPEYDIQGTCDPFLQCESIYTLR
                     LFFEQTLDLSQYQNKFCDLLTQIATNTDGAKNCGQAILYETARTIFSLNLEQPLRVLG
                     VNILAKFLSQKDNNTKYVALNTLLKVVDQEPETVQRHRKFISKCLRDPDISIRKRALE
                     LSFAILNDVNLVEIVDQLIGFLAGAIDDDKTLIVYTVENLVKILESHNISDEKWKLSI
                     LFESLKLAGTYVTSDITGDILISINNSKDTIQRRNLVVDMLMISLDETKNCEISEDNI
                     AWLIVTIWCIGEYADEILEDPSCRQALSETKMTNFLVLQDKTFNISNKKLINYLLTAA
                     LKLSSKFKDSGCIEALRQIILGHTKDSDLLIQSKSVQYEIIFAQPQSVKKVLLETMPV
                     FERRKCMKVGNTSPELKKIHKSTDKSSNVALLDLGSENDKKKDTEVANSSTPADLLAD
                     LFSSTSIDENTKNTSRNGKTVQISVSATKIYDSDTIQAYVQLISCDAGSAQIELYLKS
                     SKAISDIKPFSAVPRTQKLTLGQLYPGNSLQKDEVCSQVLKITGTGKLKLRIKLDFKL
                     NGVPVEQQFDYKFEQTL"
     gene            complement(<1067180..>1067826)
                     /locus_tag="HG535_0B05450"
                     /db_xref="GeneID:59235164"
     mRNA            complement(join(<1067180..1067668,1067776..>1067826))
                     /locus_tag="HG535_0B05450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287336.1"
                     /db_xref="GeneID:59235164"
     CDS             complement(join(1067180..1067668,1067776..1067826))
                     /locus_tag="HG535_0B05450"
                     /inference="similar to AA sequence:RefSeq:NP_015353.1"
                     /note="similar to Saccharomyces cerevisiae YOP1 (YPR028W);
                     ancestral locus Anc_7.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143231.1"
                     /db_xref="GeneID:59235164"
                     /translation="MADFASSIQGQLKSFDSRFASNGFLQQLEARTKLPKSYLAAGAF
                     AFYLILIFINVGGIGEILANIVGFVIPTYLSLIALRTKTSEDDTQLLTYWIVFSFLNV
                     IEFWSKTILYMIPFYWFLKTIFVLYIALPQTGGASLIYRTFISPVADKYIVKAKKSDD
                     IKDAVHGAASKASGSSIHN"
     gene            1068019..1068114
                     /locus_tag="HG535_0Btrna1F"
                     /db_xref="GeneID:59235326"
     tRNA            join(1068019..1068056,1068078..1068114)
                     /locus_tag="HG535_0Btrna1F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:59235326"
     gene            complement(<1068312..>1068683)
                     /locus_tag="HG535_0B05460"
                     /db_xref="GeneID:59235165"
     mRNA            complement(<1068312..>1068683)
                     /locus_tag="HG535_0B05460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287337.1"
                     /db_xref="GeneID:59235165"
     CDS             complement(1068312..1068683)
                     /locus_tag="HG535_0B05460"
                     /inference="similar to AA sequence:RefSeq:NP_011486.1"
                     /note="similar to Saccharomyces cerevisiae CGR1 (YGL029W);
                     ancestral locus Anc_4.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143232.1"
                     /db_xref="GeneID:59235165"
                     /translation="MSSAGSPKEQEVTQPKGAPVSGRTWKSDKGQFRVKSRVVKNKKL
                     TSWEIRQQKRLDDQQFKERMKQLKDEKEDIRQNRIKAMKERREKKAENERYELLAAKM
                     HAKKVERMRRREKRNKALKER"
     gene            <1068945..>1071509
                     /locus_tag="HG535_0B05470"
                     /db_xref="GeneID:59235166"
     mRNA            <1068945..>1071509
                     /locus_tag="HG535_0B05470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287338.1"
                     /db_xref="GeneID:59235166"
     CDS             1068945..1071509
                     /locus_tag="HG535_0B05470"
                     /inference="similar to AA sequence:RefSeq:NP_011666.1"
                     /note="similar to Saccharomyces cerevisiae YGR150C;
                     ancestral locus Anc_4.87"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143233.1"
                     /db_xref="GeneID:59235166"
                     /translation="MLCYKLLGSSNHLRSLSSRNIPANVHVIGRRWAVIPSKNGSFTR
                     RRRRKIRDVSFDNLNLKNIDSKSAKSVEFKVKQLQEFTRNLREHIKVADSSVAKSEAQ
                     KELHIFEKEASERDADMVYNELTSRPLVDSQSLMTSSNDDVEHLSTLILASEKNAAST
                     LLPDVIRGRINDDNSVLSFLLDKSQQNWDGIVSKLYKSELRLKSISRNILQKYILSRV
                     DNLSLESIERMDKMLLENIDGDITKFSTSMYECLFFNLAKLKTEDITGEAVIGKMKRL
                     IERFDNAKELNSNAKMTQFILNSCIKYSTKLISFESMNFFLSKFKEDYGLLPNRENYT
                     TIIQFYTRLGVSKQAWNVFDTMKFLSKGHSPDVITYNTVLHLCNKDKNYARAIDIYQE
                     MIDQNIEPSVQTLNIMAKTMARASSDPITSEHKQESLRLLGWKYIHMVEGKFNSKQSD
                     KYLYHTLNSMMALAAYDGDVGLARALYFKYCSQRYREVTKNWINKSLEKKLWSHVLDP
                     ELLNYLLLSYSNYNPNKLPLLMGYEEGIKFRRNILNGVDYTSRSNSDDEINFGLPLLP
                     VRELSNASEILFESRAIWQFNLEFGGNLDLKSSPQFLNKEELKRMLVNSASLDQCKFL
                     MLERVAQLKSSLVNHKVLNTMSLTSFLTIPIKVRDKKEFILRLKEFTFQQQEFDTHVK
                     SFFTEVLQLDKPVASNEADQEITVTNEMEQRLAYFASMKHKILANCSIYELMMKAAAS
                     FGDLELASKAWRDRGEFRKTMAFKCLDAAERSRRDTEFAFLMVQFFSSQKLFSDALGI
                     IMTSQKYIHWKYPMIKCLHKGLLEIEDMKSIKILLDIVNRKSAVQNIEEQIQELKF"
     gene            complement(<1072121..>1073482)
                     /locus_tag="HG535_0B05480"
                     /db_xref="GeneID:59235167"
     mRNA            complement(<1072121..>1073482)
                     /locus_tag="HG535_0B05480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287339.1"
                     /db_xref="GeneID:59235167"
     CDS             complement(1072121..1073482)
                     /locus_tag="HG535_0B05480"
                     /inference="similar to AA sequence:RefSeq:NP_011477.1"
                     /note="similar to Saccharomyces cerevisiae OCH1 (YGL038C);
                     ancestral locus Anc_4.74"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143234.1"
                     /db_xref="GeneID:59235167"
                     /translation="MIIPKRSILSFDRRKKQILLLLVCAYTLIVFHFNNKKFDLRFKT
                     SATLPTSSHSSGINLKKYKADRRNLRDLRAQLSYAFPYEPEKPIPRRVWQTWKVGADS
                     AEFPAEFRTFQKDWTASIEEAELFQYSLVPDSYVLPFLQSLYGEVPVIIEAFEAMPSH
                     ILKADFLRYLLIYARGGIYSDIDTVPLKPLDSWLSVNPTSLQNFESENTPVPYSNYAK
                     SFKKVDPGFIVGIEADPDRPDWKRWYARRIQFCQWTFQAKPGHPILRELILNITATTL
                     NSVSSCSKKFKKSIDLEHSRDYNVNYRDKRGQDESYDHDALKVSENVDGTDIMNWTGP
                     GIFSDIILNYMSNIINNNDDIMLLNSNLQSSRRTNESTKKFYKKITESLQTHNKMPWE
                     FFSLIEDPVLVDDILVLPITSFSPGVEQMESKPTSDEMAYVEHMFKGTWKDEADNNQQ
                     NKE"
     gene            complement(<1073830..>1074474)
                     /locus_tag="HG535_0B05490"
                     /db_xref="GeneID:59235168"
     mRNA            complement(<1073830..>1074474)
                     /locus_tag="HG535_0B05490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287340.1"
                     /db_xref="GeneID:59235168"
     CDS             complement(1073830..1074474)
                     /locus_tag="HG535_0B05490"
                     /inference="similar to AA sequence:RefSeq:NP_011478.3"
                     /note="similar to Saccharomyces cerevisiae PNC1 (YGL037C);
                     ancestral locus Anc_4.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143235.1"
                     /db_xref="GeneID:59235168"
                     /translation="MAKALLVIDIQNDFLPPNGSLAVASGDEIVEPVIKLMNDPKQEW
                     HRIVLTRDWHPPDHISFAKSHGKPEFSKIEYHSPIPGDSSVQEGVLWPVHCVQGTPGS
                     QLAAPLIEEQKKLGCRVVDKGYLHDREYYSAFNDIWDYHRTELNNYLKSHHITDVYVV
                     GLALDYCVKNTAISASKLGYKTYIIKDYTRAINTDSESERKLEAELKKYNVKLI"
     gene            <1074890..>1075795
                     /locus_tag="HG535_0B05500"
                     /db_xref="GeneID:59235169"
     mRNA            <1074890..>1075795
                     /locus_tag="HG535_0B05500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287341.1"
                     /db_xref="GeneID:59235169"
     CDS             1074890..1075795
                     /locus_tag="HG535_0B05500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143236.1"
                     /db_xref="GeneID:59235169"
                     /translation="MLLNRLVELIALLVGSAAYFKFVGGQLTGYPDSQNPPNGLIAPA
                     GNIDFSELTLSLMNDFVLMAQVFVTCIPSMVLAATTPLFVKVSCSFNLLSVLSLLALG
                     ILDGWDRLDESGPFRFQMKGLFESWAQNHTVDASDMTKRDLPSIRNPFEEVCKNLGLH
                     ADMYVRVDTLKNQRMICSSFEVSHSSFFHKPLFQEMCVTKKGLTRFGKNRLTRMPINT
                     TRKLANFLIHGGIIKTAINPPLYLFNIIQAYGEYAEEVTQKMYEMITVMNSKTWDGAD
                     ISLTLHEDEKLLMSITYRRGGATIY"
     gene            <1076086..>1078524
                     /locus_tag="HG535_0B05510"
                     /db_xref="GeneID:59235170"
     mRNA            <1076086..>1078524
                     /locus_tag="HG535_0B05510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287342.1"
                     /db_xref="GeneID:59235170"
     CDS             1076086..1078524
                     /locus_tag="HG535_0B05510"
                     /inference="similar to AA sequence:RefSeq:NP_011479.1"
                     /note="similar to Saccharomyces cerevisiae YGL036W;
                     ancestral locus Anc_4.76"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143237.1"
                     /db_xref="GeneID:59235170"
                     /translation="MEVSPQTNDALIDSIMGSFETLHRGHVNAKLLLLLIETLGHLNA
                     KMLKGRFQSSELKGFDIFSPILKCNGLENKDEIVGVLVAYCSVYAELQPLITGSVATW
                     VPLLRSANHEILYFRPGFYTIVSLFGKNAKVSEIIPKLLKFNLGDVVRQLWIPQWISF
                     VNNGKGGYGRKLIESDLNIALNEGKMDFFIATMKSTIIEERNVTDRSSSPPFSFLFHK
                     LSQRGILFSRWVDKGLYQEFSTYLLSSGSKKRDQEMDSLNFQLEILMEVVDHPETNYF
                     EEPKLVTFLYLSLDKIYDIPCNQLHLTLGALGSTQSLFALLNMVQYLLSKFLIDTGNI
                     CELLQGTQIEMQLTKEKNQKWYKSKNNSTKLPSWFHSSILTHNPPITKSLFVYDKDDW
                     LKIESTSTSQIVELLFACLINSLLISAKLLKEYRKIKLDPLAFDISGIEVNENTFKIE
                     YLIKEQYMDLHLISLFSSLVLSEQISSCTNQFYEGKKNALSNDILFSSTMNVFKELLE
                     SHGTIGLHHLINFAARMSEDDLTIKSISLKLLNALLFDNDDSLARNLLQKNAIVYQAL
                     HRFIVIWDDGSEIFRPFHERLFHTEQPQPKATSVTISALLELLPNYESMLQIISEQRV
                     QKPANRAQTQCHREKGQCVLQTSGYKFNPYSAPSFVPAKKTTIEPSKETSSLTEQPSP
                     QALIKRSPEPWANYRRDITKVPVSSNQDRQSMFRPSIDYSTYTSAGSRTEQGQSSFAF
                     SNISSQISVPKTPDMSSSTMFSNPWEESPSMHSTPNISKIVNTGKNYILGGHNRMKNN
                     SRAQSIHIDDFEQT"
     gene            <1078713..>1080800
                     /locus_tag="HG535_0B05520"
                     /db_xref="GeneID:59235171"
     mRNA            <1078713..>1080800
                     /locus_tag="HG535_0B05520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287343.1"
                     /db_xref="GeneID:59235171"
     CDS             1078713..1080800
                     /locus_tag="HG535_0B05520"
                     /inference="similar to AA sequence:RefSeq:NP_011661.2"
                     /note="similar to Saccharomyces cerevisiae ENP2 (YGR145W);
                     ancestral locus Anc_4.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143238.1"
                     /db_xref="GeneID:59235171"
                     /translation="MVLKSTSASNVSVYQVSGTNVSRALPDWIAKKRKRTLKNDLEYQ
                     NRVELIQDFEFSEASNKIKVSRDGQYAMATGTYKPQIHVYDFANLSLKFDRHTDSENV
                     DFLLLSDDWTKSVHLQNDRSIQFQNKGGLHYTTRIPKFGRSLAYNEINCDLYVGASED
                     ELYRLNLEQGRFLNPFKLETKGVNHVSVDATHGLVAVGMEDSAVEFWDPRARSRVSIL
                     RLENQIDSSPFQVSTTSFRNDGLNFACGSTNGYVYLYDLRSSEPSIIKDQGYGFDIKK
                     IIWLDGVGTENKILTSDKRIAKIWDTVDSKAYASMEPSVEINDVEHIPGTGMFFTANE
                     GIPMHTYYIPNLGPSPPWCSFLDSITEELEEKPSDSVYSNYRFITKDDVRKLSISHLV
                     GSNVLRAYMHGYFINTELFDKVSLIANPDAYKDEREREIRRRIEKERESRIRTSGVSK
                     KSTIKINKSLAEKLSQKRGDKAAEKLLSDDRFKEMFENEEFQVNEDDYDYKQLNPVKS
                     ARETTEGAAKRIRALTAAEESDEERIALREGRADANDSSSDDESSSENEEEREQISRM
                     EQKKLQKQQKVIERRKREKHNSDQFMSKMSVSALNDEEQESRKVTFGEQVREATEADS
                     ISKSDDSVVRRTHRGEAELTFIPKSFEVKKQQHRSPLKGSEDNEENPRDTGRSRPRSD
                     GRRRASKNAFRGM"
     gene            <1081100..>1083076
                     /locus_tag="HG535_0B05530"
                     /db_xref="GeneID:59235172"
     mRNA            <1081100..>1083076
                     /locus_tag="HG535_0B05530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287344.1"
                     /db_xref="GeneID:59235172"
     CDS             1081100..1083076
                     /locus_tag="HG535_0B05530"
                     /inference="similar to AA sequence:RefSeq:NP_011523.3"
                     /note="similar to Saccharomyces cerevisiae SEC9 (YGR009C);
                     ancestral locus Anc_4.78"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143239.1"
                     /db_xref="GeneID:59235172"
                     /translation="MGIKKLFKIKPPEEDTLEQNRETLNEMGISTRNPSKKKREKFAA
                     YGRFAKDKAQDRVYAPEGYENFTKPQEEDDLNKSELDNATPNAESKGGGPQSADPYAA
                     SAGGSDPYAINTSANYGADPYSNMPTNNYQGTGYSENSYTSSGPSYGDPYQAPNGYSS
                     AYSGINGAGNVTSPYGASGSNMQDQNRPKVNPYGGGNFRDNSYSDRSSSRTANTTSNP
                     YGGLNKEQDEYSRSGSFPKSSKQPANPYATLGTDVYASHGVQAGQDSQSKNNPYSRRN
                     VNEYGSATGNEMRTGGAPRRRMGRPDMSTNRLTSTKSAADTLDLNKSAVDGDDLNEEP
                     RAGEFDFEEERPSYGENTVGVDELDLNAPLNEQDQQNDFNSTIADHQEQLYQEAPQWQ
                     LEDEGLSQSEYTQHNQGAYKTFDELQREEEARQQQEEDEAVDEVKQEIRFTKQSSVAS
                     TRNTLKMAQEAEMSGMNSIGLLGHQSERLNNIEGNLDLMKVQNKIADDKVAELKKLNR
                     NILAVHVSNPFNSKRRQREREEKIKNRKIEEKLMKEHTSQQLARSTQRIEGAMNANDD
                     INTVREKYQRKQILDRSKQFQFENDEEDDMMEVEIDRNLDQIQQISGRLKKLAMATGE
                     ELDSQQKRVRNIEDNTDDLDIKIHLNTTRLSGIR"
     gene            complement(<1083232..>1083693)
                     /locus_tag="HG535_0B05550"
                     /db_xref="GeneID:59235173"
     mRNA            complement(<1083232..>1083693)
                     /locus_tag="HG535_0B05550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287345.1"
                     /db_xref="GeneID:59235173"
     CDS             complement(1083232..1083693)
                     /locus_tag="HG535_0B05550"
                     /inference="similar to AA sequence:RefSeq:NP_011662.3"
                     /note="similar to Saccharomyces cerevisiae YGR146C;
                     ancestral locus Anc_4.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143240.1"
                     /db_xref="GeneID:59235173"
                     /translation="MSPFNDYCVVCDQLIPQSPESVKNTCTEKKHSHVGCSGKVLYCS
                     EDCRQKDQHLIHQRLESLVSCETCHETVDDPESLIKSPLLVPIDHSQQKYDEGDDDGG
                     ASYRLMNMVSSSTISIPRLSLQPPTPPISYDSIYHDHVAEKNYQLWLNQNH"
     gene            complement(<1084592..>1086046)
                     /locus_tag="HG535_0B05560"
                     /db_xref="GeneID:59235174"
     mRNA            complement(<1084592..>1086046)
                     /locus_tag="HG535_0B05560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287346.1"
                     /db_xref="GeneID:59235174"
     CDS             complement(1084592..1086046)
                     /locus_tag="HG535_0B05560"
                     /inference="similar to AA sequence:RefSeq:NP_011480.1"
                     /note="similar to Saccharomyces cerevisiae MIG1 (YGL035C);
                     ancestral locus Anc_4.80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143241.1"
                     /db_xref="GeneID:59235174"
                     /translation="METKKKTLQGVEASENGEFSSVDQSGVKSSAVQRKKSKNSGKDD
                     ARPHVCPICQRAFRRLEHQTRHMRTHTGEKPHVCDFPNCNKRFSRSDELTRHRRIHTN
                     PHPRAKRGRKKKVLVEATDESSRGTESLRKSAKTPSFELGDPQTSVSSSSSSPAQSHV
                     QLPPLSPPVAATPATSVASGSSLVPGAPTVMSTTQSPMSQLVSCSIQPSPLVAIANTP
                     SFFTDSNLASNSNSSSRLRLNALSSLQMMTPFNNSSGSVTPTRASMTNGVNHDMPNGS
                     HTGLAKHFGFMDTPDKMSSNVILPRPKSLTDFQSHHYSQNSFSGTQSSKKVIKSTQIL
                     RRPKSALSLSNLLNSKNTSMGSTSMNNSDSESDYADEDDALKEPYNGDGYDTGFERAR
                     KKSRTSTPTTKMSRSTSNTSLRKMPMMTKPCDDSIGFRDELSSKLLAVQRQQRSETRI
                     PTETTQETSESPPDHENKNVLPPLRSLQLRFPSG"
     gene            <1086580..>1087278
                     /locus_tag="HG535_0B05570"
                     /db_xref="GeneID:59235175"
     mRNA            join(<1086580..1087188,1087249..>1087278)
                     /locus_tag="HG535_0B05570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287347.1"
                     /db_xref="GeneID:59235175"
     CDS             join(1086580..1087188,1087249..1087278)
                     /locus_tag="HG535_0B05570"
                     /inference="similar to AA sequence:RefSeq:NP_011482.3"
                     /note="similar to Saccharomyces cerevisiae HOP2 (YGL033W);
                     ancestral locus Anc_4.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143242.1"
                     /db_xref="GeneID:59235175"
                     /translation="MASKKVKAVQVKGEEAEQLIEEYLVAQYRPFAINDIIQNLHNKV
                     SKTGAQKALESLEAQERIITKTFGKVVIYACKEQELAVAEDIDMEKYTLQFLSELRSE
                     LNEVEKDKNAVMEAWHKCLKEPSNEELVRIIKNNEETTKTLEKELQALEAKWDPANEE
                     AINQMVQTGDFLGKELRKRSRYLKRLISLIKDTIRPTNMTELLESIGCEYRS"
     gene            <1087641..>1088564
                     /locus_tag="HG535_0B05580"
                     /db_xref="GeneID:59235176"
     mRNA            <1087641..>1088564
                     /locus_tag="HG535_0B05580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287348.1"
                     /db_xref="GeneID:59235176"
     CDS             1087641..1088564
                     /locus_tag="HG535_0B05580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143243.1"
                     /db_xref="GeneID:59235176"
                     /translation="MAYSELAGSTYGKDNVKFLKVKKDKQNPKKQDVMEATVMVLLKG
                     DFDVSYTKADNAPIVPTDTVKNTILLFAKQYDTWPTEKFAAKLALHFTSKYDHVSGVT
                     IKIYEDRWVKYDVDGKPSLHSFVHQGPEKKVTFLDYDKKHGPSKYFLSSTIKDLTVLK
                     STNSMFYGYNKCEYTTLKPVTDRILSTDIFACWEWNCSKLGCLISISEGKKDEIFNSV
                     YTKARDITLDIFAKENSPSVQATMFNMATEILKVAPAVNYVTYELPNKHYFLFDFKWF
                     KGLENDNELFYPSPHPNGLIKCKVGRNSSKL"
     gene            complement(<1088674..>1089384)
                     /locus_tag="HG535_0B05590"
                     /db_xref="GeneID:59235177"
     mRNA            complement(<1088674..>1089384)
                     /locus_tag="HG535_0B05590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287349.1"
                     /db_xref="GeneID:59235177"
     CDS             complement(1088674..1089384)
                     /locus_tag="HG535_0B05590"
                     /inference="similar to AA sequence:RefSeq:NP_011663.3"
                     /note="similar to Saccharomyces cerevisiae NAT2 (YGR147C);
                     ancestral locus Anc_4.82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143244.1"
                     /db_xref="GeneID:59235177"
                     /translation="MFLRLSIMKSSLNRLVRFNGKGQMSVLRGNLRINRIGSARFNST
                     QQVPKPKGIKGLMQVYGYSALGVYLALTALDLPLCFLMVHSLGEEKIKVYINRAKRLV
                     GYGQEEQQVIEQVRKNLAEKMEREQHGSQETTSWWENFKESTLLAEFLIAYGIHKSLI
                     IIRLPLTAAITPGAVKLLRKWGFNIGNPKFLKTMAQDANIRFKSGNPNDFIKGSSKIN
                     ENLKQKSTKGQKWFDGLM"
     gene            complement(<1089701..>1089955)
                     /locus_tag="HG535_0B05600"
                     /db_xref="GeneID:59235178"
     mRNA            complement(<1089701..>1089955)
                     /locus_tag="HG535_0B05600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287350.1"
                     /db_xref="GeneID:59235178"
     CDS             complement(1089701..1089955)
                     /locus_tag="HG535_0B05600"
                     /inference="similar to AA sequence:RefSeq:NP_011483.3"
                     /note="similar to Saccharomyces cerevisiae AGA2 (YGL032C);
                     ancestral locus Anc_4.83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143245.1"
                     /db_xref="GeneID:59235178"
                     /translation="MKLSIPFYIAYLIASSSHIMAQSDSCQMLPTAGSLATTPFSTAT
                     TTFTTGSVTQVALVEYFESITYVSNCSPSTSIGTTTIPVF"
     gene            complement(<1090382..>1090849)
                     /locus_tag="HG535_0B05610"
                     /db_xref="GeneID:59235179"
     mRNA            complement(<1090382..>1090849)
                     /locus_tag="HG535_0B05610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287351.1"
                     /db_xref="GeneID:59235179"
     CDS             complement(1090382..1090849)
                     /locus_tag="HG535_0B05610"
                     /inference="similar to AA sequence:RefSeq:NP_011484.1"
                     /note="similar to Saccharomyces cerevisiae RPL24A
                     (YGL031C) and RPL24B (YGR148C); ancestral locus Anc_4.84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143246.1"
                     /db_xref="GeneID:59235179"
                     /translation="MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSSSLFKQRK
                     NPRRIAWTVLYRRHHKKGITEEVAKKRSRKNVKVQRPIVGASLELIKERRTMRPDIRK
                     AQREEKKKADKEKRKTDKATRKAEKAKSAAAGGAKISKQQAKGAFQKVAATSR"
     gene            <1091208..>1092180
                     /locus_tag="HG535_0B05620"
                     /db_xref="GeneID:59235180"
     mRNA            join(<1091208..1091210,1091866..>1092180)
                     /locus_tag="HG535_0B05620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287352.1"
                     /db_xref="GeneID:59235180"
     CDS             join(1091208..1091210,1091866..1092180)
                     /locus_tag="HG535_0B05620"
                     /inference="similar to AA sequence:RefSeq:NP_011485.1"
                     /note="similar to Saccharomyces cerevisiae RPL30
                     (YGL030W); ancestral locus Anc_4.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143247.1"
                     /db_xref="GeneID:59235180"
                     /translation="MAPVKNQENINQKLALVVKSGKYTLGYKSTVKALRQGKSKLVII
                     AANTPVLRKSELEYYAMLSKTRVYYFQGGNNELGTAVGKLFRVGVVTILDAGDSDILT
                     ALA"
     gene            <1092370..>1093611
                     /locus_tag="HG535_0B05630"
                     /db_xref="GeneID:59235181"
     mRNA            <1092370..>1093611
                     /locus_tag="HG535_0B05630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287353.1"
                     /db_xref="GeneID:59235181"
     CDS             1092370..1093611
                     /locus_tag="HG535_0B05630"
                     /inference="similar to AA sequence:RefSeq:NP_011665.1"
                     /note="similar to Saccharomyces cerevisiae YGR149W;
                     ancestral locus Anc_4.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143248.1"
                     /db_xref="GeneID:59235181"
                     /translation="MTVFADDELKNSSSGGISLSNLFELLDPIASSVASVYVTNNYLA
                     RAKKKLKTFDPSDKRVHLDEWKLKLLQRVKALDKPLHTVLFKEDSRLGKLFYPFTLFT
                     IFCIGFVMGKFPEWFHVLYTFLFFLLMPLRFYTYYKTNNHYYLADLCYFVNFLCLLFI
                     WCFPDSVHLYQTCFAFTFGSLSFAVITWRNSLVIHSLDKTTSCFIHIMPTCTMYIIHH
                     GISEELKSIRFPAASMIASKSWNLKKNIIWTSLYYLVWQSLYHYFITLRKSSKIKSGE
                     RMTSFEYLTTHQYKNFWVVKLPQPWPMIVYTIAQYFYQLATMLLCGIWFNYRIAAIVF
                     LTFIFLCAAHNGATYYIDYYGKRFEKEVEKLRNEVENLQQQLKSSGTNSALDNCSMTS
                     GYSIIDTAESSDRSSVNSKND"
     gene            1097636..1097708
                     /locus_tag="HG535_0Btrna2A"
                     /db_xref="GeneID:59235333"
     tRNA            1097636..1097708
                     /locus_tag="HG535_0Btrna2A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCA"
                     /db_xref="GeneID:59235333"
     gene            complement(<1097885..>1098604)
                     /locus_tag="HG535_0B05640"
                     /db_xref="GeneID:59235182"
     mRNA            complement(<1097885..>1098604)
                     /locus_tag="HG535_0B05640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287354.1"
                     /db_xref="GeneID:59235182"
     CDS             complement(1097885..1098604)
                     /locus_tag="HG535_0B05640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143249.1"
                     /db_xref="GeneID:59235182"
                     /translation="MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTI
                     DIDNKIFDLEILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLDELMELREQVLR
                     IKDMDRVPMVLAGNKADLNDERKISVEEGIEVSSKWGKVPFYETSALQRSNVDEVFVD
                     LVRQITRNEMQSVGGQDKSKSKSSLSNGYVQDGNKEAETPKTSNNRGKNLVNSPTVDD
                     SSRKGKSKVKNKKKKGPCSIL"
     gene            complement(<1099071..>1099802)
                     /locus_tag="HG535_0B05650"
                     /db_xref="GeneID:59235183"
     mRNA            complement(<1099071..>1099802)
                     /locus_tag="HG535_0B05650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287355.1"
                     /db_xref="GeneID:59235183"
     CDS             complement(1099071..1099802)
                     /locus_tag="HG535_0B05650"
                     /note="ancestral locus Anc_4.71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143250.1"
                     /db_xref="GeneID:59235183"
                     /translation="MSHHCEDEHHDHSHGHDHDAPIATNPNQSLYSNIDTANVRCFNT
                     VTLGLPRQMEAYKSFLKDQDSKFNCSSYLQSDADCQMIIHIPFVGNCKLFSLILRTNA
                     NDHESELNSPRTIKLFKNFNQSVDFDTLQTRKEDYKLEHPENVGLRDSRVETNDDENT
                     FVEHYLPRRSFQNCSSLTLFVEDNWSGNEDEYCRCYYLEIRGEFSGHRVLNNGVPIIN
                     AYEAVPNPLDHQKLENEGDEIGLGF"
     gene            <1100033..>1101055
                     /locus_tag="HG535_0B05660"
                     /db_xref="GeneID:59235184"
     mRNA            <1100033..>1101055
                     /locus_tag="HG535_0B05660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287356.1"
                     /db_xref="GeneID:59235184"
     CDS             1100033..1101055
                     /locus_tag="HG535_0B05660"
                     /inference="similar to AA sequence:RefSeq:NP_011475.1"
                     /note="similar to Saccharomyces cerevisiae HEM2 (YGL040C);
                     ancestral locus Anc_4.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143251.1"
                     /db_xref="GeneID:59235184"
                     /translation="MHTAEFLDIEETSISSVLAGGYNHSLLREWQNERQLTKNMLIFP
                     LFISDDPEECSDVPSLPNIKRFGVNRLCSYLKPLVAKGLRSVILFGVPMRAGCKDPVG
                     TSADDPEGPVIQGIKLLRKNFPELYIICDVCLCEYTSHGHCGVLYDDGSINREASVAR
                     ISAVAVNYAKAGAHSVAPSDMIDGRIKDIKRGLIKAGLAHKTFVLSYAAKFSGNLYGP
                     FRDAACSSPSHGDRKNYQLPSGGRGLARRALKRDVNEGADGIIVKPSTFYLDIMCDAS
                     EICKDLPVCAYHVSGEYAMLHAAAEKGIVDLKTIAFESHQGFLRAGARLIITYLAPEF
                     LEWLNE"
     gene            <1101471..>1102985
                     /locus_tag="HG535_0B05670"
                     /db_xref="GeneID:59235185"
     mRNA            <1101471..>1102985
                     /locus_tag="HG535_0B05670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287357.1"
                     /db_xref="GeneID:59235185"
     CDS             1101471..1102985
                     /locus_tag="HG535_0B05670"
                     /inference="similar to AA sequence:RefSeq:NP_011671.3"
                     /note="similar to Saccharomyces cerevisiae CYS4 (YGR155W);
                     ancestral locus Anc_4.69"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143252.1"
                     /db_xref="GeneID:59235185"
                     /translation="MVTDTRTNVLDLVGNTPLIELKKLPKAYGIRPRVFAKLELYNPG
                     GSIKDRIALSMIEHAESTGQIHPDRTTLIEPTSGNTGIGLALIGAIKGYRTIITLPEK
                     MSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKRLEKEIEGAVILDQYNNPMNPE
                     AHYVGTGKEIQEQLEKLSKFGQLKAVVAGAGTGGTISGISKWLKEQRNDIVIVGADPK
                     GSILAQPESLNESSQPEYKVEGIGYDFVPDVLDRSLVDVWYKTDDKPAFKYARQLISN
                     EGVLIGGSSGSAFTALVEYSKDHPELTEEDILVVVFPDSIRSYLTKFVDDEWLKKNDL
                     WDDEVLAKVNAKNESPVAKKDPFDGATVKDLHLKPVVSVKESATVSEAIKILKDNAFD
                     QLPVLTEDGKLCGLVTLSQLLRKVSKGVSKDDELKGIYFNFRKLNHCNEVSSYNDNKS
                     GKKKFVQFNENTRLSELNKFFEKNSSAIITDDMRPTHIVTKIDLLSILLDTWKN"
     gene            complement(<1103052..>1103483)
                     /locus_tag="HG535_0B05680"
                     /db_xref="GeneID:59235186"
     mRNA            complement(<1103052..>1103483)
                     /locus_tag="HG535_0B05680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287358.1"
                     /db_xref="GeneID:59235186"
     CDS             complement(1103052..1103483)
                     /locus_tag="HG535_0B05680"
                     /inference="similar to AA sequence:RefSeq:NP_001106172.4"
                     /note="similar to Saccharomyces cerevisiae YGL041W-A;
                     ancestral locus Anc_4.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143253.1"
                     /db_xref="GeneID:59235186"
                     /translation="MLRRISGITTAKHITSPLSLRASSGVIWIRKSQRFYAQSWDNRQ
                     PNEKIDAHIKVQQLMDRIHSHPNVMQKLEKVSEIMIQKGLVTEDATKPLGPWQMIKVL
                     MDKDLKTAMSEFKEELNKANIQLGPDQLGPLMSVLGIEKKK"
     gene            complement(<1103815..>1104744)
                     /locus_tag="HG535_0B05690"
                     /db_xref="GeneID:59235187"
     mRNA            complement(<1103815..>1104744)
                     /locus_tag="HG535_0B05690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287359.1"
                     /db_xref="GeneID:59235187"
     CDS             complement(1103815..1104744)
                     /locus_tag="HG535_0B05690"
                     /inference="similar to AA sequence:RefSeq:NP_011472.1"
                     /note="similar to Saccharomyces cerevisiae DST1 (YGL043W);
                     ancestral locus Anc_4.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143254.1"
                     /db_xref="GeneID:59235187"
                     /translation="MPNKDICIDRQLPMMDSKEVVVHVKNLEKSKTNDEAVLQILSVL
                     EKEIVPTEKLLRETKVGVEVNKFKKSGNPEIARLVKKMIGSWKDAINRSKKSKLQQAQ
                     SQDIPTPNNGPSTGNVESKKQEKFVSTKPRSSRNDGVDTNIYNHKLRDMVIKALYDAI
                     AKESEHPPKSILTTVKSIEEELHKLNNCETKEKGYKEKYRVIYSNIISRNNPDLKHKI
                     ANGDITPFYLVNCDPKELAPEYLRKKIEEIAKQNLFNAQGATVERSVTDRFTCGKCKE
                     KKVSYYQLQTRSADEPLTTFCTCEVCGNRWKFS"
     gene            <1104887..>1105723
                     /locus_tag="HG535_0B05700"
                     /db_xref="GeneID:59235188"
     mRNA            <1104887..>1105723
                     /locus_tag="HG535_0B05700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287360.1"
                     /db_xref="GeneID:59235188"
     CDS             1104887..1105723
                     /locus_tag="HG535_0B05700"
                     /inference="similar to AA sequence:RefSeq:NP_011471.1"
                     /note="similar to Saccharomyces cerevisiae RNA15
                     (YGL044C); ancestral locus Anc_4.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143255.1"
                     /db_xref="GeneID:59235188"
                     /translation="MNRSGNNSSQNNAPSKVVYLGSIPYDQTEEQILDLCSNVGPVTN
                     LKMMFDPQTGKSKGYAFVEYKDFESSASAVRNLNGYQFGSRLLKCGYATGSDISSSDS
                     PQQQQLHQSQQQLRQQNFQVNETLLKFPELPSGVDVNINMTTPAMMISSELSKKTREE
                     QLKLLSIFQDWTRKNPEDATELLHECPQLSFVIAELLLTNGISKVDDLTQLAVQEHDR
                     AHPNGDQNTPIDPKIQTKQRELLRQVLQLNDSEISVLPDDEKMSLWDLKQRAMRGEYG
                     MI"
     gene            <1105943..>1107163
                     /locus_tag="HG535_0B05710"
                     /db_xref="GeneID:59235189"
     mRNA            <1105943..>1107163
                     /locus_tag="HG535_0B05710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287361.1"
                     /db_xref="GeneID:59235189"
     CDS             1105943..1107163
                     /locus_tag="HG535_0B05710"
                     /inference="similar to AA sequence:RefSeq:NP_011672.1"
                     /note="similar to Saccharomyces cerevisiae PTI1 (YGR156W);
                     ancestral locus Anc_4.65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143256.1"
                     /db_xref="GeneID:59235189"
                     /translation="MSDPRRRKARHDLTPDNLSYAIQVTNLPIDWTQDTVSSVLAGSG
                     PVVEISSKTDPRTGKLSSLRFDYKSSKDCKSAFDILNRIQNFPCTLERIIPPNYKDME
                     LLSNKEELQLNRDAYPWNAGLDLPFDMVSEVPLPRKPTQTSPATTNSVVFPDILSKAS
                     QHLPPFQPNVLQAPDLVSTNLSKIPPLQLIEIISNLKILANQDSSKRTQLENFLKTNM
                     EISVSVTQALLEMGFINYNVVTNVLKGQPKNDTTVFHSNTTNGTGNSNSNSVNNSSSN
                     TPLYANSNVASLSSVPVPAAFVPPMPQHAQRPPFGFVPPPMPFMPPNPVLGMAPSNPM
                     MRMSPPHPVINMPQSTVAQNSSGRINMAKLQALPQNQRETIETVLKLTLDQINALPAN
                     QKSMVENLKKEYTL"
     gene            <1107934..>1110450
                     /locus_tag="HG535_0B05720"
                     /db_xref="GeneID:59235190"
     mRNA            <1107934..>1110450
                     /locus_tag="HG535_0B05720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287362.1"
                     /db_xref="GeneID:59235190"
     CDS             1107934..1110450
                     /locus_tag="HG535_0B05720"
                     /inference="similar to AA sequence:RefSeq:NP_011673.1"
                     /note="similar to Saccharomyces cerevisiae CHO2 (YGR157W);
                     ancestral locus Anc_4.64"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143257.1"
                     /db_xref="GeneID:59235190"
                     /translation="MTKQGGKGLVAETRSTGVKFEPPETHDMVRSLFDPTVKKSFLEI
                     CITLALMSNFAFCYWLLKTFNAQMATKVFFFQYFFWRLCYNVGIGIVLHYQSKSEFLT
                     RYARNNSLFVKKSKSKLARFCQFELSSKMPKSYDMYSYPEELNIWLLFRQFVDLILMQ
                     DFCTYVIFVYLSFPESWASMVNWRTGLGFSMILFNIWVKIDAHRVVKDYAWYWGDFFF
                     LQESELVFDGVFNISPHPMYSIGYLGYYGLSMICGDYRVLLVSLCGHYLQFLFLKYVE
                     SPHIEKIYGDDSNGGLESNSRIDDLIASRNYDYSRPLINTGFTFQNFDKLRFTDYFTL
                     STIVALISWMLLTKPSSDVLFYLTFTAKLLTSIGVLVVLFKQSKTKWFTRLYLKNGHT
                     QVYSYQQWQFVYNFSLAITYTLLGCETYAKVSERLPALERNQFIYGLILCALQGWCNS
                     EIRSAISDFGWFYGDFFLNNYITKKNITSHGIYRYLNNPEAILGVAGIWGTVLMTNFS
                     WQNVVLASLWTLTNFILVKFIEQPHMAKIYGEKNRVGGIEKTLLTSKTWRRMSEMVEK
                     VEHIVIKSLLSQTPTYEEVAISNHSSERSDSTANNEMEELESAVEDAIDVVAAKLSPN
                     CKFEIEEYDKHSNFILPEPITITWELPKSLYNQKDWIGLYSVLKTGCDRSKTRTSSLG
                     HWSATSPTAYPNDISKAKSIIEYEQKDKVVRGKVTFDASLLYFESGIYEFRYHCSSSH
                     KVLLVSRPLQLELPRFDVTTSEKLTKDFVRFLTSINSFEGGRANLNGNKYFGLKTFRQ
                     FIKESVDVELSSDYIKRVNGDAEAIAQRICHIKKVLDSLE"
     gene            complement(<1110513..>1111244)
                     /locus_tag="HG535_0B05730"
                     /db_xref="GeneID:59235191"
     mRNA            complement(<1110513..>1111244)
                     /locus_tag="HG535_0B05730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287363.1"
                     /db_xref="GeneID:59235191"
     CDS             complement(1110513..1111244)
                     /locus_tag="HG535_0B05730"
                     /inference="similar to AA sequence:RefSeq:NP_011674.3"
                     /note="similar to Saccharomyces cerevisiae MTR3 (YGR158C);
                     ancestral locus Anc_4.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143258.1"
                     /db_xref="GeneID:59235191"
                     /translation="MNVQDRRRLLGPGNAKPITFEPIVKEKDKQEATEHDIKETLFLR
                     SGLIENCNGSSLVEFKSQHRQTSLIASVYGPRAVRGSFTSKAAISVQIKNGSSGDYDK
                     SRLKELASFLTTVFSSVINRSRYPKSGIDIFIHLTYDRDLQDEKNAGIAAIIPHCITG
                     ITLALIDAGIEVLDITSGGHHNGSVFAFIKEGEEVTGFWKDPSRCDDNMEESLKVCKE
                     RYLNYKSIMTGYLFQNQKSESVQEA"
     gene            complement(<1111516..>1113168)
                     /locus_tag="HG535_0B05740"
                     /db_xref="GeneID:59235192"
     mRNA            complement(<1111516..>1113168)
                     /locus_tag="HG535_0B05740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287364.1"
                     /db_xref="GeneID:59235192"
     CDS             complement(1111516..1113168)
                     /locus_tag="HG535_0B05740"
                     /inference="similar to AA sequence:RefSeq:NP_011470.4"
                     /note="similar to Saccharomyces cerevisiae RIM8 (YGL045W);
                     ancestral locus Anc_4.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143259.1"
                     /db_xref="GeneID:59235192"
                     /translation="MSFLSVFKKDSRAVPGSRLSQRGKHSMNFVSGYGNGISNGCVRE
                     FYIDLKEPHRIWKPEEYITGETVVSIKKDVTNVAIRLILICEIKVKLGSTAAVRRKLG
                     ERLLEKSTFLYGKEWDQDSNATVINGLTKGEHRFPFRIKVPSGRKVCSSIKFERGSID
                     YYLKCSIENIESNQVERPISVCESGFSVIVPRDVSLLPKPKVKTVVLQSAAMVRHASK
                     TLGDGSSSSFTKATKSSTNSNSSANTSGSISSIDKTVTISVDISNAGFAIGEIIPVKV
                     FVQHYKNFCRPAGLIITLARICRVSGGGKDEPMETFRKDICQTISPLYVDPETLQCSV
                     TAYLKVPIDAFSTFTTCHKYFTFQYYVEVMVNLSQKNVIYTESKRVVGTKDTIVSEIA
                     SDLDDKASFSKLPRKFFNAVNSDRTLNDENSIESNISYQDMVNVEKLKRLNNVTGMSI
                     ETVIGTTGSKLEELPPRVEYETLSGAIEATDDLESPLTSTAASPDRSATDWLAPLYAY
                     DKYPPAPQYTPNESISAAVDDKKELEHARLKQLESDPPTENF"
     gene            complement(<1113651..>1115090)
                     /locus_tag="HG535_0B05750"
                     /db_xref="GeneID:59235193"
     mRNA            complement(<1113651..>1115090)
                     /locus_tag="HG535_0B05750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287365.1"
                     /db_xref="GeneID:59235193"
     CDS             complement(1113651..1115090)
                     /locus_tag="HG535_0B05750"
                     /inference="similar to AA sequence:RefSeq:NP_011675.1"
                     /note="similar to Saccharomyces cerevisiae NSR1 (YGR159C);
                     ancestral locus Anc_4.61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143260.1"
                     /db_xref="GeneID:59235193"
                     /translation="MAKTAKAASNKSTKKSVKSKKEEKVVDVSASESSSSSSSESEDG
                     SSSSDSDSSSDSSSDSEAEKPKKVTKKEAKKDTKKDAKKETKKEKASSASSDSDSASS
                     SASDSSSDSDSSSDSDSSSDEEEEKAKEKPAKSESKSASNSDSSSDSSSDSDSSSDDD
                     EEEKAKSSSSSSSSSSSSSDDEDVPKKRKAEESAEESSEEPSNKKTKVELSGEPATIF
                     VGRLSWSIDDEWLKNEFDHIGGVVSARVIYERDSDRSRGYGYVDFEDKSYAEKAVKEM
                     HGKEIDGRPINCDMSTSKPAGGDRADRGDRAKKYGDVPSEPSETLFLGNLSFNADKDN
                     LYEMFSKYGDIVSVRIPTHPETEQPKGFGYVQYGNVEDAKKALEALQGEYVDNRPVRL
                     DYSTPRPNNDNGSRGGRGGRGGSFRGGDRGGRGGSFRGGDRGGRGGSFRGGDRGGRGG
                     FRSSGSGANNSPLGARNTASFAGTKKTFD"
     gene            complement(<1115425..>1118214)
                     /locus_tag="HG535_0B05760"
                     /db_xref="GeneID:59235194"
     mRNA            complement(<1115425..>1118214)
                     /locus_tag="HG535_0B05760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287366.1"
                     /db_xref="GeneID:59235194"
     CDS             complement(1115425..1118214)
                     /locus_tag="HG535_0B05760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143261.1"
                     /db_xref="GeneID:59235194"
                     /translation="MLFNIVTIIYIFALACHVDGLSTVTRRETSIRTSYVCPCSASSV
                     PGTVSSSTLSFISSTSSSLASASLSTTTSTICPSCSITTPSTTTRITSTVTSTICPSC
                     GFSSSGTSTRSASTTSSRTSPSRSSSATASTRTTSSTVCPSCSASGTSATSFTSSLSS
                     SSRATTSTTTTSSTRTTFSRTSSSSSSSSSSSSSSSSSSSSSSSTTTTSVSTITSTVC
                     PSCISSRTSTQSFTTISSGSVLTSSTATGSTSTASYTSSSSTSFSGSSTTIRSTTTAS
                     STSISSDSSQSSYFSSTTDLSSSSATSSPTTGSTSTTSSTAHSISTQGSSSTATTSIS
                     TFTSTVCPSCSLPRTSTQSFTTIPSDSVLSSNTVIRSTGRTLSGRSSSISATGESTTT
                     LSFTSSSRQTTTLLNSSSNGECSNQIIERIQNTQWVTATAYETNFSTIYDTISNTVTQ
                     TETATVNETSTLTQIQTALSDGTTCISVVTEKTTVVATATATATATVTVTVTATATGA
                     ARSDAGTTLIGPESNITETVTQMVPTIVTLTETETVNEVSTLTQIETATSSNCTLRIS
                     AVTETSTVVTTFTDTVRNAVATTSFEGQSTITEKVTQTVPTTIVQNGSATIFGTTIIT
                     PTTVIVSAPKKRSVLTVYLNMTTTALNQGTGPITETITVTNDHIVTIPYTVNHVGSPN
                     TVQMVSTVTTTYTETADGSCAATKTVTETSAVSGETPDIASSTSTVNAVVTANLSILT
                     TRLTQPVAQPDMAPLTTTAIFLTTQTSHDATSLNSPVNLMGPSTLSHNTASEVLISNI
                     TVGTTNTALTTPTGQLSTSSFTSRLPTDETKSDHIYPASHGNANSTTPLQPPVVTVTS
                     TTSYGSGAFYPTTSGVQGSSTIAPTRNSAQSLPPSYSITDIQITSNPSILPQNSAIKP
                     KSRQLYFILPLLFLL"
     gene            complement(<1118949..>1119626)
                     /locus_tag="HG535_0B05770"
                     /db_xref="GeneID:59235195"
     mRNA            complement(<1118949..>1119626)
                     /locus_tag="HG535_0B05770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287367.1"
                     /db_xref="GeneID:59235195"
     CDS             complement(1118949..1119626)
                     /locus_tag="HG535_0B05770"
                     /inference="similar to AA sequence:RefSeq:NP_011677.3"
                     /note="similar to Saccharomyces cerevisiae RTS3 (YGR161C);
                     ancestral locus Anc_4.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143262.1"
                     /db_xref="GeneID:59235195"
                     /translation="MRRSSDIRESPRSKQFGLHLQPMCSRPIQKRKLSCEEIINEMEK
                     EQDAQVMRLLREVDMLREENMLLRKQLYQGPVSARQSYPQLQGEGFTMDEECDANYHY
                     GLSSGSTRSSISYPQRKPSPVGIQTAQRGGGLPIDTMMPTLSLNLKRGSTSAAPNSSS
                     SSSITAESESSQHLLKSGMQEADPRYKMPRRYSSVSDTNNKFDRSHVEATRRLREYEF
                     ESSRGLT"
     gene            complement(<1120268..>1122322)
                     /locus_tag="HG535_0B05780"
                     /db_xref="GeneID:59235196"
     mRNA            complement(<1120268..>1122322)
                     /locus_tag="HG535_0B05780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287368.1"
                     /db_xref="GeneID:59235196"
     CDS             complement(1120268..1122322)
                     /locus_tag="HG535_0B05780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143263.1"
                     /db_xref="GeneID:59235196"
                     /translation="MVILAIFLLFAGLAGCEAHKMDSWQSNSVLGCGVYLSKMQWMYE
                     SSSNFYSSICAYEPALGSWSTCIHDMLNDRMPNERDIIYEKTLTNVKDICQLGNKKFA
                     EELTFERYNASRNNASRYLCGDDDTYMNSPLTCPVKVDKAMRDRIGNAYHYYSSNFDN
                     SSKYGSMTYVYFIVVVLISCAFKVCKTSALSRSILKYRFINLVRGYLVLPTLFGKHAS
                     HLETNWLCTGLIPTTFESLMILGYTLISATTLAVKYQLDPFNFLFPSKWLQFIRLLAD
                     RSGIIAIIQVPLIILFSTRNNIVECLTGFKYTTMIMLHKWIGRVMILEACIHSIAYAL
                     YATLLHSYKASADEAYWKFGVIAMTSCVGLLVLSMGIIRKCTYETFLYIHILLVIVFF
                     YTYFKHVESFGFGSTIYFPLSLWVIERILRVVRILRFGYLKARIQLIDDDLLRITIQL
                     PSCQKQKAFEPGQYIFLYFMQPSIFWQSHPFTVIHSNNELTLVVKPKKGATNTMLKKV
                     RQVNGFLEINVLVEGPYGSRSAINKSDRLLFLAGGTGIPGPLSHAIELGKRQSKRTID
                     LVITVRELDILKAYRSELLLLEHLPVHLVIHLTNSITTTTYSSTEETEIITKLKSFAT
                     IRNGRPDVEKLINESLNNGPLAIVCCGPASFVDQTRDFVAKVTVENPSAPVEYLEEYQ
                     CW"
     gene            1123087..1125047
                     /locus_tag="HG535_0B05790"
                     /pseudo
                     /db_xref="GeneID:59235197"
     mRNA            1123087..1125047
                     /locus_tag="HG535_0B05790"
                     /product="uncharacterized protein"
                     /pseudo
                     /db_xref="GeneID:59235197"
     misc_feature    1123087..1125047
                     /locus_tag="HG535_0B05790"
                     /note="possible pseudogene; frameshifted compared to
                     homologs in other yeast species"
                     /pseudo
                     /db_xref="GeneID:59235197"
     gene            complement(<1125206..>1125592)
                     /locus_tag="HG535_0B05800"
                     /db_xref="GeneID:59235198"
     mRNA            complement(<1125206..>1125592)
                     /locus_tag="HG535_0B05800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287369.1"
                     /db_xref="GeneID:59235198"
     CDS             complement(1125206..1125592)
                     /locus_tag="HG535_0B05800"
                     /inference="similar to AA sequence:RefSeq:NP_009958.2"
                     /note="similar to Saccharomyces cerevisiae RIM1 (YCR028C-
                     A); ancestral locus Anc_1.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143264.1"
                     /db_xref="GeneID:59235198"
                     /translation="MFLRQIRSFHATSRKFDLSKMTIVGRVGSDFTEFTSANNTRYLK
                     YSVASQPRRDGATNWFNITVFIDPQINFLTQYVRKGYVSRPYGVFNLHKEEFLLTLYT
                     AVLWFTLRLTLLTIPSKEKTALREPL"
     gene            <1126365..>1127210
                     /locus_tag="HG535_0B05810"
                     /db_xref="GeneID:59235199"
     mRNA            <1126365..>1127210
                     /locus_tag="HG535_0B05810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287370.1"
                     /db_xref="GeneID:59235199"
     CDS             1126365..1127210
                     /locus_tag="HG535_0B05810"
                     /inference="similar to AA sequence:RefSeq:NP_012350.1"
                     /note="similar to Saccharomyces cerevisiae YJL185C;
                     ancestral locus Anc_1.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143265.1"
                     /db_xref="GeneID:59235199"
                     /translation="MSFNNGFTRRSGSRSAIQATIASANVQSEHGYGYDVDSIEAFDD
                     VRVLNNPDTESYGISTSEESRNGAVVYELRSEEFAILSTESSSSSEINQPTTENLLVC
                     SVPSSNSQRIDEWCMNNELDDFGEHQKHALTSLRVQDVIQSWGVDQAPNKSFGRDLQA
                     EYQLKGDPYENYASKMLQELNGDQLFKVKQLTKELLPLLRNSRRSHSVFTHRFRNIPS
                     VFSQRDLILTFSLQYNESESSSTTFLDKFSSVSLDDGISISSQGNSSWLGWTLVPRFT
                     DNELS"
     gene            complement(<1127317..>1129782)
                     /locus_tag="HG535_0B05820"
                     /db_xref="GeneID:59235200"
     mRNA            complement(<1127317..>1129782)
                     /locus_tag="HG535_0B05820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287371.1"
                     /db_xref="GeneID:59235200"
     CDS             complement(1127317..1129782)
                     /locus_tag="HG535_0B05820"
                     /inference="similar to AA sequence:RefSeq:NP_009959.2"
                     /note="similar to Saccharomyces cerevisiae SYP1 (YCR030C);
                     ancestral locus Anc_1.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143266.1"
                     /db_xref="GeneID:59235200"
                     /translation="MTAERTAYADSILTTKSPSEATEVIRIRLSQAKLINKEFYLLFN
                     EVSQLKRSYAQQLRKIITENEDLNKLLKQQMVENKVLSTQEMSQFNFESLGELQSVWD
                     TIVMGLKEDMKATTEFYHTVDNEVIRELQRSTENDTKWSESKKLHSKLSQIAAAVDSH
                     QSNHNSNTKLEEANKQWDSEVPYLFELFENIDFNRLETLKNTSIRYQTAVSDYLLNYS
                     KKSEVSMTKLLEFDSQKEINRFARESSRYKFEALPTQKLEDHKTKRKSTFGNRFTSGS
                     SVLHHDLMNQDFSDSNNNSSLGNKKSTNKLKSKMGSIFSRNKLKNKRSTIFNKDVGSP
                     LVEGEITHSSTRDRSSTKTSSTSQPQSPIPSETHDQTARRRSTIQSSRESDSLYRAVN
                     RTSTAQSFQSGTPIGASETDHEENSPRPETPQKLDSQRDMSRTPLSMSQPPLQPQLKT
                     KALPSEPPQSASPERNILPTQQNYQQGQVDAKALHIRAPALPPSRKHTTNIKNSEPLS
                     SPEASPGNGTSMQKDAPQLTSQITGSLTMLNPQTTGSSASLIGQNVFQHSYLEVPDFG
                     LSASIAEVINATFKDGILKDSQLIGEIAFSYMTNAALNTPLPIGINLRIDNAANLSKV
                     ILNQAFVERVDIENFKVSPQFINSRTLGAIKYSMKEPTAPIVIHPVWRFEATQASVVL
                     TIKMSPTVSNQTKQIILDDLTVLVSIQGANATSALSKPQGSFSKEKKRIAWRFKGPTV
                     LNRDGEQRLIARFLTDGPAQETENGVITKFTIRDQSKGEVGIGSDISIKYQELDENDP
                     FGGPWNDVISTRTITAGNYNGLS"
     gene            complement(<1130039..>1131799)
                     /locus_tag="HG535_0B05830"
                     /db_xref="GeneID:59235201"
     mRNA            complement(<1130039..>1131799)
                     /locus_tag="HG535_0B05830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287372.1"
                     /db_xref="GeneID:59235201"
     CDS             complement(1130039..1131799)
                     /locus_tag="HG535_0B05830"
                     /inference="similar to AA sequence:RefSeq:NP_012349.2"
                     /note="similar to Saccharomyces cerevisiae MNN5 (YJL186W);
                     ancestral locus Anc_1.150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143267.1"
                     /db_xref="GeneID:59235201"
                     /translation="MSVIRLIGSRIRANKMYKRMTFRYLVVAIIIYVFVTILYYQDSL
                     PDSIVSNGRKVWTSGPLEFSPDRYYFKLFDALSKYEPLPRPDIKEMRGEAGCHEGDIS
                     GASSEEVLRKASYQNLDSCMHPPNELLDDLKKKHTQFVEKMHLNLQVSPEDVKKLWPN
                     ERGIVTIGGGRFSVISISMLETLREMNSTLPVEVIVPPEDEGDDDYCDNVLPKLNAKC
                     VFFSDVLPQDLISKLKIERYQYKLIGLLISSFREVLFLDADSLPLENIDRVFDKPLFK
                     EKGLILWPDMWRRATTPAFYKVAGIEYDLSTRVRYMGDDISPISRYEDTSSKPDYKTE
                     VPMHDLEGFIPDLSSESGQLLMNKVEHLSTLILATYYNVHSRWYYRMLSQGTSGEGDK
                     ETFVAAAYALNMTYYQVKTKLTLDGYRDHNADYHGISLYQHNFQQDYDQYQRAKRYVE
                     ENLEEFSVYNPKYSYNSDFMDSLMKPTKGNNVGVMFAHISYHKFDPYEMATEDIHMNK
                     DREHFRAFTRYDVLKGFDLELFNYKAYQRYLCSPDSLPIDFKYYREKFNNEERNNMCK
                     YLDDRVEFLNQTHQEYLGNS"
     gene            <1132334..>1134640
                     /locus_tag="HG535_0B05840"
                     /db_xref="GeneID:59235202"
     mRNA            <1132334..>1134640
                     /locus_tag="HG535_0B05840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287373.1"
                     /db_xref="GeneID:59235202"
     CDS             1132334..1134640
                     /locus_tag="HG535_0B05840"
                     /inference="similar to AA sequence:RefSeq:NP_012348.1"
                     /note="similar to Saccharomyces cerevisiae SWE1 (YJL187C);
                     ancestral locus Anc_1.149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143268.1"
                     /db_xref="GeneID:59235202"
                     /translation="MHIPLMAGNYKIRIDREPVIEEEREEEEEEDFEMFQTEREAVGR
                     SGLDDIGDDKGDQAGSNNLKFYPYSNSGLTRSVGTLNLSLSNTELPKQVSRRLGDIKE
                     EEQVGSGVDEFIKGWSPFNEDAPTTPTTTTFGKQSLKNELSPFVNDPDILRKWKFKSS
                     LSKTPINAKEEEKISPSWQDNDVPDQSAFLSPRGLVSKVTQAKADASFPKKLSILNTP
                     VKKSPVMDTSRISNSLMDSPNYLNQSNFTQNTSFFIQSPSVRFLPQLYVEESPFDSFT
                     NTELNKKSAKVRNSQSPAQLHVNRYKKIKKSRNSVLLNNEELTNSLQQFTDDLYGTEN
                     ENDNGHENANENDNENDFESSKIGEDDLSFFNNFRPRLSNLSNDIDSCSSTDTTPTRK
                     KTLLNNNMKTIESSPSPLKTRRFINAKISTNPDAHLFEKFSNVMAIGDGQFSTVYQVT
                     FTETNKKYAVKAIQPNKFNSMKRILQEIKLLSEISETNLDEEGKEYVIDFISSWNHQT
                     SFYVMTEFCENGNLDIFLREQIIARQVRLEDWRIWKIIVELSLALRFIHDSCHIAHLD
                     LKPANVLITFEGNLKLGDFGMATHLPLEDQSFENEGDREYIAPEIISECVYDFRADIF
                     SLGLMIVEIAANVVLPDNGNAWHKLRSGDLSDAGQLSATDIHSNSLFSDNSKVDTNLT
                     EISDYHNNFNGQRQKHKIPAWVPKFLIDGESLERMVKWMIEPDYKRRPTASEILNAEE
                     CIYVEMTRKAGAIVQEDDYGPKPGFFMA"
     gene            complement(<1135132..>1135602)
                     /locus_tag="HG535_0B05850"
                     /db_xref="GeneID:59235203"
     mRNA            complement(join(<1135132..1135281,1135597..>1135602))
                     /locus_tag="HG535_0B05850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287374.1"
                     /db_xref="GeneID:59235203"
     CDS             complement(join(1135132..1135281,1135597..1135602))
                     /locus_tag="HG535_0B05850"
                     /inference="similar to AA sequence:RefSeq:NP_012346.1"
                     /note="similar to Saccharomyces cerevisiae RPL39
                     (YJL189W); ancestral locus Anc_1.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143269.1"
                     /db_xref="GeneID:59235203"
                     /translation="MAAQKSFRVKQKLAKAKNQNRPLPQWVRLKTGNTIRYNAKRRHW
                     RRTKLGI"
     gene            <1136359..>1136751
                     /locus_tag="HG535_0B05860"
                     /db_xref="GeneID:59235204"
     mRNA            <1136359..>1136751
                     /locus_tag="HG535_0B05860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287375.1"
                     /db_xref="GeneID:59235204"
     CDS             1136359..1136751
                     /locus_tag="HG535_0B05860"
                     /inference="similar to AA sequence:RefSeq:NP_012345.1"
                     /note="similar to Saccharomyces cerevisiae RPS22A
                     (YJL190C); ancestral locus Anc_1.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143270.1"
                     /db_xref="GeneID:59235204"
                     /translation="MTRTSVLADALNAINNAEKTGKRQVMIRPSSKVIIKFLQVMQRH
                     GYIGEFEYIDDHRSGKIVIQLNGRLNKCGVISPRFNVKISDIEKWTENLLPARQFGYV
                     ILTTSAGIMDHEEARRKHVSGKILGFVY"
     gene            complement(<1137061..>1137780)
                     /locus_tag="HG535_0B05870"
                     /db_xref="GeneID:59235205"
     mRNA            complement(join(<1137061..1137467,1137771..>1137780))
                     /locus_tag="HG535_0B05870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287376.1"
                     /db_xref="GeneID:59235205"
     CDS             complement(join(1137061..1137467,1137771..1137780))
                     /locus_tag="HG535_0B05870"
                     /inference="similar to AA sequence:RefSeq:NP_009960.2"
                     /note="similar to Saccharomyces cerevisiae RPS14A
                     (YCR031C) and RPS14B (YJL191W); ancestral locus Anc_1.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143271.1"
                     /db_xref="GeneID:59235205"
                     /translation="MAKDLVQTPINSQVFGVARIFASFNDTFVHVTDLSGKETICRVT
                     GGMKVKADRDESSPYAAMLAAQDVAVKCKEVGITAVHVKIRATGGTRTKTPGPGGQAA
                     LRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL"
     gene            <1138695..>1139381
                     /locus_tag="HG535_0B05880"
                     /db_xref="GeneID:59235206"
     mRNA            <1138695..>1139381
                     /locus_tag="HG535_0B05880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287377.1"
                     /db_xref="GeneID:59235206"
     CDS             1138695..1139381
                     /locus_tag="HG535_0B05880"
                     /inference="similar to AA sequence:RefSeq:NP_012343.1"
                     /note="similar to Saccharomyces cerevisiae SOP4 (YJL192C);
                     ancestral locus Anc_1.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143272.1"
                     /db_xref="GeneID:59235206"
                     /translation="MLHFLVFVCLQLISISAASIRGRLDIGLSNITGATLSRTHFRLN
                     QIGNYSNEVGYTATSHLKNTLGDFEFQDMPLNHGTNETTYFVLALGSLDFNLKPNRIL
                     CEFINIDENGTEYQFNAYKNIFGKEFFPSPDITFPEKLESVETEPFIPISLVNRAPLR
                     LYYQQQNKGLFTGGPFARLLDTTWKQAIAVTFVALLALPVLLEKFDPETAQAIKEEKL
                     KKQREKYQIE"
     gene            <1139609..>1146001
                     /locus_tag="HG535_0B05890"
                     /db_xref="GeneID:59235207"
     mRNA            <1139609..>1146001
                     /locus_tag="HG535_0B05890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037287378.1"
                     /db_xref="GeneID:59235207"
     CDS             1139609..1146001
                     /locus_tag="HG535_0B05890"
                     /inference="similar to AA sequence:RefSeq:NP_009961.2"
                     /note="similar to Saccharomyces cerevisiae BPH1 (YCR032W);
                     ancestral locus Anc_1.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037143273.1"
                     /db_xref="GeneID:59235207"
                     /translation="MEGDIEILADLLLACLSLSPLEEQEGNLVATYKSSIRDHLVEIL
                     SNFSGESLQTVHESSSYQFCDMWTYIDSELAQRFELSTTDLHFTMNDLDSWSKLLLCS
                     SGSIEYALCLQIIISLSNMSLMNKMALKKLGKLKSNYLDKLLSFIDGDSILVVEKSTE
                     LFSLILTVCCEPTDIFQLYNNFQARAASHTLNSLAAQLSDPLSQNYLQFENCYKTFKI
                     EPNEYSQYTLQLFIEFNNVTSNRVMTIGRDIYLEIKEGQFCISNDEFIVALFTEYEFQ
                     EGILYSIAVVLDSDNISLYVGGSCVGKICLFEGSMMGIEQFDLGSMICSFKLFRFFIF
                     NDIYTEDSIKILHAFGSFVKASFAKNTDLHDVRPILADMMNCSSRSLEEQVEEVRKQN
                     EKNLITDLNPLEESSSGDHQKEHAVEGLVDHITMGKCYIYRGANLLPMFASVNCFLFI
                     LCSLENSKSMDDLFNYLSHLMTLLRNSHLRNWFQKAYGFSLLSHILLTKAVKKMGRSL
                     PIQFLNLFQEYCGWDFSNITKSLINDEIAYQTLVLNIDLWYFHKDKSFENDAGLEIIR
                     FLFFQIASLLENSKYQHYNSQKLRRLNILGRLNNTQHLFAERYGTPNIIKDLESELSH
                     VYYGLLKDDFSKKNIQWLLQFSYFELKNGFSSNSEISLIALDRFCIEMLNKNDMRAIR
                     VFSESVSPKFLVMLLNEITVSKGNPMIALNILFKLLLINKLAYKNFAKSGGLELIFHI
                     LRGAARFYEDIIYLLYLYSFGDYNLDPDLKVSEEFQNEAVPENNIIVMREAFLLAVEL
                     LEWAVINDIKESFPLDLESFICIFLKKVSILLRNAKNFSPLSPCSSALFRLLQDLLIT
                     LTKPQNSQVYSDSSRILIDILSERTIHSIKVLNHWEFERFFNELVGSYTGAGNGTPSL
                     EKKVSYFELSFVHSILPSIVRQISGLKKLYEDLAKNTYMMANVLLLLDRCIPILIREV
                     FDVKLKFELFLCLLNLTKLVKQGHSFKCLNKTGLDEIFSSITLSLLYTFIMNEPYESI
                     PILPSFYGAILEDFDLLCDVKHSSHQSSMA