GenomeNet

Database: RefSeq
Entry: NC_050722
LinkDB: NC_050722
Original site: NC_050722 
LOCUS       NC_050722            1312970 bp    DNA     linear   CON 09-NOV-2020
DEFINITION  Zygotorulaspora mrakii chromosome 4, complete sequence.
ACCESSION   NC_050722
VERSION     NC_050722.1
DBLINK      BioProject: PRJNA670754
            BioSample: SAMN14605243
            Assembly: GCF_013402915.1
KEYWORDS    RefSeq.
SOURCE      Zygotorulaspora mrakii
  ORGANISM  Zygotorulaspora mrakii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Zygotorulaspora.
REFERENCE   1  (bases 1 to 1312970)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     The yeast mating-type switching endonuclease HO is a domesticated
            member of an unorthodox homing genetic element family
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1312970)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1312970)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUL-2020) Conway Institute, University College Dublin
            (UCD), Wolfe Lab, Belfield, Dublin Dulin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP058607.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: HGAP v. 3
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100.0x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1312970
                     /organism="Zygotorulaspora mrakii"
                     /mol_type="genomic DNA"
                     /strain="NRRL Y-6702"
                     /isolation_source="silage"
                     /db_xref="taxon:42260"
                     /chromosome="4"
                     /country="Italy"
     gene            complement(<7400..>11644)
                     /locus_tag="HG535_0D00100"
                     /db_xref="GeneID:59236029"
     mRNA            complement(<7400..>11644)
                     /locus_tag="HG535_0D00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288138.1"
                     /db_xref="GeneID:59236029"
     CDS             complement(7400..11644)
                     /locus_tag="HG535_0D00100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144033.1"
                     /db_xref="GeneID:59236029"
                     /translation="MTIVEVSDKYVVVNGWLVDRKEKKVVNPSWRSRRKLSKQRQNVI
                     LDQDLSAWDRYLTSESVILPVADPELFSFIQVRPYDFAELRDGKTVAQSKELYRRNPG
                     SVRRSFTLQCHRVNIRARKHKYIRLSVLAQSVDMLDAGVDLHLDKDNSVLSRVIKVRE
                     FTFSEEDYEVLREFREMKTAYVVFGQNYLNFAYLKAEHSASNYLNIDMKDGITSMVKK
                     FAPSTINQYGVTLAPYLFLLFNAWRLSCFAEHAFLPHRVIEMLTHDPERQDTIVYKMK
                     ALGRCFDNCLRENIYREYLARWVRMCAFNFPVWDRTDVPCPENTVTKARRIMDTIRCL
                     IVFTCFATTENVSETAYWLASRNYLSVINYWGWFRRLYHKVAKEEGIEATVRVTVNPD
                     ERAVRVEGKLISFEYVAQMKSDLNRDLEAHVEELHRWLEFGSVSDVYMTVMANRSICV
                     VENLSGQDSVFNVIGAEAVSGYTMRFREQASAQNEQVRASILKLVNTITKLLMLAVWI
                     NPGLALRFPELSIISFGGSHRNLYFDSDDRVFIIRSRYNKNTKYDTRLLFLDTRVSAQ
                     LFWFIYILRPFTIVLLGDDISKINISAIMGALTPQEPLTDTHDTEEEVEDINFNAELY
                     YHQMELRNRLNNASPQTIGNAIFKSMVFLDVRKLVLVHRSTFSNMLLKYPTATAMRES
                     HRIRSMRHGLSALWKHFIAGQLYDQSLELGQAVARGFGHSVSVDAAVYGFDNSRTVGP
                     GEVPFVSAKKLCQIFQKLTQNGPLITDTACTSSAASEPDEGTIGDYTNLCEAGSGIIS
                     GFKFRSVEQERFTNMILTGDRNVLALQAPTGFGKTMTFVLPMLVLKRTRPGKYVHFVA
                     VPYVSLKIATMQRLEEVGLAVADLKLLGSAEWKSKLKNTDVLVGTFDMFGTHATFSSI
                     NGWQEELMCVRQKGYFILDEAHALWLEQDFREELREIHSLRWREFLKIVFISATLPAW
                     LMDELCQQLNLSRYMVRNARWTNAVHQVPNQKVLKEVTLVPQKEFGGAIEQRVNSYLL
                     GTATGKAIIFFSNKARMRHCYARWKKVAAVAAVDSEMADRVKLSVFREFESASSPVCV
                     IMGTKLISNGLDCNAVDYVCLADCDVDVIDFLQMVGRIRGSGYLEVVRIAGKKKEFRD
                     AVAHEDLRDVNWSKCITETVASFYSVPAPDHQLCCNSWEEQSCPREIGEVRRIVHSVR
                     LNVPSEEEGDEEEDQGHSRMFDFILDNIQNKTTGLYASELRTLLFDSTSADLPRMKDL
                     IYGVPADHILTAAEMNLSESVCRTCFMSNEYCQCETFGKHMGKIILEALALLRLVSAR
                     QNMRHLFNFAQLGRGHNIVQHVLRQKAVWSRLYEEAMESEYTETIEGITCNDDVTSRA
                     LLQWAYFWHAVVRSKANVATLVFEGRLSKPFGIDME"
     gene            <19024..>20955
                     /locus_tag="HG535_0D00110"
                     /db_xref="GeneID:59236030"
     mRNA            <19024..>20955
                     /locus_tag="HG535_0D00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288139.1"
                     /db_xref="GeneID:59236030"
     CDS             19024..20955
                     /locus_tag="HG535_0D00110"
                     /inference="similar to AA sequence:RefSeq:NP_014478.1"
                     /note="similar to Saccharomyces cerevisiae BDS1 (YOL164W)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144034.1"
                     /db_xref="GeneID:59236030"
                     /translation="MIDSSRREQECSRLLPKGSQPSTLAANHEMAKDLPFSDRGDFED
                     AIRGYVGSIHDEQILGSDGSIVWSMKPYDFLKTDNSSATVNPSLWRQAQLNAIHGLFE
                     ITNGVYQIRGLDIANMTIIEGDTSLIIIDTLFTTETARESLKLYYEHRPQKPVGTVIY
                     THSHSDHYGGVKGVVNEADVKAGKVQIIAPVGFMESVVAENFLAGNAMHRRAQYQFGM
                     LLPKGTRGLVDCGIGKAASHGTVTLIAPTSTVADPFEERTIDGVEFVFQLVPGSEAPS
                     EMLIYLPQQRILNMAEDVTHHMHNLYAIRGVEVRDGNQWAKYIDAARVAFGGQTDILI
                     AQHHWPTTGRERVNAVLKKQRDMYKFIHDQTLRLLNQGYTSRDISEILRMPSNLEHEW
                     STRGYYGTLSHNVKGVYQKYMGWYDANPANLNPLPPVASAKKVIEYMGGAEAVLARAY
                     KDFQKGEFRWVASVVNKLVFAEPANRQARELCADALEQLGYQSEASTWRSAYLVGAME
                     LREGVPKRPSTGKRNNLGALNNAMLFDFLAVRLNASRAEGMLIVANWCFVDSNERFVL
                     TLENCALTNVRGLQADVDATVTLSRDTLEALIDKETNLDDAVKKEKVSIEGDQLKIEQ
                     FWTLFDDFDQSFPVIEPMK"
     gene            <21746..>23449
                     /locus_tag="HG535_0D00120"
                     /db_xref="GeneID:59236031"
     mRNA            <21746..>23449
                     /locus_tag="HG535_0D00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288140.1"
                     /db_xref="GeneID:59236031"
     CDS             21746..23449
                     /locus_tag="HG535_0D00120"
                     /inference="similar to AA sequence:RefSeq:NP_014479.1"
                     /note="similar to Saccharomyces cerevisiae YOL163W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144035.1"
                     /db_xref="GeneID:59236031"
                     /translation="MKNGFIVTDMSVNKEDGSKFEKVLTGATTSQLEYSSFNELDSSS
                     IDAFNDSKFQEDNGNPFLNPIVEKHYRELYVSTKYECVERFDPFFTWTKKEEKKVVNK
                     LDWHVTLLSCFLFVALQVDRGNLLQGVADNLLHDLGLNSSNYNVGNTIFFLTFLCAEL
                     PSQLISKKIGADNWIPMQMTAWALVATLQCRMKGKNSFYACRALLGLLEGGFVPDLVL
                     WMSYFYNSSELSIRLSFFWVTLSLTQIVTSFVAYGVFHMRGIGGMAGWQWLFLIEGIF
                     TLFIGVSAYFLMVPSVVQTKKPWNKKGWFTEREEKIIVNKILRDDPTKGDMNNRQGMS
                     LKMLWKALTDYYLWPIYLIGLVAYIPTNVLTTYLTMVLRNIGFTTFEVNLLAIPSFIL
                     HIILLLGLTWLTEKCNNRLGLSLLQPLYTVPLLAVLRFWKATMFNKWGTYAIITLLLG
                     NPYIHAICVSLCSRNSQSVKTRTVSTSLYNMFVQAGLIISSNVYAIKDAPIYRRGNAV
                     LFGLALAMFPILIGSKFLYVYINKQRDKTWDCMSEEERDHYLNTTTEVGSRRLDFRFY
                     H"
     gene            complement(<28526..>30262)
                     /locus_tag="HG535_0D00140"
                     /db_xref="GeneID:59236032"
     mRNA            complement(<28526..>30262)
                     /locus_tag="HG535_0D00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288141.1"
                     /db_xref="GeneID:59236032"
     CDS             complement(28526..30262)
                     /locus_tag="HG535_0D00140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144036.1"
                     /db_xref="GeneID:59236032"
                     /translation="MLLDTKTERNIPKYNQLISKRRVAMAIGAGMLIVGALSNMFSWS
                     YHNHIGVDYIEQCGRMDPILPEFNKSIMMIFESPDFKEKAISRLAGAIQIPTEVFDDN
                     PSPSEDIEYYHEFFKLHDYLVNSFPLVSKHLKLEKVNEVNLLFTWEGKDKKLKPMMLT
                     SHQDVVPVDPETVSQWTYPPFSGHYDASSDLIYGRGALDCKTLLIAQLAAIEQLIEDG
                     FEPTRTVIVALGFDEETAGLHGARTMGKFLHERYGDNGIYSIVDEGSMVAEISKNVFI
                     AAPVVQEKGYLDVNITVLGNGGHSSIPPEHTTIGVAAEIISSLENKPFKFEFSLENPF
                     YGFLVCMAEHSNSLPAEFKKAIIEARFDEKERKNLVEFISQRPEMRELIRTSQAVDVF
                     HGGMKANALPQVSTFLVNHRIDIQSSVQEVLESDLSVAREVAEKYGYGLYLADEEVIP
                     CTDVGSITVTGYKPLEPSPYSPTKGSQVWDIFSGTIQNVFQNGLLRNNFEAEVYVTTN
                     TISANSDTKHYWALTKNIYRFFGNVLPQGLWKTVHSVDETIPASAHLTSIAFVYEYIV
                     NVQEGANEDSLP"
     gene            <30908..>32560
                     /locus_tag="HG535_0D00150"
                     /db_xref="GeneID:59236033"
     mRNA            <30908..>32560
                     /locus_tag="HG535_0D00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288142.1"
                     /db_xref="GeneID:59236033"
     CDS             30908..32560
                     /locus_tag="HG535_0D00150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144037.1"
                     /db_xref="GeneID:59236033"
                     /translation="MKDQVKVDCAPSPVESCDSNGSLSLEKNHGGAPLHNDESEDEPI
                     QTILSARGKPVKVWADFDDAMDLADKASYLELTPEEDKKLCRKIDLHMFPLMSLLYAI
                     QYMDKTSNGNAAIMGLITDLKMVGDQYSWASSAFYFGYLGGLFVLPPLLQKSKYFMKT
                     LAAIIILWGMVLIVHAAPNVNFASFVFLRCLLGFLESAITPAFTVITAQYWRKEEHFL
                     RICIWFGFNGFGAIWGCSIAYGLFIRADVYSIPAWKIVFIVNGCITVFVDFLMLFILP
                     DAPQKAWFLSKREKLLLILRIKGNQQGFGNHRIKKHQIWEAFRDLRTWIYFFYAISAS
                     IPNGGITNFQTILLHGDFEYTTKQTLVISIAISFVSWLGVPLFGYASSYYLKKKSKYL
                     GSCLIWSIISLVIVLLGVCLLAFLESSKQGRLAGLVFILLSPVALISVLANISANTLG
                     YTKKWTVMSIMLIGYCAGNIAGPHTFIESQAPHYQGAKVTLVVCFAVGIALLTGLYIL
                     NVSENKKRDRYAMENTMEENAIQNIEFADLTDFENPLFRYTL"
     gene            complement(<33330..>35108)
                     /locus_tag="HG535_0D00160"
                     /db_xref="GeneID:59236034"
     mRNA            complement(<33330..>35108)
                     /locus_tag="HG535_0D00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288143.1"
                     /db_xref="GeneID:59236034"
     CDS             complement(33330..35108)
                     /locus_tag="HG535_0D00160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144038.1"
                     /db_xref="GeneID:59236034"
                     /translation="MNKSGRRRITRNREVKSCERCIAGKRKCDKDKPKCERCTRLGII
                     CLYPTRAGLKKSALVSNSSEDSSTLHFLVEANNKTTSNNFQIVTNLTGEVSVFIPTNH
                     FPFYGLFSKLDDTFTITQGNSGVNDVFDFSRFTTKILSLRQLKAKIPAKELGDHFISH
                     FFSEIFPLVPIIDRDDFLLKWKTYWEEPYSFSDLNALILMFGVFFSSCVSIQLNSLYH
                     GPPDFASSDLDRHKMEYFECVENIRYLLKTDICPSIPAISSLGLMYYVSSLNCYGLAA
                     AISTLQRYCQMAGLHRKTSQLPEKPLKEILYGFVTYLDSLVSVYHGLPTQVDPRVSEI
                     TEISDALPESVHVLAFFARFFSARICARSRTSLNKINGPSAHDVRKLKKDFKKVQRVV
                     KSINEKISDSQYLPTSDKDFVKAGNQLFLRRAAYFLVVMKIIVETSDQEKLVDLSCHH
                     KELLIQSLLLMNESFILISQLPNSGRGCLWFARNTYPLEAILIVISNLETYPTEGINF
                     SNLSHKERYTTCDSIDYISGDIRAILLEKCCDALQQIECLWPPVLRELFRKIVEIKER
                     TLCKGRGSCDTTCSAVVKANVAQSTR"
     gene            <40696..>41271
                     /locus_tag="HG535_0D00180"
                     /db_xref="GeneID:59236035"
     mRNA            <40696..>41271
                     /locus_tag="HG535_0D00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288144.1"
                     /db_xref="GeneID:59236035"
     CDS             40696..41271
                     /locus_tag="HG535_0D00180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144039.1"
                     /db_xref="GeneID:59236035"
                     /translation="MKEFTIGVIIGSTRSARICPMVTQYVVDTINSQQWQKSFTLSVV
                     DLKVWNLPMFDEPKVPATIKQSEDYEHDISRKWSKEVSTYDAFIFIAPQYNWGYPSCL
                     KNAIDYLFNEWTGKPAMIVTYGSHGGEKCYSQLKQVLEGLNMKVSDQGVLICYPTKKE
                     ILNGIPRDFHFDQLPGLDEIVKHAFSRLLSL"
     gene            complement(<43574..>44650)
                     /locus_tag="HG535_0D00190"
                     /db_xref="GeneID:59236036"
     mRNA            complement(<43574..>44650)
                     /locus_tag="HG535_0D00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288145.1"
                     /db_xref="GeneID:59236036"
     CDS             complement(43574..44650)
                     /locus_tag="HG535_0D00190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144040.1"
                     /db_xref="GeneID:59236036"
                     /translation="MSHIEKFHGIGIVDPTDWKHPKRVTFDPKPYGDYDIDVEIEACG
                     VCGSDIHCASGDWGKVPKNLVVGHEIIGRVVSLGPKCHTGLKIGDRVGVGAQVYSCLE
                     CDRCESGNEPYCPKFVTTYSQAYEDGYISQGGYSDHIRVHEHFVIPIPKEIPSHLAAP
                     LLCGGITVFSPLLRNGCGPGKKVGIVGIGGIGHMGLIFANAMGADVYAISRSYAKKED
                     ATKMGAHHFIATKEEPDWGTKYFDTFDLIVVCSSSLTEVDFDIMPKVMKVGGHIVSIA
                     APSLSEKLTLKPLGLMGVSISNSALGSPAELKILLDMVANENLKIWVETLKIGESGVH
                     EAFERMEKGDVKYRFTFIDYDKEF"
     gene            <47278..>48222
                     /locus_tag="HG535_0D00200"
                     /db_xref="GeneID:59236037"
     mRNA            <47278..>48222
                     /locus_tag="HG535_0D00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288146.1"
                     /db_xref="GeneID:59236037"
     CDS             47278..48222
                     /locus_tag="HG535_0D00200"
                     /inference="similar to AA sequence:RefSeq:NP_012706.1"
                     /note="similar to Saccharomyces cerevisiae URA1 (YKL216W)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144041.1"
                     /db_xref="GeneID:59236037"
                     /translation="MSASLHTSFLHSSYDNPFMNASGVHCMTTKELEELSESKAGGFI
                     TKSATTLQRDGNPEPRYFSVPLGSINSMGLPNAGFEYYMSYVLDYQEKNPNLNPPFFS
                     VAGMSVEENLKLLRRIQDSEFYGVTELNLSCPNVPGKPQVAYDFELTKEILTKVFEFF
                     KKPLGVKLPPYFDFAHFNIMTDILNQFPLCYVNCINSIGNGLYIDSENESVVIRPKDG
                     FGGIGGDYVKPTALANVRAFYTRLNPNIKIIGTGGIRSGQDAFEHLLCGATMLQVGTE
                     LYKEGPSIFDRLECELKDIMNKKGYATIDEFRGKLKGL"
     misc_feature    50877..51169
                     /note="Z region"
     gene            complement(<51248..>52125)
                     /locus_tag="HG535_0D00210"
                     /db_xref="GeneID:59236038"
     mRNA            complement(join(<51248..51283,51337..51681,51742..>52125))
                     /locus_tag="HG535_0D00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288147.1"
                     /db_xref="GeneID:59236038"
     CDS             complement(join(51248..51283,51337..51681,51742..52125))
                     /locus_tag="HG535_0D00210"
                     /note="HMRa1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144042.1"
                     /db_xref="GeneID:59236038"
                     /translation="MIQCSLVRYIIYISIFKYLYFLSSVASRCDASHFVSIVEKGCVY
                     RAPKNCRHFIPQVLNNEIGSNMQNLGSVLSTLSMIIQLCESSTKTENGFNTEENAQQE
                     VADKSFQTGIEELDQRIQESFDAIQPLLFELCISESDRKLLQKKIHENCSKFSQNFVD
                     KEGETSKSSTKYQAVYSICNTDRNAEARTILPVKSNIKRVQRLPKSTTYFLEQVYSKK
                     QILNSRERMAIAKKCKISCSQVRIWFSNKRMRTKST"
     gene            <52153..>53433
                     /locus_tag="HG535_0D00220"
                     /db_xref="GeneID:59236039"
     mRNA            <52153..>53433
                     /locus_tag="HG535_0D00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288148.1"
                     /db_xref="GeneID:59236039"
     CDS             52153..53433
                     /locus_tag="HG535_0D00220"
                     /note="HMRa2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144043.1"
                     /db_xref="GeneID:59236039"
                     /translation="MFFTECMLPKRGDIDEEYTDFIFFKDESRKSSNRVKFKFVGQKI
                     HEDKQVEEFNLSVEYKSSKMGMLITRPRNRFIIMRTILYNTIIRSLEKCDLSSLKDVS
                     AITSQLWGKNDGIFQLYFELLSQFEEHWHLNIYPEYRYHKVNKISRQLENKLVYQNML
                     NRMRYFTASSLLSKLEDIVTLPAASATDAAGTAPTAAEPFSSTYTYSSFHSSQIRANH
                     LHHYHYQNRQKRQSTTTRSNSQQPNLPSLQNPHSSETLQNCHWKIKKSSSCKRTRNHN
                     FALPKQDHRCDRIKFDFPKKKLLPPDLNTVSNNTNPSRFPSTSSMKKPLQYSTLPSPH
                     YSPLLPRIPTASRLASSKADHCHRTAGASHSYNISSSSFPSLAYFTKPTEIDFTLQTR
                     LSTLPYVPEPKSLSNVEDLFIESDRIVLFSSRNP"
     misc_feature    52461..53876
                     /note="X region"
     gene            complement(<54098..>55243)
                     /locus_tag="HG535_0D00230"
                     /db_xref="GeneID:59236040"
     mRNA            complement(<54098..>55243)
                     /locus_tag="HG535_0D00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288149.1"
                     /db_xref="GeneID:59236040"
     CDS             complement(54098..55243)
                     /locus_tag="HG535_0D00230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144044.1"
                     /db_xref="GeneID:59236040"
                     /translation="MEESPVYPFITLPEGQFTIVDGFLINLNGKALNPDLTGGIEIVD
                     ESCSAFFREYSIYNSLRRLEKTASNYFLTRHSMFFRLMGIKDYVTFVKSREKYYCRKC
                     DRSNATHAAFTVKFFGGKKPVRAKYIVFERALENSTCDLSELYRQQYTELERTDLSLK
                     LGKRSWLTRNNGQKDSFNIEYMKEEELLKKIKSPTVNFLPPLNRYSERPKVVSRASLK
                     KFQENLLRHCELISCWKLKKLIELLKISKELIGLIFDVQPLYLEGLKQIRNNLKFIDQ
                     RLFFVLMRTPCSGATLLKILSLDNVISSSNAEDAKPETTINQPSEPKHIKSEDNSEQR
                     HAIDNSVDPSHYFLRELTLFCSYTEQSKIYIKCFFEAKEKYGKKMGN"
     gene            <56072..>60736
                     /locus_tag="HG535_0D00240"
                     /db_xref="GeneID:59236041"
     mRNA            <56072..>60736
                     /locus_tag="HG535_0D00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288150.1"
                     /db_xref="GeneID:59236041"
     CDS             56072..60736
                     /locus_tag="HG535_0D00240"
                     /inference="similar to AA sequence:RefSeq:NP_014157.1"
                     /note="similar to Saccharomyces cerevisiae ATG2 (YNL242W);
                     ancestral locus Anc_2.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144045.1"
                     /db_xref="GeneID:59236041"
                     /translation="MGLWLPQMIQKRLLLYVLQQISVLSNIDLSNLHVSLGSSSQFSF
                     DDLNLAVDDIKIPYLSLRSGSIKHLEIELTVSGGVSICGKGVLFVVKPLIDDQDNDPN
                     SFSLTKSIHDLTNSIIQYSESDKHSFSVYKDPESDGSTSPLADSTESTSSSGKESEPI
                     IAVGALENMKNKILNVALSKLMVRFENIKFRFLLEENIIEASLGEIELNTEDNNIRKV
                     EIHDFKVVCVKNSEPNDTEYLSDDNMSNSVLYSSKEASSIYMSALEGLKSPPDGQEDS
                     ILEDNELSLGLTAIEHISISFQGLSSLDDLALRDLKVKIQNASIDLESLLTMSDTTIG
                     FVSRVFTTRKTEDVPQASNLKGYKRFQKEQGILEGFDNLAVDMNYLSVHFGEGVSMVF
                     NNMNYTCWENREQTMLIDTMTLKGDGIDLQSSPAPILRAVLNSNEVEINILHSLILKV
                     DKLALGKLAKVQHRLQEFSVRNIRPPPKKSHASSRYKEERVYKFCAKPITVLLNIGAY
                     QLYLSTSEIFSRLPNDIIKIKNVTIGRRTEQKDHSMVTLDDLSIIASKSRMQLISFDE
                     NFKESSLTSKMLVRVREIAVSHEFEHLKRLFLDFQDIHSIIKINDKKPNVDKHKVFMK
                     RSVRILKSSNIVYKKTDQALYSIILDNVDIKIRSFYNEHFGDLQTNISSILLAASMDG
                     SFFGFCKDFLCKRNTASQQEVLASSITTEDIKKPLIFFQAKANGKIKTILREMSLHYY
                     AKWLDFFSSKSNDSSSEKSNLQNSIPWELKMINCSIKLHPYRIKPCLAIIMEHIHLTG
                     RTAMEQVKIVAKNGAILLIDDVQNIKFVEKRHYPSLVNFYVYQGFSEVGKIDSVSIQS
                     KRVANATSAKIKANNIGLSLCADSAHTLVQLFMDLKIPITFPDDEKYSLTVPSAIDVF
                     KHIDSDFFCSSHIKKNSDCYENDEEDLIHVDSSFLDDDTNNQHQQVMKENYTIDTSSE
                     STSSNMRLQESYLDTTIREDHESLTELKEHIDIVIELEVAKMTIKLFDGYDWKFTRKS
                     ISQKIEEIDRELKKRSETTNSNERLEGAIFDSIYISGNPSDSVDLKKRVNDEIQGEFM
                     SGLGSRKADLHPSRYYKALVELNQLGLIFTGYPMGTPTRSESAGTAEVLNKCEILVQS
                     FDVIDNVPTSTWNKLLTILRHEQWPLDRPMLNMNVCLLRPVDFLAATELRFDIKLAPL
                     RLHVDQDTLDFLVKFGEFKDMRFELIDKYPDIPFIQKLTTNSVKLKLDYKPKKVDYSG
                     LRSGHTSELMNFFILDGANITLKGVALYGISGFSELNTILKSVWTPDITSRQLPGVLK
                     GFAPVKSILALGSGARALVSVPLAEYKQDRRLGRSLKQGCNVFVRTATGDFVKLGARL
                     ASGTQTVLESTEEFFGGDGAQGRLFKYDDPLMDINGLLEEDQLVGGSNPTIKGRGPAA
                     LVIDPSKCNEGEPKIVSLYADQPLDLHKGLEEAYSSLEKHMHLVYDVIWKTQGEIKDS
                     RSGTAAAAVSVAKVAPVAIIRPLIGATEAIAKALQGISNQLDKEQVNDLNDKYKSRSG
                     KK"
     gene            <61293..>64373
                     /locus_tag="HG535_0D00250"
                     /db_xref="GeneID:59236042"
     mRNA            <61293..>64373
                     /locus_tag="HG535_0D00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288151.1"
                     /db_xref="GeneID:59236042"
     CDS             61293..64373
                     /locus_tag="HG535_0D00250"
                     /inference="similar to AA sequence:RefSeq:NP_010041.2"
                     /note="similar to Saccharomyces cerevisiae LRG1 (YDL240W);
                     ancestral locus Anc_2.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144046.1"
                     /db_xref="GeneID:59236042"
                     /translation="MSTQLDLKRNHQHEHTASSTEYSNNRQIRNMKKKCAHCHKDIQG
                     QGKTTLKALNNYYHEECFTCRDCGVLLKPKYFPYELPGTNETILLCQYDYFRRHNLLC
                     HVCDKPLRGLYYTAFGNRYDEEHFSCSICGVPCGVKKCFMHEDKLYCKYHFLKFFSKR
                     CSGCDYPISDQYIEFPKGDEIHCWHPECYGIHKYWHVNLSAETLGLLALPVVRYEEGN
                     IDNNINPIPKELDRQMQAFNSIMSRTWSVLYRFEEETAACISDMFQYLTIFDQMKGIE
                     ATALFVLKIECLFKAIGTFEVFNSGTAPKDRNYQTIGPEEAANEADSSTSKYSKFPRN
                     LSTKIMIYLQLLRKLSSESKDTKVNLSSFMSVITGLTHFLKLLTRYGFHTALEKNKLN
                     RSATILLRFLREIEKNELFEKDPFSYIDVSINATDNCAECGRYIQEECVQFQDNRWHL
                     SCFSCSMCKQRIDTHDLGDATYNKSLKRIMCSRCSPNDPASIPGFKYITKLAQLVFLL
                     KIALVRSKAVMEVQMKTKASKTSISEAHNSVSMQQTYIRTLNDIKRLRSRREYVRVTH
                     DKEEARKSVILETSEVDLNGYASKKNKGLLIHTDPLTNGNDTTHSNVFADTKTLTLDD
                     ISRIVAVEQARELRPNAFTHFKKLRENDEETANVISKKSGVYYSELTSDELLIIQSIS
                     LSLLASNNKIVPDDNSLRRLIPLKQKMEKSSPGNFWWKMKIMMNKETKKPSDGKVFGT
                     PLEVLSNKWGVESDLGIGPSRIRIPIIIDELISSLRQMDMSVEGIFRKNGNIKRLKIL
                     TLDIDNNPSEPPDFSKENAIQLSALLKKYIRELPDPLLTTALYNLWINSAKINSSSEK
                     QMTIALVYSMLPVYNRNVLEVMLSFLCWTASFSHIENEMGSKMDIHNLSTVITPNILH
                     MHNNGVPSVTSSEVSRTYNDTFAHNEGETYFLAIEVVDYLITHNEEMAVVPKFLTALM
                     KEIKNKKIEGYELINKYVQERWKNKEIDLSEFEIQRNVQMKHSTSVVTQGEVKR"
     gene            complement(<64592..>66115)
                     /locus_tag="HG535_0D00260"
                     /db_xref="GeneID:59236043"
     mRNA            complement(<64592..>66115)
                     /locus_tag="HG535_0D00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288152.1"
                     /db_xref="GeneID:59236043"
     CDS             complement(64592..66115)
                     /locus_tag="HG535_0D00260"
                     /inference="similar to AA sequence:RefSeq:NP_014158.1"
                     /note="similar to Saccharomyces cerevisiae ZWF1 (YNL241C);
                     ancestral locus Anc_2.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144047.1"
                     /db_xref="GeneID:59236043"
                     /translation="MTSVKQGPVKFEKDTIIVVFGASGDLAKKKTFPALFGLYREGYL
                     DRSTRIFGYARSHLEKEELKERVSPHLSKPHGAEDDAKEQEFFEMITYVAGAYDTSEG
                     YNKLRKIIERYEADAEITEPHRLFYFALPPSVFLSVAKEIKKELYAEHGITRLIVEKP
                     FGRDLKTARELQNNLAPLFKEDEIFRIDHYLGKELVKNLTLLRFGNTFLNAAWNKENV
                     QSVQISFKEPFGTEGRGGYFDNIGIIRDVMQNHLLQILTLFTMERPVSFDPESIRDEK
                     VKVLKAMSAIDPNDILIGQYGKSEDGSKPAYTDDDTVTKDSKCVTFAALCFNIQNERW
                     DGVPIIMRAGKALNEGKVEIRLQYKAVPSGVFKDIPNNELVIRVQPDAAVYMKFNSKT
                     PGLSNATQVTDLDLTYSSRYKNYWIPEAYEVLIREALLGDHSNFVRDDELEISWQLFT
                     PLLEKLEADDAPKPEIYPYGSRGPKNLKSYLAKHKFNLEGSHSYTWPVSSPDDNSKL"
     gene            complement(<66923..>68386)
                     /locus_tag="HG535_0D00270"
                     /db_xref="GeneID:59236044"
     mRNA            complement(<66923..>68386)
                     /locus_tag="HG535_0D00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288153.1"
                     /db_xref="GeneID:59236044"
     CDS             complement(66923..68386)
                     /locus_tag="HG535_0D00270"
                     /inference="similar to AA sequence:RefSeq:NP_014159.1"
                     /note="similar to Saccharomyces cerevisiae NAR1 (YNL240C);
                     ancestral locus Anc_2.4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144048.1"
                     /db_xref="GeneID:59236044"
                     /translation="MSALLSEADLNDFISPGLACVKPTESKKISVDADEREIQVGKEP
                     DELEKVSITLQDCLACAGCITSSEEILLSRQSYSVFMDSWQTLAGEMVLAVSISPQGR
                     LSLANYFQMGLDQLDLCLLNFFKSYFGCKYFVGTQMGRNITISRTNQVLQERKTSGES
                     AAKPMLSAVCPGFVLYAEKTKPELVPYLLNIKSPQQITGSLLKDSVPQDEKVYHLAIM
                     PCFDKKLEASRPDGEQEVDCVITPKELVTMLQELNVDFAAFQTADTNIVNELSPPGWD
                     PLLHWSSNEGSSSGGFAYQYVSELQKTHPGSRLLVLPGKNSDVREYRLVEATAGHQPS
                     TIASSSELYGFRNIQNMVRRLTSARRAKPRTVRALRKRTTTPEHQQQPPEHRLPEADP
                     YNCDFIEVMACPGGCINGGGLLNSDIHGEAAPNRKRDAIDKMNKLYASQLTTIDAATV
                     GKRLDELSRSSARQYVYEFNPIVPAPDDNIVSVANTW"
     gene            <69217..>70650
                     /locus_tag="HG535_0D00280"
                     /db_xref="GeneID:59236045"
     mRNA            <69217..>70650
                     /locus_tag="HG535_0D00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288154.1"
                     /db_xref="GeneID:59236045"
     CDS             69217..70650
                     /locus_tag="HG535_0D00280"
                     /inference="similar to AA sequence:RefSeq:NP_014160.2"
                     /note="similar to Saccharomyces cerevisiae LAP3 (YNL239W);
                     ancestral locus Anc_2.5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144049.1"
                     /db_xref="GeneID:59236045"
                     /translation="MLPLIKNIKLRKQQRMLFNLLSRKKNSTMSSIDVTKINSWDQEF
                     AKDMNHQLATTVLKNFNVTDALLDKSRLLQEDQRIFNTAISAEPLPVTNQRSSGRCWL
                     FASTNQLRLNVAEELNLKEFELSQAYLFFYDKLEKANYFLDQIIDTADEEVESRLVQN
                     LLSAPTNDGGQYSMFLNIVKKYGLIPKDIYNDLPYSTTASRTWNELLTTKLREFAEAL
                     RDTKAKGKDVSKLVQSMQKEILRLMTLFMDLPPVKPNEKFTWSYQDKDKKIHTLQVTP
                     LEFAQKYAKLDASKPVSLINDPRHPYGKLIKIDRLGNVIGGDDVVYLNVDNDVLTELV
                     VKRLKNDKTVFFGSHTPKFMEKKFGVMDVQLWNYPAIDYKLKQQKASRIRYNESLMTH
                     AMLISACHIDESTNEPVRYRVENSWGKESGKDGFYVMTQEYFKEYCFQIVVDIDELPE
                     DLAAKFTSEEEEPIILPIWDPMGALAD"
     gene            <71040..>73424
                     /locus_tag="HG535_0D00290"
                     /db_xref="GeneID:59236046"
     mRNA            <71040..>73424
                     /locus_tag="HG535_0D00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288155.1"
                     /db_xref="GeneID:59236046"
     CDS             71040..73424
                     /locus_tag="HG535_0D00290"
                     /inference="similar to AA sequence:RefSeq:NP_014161.1"
                     /note="similar to Saccharomyces cerevisiae KEX2 (YNL238W);
                     ancestral locus Anc_2.6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144050.1"
                     /db_xref="GeneID:59236046"
                     /translation="MKVCMENIFVLFTLIALDYAQQIPIKNHKIRDYFAVESDQGLNE
                     ILERYPYWRFEHNVRGLENHYVFSELSNTTSKRGENVLQDEFIVSLEDLPSRQLQKRL
                     PIPDPPIDSSMLPIKDAESILQISDPLFERQWHLINPSFPGNDINVTGLWYENITGHG
                     IVAAIVDDGLDYENEDLKDNFCEEGSWDFNDNTKLPKPILSNDYHGTRCAGEIAAVKN
                     DVCGVGIAYNAKVSGIRILSGQITPEDEAASLIYGLHVNDIYSCSWGPADDGRHLQGP
                     PDLVKKAMIKGVQEGREKKGAIYVFASGNGGIYGDNCNYDGYTNSIYSITVGAIDHRG
                     LHPPYSEGCSAVMVVTYSSGSGEYIHSTDLHGKCSDRHGGTSAAAPLASGIFALVLEA
                     NPQLTWRDLQYISILSAKQINDDTGDWQKGAMGKMYSHRYGYGKLDAYTIASIAKEWK
                     NVNPQAWYFPATEEVSGFTNSTSETIESIVSIGEQDLRDSNLKRVEHVAVTVNIDGKR
                     RGDIIVDLISPQGIVSNLGVSRRRDDSNEGFKDWTFTSVAHWGEEGVGDWKMQVKTSL
                     DGNEVRLHSWKLKLFGESIDASKAIDYKFGDDTFEPTVTSSEVPEPTTELLQPPTDVS
                     QSTMGESQPTTEPTEVNTNLPVMTPESSATSDSPRPTANPEFEAYPSKKIGGSTQTMI
                     YFIALLGLGGLVLILYFCIFVKTRRRIRRSRAEAYEFDIIESDSEYDSTLDHTIGDNS
                     DLQEGEVEDYDFDLSDEDNINDENTENSGFGIDQILDNRQEIGKDDEQNTSSQT"
     gene            <74112..>75452
                     /locus_tag="HG535_0D00300"
                     /db_xref="GeneID:59236047"
     mRNA            <74112..>75452
                     /locus_tag="HG535_0D00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288156.1"
                     /db_xref="GeneID:59236047"
     CDS             74112..75452
                     /locus_tag="HG535_0D00300"
                     /inference="similar to AA sequence:RefSeq:NP_014162.1"
                     /note="similar to Saccharomyces cerevisiae YTP1 (YNL237W);
                     ancestral locus Anc_2.7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144051.1"
                     /db_xref="GeneID:59236047"
                     /translation="MQNIRLPVIGVVCACFIPFALAMDMDSAEKYTRPEIVDAGSKTF
                     HWLCTLVLSLLLPSYAAALSFAGKSYSAVFLQVISGAYAIVDVLAFRYGDWDGVENRT
                     SRGAGWFLLGLLWLTVFFGGLSSGTSVLIRNKKLQSFVSHTGERKLSLVHRGLSLLVT
                     ITGWVKTCLVPVAFFGFCREEHTGQCIAHGIMGSAFILYGFIYALVLVVPWLRNSKSP
                     YSQDFIDSWIMCLWGIVNTFTEHRWGREAWSMGDYQHTLMGIIWWCGGILGIFLSRGG
                     RRSFVPSLIIIFTGWAMSEHSQHLLISTKVHYFFGLVLMLGGALRIVEISFLLRDQRT
                     LDKIYSFQYLPPFCLVCAGLTFMGANEQQLELVLRLGADHSSYTLLLGAAAFLVYFWM
                     LTCLEFYVRLAERAGQGFLYKYSDDSNADQSPEFELQGISDPPNSSYESDDLQT"
     gene            <75766..>78684
                     /locus_tag="HG535_0D00310"
                     /db_xref="GeneID:59236048"
     mRNA            <75766..>78684
                     /locus_tag="HG535_0D00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288157.1"
                     /db_xref="GeneID:59236048"
     CDS             75766..78684
                     /locus_tag="HG535_0D00310"
                     /inference="similar to AA sequence:RefSeq:NP_014163.1"
                     /note="similar to Saccharomyces cerevisiae SIN4 (YNL236W);
                     ancestral locus Anc_2.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144052.1"
                     /db_xref="GeneID:59236048"
                     /translation="MNILGQDLVSWSKTGLIAYGDSKSTEGNLYITFLEVVNGTNYRF
                     HPPQGYVIHPQLHDTPQVFSAGSTTSAQPSNGTHSGNAMGSTPNYISSGGSDKHPHRF
                     FYNISSIHWNNWFSLPGDMLAVCDEIGNMTMLISGQSPEGPSTIDKLTMLFQDNVYKI
                     FNHVMPLRPASSIIEKLERKRTKKEYHTAILDFQWFSSSKPIIASQFCVFDSDANMYR
                     NKAQQLPPFGVFHPPFMKYACVAVRKNGQIDFWYQFSNSKDHKKITSQLFDSQNTNVV
                     EHEWLQFAKITPISEEQCMLISTYSRLSKRLCFFKLQMNWNVNTTNQKILNDPSLKIT
                     HILESPLDSIDDEGHVLELTHFHVLSKSPLEKIPVCDILLIYNICETDKSLLKRFRLV
                     LTRISPVLINVLKSTSTSEEISNDIQLSKRFNLHNLGNMVLFSKVVSVTSEMLDGFAT
                     FYFQDGSIQSYNQNDRKFESERLQSQIKEGKSRGIITSILSAGFHYPKLPSSCAIEWM
                     RVSPAMSGVIFKLEKEDTPIFYCIQGEEFSDSSKDLVIATAFAFGFVASIHRQLSSED
                     LSIACKTHVMKIAKHDEERAMDFVTSLMACIYTFFNVSPDARKEIMDKMISSRPIQKT
                     MLLQLELGSCFKPNNIYDMARVVMSLRNVLFAFNGVARNLHFAIEQLSNSAIQQPNGK
                     SFQTSFSKQDLVHSLIPLAKWFVKFVTFLVQEVILLINNPQEKQNTLVLGVFGARMPR
                     TLILSILNEIKKVTHMVTKFPETTYPVLNESSNFLKMVLGESPVNFEKFETFLVDVNN
                     KFTAFNEQQPSSTREPSLLVRAQIPPDVSKIGDFLLAYSNNAVISHIKATTVYFSDTS
                     GLRISINEFFQPQIYKLLKPLEEGLVVDTKDLPEHFRTSKSFCKMDFDAISYDRLTQD
                     EITSGKLKRCCRCGYVTRAGYVISYNKTIVPTSIQTKRWPTMHSRICICSGFLYELQI
                     "
     gene            <78966..>80324
                     /locus_tag="HG535_0D00320"
                     /db_xref="GeneID:59236049"
     mRNA            <78966..>80324
                     /locus_tag="HG535_0D00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288158.1"
                     /db_xref="GeneID:59236049"
     CDS             78966..80324
                     /locus_tag="HG535_0D00320"
                     /inference="similar to AA sequence:RefSeq:NP_014165.1"
                     /note="similar to Saccharomyces cerevisiae YNL234W;
                     ancestral locus Anc_2.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144053.1"
                     /db_xref="GeneID:59236049"
                     /translation="MNSTKNTLYNPLDRSQIEFIPSHFDVVTDSLIPIQESYSSDVSS
                     ISDRSHLSAKELNITARRGSFTISDIISNGVSRIQSHDSSLDDAYHLQRISTTESLGS
                     SVLDRIRYKIVLKLNPKEKQLVRESWEMILNEDVTSKQLKPKPHTGKTFNVSNLLPMS
                     SSTSEKNSESDSSVVSASHVPEPKGNTISRTFASSLFCSQFYANLLSMDPDLERMFPS
                     IKHQATAFAGVLNAAISNLENLRAIEGYLISLGKRHARILDIEPPHFELMGIAFLKTL
                     QDRFGVHCTIELEEVWSRLYSYLANSILQFGIDPVLQLNVDKDEIIFPVPNLVEGSGS
                     TISRLNSNDSQDGAKSLRSIFLSRTTSAHQKSHDPIQNKPRHQAQLPDHASISGGARK
                     RTPGSSMAPSRSGTASISSAIPVRRQPHAVSRTKVSDSKPGHKKATSKLSLSSNEDCC
                     IM"
     gene            <80971..>83412
                     /locus_tag="HG535_0D00330"
                     /db_xref="GeneID:59236050"
     mRNA            <80971..>83412
                     /locus_tag="HG535_0D00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288159.1"
                     /db_xref="GeneID:59236050"
     CDS             80971..83412
                     /locus_tag="HG535_0D00330"
                     /inference="similar to AA sequence:RefSeq:NP_014166.1"
                     /note="similar to Saccharomyces cerevisiae BNI4 (YNL233W);
                     ancestral locus Anc_2.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144054.1"
                     /db_xref="GeneID:59236050"
                     /translation="MMSQGKEQGNNRELLNSSFYSSSSINTLDHARNFRNSLILRDMS
                     DHSLETSLKSDNSYPDEKPINGVHVLPQQIARDEETVTMKMSTSPSLSALAGILNEKS
                     RLAQQQAKNSIKTVNVISEETDFYDPNPTASRNDPVMSPNLIDVDGNDSIHFPKIAPP
                     PNALISEQPDFLSSPKMDRNKSQSFKELPKERGGIKNDSRHEPETSIVNDHMSYDKNV
                     KQKIDSGEASHHLSASISSIGPKKKKNIFSFLRRRSSAEIIPKESTNTPDSKSGIPNS
                     SSFSSGTLVSSQTPTRMTKKSYSSNNIFSTFKKGKNNKEESANRTRSHSTTAPLSEKS
                     DVKIINSRTDESIKLHKTRSPSIHKEPKFRKPTPLSFEHIDMSKSSLSQALIPESTPS
                     DENNEDTLLPDDSRLDTGEVLFPKSLSKHEVDSIVSLERCRSTKSNKRSSIASHRRSL
                     TDTLSINAQNEGMFVTEGSSIVISTPDLTKSPTSSILRNGTFEPLEFASNSSVVHDEN
                     GLPPTELIDIGDLETYPKVNSFSLHSIEEKLNEMTLDADKELGLSKDVGIQSFKKEMA
                     DDPELMSDIMEFASLINFGDGINIEIDDKAIETPYKTVMPSRTSDHSLNETQELDSMH
                     LSQSQFGSEKEDLNLSFGEHFGSGEGFEAHKHNSSPEKYISEDLHTADEYDGFENENF
                     NEIGRSSENTPQIRQLIPDSQMARPLSMSFRGLRAPSLNASLLDSSVIESSLNTGEYV
                     TSSVTDKTLNRVSFSSRIILYDTYAEDEYDRKPDIATCNQLTPQLAQLIKAELNELKC
                     GMEVHEESKCYTHFY"
     gene            <84197..>85069
                     /locus_tag="HG535_0D00340"
                     /db_xref="GeneID:59236051"
     mRNA            <84197..>85069
                     /locus_tag="HG535_0D00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288160.1"
                     /db_xref="GeneID:59236051"
     CDS             84197..85069
                     /locus_tag="HG535_0D00340"
                     /inference="similar to AA sequence:RefSeq:NP_014167.1"
                     /note="similar to Saccharomyces cerevisiae CSL4 (YNL232W);
                     ancestral locus Anc_2.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144055.1"
                     /db_xref="GeneID:59236051"
                     /translation="MPEVSRSQFSFELPDTVVPGQLICPECDVCQTDGKNIVYRFVSG
                     HGTMTQTYNKAGTQVAAISATLVGFVKVQEELRDLSDNDEPQEEVDTMKDAETNVVRV
                     EKVITISVLQNGTKMNIESSNNDFANNLPKEGDIVLTRVTRISQQRANVEILAVENAA
                     IPVDSGIGSNGLGVIAAQGGSGAATFSIAQASSDLGEMFRGIIRSQDVRATERDTVKI
                     INCFKPGDIVRAQVLSLGDGTNYYLSTARNDLGVVFAKAANGAGGLMYALDWQTMCVP
                     SSGATENRKCAKPF"
     gene            complement(<85270..>86313)
                     /locus_tag="HG535_0D00350"
                     /db_xref="GeneID:59236052"
     mRNA            complement(<85270..>86313)
                     /locus_tag="HG535_0D00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288161.1"
                     /db_xref="GeneID:59236052"
     CDS             complement(85270..86313)
                     /locus_tag="HG535_0D00350"
                     /inference="similar to AA sequence:RefSeq:NP_014168.1"
                     /note="similar to Saccharomyces cerevisiae PDR16
                     (YNL231C); ancestral locus Anc_2.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144056.1"
                     /db_xref="GeneID:59236052"
                     /translation="MFKKFAKKSSNEDSISKEKLIEIEKPIKELPSSITAPKEKELSD
                     DQEKMYIKVLQHFQDPELKIRLTEKGGSEDKEGLIDEEKAWLTRECFLRYLRATKWNL
                     QDCIDRICSSLAWRREFGISHFGEENGDELTGDEVAVENESGKQVVLGYENDARPILY
                     LKPGRQNTKTSHRQVKHLVFMLERVIDFMPVGQDSLALLIDFKEYPDVPKVAGNSKIP
                     PLGVGKEVLHILQTHYPERLGKALLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFT
                     EYVPMDELDKLYGGYLDFTYKHKIYWPTLIEYSREKREHYLSRFQKFGSKVGLSEYDL
                     RGNHDNLLFPVNK"
     gene            complement(<86773..>87873)
                     /locus_tag="HG535_0D00360"
                     /db_xref="GeneID:59236053"
     mRNA            complement(<86773..>87873)
                     /locus_tag="HG535_0D00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288162.1"
                     /db_xref="GeneID:59236053"
     CDS             complement(86773..87873)
                     /locus_tag="HG535_0D00360"
                     /inference="similar to AA sequence:RefSeq:NP_014169.1"
                     /note="similar to Saccharomyces cerevisiae ELA1 (YNL230C);
                     ancestral locus Anc_2.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144057.1"
                     /db_xref="GeneID:59236053"
                     /translation="MMSLQYLCEVSLMRNYLLLQNVENVPYRLIKKVLVKCKRDHLCK
                     LESSNVLLIFEDDELWLHFLKQDFPTSVHDCFVSKKDNIKDYYIDFIKKYDSELLKNE
                     RERVDTYLENAIRKDPTTKKYKMPYRLLYFRYQQDVEKKQEKSAERLRYQMKKLEMER
                     QKNQPVVVDHSFYAQNQPKRASKNLARRSHSDLFRKSIKDHENRVQHFRSGGFDITKR
                     HTTRVAFSGSVPNISESTAIVSPTKASEERGTIMNQPTPPPPASQNSQSPPKLKKRRS
                     EPPSIFLNRKRPTLQANRDKIIKAEGPNSKPKKVHIENGSAKVKVPVVTSGHKKKSAL
                     FSSPAILDKETTPPATGRNKRTSIYIFEVQKP"
     gene            complement(<88315..>89370)
                     /locus_tag="HG535_0D00370"
                     /db_xref="GeneID:59236054"
     mRNA            complement(<88315..>89370)
                     /locus_tag="HG535_0D00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288163.1"
                     /db_xref="GeneID:59236054"
     CDS             complement(88315..89370)
                     /locus_tag="HG535_0D00370"
                     /inference="similar to AA sequence:RefSeq:NP_014170.1"
                     /note="similar to Saccharomyces cerevisiae URE2 (YNL229C);
                     ancestral locus Anc_2.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144058.1"
                     /db_xref="GeneID:59236054"
                     /translation="MNVNSNNNNSNVSNLSSALRQVNLGNSNTTTDQSNINFELSNGI
                     SDDKMSPNDSNTINNNMNNGMQRQRQSDMQAEQLSQQIQQQQAFSNMGPVDNSRIRKF
                     FQNQPMEGYTLFSHRSAPNGFKVAIVLSELGLPYNTFFLDFNAGEHRAPEFVTVNPNA
                     RVPALIDHNMENLAIWESGAILQHLVNKYFKETGRASLWSDNLADQSQINAWLFFQTS
                     GHAPMIGQALHFRYFHSQKIGSAVERYTEEVRRVYGVVEMALAERREALIMELDTENA
                     AAYSAGTTPLSQSRFFDYPVWLVGESITIADLAFVPWNNVVDRIGINIRVEFPEVYKW
                     TKQMMRRPAVIKALRGE"
     gene            complement(<89794..>91536)
                     /locus_tag="HG535_0D00380"
                     /db_xref="GeneID:59236055"
     mRNA            complement(<89794..>91536)
                     /locus_tag="HG535_0D00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288164.1"
                     /db_xref="GeneID:59236055"
     CDS             complement(89794..91536)
                     /locus_tag="HG535_0D00380"
                     /inference="similar to AA sequence:RefSeq:NP_014172.1"
                     /note="similar to Saccharomyces cerevisiae JJJ1 (YNL227C);
                     ancestral locus Anc_2.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144059.1"
                     /db_xref="GeneID:59236055"
                     /translation="MKICYYELLDVQPSANDNELKKAYRKKALQYHPDKNPDNIDEST
                     QIFAKIRAAYEVLSDPQERAWYDSHKQQILSDDAVPDDGSFDCEVDASVTGVTTDELL
                     MFFNSALYTKLDDSPAGFFQIAGKIFARLAKDEVSAGQRGGLTSFDKYEDISLEQDIG
                     TLGYILACERHITNLKNTPECNLFPPFGHSKTEYEYLKVFYKTWSKFSTLKSFSWKDE
                     YMYSQNYDRKTKREIKKRNEKARQSAKSEYNKTVKRFVTFIKKLDQRMKHGSKRAQEL
                     KRTEQRLKHQELKAAYIADKRDKERREFEMQSWQTINEVNFDELDKTYDEIYKGGNEH
                     ENENSSQDEIIIYECFLCNKKFKSEKQLDNHTKTKLHKKNLWEIREEMREDSMTLGLD
                     ELSGLDDFDSAAESIRNSDTESDNLAENADLALDNINDQLAYIEEQLANMNSSSEDLS
                     DDDVGSEIPESSTSASRDPSGYSFSEASSDDELARLLASLNGTSKDNKDNDKNVHQSD
                     WNNDKRTNSKKSKRKGGNAKKSQESTNVTGETCETCGHSFESKNKLFKHVNVSGHAAL
                     KSKVKTKSKKSKKR"
     gene            complement(<91768..>94512)
                     /locus_tag="HG535_0D00390"
                     /db_xref="GeneID:59236056"
     mRNA            complement(<91768..>94512)
                     /locus_tag="HG535_0D00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288165.1"
                     /db_xref="GeneID:59236056"
     CDS             complement(91768..94512)
                     /locus_tag="HG535_0D00390"
                     /inference="similar to AA sequence:RefSeq:NP_010042.2"
                     /note="similar to Saccharomyces cerevisiae ADY3 (YDL239C)
                     and CNM67 (YNL225C); ancestral locus Anc_2.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144060.1"
                     /db_xref="GeneID:59236056"
                     /translation="MTARLDLSIPSLKQPQTEQDYLDEVEKAIKADYKSMLGTTGSPV
                     RINPWSFIGTLGTKKQALAVAREIDVQRGVQPDSTTGSEVKEADNATDSSHSTARRLP
                     SGARPPSNGQNLEAATSEKHDFAAGQNSNDESIRNVAGQSTPLAQTRMAGGSKNGKDT
                     QRDLDLQKEELMKEDARRETLEDILELRDEIEKLKAINETQRQDQEKMNDEVVQIKKA
                     LRDKTKEITSLEEIVNTKESSIVAREEQLNELRRLAELKEQERIREIDSYKTRIKAIQ
                     SLMASNGKTVAIGKDGEHASKYHASIDTMLEKLKCQAIEKSLEINELLKREAQNSKKK
                     VEELNAQFKLEKNQVQEQHKEQLNKLEQLLNANSESIKSMVCEINEKSKIVISNVEEI
                     NQMKRSASDLEAENLNLKKEFADSKDTINKLQNELREKGANFGKVKNEICSEKKDLEN
                     KLVKCENLIEVLKKRITEKETDLEKQIAENLQGTREKTKLNARLTESNTFANQLKKDI
                     ASAATTTEEAVRNYEKILKQYSEETKKHEVTSECLRNVTSLSADFQRFVRSLKLFNIE
                     LGLIIETSFNRKEHGDSFESFFCMEHENIVGFYYEKQQNKHNELQDNLQRITEENRSL
                     LNDIDTKWKSAVEEQKRRTQLLIKDLANAKSNKEHLEYRVSELEKTLTDNQRNKELMM
                     NEKEKILTVNASLLDEVEGIRKSAMEESEQKLNDLLNRVEEFAKNISEIQEQIINENE
                     QQKVLKDTVSVKDAKIQELEDKYYRVDEALREKSIEFQKLQGDISKRINFEIAHKSRP
                     DIEKTNYAALMIDKVDYIDMVELQNIVKNLILLLEIPFNKLTKKSPLVAIYLKYERPI
                     FSHFANRLHYEIFNEPIDMKGFTSDAYDQYTENHSMTTIQHPLESCLDNLYQKIVSRM
                     "
     gene            complement(<94719..>97049)
                     /locus_tag="HG535_0D00400"
                     /db_xref="GeneID:59236057"
     mRNA            complement(<94719..>97049)
                     /locus_tag="HG535_0D00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288166.1"
                     /db_xref="GeneID:59236057"
     CDS             complement(94719..97049)
                     /locus_tag="HG535_0D00400"
                     /inference="similar to AA sequence:RefSeq:NP_014175.1"
                     /note="similar to Saccharomyces cerevisiae SQS1 (YNL224C);
                     ancestral locus Anc_2.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144061.1"
                     /db_xref="GeneID:59236057"
                     /translation="MAKRHSHYRDTSRSNRRGGYKGSKKGSRGHKKKAEAGNGGSTTN
                     FSSQVPLAGGDLSNPDLSDLDDGSGRRYITHNAVEDYYFNRSNKEKSMKTGGTRPGHR
                     NDSTSDSRNTEWASFRKRPMQFVKSKELYDPSHDLIEQLRKRNGSPLLQDPAAANDKN
                     STVEANLSQEAPAQNAQESPPLRQNHSKINTNISKLDSSELFFVDEAGEPTKRDVVLP
                     IRELVVKGVIPPKTRSFSNELEYDETITVGKMQLSTQQDDNGATLVRIPDSRLKNPNP
                     YGSYIANVLHNVLHSPENSTNSESSSETHEEDSEWDFEDIKEVMLEEIDSASEKEIAG
                     EYLKEDSEECVQEEVVSNERFIEEGNARNNTGSPELSSNMQTLHLEESVTNSDGSALN
                     PEFGFLDEDFVVDVSEVSVTNVREGLNDCLYFVRCFRLFADHEHRWISQDIFSDFMTD
                     EIGLPDHRLPAYLRFIKNSIIPQDDLPEPSFSDIPFSDTENEEEDDDMDYPSSDFVSP
                     DMREGLDDLIAYTEKYSSYRNEEYETKSLPISGKGMKKRLLIDDSIALDTESIATLQD
                     KFKTRLDNKSKKRRTKKDFIHEASENSCDMFKKYPFGMHVQNIKDEFELFMRRDAESL
                     LFPPLDPHGNQTIMKFAKHYHTNSLKQGRGNKTHVMAQKSRKTHRNFPNYQLIDQLVR
                     RRPIFMRIDVARPTEIHERKGTSKGKFHTVEGEYVGKDAPEIGQENVGRRMLEKLGWV
                     DGEGLGAQGNKGISEPVMAKVKKNKSGLRHTENTEL"
     gene            <97263..>98672
                     /locus_tag="HG535_0D00410"
                     /db_xref="GeneID:59236058"
     mRNA            <97263..>98672
                     /locus_tag="HG535_0D00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288167.1"
                     /db_xref="GeneID:59236058"
     CDS             97263..98672
                     /locus_tag="HG535_0D00410"
                     /inference="similar to AA sequence:RefSeq:NP_014176.2"
                     /note="similar to Saccharomyces cerevisiae ATG4 (YNL223W);
                     ancestral locus Anc_2.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144062.1"
                     /db_xref="GeneID:59236058"
                     /translation="MEFMQRISHQLIDPLEEEKDEESFIVLGIYYPAILTQQQQDKKG
                     VSGSGFLNSFFSRNDEENPDFLSDVHSRIHLTYRTRFAPIPRAADGPSPLSFHFLFRD
                     NPLNTIENVLFNSDCFNTDIGWGCMIRTGQSLLANAIQIALLGRGFRVNEDGTGSESE
                     ILGMFMDNFEAPFSIHNFVKKGLELSNKKPGEWFGPAATSRSIQSLLRDFSECGLDEC
                     LISVSSGDVYEEEVEELLGKNENGKILLLLGVKLGINGINEYYWDEIKEILGSEFSVG
                     IAGGRPSSSLYFIGYRNNELIYLDPHNPQPSVQPGNESLFYESCHTVNYGKLSLSDLD
                     PSMLIGILISGRDHWVKWKESTKSSRIFNVLNKRPSDFDIACDDEIESINSDSNDNGL
                     LVEGDYVDVKPFSQLHCNSCCEIDDSYQDVQCKKQQIMVMDDNEASSNAVDVEVEKVL
                     VERETIDMVDGEALKLATE"
     gene            complement(<98970..>101375)
                     /locus_tag="HG535_0D00420"
                     /db_xref="GeneID:59236059"
     mRNA            complement(<98970..>101375)
                     /locus_tag="HG535_0D00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288168.1"
                     /db_xref="GeneID:59236059"
     CDS             complement(98970..101375)
                     /locus_tag="HG535_0D00420"
                     /note="Rover element"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144063.1"
                     /db_xref="GeneID:59236059"
                     /translation="MPSLESSSDDEVTIVEQTMPLNTPLAHCSSSEPLTPPNENVIAS
                     TSNANQSEQQKKITSGWMGRSSFKSHFQFFFKHGRKVARCNYCGKTYKEGESTGNLSK
                     HITAVHRSVLKEKKVLKMQTLDTMSKSSKSLHLTEALIRECNKHPGTLESLLLITEGF
                     LPFNFVRLSTWSHLNRKYGGNTFIQSRTTLTKKIQHFRDCLNDTLRQNLKDTTLVNVQ
                     LDIWTAGNSQSFLAIMVSFAPNILNKELLEASNGSRLLLNIHGEASNTHLLDFVSLGD
                     KKHTGKNMCDTFMSVMEEYDLVDKLGTITMDNASNNGNFHVNLIYDHFNGLRPRGHRL
                     VGKVRFIRCASHVLNLQFQRIIKSLSRNSLFSNAFKKIRKLAKIMRYSTAINSSLKKN
                     NLPLIPYESPTRWLFTWKQVKIFLENYKAYKNWLGLVQERGQDHLVTRIQDHISFDSK
                     TINMLAYFVECGKIFDYVNKKFQDEEYNNLPQGVPLYYLLGHFYKSCLNVSTGKEIPK
                     SKKGMDFSFLNGPDTLSFDEKNIVLEAINVAYLCYQNYLSHIQANPLYYAAVMLDPTA
                     KHEQLYRMMEIDEFNLRMNQVNNFIRMYLNEEGVELGNGQQASPELSTIGREEDYYRC
                     FNVHEQPQPTETYSTASVCDVNENLEEWHRYQSEPVASGLSRIDAIKWWHANRCKYPS
                     LFKLAMSLLYTKVSSCDVERCFSLAGRVVRKDRARLHYKNVQTLMLLRDRFLKFGFYK
                     PSPILVLDSENETDLDLDNENNDIDCYLSDSSEEMHDSQDDSAATARLTSQEGINTPG
                     SAM"
     gene            <101930..>102550
                     /locus_tag="HG535_0D00430"
                     /db_xref="GeneID:59236060"
     mRNA            <101930..>102550
                     /locus_tag="HG535_0D00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288169.1"
                     /db_xref="GeneID:59236060"
     CDS             101930..102550
                     /locus_tag="HG535_0D00430"
                     /inference="similar to AA sequence:RefSeq:NP_014177.1"
                     /note="similar to Saccharomyces cerevisiae SSU72
                     (YNL222W); ancestral locus Anc_2.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144064.1"
                     /db_xref="GeneID:59236060"
                     /translation="MSHYRSRDLKFCTVCASNNNRSMESHKVLQEAGYDVSSYGTGSA
                     VRLPGLSIDKPNVYPFGTPYNDIYNDLLSQSADRYKSNGLLQMLDRNRKLKRAPEKWH
                     NNVKTFDFVFTCEERCFDSVCEDLMNRGGVLNKIVHVINIDIKDDNENAKIGGKAILK
                     LAEMLNGQVEQSDKNAAPFEDCIMDILTDWQKQYPQLPLLYSPAYY"
     gene            complement(<102620..>104092)
                     /locus_tag="HG535_0D00440"
                     /db_xref="GeneID:59236061"
     mRNA            complement(<102620..>104092)
                     /locus_tag="HG535_0D00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288170.1"
                     /db_xref="GeneID:59236061"
     CDS             complement(102620..104092)
                     /locus_tag="HG535_0D00440"
                     /inference="similar to AA sequence:RefSeq:NP_010043.1"
                     /note="similar to Saccharomyces cerevisiae GUD1 (YDL238C);
                     ancestral locus Anc_2.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144065.1"
                     /db_xref="GeneID:59236061"
                     /translation="MISLLKNEPASFIVFYGTFIDTPVLGELRIRHKTSVGVCMSESE
                     EKGSIRFIIEDSEDPLADALAYDSQLSESDVTVIDGLSMGEAGDGSSTFFFPGFIDTH
                     IHASQYPNAGIFGNSTLLDWLETYTFPLESSLKDLEIANVVYSKVVDRTLANGTTTAS
                     YYTTIDPESTKLMGEICSARNQRALIGKVCMDTNSPDFYIESTEECLKSCENVINYLQ
                     KDLRDPKVQPVLTPRFAPTCSEDLMKKLGALSQKYGGLHIQTHLSENDNEIRWVEELF
                     PECDTYADVYNKFNLLTEKTVLAHCVHISPKEAKLIKTRNCGISHCPVSNSSITSGEC
                     RVRWLLDQGINVGLGTDISGGFSCSILAIARQAHLVSRHLAMRETGTEEREHVKLSME
                     DVLYLATMGGAKALDMGDNLGTFDIGKQFDTQLIDIESQGSNVDIFQWQKISEVMNEK
                     NKFQPPKISHNDLLAKWFFNGDDRNILKVWVGGKLSHSDW"
     gene            complement(<104831..>105463)
                     /locus_tag="HG535_0D00450"
                     /db_xref="GeneID:59236062"
     mRNA            complement(<104831..>105463)
                     /locus_tag="HG535_0D00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288171.1"
                     /db_xref="GeneID:59236062"
     CDS             complement(104831..105463)
                     /locus_tag="HG535_0D00450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144066.1"
                     /db_xref="GeneID:59236062"
                     /translation="MMCERWPRIPNRSVAFSARPPKTPNNAWIDKGKPKVLQLYLRTS
                     AKSNSNRLSPEDTKIEIDELPRSGAVSDYLKHQILRAQHTPKMRTALQALFSSFWATF
                     IRRCVYIFVHICTYAAHRFVSDGRREQTVLHRPCTLCSPSPFATFTLLCTSPHYAFLC
                     LIERQFTHRHAPCKTFAKKNARKTAWALHPVTQVPKRTDPKSAVFARNCS"
     gene            <105503..>106782
                     /locus_tag="HG535_0D00460"
                     /db_xref="GeneID:59236063"
     mRNA            join(<105503..106449,106500..>106782)
                     /locus_tag="HG535_0D00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288172.1"
                     /db_xref="GeneID:59236063"
     CDS             join(105503..106449,106500..106782)
                     /locus_tag="HG535_0D00460"
                     /inference="similar to AA sequence:RefSeq:NP_010044.2"
                     /note="intron uncertain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144067.1"
                     /db_xref="GeneID:59236063"
                     /translation="MIGLKSWSVAFFFYFVVILTLFSIHRSSTKLRHSRYSHWRSSSP
                     PDLLFPVLSKRDDTKELFLRIDRLGISGKELLRFFKVHLLRIMDVDHRQRAAKNTAGV
                     LEPMDVAVSQYYDLFKQYLYTDYTNQDFNDNNHGSGDVGRGDKCAPYDSIVARLTKGV
                     DPRPIHSHNDYWRKIPLFEALAFGASSVEADVWIVPETRDETNDNNDENGEDDDSGMM
                     NQFALAVGHNEDYLDPVNQNLDQLYTKPLRDMLDQVNCRGTSKKNGVFFNSPETTLLL
                     YIDFKSMDSEMTYHLLMDKYLKPLIDQEYISFYDMEMGKSEVINNGNGDEGYYYSGKR
                     HVFLDADLLDLESMIPNTSITSSASFDDIMKHCSISKAKTMWTNHLVRSHINCIRSLI
                     DENHEKNLKTRIWGVPA"
     gene            complement(<107768..>110416)
                     /locus_tag="HG535_0D00470"
                     /db_xref="GeneID:59236064"
     mRNA            complement(<107768..>110416)
                     /locus_tag="HG535_0D00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288173.1"
                     /db_xref="GeneID:59236064"
     CDS             complement(107768..110416)
                     /locus_tag="HG535_0D00470"
                     /inference="similar to AA sequence:RefSeq:NP_014178.1"
                     /note="similar to Saccharomyces cerevisiae POP1 (YNL221C);
                     ancestral locus Anc_2.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144068.1"
                     /db_xref="GeneID:59236064"
                     /translation="MSSGVTGGKKQLNRNQLFKRQKIRNARTIRAEAVRFDVKQNVAG
                     SNAGRLEGGNNLSESGGILKVAEFVSSREFELKELQLAMRTSKSANSTRVFQSLPRKL
                     RRRTASHNVKRIPKRMRNRAMREMAKNDQRVVSPGSKSNGSVFKKTKRNHGLSARALY
                     RAKMSVKLLRLASKSASMKLALPDGVLSRNINLRSKIKFLNSQIGAKRRNNPDVLSRN
                     NAMGSYDNCALNELALPPRNRIKFLKRQRFFAWIPSHIWNAKRSHMIKRWGYQIPWSP
                     TQKCFRLTHRLGGNVASSDGALALDTSFYGTMIVKDSLKKDENGSNLKEIISTLSGSR
                     SVTKKFRDSKNWFEGYVYDIENDCSTILGPVDLLWIDVHTVMIRLHPAIYPTVFFAIL
                     RKYGDRISLSDCRYSLGSITVKGAKSLNALASIMRTHSKSESFSQLKMASTIADTSVL
                     PLKAMFAFECIDPRHLSAPRPLNTSSSDTPTVDDIINLQNNFPSKEISSIVHKLTNSK
                     ERENSYFNQSTLKQLATRRQRLMSTDPVNQTKNMIPYNSKTDPSIPLFIVKRQKSDDW
                     VVILPWFWVLPFWYQLNRVTRVYHMGLRQMQQLSYENNKLFFPDDFPFTLVGQKENSI
                     YKRDTKKLKWDKKAPGKRVSFDKILDIHKDVLPSFQGEIGDYFSCDWKLLQILRNGLK
                     YLTRDGKTLGHCNENKTTQFDSYGARDIQVLNDLFEYYKDIVNKDTYDITQDFSLPIE
                     LTVNTRAEPREIDWEKSAQSSINETPLQVTAISCTCVGKGHPTDNSRIYQIPLEDADY
                     WKKVSAGLYRSDGRKDNETKHPLPNIHDLVGFITTGAYHLAEGKGVAQGFIDAEVARK
                     RTSRHLLIRNVGTNTYRLVEWNFIPM"
     gene            <111429..>112727
                     /locus_tag="HG535_0D00480"
                     /db_xref="GeneID:59236065"
     mRNA            <111429..>112727
                     /locus_tag="HG535_0D00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288174.1"
                     /db_xref="GeneID:59236065"
     CDS             111429..112727
                     /locus_tag="HG535_0D00480"
                     /inference="similar to AA sequence:RefSeq:NP_014179.1"
                     /note="similar to Saccharomyces cerevisiae ADE12
                     (YNL220W); ancestral locus Anc_2.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144069.1"
                     /db_xref="GeneID:59236065"
                     /translation="MVNVVLGAQWGDEGKGKLVDLLVGKYDIVARCAGGNNAGHTIVV
                     DGVKYDFHMLPSGLVNPYCQNLLGNGVVIHVPSFFKELETLEAKGLTNARGRLFISSR
                     AHLVFDFHQRTDKLRELELSGAAKDGKNIGTTGKGIGPTYSTKASRSGLRVHHLVNDN
                     EGSWDEFVVKYNRLLETRKQRYGDFDYDADEELARFKKYKEELKPFIVDSVVFIHKAI
                     AEKKSILVEGANALMLDIDFGTYPYVTSSNTGIGGVITGLGIPPRTIDKVYGVVKAYT
                     TRVGEGPFPTEQLNANGEKLQNIGAEFGVTTGRKRRCGWLDLVILKYSTLINGYTSLN
                     VTKLDVLDTFKEIPIGVSYFLNGKELDLFPEDLTTLGKVEVKYVTLPGWDQDITKVTN
                     YADLPENAKKYLKFIEDFVGVPVEWVGTGPSRDSMLHIDV"
     gene            complement(<112835..>114544)
                     /locus_tag="HG535_0D00490"
                     /db_xref="GeneID:59236066"
     mRNA            complement(<112835..>114544)
                     /locus_tag="HG535_0D00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288175.1"
                     /db_xref="GeneID:59236066"
     CDS             complement(112835..114544)
                     /locus_tag="HG535_0D00490"
                     /inference="similar to AA sequence:RefSeq:NP_014180.1"
                     /note="similar to Saccharomyces cerevisiae ALG9 (YNL219C);
                     ancestral locus Anc_2.24"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144070.1"
                     /db_xref="GeneID:59236066"
                     /translation="MTITKEREGPKEQLTYTMKSCKLITGTLIILLAFSRVFLQPIFS
                     IISDCDETFNYWEPLNLLVRGFGKQTWEYSPEYSIRSWAFLLPFASLLYPLNKALAFN
                     AEWNFYIVRGLLGFGSFILEISLHREISRTLSISIANYWLLFQIFNPGWFHASVELLP
                     SAIAMLLCLGSSKHALNYLSTDSTSSFLASITFNLIGGVLGWPFVLVLSLPICLHYLF
                     HHKLIVTVRTVFDSLVIVSLVVAATFTLDSLFYGKFTPVSWNIFWYNVINADASSGPN
                     IFGVESWTYYVFNLFLNFPLPVLILSIIGISRKRLWPLWLSLITWLLIFTSQPHKEER
                     FLYPIYSLLSLAAAVGFSTLLKSVNRCKLTRSVIKLCIIAFVIIQATSRIMAILDNYS
                     APLDVYSTLYDLNNESDDIVNVCTGREWYHFPNSFFLPDNYRLRFVSSGFDGLLPGDF
                     SEEGNIFSKIRKIPKGMNKKNIFDEGKLWPISKCDYFVDITSDVNERKDAFDPNSMPQ
                     GWIAHSCAKFVDVENSKILGRSFYFPTSIAELLSSNYAEYWSKIYGTEKVDYCLFEQV
                     KNV"
     gene            <114960..>115889
                     /locus_tag="HG535_0D00500"
                     /db_xref="GeneID:59236067"
     mRNA            <114960..>115889
                     /locus_tag="HG535_0D00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288176.1"
                     /db_xref="GeneID:59236067"
     CDS             114960..115889
                     /locus_tag="HG535_0D00500"
                     /inference="similar to AA sequence:RefSeq:NP_010045.1"
                     /note="similar to Saccharomyces cerevisiae PHO13
                     (YDL236W); ancestral locus Anc_2.25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144071.1"
                     /db_xref="GeneID:59236067"
                     /translation="MTLTGPIKIKSKAVAQEFLDSFDSFLFDCDGVLWLGSHLLPSIK
                     ETLKLLTDLGKKLIFVTNNSTKSRAAYTKKFAGFGIEVSEDQIFTSGYASAVYVRDFL
                     KLQPGKDKVWVFGESGISEELSLMGYESLGGGDPRLDETFDFKTSPFLVNGLDPDVHC
                     VVAGLDTKVNYHRLAVSLQYLQKEDSVHFVGTNVDSTFPQKGFIFPGAGSTIASLACS
                     SGRTPVYCGKPNINMLNTIVSAKNLDKSKCCMVGDRLNTDIRFGVEGSLGGTLLVLTG
                     IETEERALEEDGDHPQPKYYAEKLGDVYELTSS"
     gene            <116408..>118192
                     /locus_tag="HG535_0D00510"
                     /db_xref="GeneID:59236068"
     mRNA            <116408..>118192
                     /locus_tag="HG535_0D00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288177.1"
                     /db_xref="GeneID:59236068"
     CDS             116408..118192
                     /locus_tag="HG535_0D00510"
                     /inference="similar to AA sequence:RefSeq:NP_014181.1"
                     /note="similar to Saccharomyces cerevisiae MGS1 (YNL218W);
                     ancestral locus Anc_2.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144072.1"
                     /db_xref="GeneID:59236068"
                     /translation="MESNSVIMTKALCIRVSYRREQAPWILFCIPMSNKSKLSSEQLI
                     ACPVCNKTIPYSSINAHLDSCATSNHSTGKQPTLTSVLGGIKKRRRKEADATVIDLDA
                     ETSNGIPPGKSAFPSEDTQDSKRVKKESSNNSNTYELRHLQRISHLPLSEKLRPKDIR
                     EYVGQQHILSQENGTLFKYIKEGIIPSMILWGPPGVGKTSLARLLTGTASNNGVTYHL
                     VETSATKANTQELRSIFDKAKNDYHLTKRRTVLFIDEIHRFNKNQQDLLLPYVENGDI
                     VLIGATTENPSFQLNNALISRCHVFVLEKLNTNESCIVLSRGVALLNRLRNHVWKVGK
                     PLKLSRVVLEYIVNLSVGDIRRALNLLEMIEVSTRTIQDGKELTVDEVRSILTNKSSE
                     GISTYYDTSGDNHYDTISAFHKAIRGSDENASLYYLARMLQGGEDPLYIARRMIRIAS
                     EDIGNRDNTLLPLAVAAHDAVMKIGLPEADLALAQCCVALARAPKSVDLYRAWKQLKS
                     MLHENTYSMASSEIPLHIRNAPTELMKGLGYHKGYKYNPDYIDGKVKQSYLPDEIIRQ
                     CEDKEDLQFLKGQHLGTKRDPDLDYDSL"
     gene            complement(<118320..>118763)
                     /locus_tag="HG535_0D00520"
                     /db_xref="GeneID:59236069"
     mRNA            complement(<118320..>118763)
                     /locus_tag="HG535_0D00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288178.1"
                     /db_xref="GeneID:59236069"
     CDS             complement(118320..118763)
                     /locus_tag="HG535_0D00520"
                     /inference="similar to AA sequence:RefSeq:NP_010046.1"
                     /note="similar to Saccharomyces cerevisiae YPD1 (YDL235C);
                     ancestral locus Anc_2.27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144073.1"
                     /db_xref="GeneID:59236069"
                     /translation="MTIPKEVINWSILNEIISMDEDDPGFSKGLIIQFLEQASNTFEE
                     MEVNVQQTRDLKKLDSLGHFLKGSSAALGLQSIAWVCERIQNLGRKKESGFSSTEDLG
                     SMASSEDVTEDDAVYLDAIEKALVQARHEFSLVREELSEYYHCEL"
     gene            <119319..>120356
                     /locus_tag="HG535_0D00530"
                     /db_xref="GeneID:59236070"
     mRNA            <119319..>120356
                     /locus_tag="HG535_0D00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288179.1"
                     /db_xref="GeneID:59236070"
     CDS             119319..120356
                     /locus_tag="HG535_0D00530"
                     /inference="similar to AA sequence:RefSeq:NP_014182.1"
                     /note="similar to Saccharomyces cerevisiae YNL217W;
                     ancestral locus Anc_2.28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144074.1"
                     /db_xref="GeneID:59236070"
                     /translation="MVNKHKERDSLAMRSVPFVLPLLVSLVLFGIYMTCTLVSLDDGP
                     LNIPPEKRLPKLNMFERVTEHMSHERDFRLVFIGDVHGQYDDLQRFIDEELGGLDEET
                     TIVLLGDMVNKGPDSDKVVSFILNNKRNVRCIMGNHDLAVLFAYMNPKLNRRPLRKIR
                     KQLRPLEVDSQAGFFYPDDVTKVKEAHTVLAENLGFEALRDLALHCPVAMELKLPDDE
                     SLFTVHAGMMPGDFIDNIPTAGAVTETKYINPKDWSDYSKEKDRRHKSRWYTFWKKDK
                     LQEKYDHITVLYGHDANKGLNLHAHTKGMDSGCVKGGALSGFVYQYHHKKNKLTHYLL
                     QTNCDGYFPQL"
     gene            <120657..>123146
                     /locus_tag="HG535_0D00540"
                     /db_xref="GeneID:59236071"
     mRNA            <120657..>123146
                     /locus_tag="HG535_0D00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288180.1"
                     /db_xref="GeneID:59236071"
     CDS             120657..123146
                     /locus_tag="HG535_0D00540"
                     /inference="similar to AA sequence:RefSeq:NP_014183.1"
                     /note="similar to Saccharomyces cerevisiae RAP1 (YNL216W);
                     ancestral locus Anc_2.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144075.1"
                     /db_xref="GeneID:59236071"
                     /translation="MSSPADFETAPDEFVDNLGSNADNNVNKDTPAIDVPAVSSKFEE
                     RAADVVENTAETKQKKEEDESAGKTVEESSGTGVESAGGVTVHEEETGVDVPEQTLFK
                     GFSFYLNRDASAYDSMNDADQLSRLIEANGGKTLSEQPQVGSDITSVFVVSPYNDTKL
                     PTVTPTYIRACCQNSTLLKIENYLVPFDEFRSVIDTQLHEEHGNVKQGYENEEVFDDP
                     SLQNNDVNAIESKVDASDEQKLKSGNDQVQHSPLGTGVAVNIPNTNTNTGLAPEQQSQ
                     ADHESKKDAEPLVEMEDQIPSKISDSQLVPGVPQESYQLPHAGVQQQMVRKEGDNAFD
                     STRTMLARANMPTHNKASFTEAEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNS
                     IRHRFRVYLSKRLEFVYEVDKYGKLIRDDNGNLIKTKILPPSIKKKFTADEDYSLAIG
                     IKKQFYRDLYQIDPDTGVSLITDEDSPTAIAKRNMTMDPNHVPGTEPSFTDYRVNDRR
                     GPIAREFFKQFGESHSTHTENAWRDRFRKFLLAYGIDNYIEYYEGEKNEGNIPEPMKN
                     LTNRVKRPGIPTPGNYNSAAKRARIYGSEKPNQSGTTSAAVTAATSAVAAASGNTAGQ
                     LESGHGHYAVPESELLDEDTMNFISSIRNDLNKFDNSIPFEYPQEIAEAIRNDFSNEE
                     AEFDNIDPDSIPFPPEIASIDLFLPQFFRMSSTREFLEKVHEVISRDYEPSQAEKLVQ
                     DLCDEAGVRKTFSTSILTALSGDLMVFPRYFLNMFKHNMNPPSNVPGIWTREDDRMLR
                     ANKEDGINELTKRHGTGRLEMRRKFVEKDLI"
     gene            <123726..>125309
                     /locus_tag="HG535_0D00550"
                     /db_xref="GeneID:59236072"
     mRNA            <123726..>125309
                     /locus_tag="HG535_0D00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288181.1"
                     /db_xref="GeneID:59236072"
     CDS             123726..125309
                     /locus_tag="HG535_0D00550"
                     /inference="similar to AA sequence:RefSeq:NP_012124.1"
                     /note="similar to Saccharomyces cerevisiae CCT2 (YIL142W);
                     ancestral locus Anc_2.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144076.1"
                     /db_xref="GeneID:59236072"
                     /translation="MSVQIFGDQVTEERAENARMSAFVGAIAVGDLVKSTLGPKGMDK
                     LLQSASSDKSLVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAEL
                     LREAETLIEQSKIHPQTIIEGFRIASHAALSALEKVAIDNSADEKKFHNDLIHISKTT
                     LSSKILSQDKEYFAKLATDAILRLKGSTNLEHIQIIKILGGKLSDSFLDEGFILAKKF
                     GNNQPKRVENAKILIANTSLDTDKVKVFGTKFKVDSTSKLAQLEKAEREKMKNKIAKI
                     SKFGINTFINRQLIYDYPEQLFTDLGINSIEHADFEGVERLALVTGGEVVSTFDEPSK
                     CKLGECDLIEEIMIGEESFLKFSGCKSGEACTIVLRGATDQVLDEAERSLHDALSVLS
                     QTTKETRTVLGGGCAEMIMSKSVDTAAQNVDGKKSLAVEAFARALRQLPTILADNAGF
                     DSSELVAKLRSSIYNGMSTSGLDLNNGCIADMRELGIVESYKLKRAVVSSASEASEVL
                     LRVDNIIRAKPRTADRQRM"
     gene            complement(<125429..>126604)
                     /locus_tag="HG535_0D00560"
                     /db_xref="GeneID:59236073"
     mRNA            complement(<125429..>126604)
                     /locus_tag="HG535_0D00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288182.1"
                     /db_xref="GeneID:59236073"
     CDS             complement(125429..126604)
                     /locus_tag="HG535_0D00560"
                     /inference="similar to AA sequence:RefSeq:NP_014315.1"
                     /note="similar to Saccharomyces cerevisiae END3 (YNL084C);
                     ancestral locus Anc_2.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144077.1"
                     /db_xref="GeneID:59236073"
                     /translation="MPKLEQFEIKKYWQIFSGLKPVGNKLNHDQVSPILFNSKLDSSI
                     LNKIWFLADIDDDDSLDFEEFVICMRLIFDMVNKNIDKVPDELPDWLVPGSKSSLIAE
                     RKKRKIQENAEIPKAEQPKVDWYMAPEDLSQYGKILESCTLSRDGTVTFPSISYVIKT
                     KFFNLGSSDIDKVWNLVNPKRLPSIDKDPAFYFIHCLRQCNDVGARIPTELPKALFDI
                     CNKERVSYDMNSNQGNVKKISPTPSTNTHEKEHAASISTRTGVSYGSNSTNNGSNINM
                     NKAGSSENLSDSDIKRLEEELAQLDSELAQLETENKTVPQNSPASIREQLEGLLSYME
                     EKAYERNRNKNVSVPFNINEAKDDLENIEEQITVLEGYLQNKQSELHDLRTEIASFH"
     gene            <127454..>129931
                     /locus_tag="HG535_0D00570"
                     /db_xref="GeneID:59236074"
     mRNA            <127454..>129931
                     /locus_tag="HG535_0D00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288183.1"
                     /db_xref="GeneID:59236074"
     CDS             127454..129931
                     /locus_tag="HG535_0D00570"
                     /inference="similar to AA sequence:RefSeq:NP_012126.1"
                     /note="similar to Saccharomyces cerevisiae AXL2 (YIL140W);
                     ancestral locus Anc_2.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144078.1"
                     /db_xref="GeneID:59236074"
                     /translation="MRNFSRLALLPLVLFVGLSKLVNSQPYEAYPIADQLPPVARVGE
                     QFTFQISNDTYKSSVSQSTQIAYEAHELPSWLSFDPSSRVLSGSASSGDLSNDAEQYF
                     TFILEGTDPSDNSKSNFTHQLVLSNRSSVEIAANFNLLALLKNYGSTNGKSGIILSPN
                     EIFNVTFDRSTFASNNAIVAYYGRMKQYNAPLPNWLFFDQNNLKFSGRAPVVNSDIAP
                     QTTYSLTLIATDIENFAGVEVPFDLVIGAHELTTTIQNSLLVNVTSSGEFHYELPLDY
                     VFFDGNQITAQELGSMDLVGAPTWVELNNDTLSGTMSTDESSSNSANFSVAVYDTFAD
                     VIYFNFRIESTNQLFAVPSLSNINATRDDWFEYNFLPSQFTEYSDTNVSIAFTNSTQS
                     HNWINFRSSNLTLSGMVPEDLDSLALSLIASRGSVRQSLDFQIIGMDSTERHLNRTHN
                     STTSLRSSSTSSTSLPSSTSGSNPVTTTSSAATSSPTTSAGTAPLMLNSSSRRTTAIA
                     CGVAIPLGLIAIFALIFFLFWRRRKSKNADDAEKFANISGPDVNNSANRPNQASALAT
                     AGAFDDPFDDLNAHAGTDAQRLGALNAMKLDEVSSSNSEGSTIDEKTSSLDNKDIYLD
                     NDVSHSAEELLPNPPPNGNFFDPQNRSSSVYLDSEPANRKSWRYKLSPMKIQDSKTRD
                     SCTSASTVSTTDFMNTIIKDDQPLPKDPRKSTLGLRDSVFWNKMSPAKKPMNNLSQQL
                     ESQNSMIPNLDDQSHASSNYRTETSPTSTFSDEFVPVKNGNNYSWVQRSKPNRQPSGK
                     RLVKTPNLGDVNVSQAAEVEGHVPEQI"
     gene            complement(<130140..>131738)
                     /locus_tag="HG535_0D00580"
                     /db_xref="GeneID:59236075"
     mRNA            complement(<130140..>131738)
                     /locus_tag="HG535_0D00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288184.1"
                     /db_xref="GeneID:59236075"
     CDS             complement(130140..131738)
                     /locus_tag="HG535_0D00580"
                     /note="ancestral locus Anc_2.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144079.1"
                     /db_xref="GeneID:59236075"
                     /translation="MMNIYAKGRALSIWKRASSFRNVTRKFQVASVVLKQGNGSNDPT
                     SVEDLATRPDANATTSTDYYEYSRVVKDAARDFKATWLNALAERKAQLAQGKVIDSYV
                     YSHIKSTDVIDKTTKDSFAYVVLPFRDDPVVADFYVNAAGRLRMGQLFQDLDSLAGKI
                     AYKHAAPVEPMIVTASVDRIYLLKPLDTIADFNIILSGSVIYTGRSSMEITITARALP
                     GDIPKEISGDNLSDDDIFLTASFTFVARNPETHKSLAINRFLPLTEKEWMEFKRAESR
                     MASKKLKSRNMDLEKNPPTNEESVLVHSLWSASKELAGLKNKPTNIVFMKDTNVKSTM
                     FMQPQYRNRHSYMIFGGYLMRQTFELAYCCAASFSHALPRFVSLDSLTFNTPVPVGSV
                     LHMDATVVYTEHLHEDSSKPKVLSVSDSAIDGNTIFHFQPTPVNNLSLHENDFLSKPG
                     TLIQIKVDTMVQELASEKLQKSGSFIYSFFAPRDLDDEQLGSPGYATVVPESYSEMIE
                     YIQGRRRATETALYAKSIKENSEK"
     gene            <132283..>133905
                     /locus_tag="HG535_0D00590"
                     /db_xref="GeneID:59236076"
     mRNA            <132283..>133905
                     /locus_tag="HG535_0D00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288185.1"
                     /db_xref="GeneID:59236076"
     CDS             132283..133905
                     /locus_tag="HG535_0D00590"
                     /inference="similar to AA sequence:RefSeq:NP_014316.3"
                     /note="similar to Saccharomyces cerevisiae SAL1 (YNL083W);
                     ancestral locus Anc_2.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144080.1"
                     /db_xref="GeneID:59236076"
                     /translation="MAPERTNGETDEERYKRYERTFEKLDIEGTGRLTFQKLKEALEK
                     HGHPLRDSDEAIIVLFNAMDCDKDSIVDLQDFKKYASLAESQIKQGFQKIDSDHDGRV
                     KISELSQYLSKVDQNCRQENDDSKNIKGQMVHEEQNHDKDKERSRFNRFFNWAFQRKS
                     KDNDDSAVRYITYDQWRDFLLLMPRKEGSRLHTAYSYYYYFNADVDLSSEGDMTLIND
                     FFRGFGFFIAGGISGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSRKDLIAKNPHADL
                     AKIKSPLVKAMTTLYRQGGLKAFYVGNGLNVVKVFPESSMKFGSFELAKRILTRLEGC
                     KDTSELSQFATYIAGGMAGVVAQFSVYPIDTLKFRIQCAPLDNQLYGNKLMVETAKEM
                     YRQGGLRLFYRGILVGVAGIFPYAALDLGTFSALKKWYIAKQATKLQIPREEVYLSNL
                     VVLPMGAFSGTVGATLVYPINLLRTRLQAQGTFAHPQTYTGIKDVFIKTIQREGYPGL
                     FKGLVPNLAKVCPAVSISYLCYENLKSFMKLE"
     gene            complement(<134136..>134870)
                     /locus_tag="HG535_0D00600"
                     /db_xref="GeneID:59236077"
     mRNA            complement(<134136..>134870)
                     /locus_tag="HG535_0D00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288186.1"
                     /db_xref="GeneID:59236077"
     CDS             complement(134136..134870)
                     /locus_tag="HG535_0D00600"
                     /inference="similar to AA sequence:RefSeq:NP_012127.1"
                     /note="similar to Saccharomyces cerevisiae REV7 (YIL139C);
                     ancestral locus Anc_2.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144081.1"
                     /db_xref="GeneID:59236077"
                     /translation="MNQWVAKWTKIYLKCFINLILYHRNVYPAASFDFTTYQAFDLPQ
                     FTPMNRHPGLQNYIEELVLDLISKLSHIYSLSLCIVSKEDNTCIERYVLSFHEFRHVD
                     DIGLLSETDVFDEFRSCLNSLTAHLETLPYVKDDKVTFETVINTMDMELGHRPENMTT
                     LKTRQDLLAFNRATNWTKCQEDEGYPNGNENLGMYNPKIKMTSLVGCDVGPLIIQQHC
                     EKLLASEKDLESFYCRDGRGSPFSPL"
     gene            <135079..>137757
                     /locus_tag="HG535_0D00610"
                     /db_xref="GeneID:59236078"
     mRNA            <135079..>137757
                     /locus_tag="HG535_0D00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288187.1"
                     /db_xref="GeneID:59236078"
     CDS             135079..137757
                     /locus_tag="HG535_0D00610"
                     /inference="similar to AA sequence:RefSeq:NP_014317.4"
                     /note="similar to Saccharomyces cerevisiae PMS1 (YNL082W);
                     ancestral locus Anc_2.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144082.1"
                     /db_xref="GeneID:59236078"
                     /translation="MSKINAIAIDDIHKITSGQVIIDLVTAVKELIDNSIDANARHIE
                     VSFKNYGVESIECSDDGDGIKPENYETLALKHHTSKISNFEDVSTVKTLGFRGEALAS
                     MCAIANISVVTTSNPPRADRLEYDFNGILKSKTTTTRNKGTNVQVAQLFKNLPVRRKE
                     FTKNCKREFTKCIALIQSYALIQGNITFTVWHTTPNGKKSRILSTGKEPEMFKKILNI
                     YGTSSMRGLSEVNLCLDLNPFKKLMERKHVENHLFEGLDYKIVATGYISKCSFGCGRS
                     SKDRQLVFVNARPVEYPVLLQSCNEVYKSFNNVQYPSIFINFQVPPELVDINITPDKR
                     TVVLHNEKCVVDVFKDGLTEYYEKQELELPKSALSQPEPKLLKKRKIDGAKAESSFTS
                     SQICQGSRGELRDENFELEELSKKDEKSKCLFGYNEDSDHEGDTITPQIALQFDNITR
                     TPPNSETTIERKSSGENQVNRTELFIHESEGSHKVLHDIKNGIATPRKALTEYAHLSS
                     PNASQNNAPILDNSQSVEVEIDGKKEDLQAKLSQDERLIFLREDSSHRSCCSHTSSCS
                     GTCSPHATTNEDDEAFTYEDTDDSYAVLESAQLNVRTPAKPNQIVSRGVYRSLSDTEV
                     QQANEIDFPSISLHVDTSIKRGAETLTAIKNKQPPKQEHFIKKNDNFENFEESEKFLT
                     ITVTKDDFIKMQVVGQFNLGFIIVTRKIGDKYDMFIVDQHASDEKYNFEVLQKITVFK
                     SQRLIAPLPVDLNVIDEMLVIDNQPLFEKNGFKVIIDENEMPGSKIKLYSLPVSKRTL
                     FDVDDFYELIHLIRESGGLNLESLRPSKIRSMFAMRACRSSIMIGKPLAKKTMTKVVR
                     NLSELDKPWNCPHGRPTMRHLLELRDWGTFNDDYVI"
     gene            complement(<137866..>138282)
                     /locus_tag="HG535_0D00620"
                     /db_xref="GeneID:59236079"
     mRNA            complement(<137866..>138282)
                     /locus_tag="HG535_0D00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288188.1"
                     /db_xref="GeneID:59236079"
     CDS             complement(137866..138282)
                     /locus_tag="HG535_0D00620"
                     /inference="similar to AA sequence:RefSeq:NP_014318.3"
                     /note="similar to Saccharomyces cerevisiae SWS2 (YNL081C);
                     ancestral locus Anc_2.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144083.1"
                     /db_xref="GeneID:59236079"
                     /translation="MVVHILGKGFKGKEVIRIALASKFYGIGLTTAERICSRLGFYPW
                     MRMHQLSEAQILSITSELSNMTIEGDARAIVKENIALKKRIGSYAGMRHATGLPVRGQ
                     KTRNNANTARKLNRIDRKGYHTSAWSSILGAFTKTL"
     gene            complement(<139618..>140856)
                     /locus_tag="HG535_0D00630"
                     /db_xref="GeneID:59236080"
     mRNA            complement(<139618..>140856)
                     /locus_tag="HG535_0D00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288189.1"
                     /db_xref="GeneID:59236080"
     CDS             complement(139618..140856)
                     /locus_tag="HG535_0D00630"
                     /inference="similar to AA sequence:RefSeq:NP_014319.1"
                     /note="similar to Saccharomyces cerevisiae EOS1 (YNL080C);
                     ancestral locus Anc_2.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144084.1"
                     /db_xref="GeneID:59236080"
                     /translation="METPAAEYANLNGNGNGGSTAVEHHHHHHHHYHVYDPAEPNIQR
                     RQITGGSRFSIGNGVYSRASTVDAGNPSSSDSCDSQNQMRKLKTAPLVQAYASIKTLS
                     LSHLTAKQHLLMALCRDVSLLPPITYTFSSLRKAWRILFQNNVKLLHEPQSLKDAMSF
                     LLQNYAKHNATVSNNLQAGSNLESSNLLLNTLTTARASEYMLCSLWCIVSLYLTYSIL
                     DSLMVRWIVKYSTLAAILRMFSMSLIIITLELLLLSSLSPKGDYHLHTWILLSCLLTS
                     AYIWQNYLTSNLNYVSPNDYEEDCIDCDDDDFNNRHKSSDSITSISLTGSHSLGSPPG
                     SSCTTGARARKSRRRIRKSFQFTKKRTIDFYNITVFCVVPVGFASFITMIGLLRNLVI
                     QRLDVEQLARMIQTTNYFQE"
     gene            complement(<141479..>141964)
                     /locus_tag="HG535_0D00640"
                     /db_xref="GeneID:59236081"
     mRNA            complement(<141479..>141964)
                     /locus_tag="HG535_0D00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288190.1"
                     /db_xref="GeneID:59236081"
     CDS             complement(141479..141964)
                     /locus_tag="HG535_0D00640"
                     /inference="similar to AA sequence:RefSeq:NP_012128.3"
                     /note="similar to Saccharomyces cerevisiae TPM2 (YIL138C)
                     and TPM1 (YNL079C); ancestral locus Anc_2.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144085.1"
                     /db_xref="GeneID:59236081"
                     /translation="MEKIREKLNNLKLEAESWQEKYEELKEQFKTLEQDNVEKENQIK
                     SLTTKNQHLEEEVEKMETDLGEAKEMAGESHNLRSNNENYTKKNQQLEDELEESDAKL
                     KETTEKLRETDLKAEQLERKVAALEEERDEWERKHEELTSKYDEAKKELDEIAASLEN
                     L"
     gene            <142780..>144003
                     /locus_tag="HG535_0D00650"
                     /db_xref="GeneID:59236082"
     mRNA            <142780..>144003
                     /locus_tag="HG535_0D00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288191.1"
                     /db_xref="GeneID:59236082"
     CDS             142780..144003
                     /locus_tag="HG535_0D00650"
                     /inference="similar to AA sequence:RefSeq:NP_014321.3"
                     /note="similar to Saccharomyces cerevisiae NIS1 (YNL078W);
                     ancestral locus Anc_2.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144086.1"
                     /db_xref="GeneID:59236082"
                     /translation="MEVVYPERVFDLSSGRSHRRLMSSINHSPSATDSTATSEDKSRI
                     ANGGSISVSFNSAAYRLPDTLDQLQTPVINRVTSEDSWPVFKPFESPRPLPLPGSMAA
                     VTTQANIELLPTQLRRRKSARAINDSSSDEVISQFSQWDNYRNTSQQSRRNEQIASKP
                     PIRRASVRRNDFTSKKEVQQSKESKKFLFHKGFFKKTKSQPVTRRFLRNRAGLNAVLN
                     FIDLQSMSPSDVVSSDVATTYAPRKLLRRCPAIIESYKAPLREYVAAISRQGSVQRSS
                     KSPLLAERPKTTKKRTALSRSHSTPSAIRHIRSSSYSPQSRIVHELWKEYLRLVIFQR
                     IQLRLSLTNIDDSASVSSKASPELSPIAFSSYSPDKQNRKHKFYRVSSQESYYSSTPP
                     ITPSSNAVCAMRKAY"
     gene            complement(<144046..>146841)
                     /locus_tag="HG535_0D00660"
                     /db_xref="GeneID:59236083"
     mRNA            complement(<144046..>146841)
                     /locus_tag="HG535_0D00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288192.1"
                     /db_xref="GeneID:59236083"
     CDS             complement(144046..146841)
                     /locus_tag="HG535_0D00660"
                     /inference="similar to AA sequence:RefSeq:NP_012129.1"
                     /note="similar to Saccharomyces cerevisiae TMA108
                     (YIL137C); ancestral locus Anc_2.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144087.1"
                     /db_xref="GeneID:59236083"
                     /translation="MSELLAITNAVVPSHYELHLDINPLKTNFRGSARISLKPTNLAA
                     CSIQDLKLHSKNLVILSASLCESKVEHPLDVTYDKSEEVVIFNCQEQILFSPDRKLFL
                     HLDYVGRINAIKTYQDETAGVFKTNFMDPKTGKSNNMVIATHCQPYFARSIFPCVDEP
                     SLKTTFQLTIKTLSRFKVISNTSKVSSSKVGNSDQKLTVFGITPLMVTSIFGFVVGDL
                     EMSRTEVHSNYSPNKMPLSIYSPSNIENAAFALDTVQKYIPILEEFFDKKCPLDKLDF
                     VLLPFLKDMAMENFGLITVQMNHLLLTPTVLANNDVRQQVQQLIVHELVHQWMGNYLS
                     FQSFEYLWFNESFATWCACEVLEKSGDLPNYWTSKAYLVDQTGTAMSSDSDSHTLSIA
                     AASLKATMNSPSQTKDLFDAHSYAKGIAILRGMSLSTGEEFFKKALQKVFKDESLHKN
                     SIKPINIIYHMANTLKSQNISNHFSSWCRTAGLPIVSVELIEESNKTKTKLVQHRYIT
                     SGDTDYEDVPYSIPLFIQLPNTELDTKHILMTDRTLKIDYPILLCNHESQGYYHVSYE
                     SDEFYKQINQHLTNGDLSEIDLVKIFTDLQYYIGDSAYQKPIHLSGLQNLLQHLSSDE
                     VDLKRHAKYWLAMRSGLIALGKVEQLSAANGNFAHDYIYSVVTPLIKKINWPVGKFEE
                     GTYSSYQLDCMSKLLFMGRELPNICELCHNYFNHILQGPPSSVPIEIVESVFAVISQS
                     AKNTKQWKRLFELANSCEGIKENVSFLNINTPVHSDALQFYAINYMCFSKNFGIIKKT
                     LEFIAANLEISGIDSALLGLTYNAYQKPKGDQSDCQIREIVWEWFRTHFDVWVRSCVR
                     KDASSDNKRTSLSSIAFHVFKMFAADEEIVDEFLEITQDSFLDILSAKDYWEIVKSTH
                     SEDKQLLEKTMKYDVFN"
     gene            <149060..>149422
                     /locus_tag="HG535_0D00670"
                     /db_xref="GeneID:59236084"
     mRNA            <149060..>149422
                     /locus_tag="HG535_0D00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288193.1"
                     /db_xref="GeneID:59236084"
     CDS             149060..149422
                     /locus_tag="HG535_0D00670"
                     /inference="similar to AA sequence:RefSeq:NP_013842.1"
                     /note="similar to Saccharomyces cerevisiae PKR1 (YMR123W);
                     ancestral locus Anc_2.415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144088.1"
                     /db_xref="GeneID:59236084"
                     /translation="MANFFVALWESIFQPGTTPQLIIATHLSFAALVATLGWLIFATS
                     GNIHFIALFSISICLWLAVTWFVQELNHVKLSDNRTIESESKAEEEKRPVTASSSSAE
                     TASLTSSKKASQLRSRKV"
     gene            <149731..>152598
                     /locus_tag="HG535_0D00680"
                     /db_xref="GeneID:59236085"
     mRNA            <149731..>152598
                     /locus_tag="HG535_0D00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288194.1"
                     /db_xref="GeneID:59236085"
     CDS             149731..152598
                     /locus_tag="HG535_0D00680"
                     /inference="similar to AA sequence:RefSeq:NP_013131.1"
                     /note="similar to Saccharomyces cerevisiae YLR031W and
                     YMR124W; ancestral locus Anc_2.414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144089.1"
                     /db_xref="GeneID:59236085"
                     /translation="MDAGLSAIRNPGGTGHRGSSQAQMRNQLLQSDIGNLDIRYEIPN
                     QPSYSGRGSQQYFSNQPEYTNPQFRGLPPQQPQGNPQQPFNRVAYPSYPPMGANMGPP
                     AGPRMGPQIPQYQSTHGRNSSMRPGSQMTQGQAGRRAYSLNQKSLSSFFKGPKFLHGK
                     GKPHSNKDDYDDDEDVILEDNEQAMLTLHDIKTSGNRGGESYGHGTSTAPMIPVTMTK
                     DHGNMTNMEYRKHLFAQRKMAMNAVNKQQKGMPYEPRAMSLQTYNNESPFIQGRMAPH
                     PQGSSPIVTNRANSLMRGPESIRQQPQQPQQQYKNYSPHDIPRYNSLPSNGPRSMSLL
                     TPQPGRQAGSAYQMPGQVQASNEFLADRQPRTEMYMAKNASWSSDNESKQYQTWKSSD
                     TSSSNPSKSFAPSNSAPSVGDFPSSTFHTEYGSNTAAPLNNQLNVPPLTQAKGQLNVL
                     KLSAPQQNELEAKARLLSQKEKDLKDKELRIREKEASFKNGLLESRGGSVDSVQQEES
                     RTVLPHSSQTEQEIVNEKDERDERDDGDDLDIQPQPSLEVGLGSLSLHSRDNGDSGQP
                     SNRISNATFVSTFSESPQKVNVPKKSTGMYKLEKSANNSIFVTAQEFPNDMENRSDTS
                     RASTGKEFSRKDSPNTSTDSIDDGNSTLKGSIGRVDASKESIDRKNSNASSGAKLKKR
                     TSFVKAKNFLRKMSSSSPTKGGDEDSQLALRRSPTNISIDSLPSSNNDTFHYRTQNKK
                     TDNRISVLSASSKKMPDDQQNSSIPETDTEGRTERRENSDVSDPDGFDFDNTLGKPYE
                     PLFAVNKDIDTKKFRTITISGEQLNILNENKLLMQEITLVSTELAESIKRETILESQL
                     KDLAHNNFSLTENDSTSLAEFEIELRKKSAKIVQLIQQLNDERLKRFIAEEQLLLQEN
                     GAKPSSIDLVHTISTLNTQLQDKNAEISMLRGALENNTTIR"
     gene            <152787..>155748
                     /locus_tag="HG535_0D00690"
                     /db_xref="GeneID:59236086"
     mRNA            join(<152787..152811,153194..>155748)
                     /locus_tag="HG535_0D00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288195.1"
                     /db_xref="GeneID:59236086"
     CDS             join(152787..152811,153194..155748)
                     /locus_tag="HG535_0D00690"
                     /inference="similar to AA sequence:RefSeq:NP_013844.2"
                     /note="similar to Saccharomyces cerevisiae STO1 (YMR125W);
                     ancestral locus Anc_2.413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144090.1"
                     /db_xref="GeneID:59236086"
                     /translation="MSGRKRRADFDDDTGPRDFRPRMPKRQRVPPVVQLCKEMMPDIR
                     TIGESVRAFPEDIKFLSDAIVNEYGHEDYFNEALLKTFRAVVFEQPHKLPAIGLLTMV
                     VNKENEVAAKSVINFFFEELQKYCNEATNENFSATSNETGPWNKVKLILRFLATLSPI
                     LIRDEIVDIFRSLLELSIALKSKDLSKRNPLSEEIYTNTLLDIPYLFIFNREDKALQS
                     MVEELVTFVEQNYSVATSDIDLLKEYNKNSPYQSLELSTIVLPNVKKALAYDMEQLSK
                     IFPEWLHLLPEQAVDHGFNEQLKLPSVEELVPFSYLNMKMGSVDSMWRNPRYAFHVYL
                     PNSVGDFETVVPITTYAGQIFNDIIIDIVESLEFNRKEVAKQIISLDTFFKPGIFAEP
                     GISIAQLASTYEEDPLASTFKIEDLAIETTLSLIFKLPDVSQPFAYFYTLLVEICQNS
                     PKAIAPVFGRAFRFFYNNLDNLDLELKMRYLDWFSIQMSNFNFSWKWNEWENDSLRFG
                     HVVYNPKMVFAKNLIRKELRLTSNTLDVEDSLPEEFKKYLDSSYVPREQLVKYYQSLF
                     VPGHIINDSDVKKSDLFFKQDSVPMSEQVRLILDYIHKQNDSREISELENILGSMKQE
                     FGSIISNFDRFVVALLVQTVVHSGSRSLSHANKYISDLKNDLNQIFSKLEISDELLQF
                     TIVEAVLRFWNTNSQNGFLIVDAFKHAGFVTPIAILNFSFTEDHDINYGLVDATSIES
                     TFRNLSQHTENSDCLQYLFEKLFTIVTGTISILQIQPHEEISIPELSDDMDIDVSDDI
                     PRLNLLWKYETSMSFIKSALRKHSREFRPLVENIKAGIDTACAHEQTKIRLLTWIEEV
                     NMI"
     gene            complement(<155925..>156905)
                     /locus_tag="HG535_0D00700"
                     /db_xref="GeneID:59236087"
     mRNA            complement(<155925..>156905)
                     /locus_tag="HG535_0D00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288196.1"
                     /db_xref="GeneID:59236087"
     CDS             complement(155925..156905)
                     /locus_tag="HG535_0D00700"
                     /inference="similar to AA sequence:RefSeq:NP_013845.1"
                     /note="similar to Saccharomyces cerevisiae YMR126C;
                     ancestral locus Anc_2.412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144091.1"
                     /db_xref="GeneID:59236087"
                     /translation="MKPNGRLKVWLYRGSLGITVLFLLGFSIVLPVDSIAQAFQSSNN
                     AFNTFIVIGALVAFGVVGIVIVFGRILFYRSCIQDIPRRYIPIAPGDLPHSRSRNMIL
                     ENMERSKDLSLLFKKPKHPVIHPGLEPPVGCDEPKFEKIFPEFLNYSTCIKSLADRLK
                     YQGIFLNNQSVDIKLGDTVADVVRNQFMVGCSDQGVLENTQRFIDLYETIQFSGKEPT
                     REQFIEFVSLAIYFVDLSSTRDKRQTVLDPNSNFQPEINFNGDMWNTEVSRIPTNISV
                     NPIQEVDSYNQDSELLPEGGTYLRKVNSSSTVAVRMPSHEIPSMHPNEHF"
     gene            <157693..>161160
                     /locus_tag="HG535_0D00710"
                     /db_xref="GeneID:59236088"
     mRNA            <157693..>161160
                     /locus_tag="HG535_0D00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288197.1"
                     /db_xref="GeneID:59236088"
     CDS             157693..161160
                     /locus_tag="HG535_0D00710"
                     /inference="similar to AA sequence:RefSeq:NP_013132.1"
                     /note="similar to Saccharomyces cerevisiae RAD5 (YLR032W);
                     ancestral locus Anc_2.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144092.1"
                     /db_xref="GeneID:59236088"
                     /translation="MTEENLPKKRFFKDELESSQEFKDIEEQKLSFQGNLENAKSFLF
                     TEKPSSQEGVDDSPVMIEETDTSSNSPASCLKKNVEHFRNIVPGVPLERAELLCRMYS
                     KENNVLSKALEHHFERPSSPAACSVNYGDTLPDTESLVTPIPVASLPSPRNHQEENGQ
                     RTSKRLKTESHSRRFIGSLQVNAMATRPTVRPIKYATKLKIGLSTGSLTMSKVSHANR
                     SKKASMASYVKIYDAVNEREIGRVPGDIARILFPLLQTNEVEFEATMIFCDNKRLSIG
                     DNFIFQLDCFLSFRIFDTSSPIEGQSKTIHDSSKRRWDSSTQPIVETSEELENGTRIM
                     SLLSLFDKLNIKPIRQSEILENEDKDSRDEIDIIDLDDDKDLVDITSPCSETDNDANE
                     EENIMNMNQLKFFYKATQSIDFLRDLPELEPPKEEFKLNLRRYQKQGLAWMLRREQEF
                     EKLSEYDDFSKVDNSMMINPLWQQFKWPKDMSWESQRSGDRTPKASAEQRFYANLHTG
                     EFSTEKPIMKTMMKGGILSDEMGLGKTISTLALIFSAPIDSEASSKQLFGTEGSDFPP
                     QSQNIPYVSHTTLVVVPMSLLNQWNLEFEKANASKSMRSEIYYGGNVSSLKTLLTKTN
                     NPPTVVLTTYGIVQNEWSKIIKEKDTSSSHTVSSGLFSVEFFRIVIDEGHTIRNRMTR
                     TSKAVLQLAGKRRWVLTGTPIINRLDDLYSLVKFLRLEPWSQISYWKMLVSEPFEKKQ
                     YKKAFDVVNAIMVPVSLRRTKQMKDADGKLLVELPPKDIVVERLPFNKTQDHVYKYFL
                     GKAENSVRSGLAQGDLLRKYSTILVHILRLRQICCDIKLLGSRDENDEDLSTSNQLVN
                     EDLKSLTQGAAGEGFSYEFDARKMQIAISNVQKMYDSAELLENIECSICTTEPISLDK
                     ALFLECGHGFCEKCIMEYFEFQKEKKLETKCPNCRELVSYNNLVKVELKEGESPKIVP
                     CNCDQKPAKVEALIKHLKVLRDTALGEQVVIFSQFSSYLDVLENELNETFASNEVKIY
                     KFDGRLNLKERATVLEEFGVKSLSKQKILLLSLKAGGVGLNLTCASYAFMMDPWWSPS
                     MEDQAIDRIHRIGQTSNVKVTRFIMENSIEEKMLKIQERKRTIGEAMDADEEERKKRR
                     LQDIQMLFE"
     gene            complement(<161234..>162169)
                     /locus_tag="HG535_0D00720"
                     /db_xref="GeneID:59236089"
     mRNA            complement(<161234..>162169)
                     /locus_tag="HG535_0D00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288198.1"
                     /db_xref="GeneID:59236089"
     CDS             complement(161234..162169)
                     /locus_tag="HG535_0D00720"
                     /inference="similar to AA sequence:RefSeq:NP_013846.1"
                     /note="similar to Saccharomyces cerevisiae SAS2 (YMR127C);
                     ancestral locus Anc_2.410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144093.1"
                     /db_xref="GeneID:59236089"
                     /translation="MGKRMGKGEKDILYGILSERNIKHIQFGIDKRFPSWYGSNAYFN
                     LETRLLGFKEDQRVVKKVERCQFWLDTLYICEYCFKYTDDEEQYIAHEANCKYKGRAP
                     GKIMYKSPTYTIRRVKGSKHQLFCQCLCLFTKLFLDNKSMYFKVDHYEFYIVYETEST
                     KPMGFFSKDLVSYQQNNLACILTFPPYQRRRLGSLLLEFSYELSKSEGILSGPELPLS
                     PFGLISYLKYWSKVICYELTTGELANFGRLTLEDIATVSGMRIQDIILTLKYLNCLGE
                     SNDIYLTPLKNNLKKYGSKRNDIFSLEEEYLLIDG"
     gene            <162471..>166220
                     /locus_tag="HG535_0D00730"
                     /db_xref="GeneID:59236090"
     mRNA            <162471..>166220
                     /locus_tag="HG535_0D00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288199.1"
                     /db_xref="GeneID:59236090"
     CDS             162471..166220
                     /locus_tag="HG535_0D00730"
                     /inference="similar to AA sequence:RefSeq:NP_013847.1"
                     /note="similar to Saccharomyces cerevisiae ECM16
                     (YMR128W); ancestral locus Anc_2.409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144094.1"
                     /db_xref="GeneID:59236090"
                     /translation="MGTYRKRFNEKARAGQVAKQKILKRIRNKQFLRHAEDYDDSKVE
                     EVENAKDTNAELLNPMTEEEKKVKKRKLQELFAPKESKISRLKKKRLDKFVEHQLDRE
                     EKKAILEKLQEYKVDTSLMTSLKNLGHGRQTKKQEFQEALSLEKQGRSDNRIQEILYE
                     KVQQRDWNRENERMSSQSDETDNEEDGWDTADKNKSSFIDLRPVKNGGTGFGFGFANA
                     KVVTRKVPKRKYNWKQRVELQERRKQDAGDEMDFLSSTDEAESLSSNESVTNEADKNT
                     SEAESQYIENSDSSEDNEVDDSEDEASEEDKEEVSQVSIAADFKEWANKEIKKIEGTN
                     KEYVMPPLKTLLQPVIREEDLDDGLIETQVPIDENSQRKAFFVDVKRPEEVNSVRMQL
                     PVFGEEHKIMEAIHHNDVVIICGATGSGKTTQVPQFLYESGFGSENSPDYPGMIGITQ
                     PRRVAAVSMAKRVSIEMGDHGDKVAHQIRFDSNTGDSTRIKFMTDGVLLREMMKDFKL
                     TNYSSIIIDEAHERNINTDILIGMLSRCVRLRAKEHAKDLKSHKKLKLIIMSATLRVS
                     DFSENTALFPVVPPVLNVEARQYPVSIHFNRKTNYDYMEEAFKKTCKIHRKLPPGTIL
                     VFLTGQQEITQMVKKLRQEFPSQKGLKANRDLSSSVAVKVNSKNADIEAEDIDFSVKV
                     MEKDNFDDGSISDGDDNSSEEEGFEEAVDQIQQKIGPLHVLPLYSLLPTNEQMKVFQE
                     APAGSRLCIVATNVAETSLTIPGVKYVVDCGRCKERKFNEVNGVQSFEIDWISKASAD
                     QRSGRAGRTGPGHCYRLYSSALFERDFKQFSRPEILRMPVESVVLQMKSMAIHNVLNF
                     PFPTPPDRKALSTAIQLLQYLGSLDADEKITEDGKIMSLFPLSPRFSKLLLVSEEGGC
                     LSYAVSIVSALSVGDPFIKEQELGIGNQPNHEEKLDEVDHSLSYAEKERQKVLRTKYY
                     KSKAQFCKLDQFSDVFRLLSVVNAFDYIPEDQKGKFLHDNFLRGKFMEEITKLRKQLM
                     YIIKSNTSKENVAVVIRDEDLKSKVPSETQLKLLKQMVCAGFVDQVAIRADCLFPEET
                     TTINKTSIINIPYIPVLTLKTPEVSDCFVYIHPNSLLANIGEIPPKFLVYHSLHQNNS
                     GKTRLNALCDIKSTPLANIARKGSLLTYSKPLNGQGLKIIPLTPTERYCYVVPRFGAT
                     LDGDLKVGWDLNPIPVHQEKVNGQWQVTKFILSKTYKSAEKDRRR"
     gene            <166479..>168103
                     /locus_tag="HG535_0D00740"
                     /db_xref="GeneID:59236091"
     mRNA            join(<166479..166537,166618..>168103)
                     /locus_tag="HG535_0D00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288200.1"
                     /db_xref="GeneID:59236091"
     CDS             join(166479..166537,166618..168103)
                     /locus_tag="HG535_0D00740"
                     /inference="similar to AA sequence:RefSeq:NP_013133.1"
                     /note="similar to Saccharomyces cerevisiae RSC58
                     (YLR033W); ancestral locus Anc_2.408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144095.1"
                     /db_xref="GeneID:59236091"
                     /translation="MGSDLHFSDLLQNIRSIFIPASSKCKVLDESFPAKFFEKEPSKI
                     FESYVKFIKSRSNAEGIIKNEDKLALTTISARFESGDYSPDVGGLYKLYHDVKLVCTI
                     LIHYHPQGTRNYQMVDKFYKFGTELILRECYKLGASLTKSDRENSVGNEDRDNELNQI
                     IAEDFITISTNYQVPLTQTYHIKTKDQDLFSSSIAKSTLDERPHELPNSNFELNKVIP
                     QTNICEEAPRLGFVAANTSNIPDPTLPPTEMMARFLHPNWYALPTTMWLKYGEYKSWA
                     PSFKENGTVIDSTTRGIIWLERVGYVEMYRKMEESRNSKSIHSEVNVAENDEKKNNDD
                     LEKVSEEKTDQQMQKLNGENGKSGSTESKKQEFVNGKGAVDNDVATSIPASEAAPDGN
                     KVSEPLLIKLENLLDWSPGNYIDDDEIEHLKNGTHDELVSATLLKIKKLRKLRISRKI
                     SKPSLEEIKAYYKVRRLLKEVLLAKQTRSLPMKHCRSFPVLQANYNGSIPVVRVQPTR
                     KRKSKK"
     gene            complement(<168268..>169695)
                     /locus_tag="HG535_0D00750"
                     /db_xref="GeneID:59236092"
     mRNA            complement(<168268..>169695)
                     /locus_tag="HG535_0D00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288201.1"
                     /db_xref="GeneID:59236092"
     CDS             complement(168268..169695)
                     /locus_tag="HG535_0D00750"
                     /inference="similar to AA sequence:RefSeq:NP_013134.1"
                     /note="similar to Saccharomyces cerevisiae SMF3 (YLR034C);
                     ancestral locus Anc_2.407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144096.1"
                     /db_xref="GeneID:59236092"
                     /translation="MVQENRMRFSMGALVPVLRKFMKFVGPGIMVSVAYMDPGNYSTS
                     VSGGAQYKYALLFAVFISNIFAIVLQCLCIKLGSVTGYDLAENCRRHLPRKVNLMLFA
                     FAEVAIIATDLAEVVGTAIALNILFGLSLNVGVLLTVLDVLVILLFYHQDGHSMKRVR
                     SFEIFVSILVAGTLICFVLELFQISIPNKGDLLKGYLPSSIIFKDKQALYISLGILGA
                     TVMPHSLYLGSSIVKPRLQEHDLKKYGKIQVRPSLNAIKYCLNYSYAELIISLMFVAT
                     FVNSAILIVAGTTLFGKPEAEDADLVSIYNLLVHYISPAAGLIFALAMIFSGQSAGII
                     CTVAGQIVSEGFLEWSLPPWATRLCTRLIAIVPCLFVTLTMGETGISDILNLSQVVLS
                     LILPIVSAPLIYFTANRKIMTVPDVYNDQVDEQTPLNNTGKVNKADFTNSNWLTVVAV
                     SIWALIGGLNCYLVACFILGEDVHF"
     gene            <170448..>174452
                     /locus_tag="HG535_0D00760"
                     /db_xref="GeneID:59236093"
     mRNA            <170448..>174452
                     /locus_tag="HG535_0D00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288202.1"
                     /db_xref="GeneID:59236093"
     CDS             170448..174452
                     /locus_tag="HG535_0D00760"
                     /inference="similar to AA sequence:RefSeq:NP_013848.1"
                     /note="similar to Saccharomyces cerevisiae POM152
                     (YMR129W); ancestral locus Anc_2.406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144097.1"
                     /db_xref="GeneID:59236093"
                     /translation="MDREHLVNANTPRGNHWIGATATSSSYLSPSNADRKRRHIRKRS
                     DGPEDTLGNRPNEGGLGDELAGLKMGQRSELGSGLGLGAGTMASRRSTRRVSSELPLI
                     SPELVEVSRQRALAVLVFAIIQGYKIYDLILLKTGLPVLGLLYSQSRLNFVSKYFIID
                     SFFLYLLPSFKIPKLNFRPWIVMLQIICMTLSTIVLCNDNDFIIVTGLIAIWKKFNTK
                     EMTLAGSSVNFRKVMDTSSHFKGALTIKILPENTAMLNPLQDSYCLPLDTDLLPTGHI
                     SVPIRINSTVDISLVQLEFTDFYTNESELRNLTGKDFKSVSDLTHLLKRDSSIPTHLH
                     DTSSIRYLELPLKEVGFYQIQKIVDSKNLSLKIYTSHLIVPHCPVATISGSGDSNRCI
                     GDPDKVSIDLQGVPPMKLSYSKSINGKSHTYTDSNLVPEFFESPLQSTSKRIFSLEDL
                     KNLKWCKTYPVTINLDLPASQDGKYTYKIDKVVDGLGNTMDFSKIPQNVRRDYDLSYD
                     FNVHGIPKASLEEKFDPKSSTKRSIIVRFEKTQDWESSVPYGVNILFTDENGKSEYLN
                     IATSSLNHEFEAKLPGNYELQSVNSNHCPGVVIGKTSVLVTKPIPPQLVIKSTPILEQ
                     CVGQIGLNFDLTFTGVPPFNYKAFIYKIVNQNRKLYDTKRYTSQGTRNQFSYNPATEG
                     DYEIVFDQLTNHLFTDAISLTPRENYTFKTSMRVKPGAQLRKSTDIKLCLGQQTKIPV
                     SLHGEAPFFLEYDIVETSSNKRTSYEIKDIVGYDHDIVIPKFDVGGSYILSLVSIRDS
                     SGCTVRLSEPDAKIYIRRDVPSASFNLLDNTNESKIKQGSYAEIPLKLAGEGPFYLKY
                     QHLGDDGQVLGIYNNKFDSNYKPALKASKEGYYELVEVKDASCKGYIERKDTRFKVSF
                     LKKPTFEVSDKNKIVKLTESTFAKQEICQGVEGNIDLSLSGSAPFVLNYDIITPNGHV
                     TAKRLPVTTKYATIRLSNEDYGEYVVIIGALYDANYAEDDSTNLDSTSEEVIIKQVVN
                     ALPVVKFSESGKTLKACSTVVNDDATALEQIDLKFTRGKGPFSVTFSIYHESTSRSDL
                     VKLDGITADTFNYQKLYEGLKLGNHIVTIEKVVDANGCINEFIPSQDNFVLISITDVP
                     KIHLLDPSMDYCVGDHVTYQLNGAAPFVIKYEFNGVQLKSKEHSSQFVRLASEPGEIS
                     IASLGDSTSQCIVDFTAPNMQKEHDKLSLHIHEIPSVTVSQGKNLVEDIHEGDQAEII
                     FSFEGNPPFSLTYVRTEEAESSHGKVRPQVVETHKVTDIYAYEYRVLTSLQGTYEAIQ
                     VSDAFCFAKNDAYF"
     gene            complement(<175019..>177085)
                     /locus_tag="HG535_0D00770"
                     /db_xref="GeneID:59236094"
     mRNA            complement(<175019..>177085)
                     /locus_tag="HG535_0D00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288203.1"
                     /db_xref="GeneID:59236094"
     CDS             complement(175019..177085)
                     /locus_tag="HG535_0D00770"
                     /inference="similar to AA sequence:RefSeq:NP_013135.1"
                     /note="similar to Saccharomyces cerevisiae MLH2 (YLR035C);
                     ancestral locus Anc_2.405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144098.1"
                     /db_xref="GeneID:59236094"
                     /translation="MTIIKISNDSRWKIVSSSIVVDPKFAVKELIDNAVDAGAANIYI
                     DVDARTCGCDYICVRDDGLGVPLKDRESLCLNHATSKISSFNDLNQLSTLGFRGEALF
                     SVATLSNQKGSMEITTRTKNDSVGEKWSVNELGEIKNNKRSKVPCPVGTVIVLRRLLA
                     GLRSRCIQVSSKALKNIEEFKTMINHYSLNLRDVRFHFSLVRLENNGKISEKRLQMST
                     VTNITRERALSLIAHLRKPSSLNFIIKEDLEATNLVRLDIILPKTNAECDVVNVKKPK
                     KFFSVNSRVMSLKQGIGKALNKKISDIYRQLQLLEPTVWFINLKCSMEIIDINIEPGK
                     DDVLIKNMNFVMEQVSKVLLSCISLELGIQRQAIDNIDSEGYIQDEPDEPDEAFIEEL
                     RASQNMQNLMCTENGAKVVGTRQDVYQSEKIPIARTKHESISNDTIKELNSELISSKE
                     AERQAIFYKESPTKSQASKGYDSTKSSSLSYNDNNSKSLNEDQKIDRDVHDPNPFPTS
                     KLGRDRHSNIRENGLHETIDLDKMPSIPSSILIRENTTQHNKKRTIDETFSSNGLTKT
                     RRLTGNEESKLLSLQSKPISPRRSSDFNDSTSDNSAEMLSARHNKIERHLSMFSEYTN
                     SFITSIKCDGSIQFQHWEEELPAVNQIKAPSVKLVEAIEVVLNRIIDKETQLTKTKEG
                     WHLLVK"
     gene            <177226..>178131
                     /locus_tag="HG535_0D00780"
                     /db_xref="GeneID:59236095"
     mRNA            <177226..>178131
                     /locus_tag="HG535_0D00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288204.1"
                     /db_xref="GeneID:59236095"
     CDS             177226..178131
                     /locus_tag="HG535_0D00780"
                     /inference="similar to AA sequence:RefSeq:NP_013849.1"
                     /note="similar to Saccharomyces cerevisiae YMR130W;
                     ancestral locus Anc_2.404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144099.1"
                     /db_xref="GeneID:59236095"
                     /translation="MFPKRLSLGNWNASNKPEIPKILTFDAYNTLYATTLPVMEQYCL
                     VGKKYGIEADPKQLTQNFPVVFKALKEEHPNYGKYTNINAKQWWSYLIVNMFKSYKVP
                     NEMIDEILERFEGPNAYIVYPDLLELLNYIKAKHPNVVLGIISNTDPLVYTLIKNIGL
                     FDYFKTHLYLSYDLDIKKPSKEIFQYVFDDIINKHPRMLECSTEAELKKRCWHVGDEA
                     ENDMLGAVMAGWNGILIDRSNKYGYFSGLSSKKKRTDNSISVDKIDHNFEESWSESMK
                     QTDSIQLSENTFVISNYNVLKSIMF"
     gene            complement(178241..178313)
                     /locus_tag="HG535_0Dtrna5A"
                     /db_xref="GeneID:59236657"
     tRNA            complement(178241..178313)
                     /locus_tag="HG535_0Dtrna5A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCA"
                     /db_xref="GeneID:59236657"
     gene            complement(<178780..>179040)
                     /locus_tag="HG535_0D00790"
                     /db_xref="GeneID:59236096"
     mRNA            complement(<178780..>179040)
                     /locus_tag="HG535_0D00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288205.1"
                     /db_xref="GeneID:59236096"
     CDS             complement(178780..179040)
                     /locus_tag="HG535_0D00790"
                     /inference="similar to AA sequence:RefSeq:NP_013139.1"
                     /note="similar to Saccharomyces cerevisiae COX12
                     (YLR038C); ancestral locus Anc_2.403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144100.1"
                     /db_xref="GeneID:59236096"
                     /translation="MSEEQKQAAGSPLHTVGFDARFPNQNQTKHCWQSYVDYYKCVNM
                     KGEDFAPCKVFWRTFSSLCPVDWVEKWDDQRQNGNFAGDINP"
     gene            complement(<179358..>182378)
                     /locus_tag="HG535_0D00800"
                     /db_xref="GeneID:59236097"
     mRNA            complement(<179358..>182378)
                     /locus_tag="HG535_0D00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288206.1"
                     /db_xref="GeneID:59236097"
     CDS             complement(179358..182378)
                     /locus_tag="HG535_0D00800"
                     /inference="similar to AA sequence:RefSeq:NP_013140.1"
                     /note="similar to Saccharomyces cerevisiae RIC1 (YLR039C);
                     ancestral locus Anc_2.402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144101.1"
                     /db_xref="GeneID:59236097"
                     /translation="MTNHLWPLSPPQRSKIGNCISVQDKFALNNNDILQTVTLPQTNV
                     FIMVTPSRILIYNLKPMAHVSSHERTGDSIREFGLNKSMTSSVTLDSAVEGLLSDKQI
                     NNSVWNQGKLVFYVMTDKNFLLTYQILKDSSNMTVFKAFGIPVVDLEKVDEEFEHEYD
                     DSVDDDTLTVFEKNKSSKVIQNGYAITKEQGFLQFLSNNQENLDELPVKKLELRLKVV
                     LKVDYQILDLYAFKRLSEVEEDKAEESLLVLFPHGLQLLTLVDFRLKSTSLVEITHGK
                     RICINQGHLLVVSQDQTSDPYKVTMNHIDMAKQHVEMIPLEGTGTLLNCFTLKGNVAF
                     ASDDTITYYNPTTQQVTYRFQFPFTPKYCCGLNRSTILAVSQKNYIYFYTELGNLLFS
                     NSLEDDNLENATVLDYSAFSYLDMTLIATSHTGEYELWNLWEQSTQNFSDTRSVSPYV
                     LHNTNNDIAIYTPVGDSSLCRDGFQYIKLPTRTINNCVSLIKVNPNMKLTAIYVANKA
                     ILLLYNLETNMWYSFIDITILDMHWIGTSYLLCQIKKDDWSIGLHCFRLRLQDLDTSD
                     IYKYSIWDYELPDSTRIQTIHVNTLSKYKSLKLKARDSDQSDKQEEKYFKTAEINVVT
                     TNNQILRFAVISLIHPIGVNIIRKIYEHGRVNIPNNICSDKIEWLMNFRDGLLYFSEN
                     KLIKAVNVESEQWVFEVLLDHIEKIVDVYIDDIFLICNQKEEFYNMDDLWDKKPPLFS
                     VTLDDDCYPISISPQTATVLGLRCIFHDYYAKFVVKHKIYLDELILTKMEQKVPADKI
                     MTECRPVRYFNFALEKILSTKILENKPLDDIIQIIKLCDIPANYEGSLSKAHSDMLEI
                     VSNCLRKTEIKHWNLLFTSLGMTPRDLLARCLEGNEAKILGVLLIVFLNYDAELVEDL
                     RNNEIDKSEAKDQNGSTNSDGSNPDSSVVDLIRDQEMMLTVLRLLVTSAANTSDSTKA
                     ADSWDMCFQLIRLLKELDKENNTQLIQKALDMFE"
     gene            complement(<182689..>184230)
                     /locus_tag="HG535_0D00810"
                     /db_xref="GeneID:59236098"
     mRNA            complement(<182689..>184230)
                     /locus_tag="HG535_0D00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288207.1"
                     /db_xref="GeneID:59236098"
     CDS             complement(182689..184230)
                     /locus_tag="HG535_0D00810"
                     /inference="similar to AA sequence:RefSeq:NP_013850.1"
                     /note="similar to Saccharomyces cerevisiae RRB1 (YMR131C);
                     ancestral locus Anc_2.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144102.1"
                     /db_xref="GeneID:59236098"
                     /translation="MSKRSLNPEEEQRAVSAKIDAQDVPKTAHTSNEPDIPMGEFEDE
                     YSDEFESDGEIIEVDNEEEFDDEAEGDQIDKKNQNAQALLEQDQANEQEKQELYLPHK
                     SRPLGPDEVLEADPTVYEMLHNVNLPWPCLTIDVIPDSLGSERRSYPQSLLMATATQA
                     SKKKDNELMVLQLSQLNKTLVKGEDDDEADNDDDEDADADPVIENENISLKDTTNRLK
                     VSPFASSAQEVLTASMSENGEVYIFDLAPQTKAFNTPGYQIPKSAKRPMHVVKNHGNV
                     EGYGLDWSPLIKTGALVTGDCSGQIYYTQRHTSKWVTDKQPFTVANNLSVEDLQWSRT
                     ESTVFASCGCDGYIRIWDTRSKKHKPAISAKASSTDVNVISWNEKIGYLLASGDDNGT
                     WGIWDLRQFAPHNSESAQPVAQYDFHKSAITSISFNPLDESIIAVASEDNTVTLWDLS
                     VEADDEEIKQQAAETKELQEIPPQLLFVHWQKEVKDVKWHKQIPGCLLSTGTDGLNIW
                     KTISV"
     gene            complement(<184460..>185071)
                     /locus_tag="HG535_0D00820"
                     /db_xref="GeneID:59236099"
     mRNA            complement(<184460..>185071)
                     /locus_tag="HG535_0D00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288208.1"
                     /db_xref="GeneID:59236099"
     CDS             complement(184460..185071)
                     /locus_tag="HG535_0D00820"
                     /inference="similar to AA sequence:RefSeq:NP_013851.1"
                     /note="similar to Saccharomyces cerevisiae JLP2 (YMR132C);
                     ancestral locus Anc_2.400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144103.1"
                     /db_xref="GeneID:59236099"
                     /translation="MVYFYQSQPEGSLRSYQVVTGKDKFENDLLIKWGYRELGYVWFH
                     VDNYSSGHIYLKLFADEKSIADVPQEVVNDCLQLCKSESIQGNKMSHCTILCTPWHNL
                     RKSKDFKPGEVSFKSLQRCQKLVCHGRDQKLLNRLAKTRVELFEDVEETLHRAKKTKD
                     GDFFLNYIQVMKERLLEEEKERKRLKKLSKKREISRENIHQDV"
     gene            <185299..>186582
                     /locus_tag="HG535_0D00830"
                     /db_xref="GeneID:59236100"
     mRNA            <185299..>186582
                     /locus_tag="HG535_0D00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288209.1"
                     /db_xref="GeneID:59236100"
     CDS             185299..186582
                     /locus_tag="HG535_0D00830"
                     /inference="similar to AA sequence:RefSeq:NP_013852.1"
                     /note="similar to Saccharomyces cerevisiae REC114
                     (YMR133W); ancestral locus Anc_2.399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144104.1"
                     /db_xref="GeneID:59236100"
                     /translation="MKEYFSMQVKTYSAYAKLAQAPFGFQMPCKPTDAKAWYHIPTGN
                     IKFAIFEAESGCLIIKVEKDGIIMEIASVDIFGSDKYIQFSARSPSISCKYIVRQGIN
                     LFIKRFQIAFHDEKDFAKTCSTLSYLRFVVKNARPSIPLNNAVHNSQLPSDMREKLPY
                     KSNQFSQTTQIYQTPSILPCEDERKDLNDALNPISSQQALLYDSFSQNSEQYQTIQGI
                     VGTTEAGHTNVTLSAKQSISRCLEPAGTDNGTDLGVTLVDEPSDKEIPGLKSKMEAAL
                     STRQSEDHYEPTEVPDEPENTRFLPAYTTKGLGKSIESALPTASANPTLPVSEPNATR
                     QPIVPAQCEKKEIRPGERLHKESMEKPIEQSLGKTNPIMARTEVKKGLPKVSITKRII
                     AQKMKDENFMKWVKKVESSMLEMSKTEKEKYNTKS"
     gene            complement(<186591..>187244)
                     /locus_tag="HG535_0D00850"
                     /db_xref="GeneID:59236101"
     mRNA            complement(<186591..>187244)
                     /locus_tag="HG535_0D00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288210.1"
                     /db_xref="GeneID:59236101"
     CDS             complement(186591..187244)
                     /locus_tag="HG535_0D00850"
                     /inference="similar to AA sequence:RefSeq:NP_013141.1"
                     /note="similar to Saccharomyces cerevisiae YLR040C;
                     ancestral locus Anc_2.398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144105.1"
                     /db_xref="GeneID:59236101"
                     /translation="MPLKICNMRLIAIFLTLSMCNALTESSMTASSAQLAAASANMGF
                     YSIFFFDYNYNQPQYSSYMSQHSMTLPQDVKNYFFHLQALPGTADLAEDVAENFPFTT
                     FNTFISAFPWYSTLLSDASMSTLYLPQYFVTDATTATQNEITATQSQPSITANFANST
                     SRVSSSLHSAAANITQSIDSTTSVARTSSGSSFSENRGHICQWSLSSIFLILMSLLL"
     gene            complement(<188743..>189198)
                     /locus_tag="HG535_0D00860"
                     /db_xref="GeneID:59236102"
     mRNA            complement(<188743..>189198)
                     /locus_tag="HG535_0D00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288211.1"
                     /db_xref="GeneID:59236102"
     CDS             complement(188743..189198)
                     /locus_tag="HG535_0D00860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144106.1"
                     /db_xref="GeneID:59236102"
                     /translation="MQYLYLIAVMCVVRFSCCSLIQKRADSSLGGSASQTGSVSTVYS
                     FLGASGSDTSLLQMPTSAISLTSATMSGTVDESSALSQFLNGAGTATMTSAAVTGGSR
                     APPSNSSDEASSASVSSSSMASVTLSAGANSLGLPLVAGGVLAGLLALI"
     gene            <190805..>191509
                     /locus_tag="HG535_0D00870"
                     /db_xref="GeneID:59236103"
     mRNA            <190805..>191509
                     /locus_tag="HG535_0D00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288212.1"
                     /db_xref="GeneID:59236103"
     CDS             190805..191509
                     /locus_tag="HG535_0D00870"
                     /inference="similar to AA sequence:RefSeq:NP_013853.1"
                     /note="similar to Saccharomyces cerevisiae YMR134W;
                     ancestral locus Anc_2.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144107.1"
                     /db_xref="GeneID:59236103"
                     /translation="MGFGARYLELESRILDRLSQTRYIQEVIHDTISGRITLFLMVVG
                     TIAFFNELYITIEMSFLQKETYEELNKGYIDESLKLHKMIVSDEYHGREYMDEKSGIV
                     IEEFEEREKFFAKPVHVAHLYVVCNILKDENPILSTPLQFHIEFSPEEYEGEKRLEFG
                     CRLKVLRTKLYHLFKDSPLYDDLVENGSNFTVSKNVRIYNTLDELLPTTIDAVQLCFL
                     KMETGDKIKCNFVIDN"
     gene            complement(<191520..>192764)
                     /locus_tag="HG535_0D00880"
                     /db_xref="GeneID:59236104"
     mRNA            complement(<191520..>192764)
                     /locus_tag="HG535_0D00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288213.1"
                     /db_xref="GeneID:59236104"
     CDS             complement(191520..192764)
                     /locus_tag="HG535_0D00880"
                     /inference="similar to AA sequence:RefSeq:NP_013854.1"
                     /note="similar to Saccharomyces cerevisiae GID8 (YMR135C);
                     ancestral locus Anc_2.396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144108.1"
                     /db_xref="GeneID:59236104"
                     /translation="MSNGGKVYEKKTFSREEWSEQVLRSMLPMSGSEMYGTSNNARAA
                     VSKDFASTTSFHEPSIPKLLLNYFVCMPYEEASVRMARELGYVKTNKDAIEFNNLYKI
                     GERAYIVELIKKGNISEAMEEINSTFGIEVLERNSDLGSRSGTTGNYESSTRSLSNSN
                     NGKEDLHFKLLLLNLIEMIRAHDKEKRTNESAEDSDEFVLKLIQYSQEKLALKASSNR
                     SYMAEVELVMTLLLFPMDNKFKIKKPKSLKNLYSLSLRTKIADLVNRKILSHIHSEVE
                     ARCAKDNKFPNLIGSDKGIINKQSSAISEVLMVRPKEDIGLNLKTEKVADIRDSPDGV
                     LKSSPSVSEDWANTVDMIKTGQKSSKSVSGLSDSDPSVDDFDLSEYQYEPRLVQVMKL
                     WAWCENQLHNNDIGVPRVGSNT"
     gene            <194150..>195847
                     /locus_tag="HG535_0D00890"
                     /db_xref="GeneID:59236105"
     mRNA            <194150..>195847
                     /locus_tag="HG535_0D00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288214.1"
                     /db_xref="GeneID:59236105"
     CDS             194150..195847
                     /locus_tag="HG535_0D00890"
                     /inference="similar to AA sequence:RefSeq:NP_013856.1"
                     /note="similar to Saccharomyces cerevisiae GAT2 (YMR136W);
                     ancestral locus Anc_2.395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144109.1"
                     /db_xref="GeneID:59236105"
                     /translation="MCATKMSCVRIQEMSASNMENNHSAEKEARGKGVRKFKGLDTSG
                     RSTSNRQSLLRRSDRSSERDAERDARTISVPNLLNLGNEQRVTRVGDAAIKGGESGTH
                     AGEDVLRVPQEYTENSFVVSSMSQSAYQAARAQRKSSVDSLMRAAVTVERNDQDLRKM
                     HQNQINSIIDFKNQISDEIQSWPNTGHTSQENAIRSSTEAMKDFTFTDMSSENLDSLK
                     HVANTLHATVKQLDELKRQQRPNEDFNRQRIRLPSIDMMTSNIGSNPQAGLRNYQFPN
                     DEFNRNPRPSNRHLESQFIASSSASSSSSIHQPVTSYVQAHPHNSGNYVSFTGPMTNV
                     SPRINHRATISDPSSAYRSSMMKERQNSATCSNWPLLPFYPLAPSSSSSSSSCPIVFQ
                     PPYSSNDSSADSSRQNAAENSIGKRKLESKDQKINMRTQRSSSENSVFQNRQALAHGL
                     LMAENIKRNQQSTTSCIHCGEASTPEWRRGPYGNRTLCNACGLFYRKLVKRFGNKDTN
                     MFMRYRKSTNPEDRRVPSIAEVPKSIQQELDNDKNLDGEYFTIGGTNANFIFSENKK"
     gene            complement(<196161..>198131)
                     /locus_tag="HG535_0D00900"
                     /db_xref="GeneID:59236106"
     mRNA            complement(<196161..>198131)
                     /locus_tag="HG535_0D00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288215.1"
                     /db_xref="GeneID:59236106"
     CDS             complement(196161..198131)
                     /locus_tag="HG535_0D00900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144110.1"
                     /db_xref="GeneID:59236106"
                     /translation="MVSSVKDEAAIAVDIEDHSSASVKWEGRDYANDTYLNPSSQAGD
                     LEKADPLGDEVARQKAQELEQENGNGNNGQSHLGHAYPQGFVLYACVISLVLSLFLAA
                     LDIMIVATLIEDVARQFHDYSNTGWIFSGYTLPNAVLCLLWGRIAAVIGFKSSMLASI
                     FIFEIGSLISGVATSLNMLIGGRVVSGIGGSGIQSLVFVIAFSLVEERKKGIVIAFLS
                     SAFGLSSVAGPFIGGAFTSHVTWRWCFYINLPIGGLAFTVFVLFYNPTGERKTVVSIV
                     KDFFTNSYANMKKLKCLAKFKTWKFIVHSLIFQFDIIECIICSAGLVLVLIAFSFGGN
                     KYRWDSGNIIAMFVIGILLIIFALVYDFAIFPRFKTVRGNVQYQPLMKWENFKKPGIF
                     TANSAVFFQSITFSIQMVYLVQFFQLVYNDTAWNAAVHLLAAAIPTVISVMFSGVLNS
                     KTGYIKPITVVGGIFSVVGAGALTRLNNHSTNSQHIGLLILPGLAFGAILQSSMLGCQ
                     NQVDKNSPTARIDFISVVTLNNFLKVLGQAFGGIVCETVFSASILNKLKQHNIQLGTE
                     STVNELIIYRGTHFDGATSLMGDLISQSIVDVFYMALGCAALAFISGVLTSNKKNDVR
                     KHPPSPSPTSNQKSDHSSASVAPSKETSSIAS"
     gene            complement(<198799..>200583)
                     /locus_tag="HG535_0D00910"
                     /db_xref="GeneID:59236107"
     mRNA            complement(<198799..>200583)
                     /locus_tag="HG535_0D00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288216.1"
                     /db_xref="GeneID:59236107"
     CDS             complement(198799..200583)
                     /locus_tag="HG535_0D00910"
                     /inference="similar to AA sequence:RefSeq:NP_013857.1"
                     /note="similar to Saccharomyces cerevisiae PSO2 (YMR137C);
                     ancestral locus Anc_2.394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144111.1"
                     /db_xref="GeneID:59236107"
                     /translation="MSKRSRSIVEIKRSDIKWKNGGRVLRETKKQRKLFEFDIPTAPS
                     LNVREKSFDNTSMEKQDLIVIEDDDEDSADDDKERRNRGCIDTSAAAKLEEVEVIELL
                     HDDSDVYAPEASPSSTSSVFKEVKKVEGEPVTCPLCSKDLTDWENYQREAHAENCLEK
                     SNDSNTSIARTSKKRAVIRPPLPQIKVLEFSNKHKIVVDGFNFDRKPDITQYFLSHFH
                     ADHYMGLKKSWDNGSIYGSQVTINLMLQKFNIPRDLVRILPMNVETWFEPTISVIPLD
                     ANHCPGATVFLFQEWDTTRTKTVKQILHTGDFRSNDSLVTKLNDICVTPIDQVYLDTT
                     YLIPGFHFPHQKSVLKVSADFCLQIIKQGKSKLFNDTQRSIFNFRLVVKPQKYLYKCL
                     FLVGTYTIGKERLAISIAQALGTKIYVPKGTPRCRIISQYLDYFPPHLISHNLEECCV
                     HLVPLSVLHSKETIDQYFKPFTSIYQDLVGFIPTGWTYTNKYAIDLNFADTAQRIAYC
                     RQVLNDDATDRLDVQFILKQYKRHAKYQVFRVPYSEHSSFKDLVRFGTSVNYKQMLAT
                     VNLHSLDKIRDMNEWFKAWQTIAHSHAT"
     gene            <200735..>201313
                     /locus_tag="HG535_0D00920"
                     /db_xref="GeneID:59236108"
     mRNA            <200735..>201313
                     /locus_tag="HG535_0D00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288217.1"
                     /db_xref="GeneID:59236108"
     CDS             200735..201313
                     /locus_tag="HG535_0D00920"
                     /inference="similar to AA sequence:RefSeq:NP_013858.1"
                     /note="similar to Saccharomyces cerevisiae CIN4 (YMR138W);
                     ancestral locus Anc_2.393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144112.1"
                     /db_xref="GeneID:59236108"
                     /translation="MGLLTIIKKQKLKDKEIRCLILGLDNSGKSTIVNKLLPENEKDD
                     EISPTVGFQIHTLEYNTDSQRYQIALWDVGGQTTLRPFWDNYFDRTDVLIWCIDASLP
                     LRFSESFKELKCFLLRDEGRIGYDCQVIIAMNKMDLLQDARALDEIKTTITKQLGSMI
                     PIVFVGCSGLTGEGLSELLSTIVSKREHMYMM"
     gene            <201545..>202570
                     /locus_tag="HG535_0D00930"
                     /db_xref="GeneID:59236109"
     mRNA            <201545..>202570
                     /locus_tag="HG535_0D00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288218.1"
                     /db_xref="GeneID:59236109"
     CDS             201545..202570
                     /locus_tag="HG535_0D00930"
                     /inference="similar to AA sequence:RefSeq:NP_010205.1"
                     /note="similar to Saccharomyces cerevisiae MDH3 (YDL078C);
                     ancestral locus Anc_2.392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144113.1"
                     /db_xref="GeneID:59236109"
                     /translation="MVKVCVVGASGGIGQPLSLLLKLNPYVSELALYDVRLAPGVAQD
                     LSHINTNSNVTGYSKDDIEGALKGSQVVVIPAGVPRKPGMSRDDLFKINAGIIKGIVT
                     SIGEYAPNSRILIISNPVNSTVPIAVEQLKAMGKLQPGNVMGVTTLDIVRAETFLVDY
                     LANVKKSPTRQYDKTAISKEVTVIGGHSGKTIVPVVRNELYIDSLQDQYAEFIHRVQF
                     GGDEVVKAKDGAGSATLSMALAGYRFTETILRSIHREATTPIPTFVYLPGISNGRQIQ
                     KKLRNEALEYFSLPVRLVDGRVSAIDASVLDHLSAKEQEMVHTAIQELLGSIDKGKKF
                     VIGSSKL"
     gene            <202889..>203506
                     /locus_tag="HG535_0D00940"
                     /db_xref="GeneID:59236110"
     mRNA            <202889..>203506
                     /locus_tag="HG535_0D00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288219.1"
                     /db_xref="GeneID:59236110"
     CDS             202889..203506
                     /locus_tag="HG535_0D00940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144114.1"
                     /db_xref="GeneID:59236110"
                     /translation="MNRSTYIYILVSSPWLKQRTDKTDKRVPKWSRIGSESQSGPIMS
                     AVLRKLSIGISAFQIKGKKDSARSDFVGKVEVQIDVGAPNNNLEYIKSIEKLIVLKLV
                     EPTEHIEDVRVGGQSGNDNTIIKATGKESTNNVGNAGNARNTKNVKTTKATRTTKSTS
                     TRLNREKIRRMIEFDEPCDPDRANANDLETSDSEKRSKKQGMYIF"
     gene            <203599..>204207
                     /locus_tag="HG535_0D00950"
                     /db_xref="GeneID:59236111"
     mRNA            <203599..>204207
                     /locus_tag="HG535_0D00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288220.1"
                     /db_xref="GeneID:59236111"
     CDS             203599..204207
                     /locus_tag="HG535_0D00950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144115.1"
                     /db_xref="GeneID:59236111"
                     /translation="MPPGPAPAEARRRTTCHGVVGVRSEKGVRVVVAASGYSVAEGGR
                     RAGARSVGLLLVGRQEPEAKRDEATLSNSKLSDQEGCNCTKAAKARGHKTRLNTQTRL
                     SRRCSRFHASPLHASPVQTASDCSQRHKHETGPPHISGTRRTQNAESQGTRGTQRTQG
                     IQRAQRARQRYGTGSVTRTLAAFRCFHRLTRQFEVVVRITHS"
     gene            <204233..>205330
                     /locus_tag="HG535_0D00960"
                     /db_xref="GeneID:59236112"
     mRNA            <204233..>205330
                     /locus_tag="HG535_0D00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288221.1"
                     /db_xref="GeneID:59236112"
     CDS             204233..205330
                     /locus_tag="HG535_0D00960"
                     /inference="similar to AA sequence:RefSeq:NP_010204.1"
                     /note="similar to Saccharomyces cerevisiae MRK1 (YDL079C)
                     and RIM11 (YMR139W); ancestral locus Anc_2.391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144116.1"
                     /db_xref="GeneID:59236112"
                     /translation="MNVSELTNQAIVQKQVYYGHPNEQGTNEPIQISYPTTEVVGHGS
                     FGVVFTTTIEETNEMVAIKKVLQDRRFKNRELEIMKLLKHKNIIDLKYYFYEKDTQGE
                     VYLNLILDFMPQSLYQRLRHFVHQQSVMPRLEIKCYMYQLFKALNYLHHHTNVCHRDI
                     KPQNLLVNPNNWELKLCDFGSAKQLKPSEPNVSYICSRYYRAPELIFGATNYTNQIDV
                     WSSACVMAELLLGQPMFPGESGIDQLVEIIKILGTPSKQEICAMNPNYMEHKFPQIKP
                     IPLNKVFKKEDDSTVEFLNNMLRYDPLERFNSLQCLCSTYFDELRYSQDNLREIVNNL
                     DLLHFDYQTELGHLTNDQLAAVKLKLMPNII"
     gene            <205617..>207446
                     /locus_tag="HG535_0D00970"
                     /db_xref="GeneID:59236113"
     mRNA            <205617..>207446
                     /locus_tag="HG535_0D00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288222.1"
                     /db_xref="GeneID:59236113"
     CDS             205617..207446
                     /locus_tag="HG535_0D00970"
                     /inference="similar to AA sequence:RefSeq:NP_010203.1"
                     /note="similar to Saccharomyces cerevisiae THI3 (YDL080C);
                     ancestral locus Anc_2.390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144117.1"
                     /db_xref="GeneID:59236113"
                     /translation="MNYTQSNGLPEYITLSEYLFHRLKQLNIETIFGLPGAFNTALID
                     KLYTVLNLRWAGNTNELNAAYATDGYSRLKGLGCLVTTFGVGELSAVNGIAGSYAEHV
                     GILHVVGMPPTSAQTKQLLLHHTLGNGDYNVYSRMASEITANTRLISDTELCAEHVDQ
                     SICTAWIQQKPVYLGIPINLNDTPVESKKLNYALNIQAPTNNPVVENEVIEQILNKIY
                     KAKNPVIISDACVTRHRLIKQTQEFCERTKFPVFATPMSKGSIDESLMSFGGVFMGSI
                     SSPDVREVVDFADVLIVIGCLLSDFNTSSFHFAYKTKDNVLIYPTCVKLKNSTYPDLY
                     IESLMKALLFALDESRITYTATHPQRMIVPRSELPNRHSLRQEWIWNQISHWFREGDI
                     IITETGTSSFGINQTKFPHGSSGISQPLWGSVGYSLGACLGASFALQELKLNQLNPFP
                     SRVILFVGDGAFQLTVQELSTIIRWGLTPYIFILNNQGYSVDRFLHHRSNASYYDIQS
                     WDYLRLLPTFGATSYETKKVVTVGDFLQMIHDPGFSKDDKIRLLEIMLPPMDVPQALM
                     DKWLTEQETKKRTGSESDISTPSSQISIKRIKPENLMLADNDI"
     gene            <208050..>209468
                     /locus_tag="HG535_0D00980"
                     /db_xref="GeneID:59236114"
     mRNA            <208050..>209468
                     /locus_tag="HG535_0D00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288223.1"
                     /db_xref="GeneID:59236114"
     CDS             208050..209468
                     /locus_tag="HG535_0D00980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144118.1"
                     /db_xref="GeneID:59236114"
                     /translation="MTVETAQLESNLFHSLIAEKKIYASNGKGVYMTIEKNGKVYDGV
                     VDAVTGAAVGALGWADPDVPGIVNEALKKHTYSFPGFICNQQAEKLAQFYIKNCPEGV
                     FASALWTCSGSESNENALKIIRQYQKERGRPQKIKVISRENSYHGFTLGASSISDNAI
                     SEGFKDIMIDQKELCLKMPRCFPYRDMRAGETEEQYTQRLLEVLEQMIIDNDPETVSA
                     VIVETLPGSSIGTAVPPKGYLKGLRDICNKYDVLFMLDEVMCGTGRCNPNGKLNCWEN
                     FLAPEDAPDIQTVGKTLGSGYVTIAGVLVGPKIVNAYIGGSGLVIGAQTYHSHALNCA
                     VSLGIQEKIIREGLTANIFKNGNLMGQKLKDALLNDSNSIVGDVRGLGGFWTVQLVKN
                     KETKESFPYDLQVASLFNDIALQNGLNIMGLTNTDLAGSWDIALYAPSFIITEDDVDT
                     IVDRTVKSVAQLQSDLKKAGSL"
     gene            <210265..>211689
                     /locus_tag="HG535_0D00990"
                     /db_xref="GeneID:59236115"
     mRNA            <210265..>211689
                     /locus_tag="HG535_0D00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288224.1"
                     /db_xref="GeneID:59236115"
     CDS             210265..211689
                     /locus_tag="HG535_0D00990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144119.1"
                     /db_xref="GeneID:59236115"
                     /translation="MTTSTVKEYKSAVFQGQVGKEKAFAKNGKGVYMTVEKNGKEYSG
                     IIDAISGAAVASLGWGDEDVYDIIQDAARKHTYSYPAYVTNQEAEKLAKFYIENSAPG
                     AFASCLWTCSGSESTENALKIMRQYQLERNMPKKVKMISRECSYHGFTMGAMSVGNTP
                     RGAPFKDLMIDQENVCIKMPRCYPYRDMKEGETEEEYGKRLVDTLEKIILDNDPDTIC
                     SVIVETVSGSSVGTPVPPKGYLKGLRDICNKYDVLFMLDEVMCGTGRCNPNGKLNCWE
                     NFLAPEDAPDIQTVGKTLGSGYVTIAGVLVSPKVLDVFISGSGTILGAQTYHSHALNC
                     ATALGIQEKIKREGLTANVFKNGNLMGKMLKEALLSDETNIVGDVRGIGGFWTIELVK
                     NKQTKEPFAPSLKIASRFSDIALECGANVMGIAGADNYGGTWDIICLGPAFIITEEEV
                     KLLVERLLKAVKTLSKQLKQEGAY"
     gene            <212200..>213789
                     /locus_tag="HG535_0D01000"
                     /db_xref="GeneID:59236116"
     mRNA            <212200..>213789
                     /locus_tag="HG535_0D01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288225.1"
                     /db_xref="GeneID:59236116"
     CDS             212200..213789
                     /locus_tag="HG535_0D01000"
                     /inference="similar to AA sequence:RefSeq:NP_013860.1"
                     /note="similar to Saccharomyces cerevisiae SIP5 (YMR140W);
                     ancestral locus Anc_2.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144120.1"
                     /db_xref="GeneID:59236116"
                     /translation="MGNVPAKLDEQSSYSQYDSGSFKSGSGRSMSASASSGNRNMSEN
                     AENTVVRSRRGTSLVGNILSASGRARADSAGGGSSVPYKKKSTKEREQMKENHAKELI
                     ARYDECVDGGFLAPYGCYGPDKLDFNAEIVKQLIIGRKLAPFYIPLQDFDESWTKEEL
                     IKIVDGLPLHEPFIENPEEFEDVPVGNIRKQNFEDLIDKSLSKREQRRLRSKIFKARL
                     HRKRIIWQEMENEVYLEQKLESKQKGPAPKNNQWLMSDDLKYSLYKNGMECPICFLYF
                     PKPLNYSRCCLQPICTECFVQIKRADPHFPHDEVDPTKPVTDDDDKDPNLLTSEPANC
                     VYCATSNFGVTYEPPTDRRVGIGGIPPATFKKKSDERNDKKNDDEDDRSDEESNQDSN
                     DRKVNSDTAETPRRRGSRSHDDPLVVSSDTIRPDWSTKLNKERMRLAKRSATATAIHV
                     SNQLVDPQHPSRRGSGTDLESGSYGYSNSSWSQSSRPRASSMLDPGIREAENEMIQQA
                     IRLSLADEKQRKKNKANAKSH"
     gene            <214187..>214510
                     /locus_tag="HG535_0D01010"
                     /db_xref="GeneID:59236117"
     mRNA            <214187..>214510
                     /locus_tag="HG535_0D01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288226.1"
                     /db_xref="GeneID:59236117"
     CDS             214187..214510
                     /locus_tag="HG535_0D01010"
                     /inference="similar to AA sequence:RefSeq:NP_010202.1"
                     /note="similar to Saccharomyces cerevisiae RPP1A
                     (YDL081C); ancestral locus Anc_2.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144121.1"
                     /db_xref="GeneID:59236117"
                     /translation="MSTESALSYAALILADADVQISADKLLTLTGAANVQVEGIWADI
                     FAKALEGQNLKDLLVSFSAGSGAVAATGAAGAASGEAGAEAEEEKEEEEKEESDDDMG
                     FGLFD"
     gene            complement(<214916..>215830)
                     /locus_tag="HG535_0D01020"
                     /db_xref="GeneID:59236118"
     mRNA            complement(join(<214916..215505,215827..>215830))
                     /locus_tag="HG535_0D01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288227.1"
                     /db_xref="GeneID:59236118"
     CDS             complement(join(214916..215505,215827..215830))
                     /locus_tag="HG535_0D01020"
                     /inference="similar to AA sequence:RefSeq:NP_010201.1"
                     /note="similar to Saccharomyces cerevisiae RPL13A
                     (YDL082W) and RPL13B (YMR142C); ancestral locus Anc_2.387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144122.1"
                     /db_xref="GeneID:59236118"
                     /translation="MAIHKNLPILKNHFRKNWQERVKVHFDQAGKKSSRRTARAVKAA
                     KVAPKPLDLLRPVVRAPTVKYNRKVRAGRGFTFGEVKAAGLTPAYARTIGIAVDHRRQ
                     NRNQAIFDANVQRLKEYQSKIIVFPRKGKIEAEQVASAAAAFPIVQPAVDVETRAVED
                     NGSAFKTLRSAANDKKYKGIREKRAREKAEAEAEKKK"
     gene            <216877..>217686
                     /locus_tag="HG535_0D01030"
                     /db_xref="GeneID:59236119"
     mRNA            join(<216877..216900,217279..>217686)
                     /locus_tag="HG535_0D01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288228.1"
                     /db_xref="GeneID:59236119"
     CDS             join(216877..216900,217279..217686)
                     /locus_tag="HG535_0D01030"
                     /inference="similar to AA sequence:RefSeq:NP_010200.1"
                     /note="similar to Saccharomyces cerevisiae RPS16B
                     (YDL083C) and RPS16A (YMR143W); ancestral locus Anc_2.386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144123.1"
                     /db_xref="GeneID:59236119"
                     /translation="MSAVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEIL
                     RFKVYEPLVLVGLDKFAKIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
                     NELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR"
     gene            <218155..>219261
                     /locus_tag="HG535_0D01040"
                     /db_xref="GeneID:59236120"
     mRNA            <218155..>219261
                     /locus_tag="HG535_0D01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288229.1"
                     /db_xref="GeneID:59236120"
     CDS             218155..219261
                     /locus_tag="HG535_0D01040"
                     /inference="similar to AA sequence:RefSeq:NP_013864.1"
                     /note="similar to Saccharomyces cerevisiae YMR144W;
                     ancestral locus Anc_2.385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144124.1"
                     /db_xref="GeneID:59236120"
                     /translation="MVDTIVDEKPLTAKDSRAFIDNSEHGGADNDCDAKNDKLRVAIL
                     RARRLIHELSSHVMRSPMEETKFPLANKHSEVTCYDHNSHLNETTQFKDRLPTKEDIL
                     NVSTPERAAIFPESIGISGHDIISDKDVLITVSSLVNALDDSLRQIQQLKFKNMLIES
                     NSNNIQSTFEVEENLRKQQFERMKCQLLLDKQELIETLHFKEGKIAKYKNRIVEKNRL
                     INKLMRTLNENSIHDNLKFGDFESSRKSSMSSANRSISKDKTYDMLKTLGLLASQVLN
                     DEIDEDSNQTIQQPSEITGGDCNATEIDITSNSISRVEKDIQLPTIEFLADSKSVSGT
                     PIEKSVLNDSSSPHIELPKMKNFSTVDGTVKDIN"
     gene            complement(<219554..>220891)
                     /locus_tag="HG535_0D01050"
                     /db_xref="GeneID:59236121"
     mRNA            complement(<219554..>220891)
                     /locus_tag="HG535_0D01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288230.1"
                     /db_xref="GeneID:59236121"
     CDS             complement(219554..220891)
                     /locus_tag="HG535_0D01050"
                     /inference="similar to AA sequence:RefSeq:NP_010199.1"
                     /note="similar to Saccharomyces cerevisiae SUB2 (YDL084W);
                     ancestral locus Anc_2.384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144125.1"
                     /db_xref="GeneID:59236121"
                     /translation="MSNEGEEDLLEYSDNEQEIQVDNGAANGEAGDESGATSGAVGDA
                     AAGDSDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVL
                     CQAKSGLGKTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVK
                     TAVFYGGTPIGKDAELLKNKEAAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDK
                     VLEELDMRRDVQDIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLT
                     LHGLQQYYIKLEEREKNRKLAQLLDDLEFNQVIIFVKSTSRANELTKLLNASNFPAIT
                     VHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHR
                     VGRAGRFGTKGLAISFVSSKEDEEVLNKIQERFDVKIAEFPEEGIDPSTYLNN"
     gene            complement(<221293..>223446)
                     /locus_tag="HG535_0D01060"
                     /db_xref="GeneID:59236122"
     mRNA            complement(<221293..>223446)
                     /locus_tag="HG535_0D01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288231.1"
                     /db_xref="GeneID:59236122"
     CDS             complement(221293..223446)
                     /locus_tag="HG535_0D01060"
                     /note="ancestral locus Anc_2.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144126.1"
                     /db_xref="GeneID:59236122"
                     /translation="MAIENAADRVLKLPLGSPFNTNEPQDHDHSHDDQHDHHGADLDS
                     QRQHQHSHDQEDSEQYDTVSLSESVPPAFGGVTDDSLVHNGTEGEKNTPVKKHQDSSL
                     TAAAAAAVASIQDVWSENFNEPLPTNKEERIQQALEFMNSEKQAHGSDKNIKKHSIRQ
                     IALFFQVPKSTLYDRLKSKSNDLNANSIIKLLPPHNSSPKPHALSASRSHQQQMKLSI
                     EKEDILLSEVRNLSHAYGNTLNYTQIREFIMSFVNGISLGKKWIHNFTRRHDEFIVYG
                     TYNSRFNVKMKRSKSCRCDFDYLWRCFIPLLQEKIRSLPQDKPFYYITRTCIHQSSMS
                     SVFTCFEIIPNEMSIKSIMPPKLLIFPDYFGKIYLHQNQYQNRSKMINDNNNNNSSNN
                     DIDNNENKNDGENDMRNSHGNENNEESNGREEFKQNSLHSDMNNNNSNNSNSNNDNNI
                     NENNLPEELSDHSSRINKQEKKYGHFKIDKLNEAFAKIYAECCQSASNSEIPFVVFEG
                     FDDRYNWNALFCKDMVQTDRFLSLPWNQQLFQQNVSTSLRGVIDATTESSSIAAIESS
                     SYETDLTDENLSLDIFEQEFQHIINLHTELLNSNEAHEHDSVQLNDLNVFEPALHAAA
                     AAAAAAAATSSSTASLNTDIEPQHGSFGKTSQQSRMENVTSANIFENSTISQLQDVIS
                     MIDNNESQLYGDLVNSNSKTTLMTIFNKIKGIVPQ"
     gene            complement(<223952..>225571)
                     /locus_tag="HG535_0D01070"
                     /db_xref="GeneID:59236123"
     mRNA            complement(<223952..>225571)
                     /locus_tag="HG535_0D01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288232.1"
                     /db_xref="GeneID:59236123"
     CDS             complement(223952..225571)
                     /locus_tag="HG535_0D01070"
                     /inference="similar to AA sequence:RefSeq:NP_010198.1"
                     /note="similar to Saccharomyces cerevisiae NDE2 (YDL085W)
                     and NDE1 (YMR145C); ancestral locus Anc_2.382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144127.1"
                     /db_xref="GeneID:59236123"
                     /translation="MFSQSVRLLELRSSRATVAKRFFGSGLRLLQEQAVKPVASEPSV
                     FRRAGKALLKVSLYSGLLGTGYLSYQLYKEKHPAPQTPQSATFVNGSPRKTLVILGTG
                     WGSISLLKNLDTSLYNVIVVSPRNYFLFTPLLPSTPVGTIELKSIVEPVRSIARRVPG
                     EVHYYEAEALDIDPENKTVKIKSVNKEHEYQLDLKFDYLVNGVGAQPTTFGIPGVFEN
                     ASFLKEISDAQEIRMKIMTSVEKAASLPPTDPERERLLSFVVVGGGPTGVEFAAELRD
                     YVDQDLSKWMPGLSSEIKVTLVEALPNILNMFDKSLVDYAEQLFKQDRIDLRIKTMVK
                     NVTKTTITAKCGDENEDIPYSVLVWATGNAPREVSKNLMQKLEVQDSRRGLLIDDKLQ
                     LLGAQGSIFAVGDCTFYPGLFPTAQVAHQEGEYLASVFKKLYKIDQLKWQAAQKNDAD
                     DSKIQNRISKIQAQIVPFKYHHMGALAYIGSDKAIADLAVGDSMYRSAGSFTFLFWKS
                     AYLAMCMSFRNRVLVAMDWAKVYFLGRDSSV"
     gene            <226964..>227158
                     /locus_tag="HG535_0D01080"
                     /db_xref="GeneID:59236124"
     mRNA            <226964..>227158
                     /locus_tag="HG535_0D01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288233.1"
                     /db_xref="GeneID:59236124"
     CDS             226964..227158
                     /locus_tag="HG535_0D01080"
                     /inference="similar to AA sequence:RefSeq:NP_075208.1"
                     /note="similar to Saccharomyces cerevisiae YDL085C-A;
                     ancestral locus Anc_2.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144128.1"
                     /db_xref="GeneID:59236124"
                     /translation="MARGNQRDLARQKNLKKQQDNAKSQKKAGDPKKRMESDAEILRQ
                     KQAAANARKEAEAAGPKSKK"
     gene            complement(<227247..>228290)
                     /locus_tag="HG535_0D01090"
                     /db_xref="GeneID:59236125"
     mRNA            complement(<227247..>228290)
                     /locus_tag="HG535_0D01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288234.1"
                     /db_xref="GeneID:59236125"
     CDS             complement(227247..228290)
                     /locus_tag="HG535_0D01090"
                     /inference="similar to AA sequence:RefSeq:NP_013866.1"
                     /note="similar to Saccharomyces cerevisiae TIF34
                     (YMR146C); ancestral locus Anc_2.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144129.1"
                     /db_xref="GeneID:59236125"
                     /translation="MRPIMLVGHERPLTQVKYNYEGDLVFTCSKDNIASVWFSVNGER
                     LGTLEGHTGSIWSIDVDKFTECCVTGSADYSIKVWRVSNGENVYTWKSPVPVKRVEFS
                     PCGNYVLAVLDDVMKYQGSINVYEVKRNPETNEIIEFVEEPVHCIMTQEGLAAVTVAG
                     WSTEGEYILAGHKDGKVSKYDAKNFEFVESIDLHKSNISDLQFSPDRTYFITSSRDSH
                     AYIVDVASMEVLKEYEADCPLNSACVTPLKEFVILGGGQAARDVTTTSAREGKFEARF
                     YHKIFEEEIGRVKGHFGPLNCVAVNPQGTSYTSGSEDGFVRIHHFEKSYFDFKYEVEK
                     AAEAKEHMQETAA"
     gene            complement(<228569..>229390)
                     /locus_tag="HG535_0D01100"
                     /db_xref="GeneID:59236126"
     mRNA            complement(<228569..>229390)
                     /locus_tag="HG535_0D01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288235.1"
                     /db_xref="GeneID:59236126"
     CDS             complement(228569..229390)
                     /locus_tag="HG535_0D01100"
                     /inference="similar to AA sequence:RefSeq:NP_010197.1"
                     /note="similar to Saccharomyces cerevisiae YDL086W;
                     ancestral locus Anc_2.379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144130.1"
                     /db_xref="GeneID:59236126"
                     /translation="MLITETYQDVKTSYGTTLRIYIYSPKINGYPNAKFPGVVVYSEI
                     YQVTGPVRRFGQKIASEGYVVVAPAIYHNFCGPEPLAYDAEGTDFGNECKIKKPLESY
                     DEDNKLCCDLLYTLPQFDGKKIGATGMCLGGHLAFRALLDKRIACATCFFPTDIHLKS
                     LGLHENDDSLERISKETKADQELILIFGTWDTHVSPEGRDIIRKKLRDNKVNFTFLEV
                     HGAQHAFIRDESSKGRFDSAITQSCLGFMFEQFNRKLKIDLGEFVGDSKNLEHVC"
     gene            <229708..>230328
                     /locus_tag="HG535_0D01110"
                     /db_xref="GeneID:59236127"
     mRNA            <229708..>230328
                     /locus_tag="HG535_0D01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288236.1"
                     /db_xref="GeneID:59236127"
     CDS             229708..230328
                     /locus_tag="HG535_0D01110"
                     /inference="similar to AA sequence:RefSeq:NP_015291.1"
                     /note="similar to Saccharomyces cerevisiae YPL034W;
                     ancestral locus Anc_2.378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144131.1"
                     /db_xref="GeneID:59236127"
                     /translation="MDKKVKKPGFIYIYTYELMYNSLLCGKLEELDWLFVDDSILSPD
                     KLARRKWIDDCQILCKIGMTTKPSVSTRLLQWQNTCKHTVVNLTPDKVELLCNRRDSE
                     KSFSKMFQKLSIKSTKKTKNSIAERLLTYRDGGFYVDHRGKRPIEEIENAIHKLLWKK
                     YGQGLIYCYGCDPSGKKRHKEWFRITIKELPWLLQTIDAICHGNDI"
     gene            <231102..>231854
                     /locus_tag="HG535_0D01120"
                     /db_xref="GeneID:59236128"
     mRNA            <231102..>231854
                     /locus_tag="HG535_0D01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288237.1"
                     /db_xref="GeneID:59236128"
     CDS             231102..231854
                     /locus_tag="HG535_0D01120"
                     /inference="similar to AA sequence:RefSeq:NP_013867.1"
                     /note="similar to Saccharomyces cerevisiae YMR147W;
                     ancestral locus Anc_2.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144132.1"
                     /db_xref="GeneID:59236128"
                     /translation="MPLKTINTTLVWQDYISMAMAITLNSKPRFKERQSRSFRSLQPA
                     KGEKENKSFAKGQESLVTSMDRFQKLDVGELRKRLPISQRIENYEHKSSAAKHETIKC
                     EEPKTLEPIDELSPENIDMLKGVLGEDGQLTESDVQELLLSFTHTSGKIEHLLKNSSN
                     KDSPLPNSSLSSLRETLKSRWADALLSVIDKLDRLQAKSFECFWKSILYFNFWFPQWA
                     SIIRYVTPSIISLSYRITLLTFKLFEAQPMRF"
     gene            <232253..>232651
                     /locus_tag="HG535_0D01130"
                     /db_xref="GeneID:59236129"
     mRNA            <232253..>232651
                     /locus_tag="HG535_0D01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288238.1"
                     /db_xref="GeneID:59236129"
     CDS             232253..232651
                     /locus_tag="HG535_0D01130"
                     /inference="similar to AA sequence:RefSeq:NP_013868.1"
                     /note="similar to Saccharomyces cerevisiae YMR148W;
                     ancestral locus Anc_2.376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144133.1"
                     /db_xref="GeneID:59236129"
                     /translation="MISLSSFFFVLYLIFFISVGIIASIFIIPSLVLSFIFASFVVIF
                     GFLSDITFRISQKLYLKVDHRLRYALKKMSAQRKSEESKKCAILNNSNMVGSSDNQMS
                     NTVSVPAEPSTAASGIARSLETRANLRVTS"
     gene            <232853..>233689
                     /locus_tag="HG535_0D01140"
                     /db_xref="GeneID:59236130"
     mRNA            <232853..>233689
                     /locus_tag="HG535_0D01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288239.1"
                     /db_xref="GeneID:59236130"
     CDS             232853..233689
                     /locus_tag="HG535_0D01140"
                     /inference="similar to AA sequence:RefSeq:NP_013869.1"
                     /note="similar to Saccharomyces cerevisiae SWP1 (YMR149W);
                     ancestral locus Anc_2.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144134.1"
                     /db_xref="GeneID:59236130"
                     /translation="MQLNKLLIVLCAVICQCIAFEAKDAHLSFLTSKRRGIMFGSINA
                     NTEKPTEPIVIEKLSEQLELGFAVAGTDLPVQVGLLVGLPEKRLELPIMATLTQNQDM
                     NLYKVKIDVSKIPAAILYYSRELNKPLAVSLILASPGLENLIAPVFDIQLSNISAIEY
                     NAPSRYGPKHEIRHIFNASPKTAPWYICQVFILATIICTFCLLISWMASGSINLQNVP
                     RGSSFFYFVAFIGSVIGFEYIFLKYYSGSSIFETLYSVLYLGIPSLLLGTKFLRNFAE
                     KL"
     gene            complement(<233750..>234355)
                     /locus_tag="HG535_0D01150"
                     /db_xref="GeneID:59236131"
     mRNA            complement(<233750..>234355)
                     /locus_tag="HG535_0D01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288240.1"
                     /db_xref="GeneID:59236131"
     CDS             complement(233750..234355)
                     /locus_tag="HG535_0D01150"
                     /inference="similar to AA sequence:RefSeq:NP_013870.1"
                     /note="similar to Saccharomyces cerevisiae IMP1 (YMR150C);
                     ancestral locus Anc_2.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144135.1"
                     /db_xref="GeneID:59236131"
                     /translation="MQSLLQSWVKTATSALRVVCFVHIVHTYVYEFTETRGESMLPTL
                     AARNDYVHALKTYRDGRGCKIGDCIVAAKPNDPNHRVCKRITGMPGDIILVDPSVGTN
                     VFNSSSAMNTEATSDGDNDGYSEADEAFNSFIKVPQGHVWVTGDNLSHSLDSRTYNSL
                     PMGLIKGKIVAANDFNEPFLGGSKGDFWGFRKIQNTYVNEQ"
     gene            complement(<234518..>235396)
                     /locus_tag="HG535_0D01160"
                     /db_xref="GeneID:59236132"
     mRNA            complement(<234518..>235396)
                     /locus_tag="HG535_0D01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288241.1"
                     /db_xref="GeneID:59236132"
     CDS             complement(234518..235396)
                     /locus_tag="HG535_0D01160"
                     /inference="similar to AA sequence:RefSeq:NP_015292.1"
                     /note="similar to Saccharomyces cerevisiae YPL033C;
                     ancestral locus Anc_2.371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144136.1"
                     /db_xref="GeneID:59236132"
                     /translation="MFSSKFLSLSKFLYNTLGAGVKLESGVSTVLILGGSTSGFGIEL
                     SAALMFEHNVCVINVDSRDFEMILNVNEAVKLEKYYTFIHCNDFSNMDNMVQAMTEVA
                     KLKLPINFFINNVQEGLHTVFDSHEDNTIGYKGVAHLRKCVNANLTNVMIATKMFLNT
                     IVPQTARLTRGKISQFYIVNISSVLSLQLPEFARHFTSSKAALNQFHDSLTSELSFES
                     GEISTKTLLAYLPNIRDGEAWEVNLTEMTDALIQDLKDGKQGDTILKCDPKDYSKDTT
                     RNNVRYRLGNLHHNWL"
     gene            <235918..>236661
                     /locus_tag="HG535_0D01170"
                     /db_xref="GeneID:59236133"
     mRNA            <235918..>236661
                     /locus_tag="HG535_0D01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288242.1"
                     /db_xref="GeneID:59236133"
     CDS             235918..236661
                     /locus_tag="HG535_0D01170"
                     /inference="similar to AA sequence:RefSeq:NP_010196.1"
                     /note="similar to Saccharomyces cerevisiae LUC7 (YDL087C);
                     ancestral locus Anc_2.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144137.1"
                     /db_xref="GeneID:59236133"
                     /translation="MSTPVAEQKKQLEQLMESDSLSGHHRKSHYKSYQRDLGIYDPRI
                     CKSYLVGECPYDLFQGTKLSMGRCPQIHSAKYKLIYEKEEKKGKKFPEFEQEYHALLS
                     RFVNDCNGQIAMALKKLEHTPEDRERIKQVTAELDILDSKIGLMIEEIESLLRANEVS
                     KALLQGLKLQAMQERRLEVAKRVKNITENVGQSAQQKLQVCEVCGAYLSRLDTDRRLA
                     DHFLGKVHLGYVKMREELERMKQSIGSNR"
     gene            <237338..>238429
                     /locus_tag="HG535_0D01180"
                     /db_xref="GeneID:59236134"
     mRNA            <237338..>238429
                     /locus_tag="HG535_0D01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288243.1"
                     /db_xref="GeneID:59236134"
     CDS             237338..238429
                     /locus_tag="HG535_0D01180"
                     /inference="similar to AA sequence:RefSeq:NP_013872.1"
                     /note="similar to Saccharomyces cerevisiae YIM1 (YMR152W);
                     ancestral locus Anc_2.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144138.1"
                     /db_xref="GeneID:59236134"
                     /translation="MPEVVTCRSVTYINNKTAASLTQEEIDLDTCYEDNEIVIHVHAA
                     AFNPVDLLSQGFMCSYLVSSRPKSYGRDYSGVIVRRGKNVDEKWQIGDKVNGAQAFLV
                     GQSGSMSDYLVLNPSKQCSISHMKPINQDIQGKYDEFTFDAAWPLVFCTAFGILTNYG
                     QKFGPDSRILVIGASTAVSNAFVQIAKNYMNVGTVVGVCSSKSVEYNKKLGFDYLATY
                     DEGPLIESVAKVFLRDLQKEKFDLIFDSVGNNDFFPVLDKFLKPRSQNSYYITIVGDG
                     KLKYGSFSAMGTFWMASRILNPFRSYNYKFGLFSPSERAMEIGNKLISEGKYKPAIDS
                     VHPIEDFKEAIDRLSSSRAKGKVVLKINN"
     gene            <238588..>240081
                     /locus_tag="HG535_0D01190"
                     /db_xref="GeneID:59236135"
     mRNA            <238588..>240081
                     /locus_tag="HG535_0D01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288244.1"
                     /db_xref="GeneID:59236135"
     CDS             238588..240081
                     /locus_tag="HG535_0D01190"
                     /inference="similar to AA sequence:RefSeq:NP_010195.1"
                     /note="similar to Saccharomyces cerevisiae ASM4 (YDL088C)
                     and NUP53 (YMR153W); ancestral locus Anc_2.369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144139.1"
                     /db_xref="GeneID:59236135"
                     /translation="MMREAQLTLSIFGSRLVKCPMFSSNPQRPDTNRFANVSVNFTQQ
                     QPQQQQNQQNTHSQQYPSTSQQQQQMLFQQGTSIQNSATQREPEWFNNPRKRTIPQAI
                     VKRTTKRSSSVDSSTTDGDGTSRTGRSGFNSIGFGSKKDVGLLPSSKDINVIKKSDHN
                     NGFMDSNEAPPTVSFYDWKREDDFGSINPLDLQTNDSQYVFKSKQTELASTPSTTKKN
                     KTEGSETNVFDRKSSVGLNNKQNNNNLETKTGGLRKSATQESAVIVFGYPESISNLVI
                     THFSKFGRILEDFEVLRSNSGINTATLKLRGNKSDKQERKCPIFTGDGWVKLTYDSVP
                     PAVRALQENGRVFGGTLIGCVPYSKSAVEQLASCHIEKVDDIGAMNSPTPIDDANTFK
                     GLSKDIEAGADDKHTDSVSGVFNTSSGKLFDSGSDDVLSHRKVVYPSRRLDIKEGKSL
                     FVHNGATNNHNFLQSLEAKMRQQEENNKKEAGIWHKVNNWLFGWNEL"
     gene            complement(<240257..>241828)
                     /locus_tag="HG535_0D01200"
                     /db_xref="GeneID:59236136"
     mRNA            complement(<240257..>241828)
                     /locus_tag="HG535_0D01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288245.1"
                     /db_xref="GeneID:59236136"
     CDS             complement(240257..241828)
                     /locus_tag="HG535_0D01200"
                     /inference="similar to AA sequence:RefSeq:NP_010194.1"
                     /note="similar to Saccharomyces cerevisiae YDL089W;
                     ancestral locus Anc_2.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144140.1"
                     /db_xref="GeneID:59236136"
                     /translation="MPFGSPRASTTSIDESGKMKVTTNSDTRDSLEDERMSYFTMLTT
                     SPSDWQLILNEKLALIDWDAKASTLAQPCGNALTILFFIIRLLQDNLIKPNFLKLNAV
                     GDAFDFAKSEKLRRYDYLLEYSIKSGNAAKSKGELYFISLGRLARILDVSIKVLIVWN
                     ILSTYRFLCVFYKTYSLFHLQSIPKSDNLTKHSLTGISNDEARYQRLANGSLWSLVKS
                     LFLRDGRSGQVDGYSNESKYYYKLRKWAPSKFSAVFFVSFPPTCIAFLFFSEVSFRTL
                     FAVIIHQYLLYFLVTKRYEQRLTDDLITVSAANAEIDEKFIKPRFSKVHQDVQVDATP
                     YGNGYVRFFPPSNKSHLFKAHSLDGSVITEQYNTDTEQFDTLSAELDVTQNTIVKPPH
                     LHPYMFYRDPYHPHYDRFRQAGQNICYSREGSPTRMSTPPGFYSPAVSTASGMSTPYF
                     RPERSSTFMNAVPAKQTMNNKNSVGVTQSRKGSKSPLRLSLLSTRNSGDEDIKRMRIP
                     KLSLSSRSSSKSPTR"
     gene            complement(<241946..>244069)
                     /locus_tag="HG535_0D01210"
                     /db_xref="GeneID:59236137"
     mRNA            complement(<241946..>244069)
                     /locus_tag="HG535_0D01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288246.1"
                     /db_xref="GeneID:59236137"
     CDS             complement(241946..244069)
                     /locus_tag="HG535_0D01210"
                     /inference="similar to AA sequence:RefSeq:NP_013875.1"
                     /note="similar to Saccharomyces cerevisiae RIM13
                     (YMR154C); ancestral locus Anc_2.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144141.1"
                     /db_xref="GeneID:59236137"
                     /translation="MDGWEALNVVRRWFYCGESKDYAKALENLSVEASKSNDVAFIGG
                     LLQLKRDSDAMNTKRKLLWLTSKVEDRFYPPLEADLAGPLQWNHDIVLQSKSDKILSI
                     YCLRKALVADTLTSPGSIQQSRDIENCSFVASMIVIKNQKVSLPLIVKVGPYKYHVNL
                     NFNGSNERLVTVDISSIPTTKRGKQLAVLSEDLNDKIIELAYLQVTTGSYDCPGSNFA
                     IDMFTLTGYIPEIVDAKRYSVKKLIEFYRSGFCYMAIGTGDNSGELENSLIKNHDYPI
                     VGINEDSCTLLARDTLDVNTTTDIDDMCLAKYYKQVYLVRKTDKLFSRKSTLHFVYKS
                     DKYNKFKSIFDKPKFVLRNGSQGMEPIWILLETNLQCKNNSGKNNIAYLKKVPKNPFI
                     HMTSALEGACEIGLQLLKLELPSNSDLRLFCHSSNTAHFTIHTFFNSGLVTFNRDSSA
                     YNITSLQFSRTTQENYPLGSLNYFRNPTFKFELVHSSTVETSVHLQLLSETPHDLLNL
                     SVFNFNDHTLSTPLLCNTDYTHQRYDKLHTPLITNTTYKIVCSTYSEPLSQEYKLVVA
                     PPDDTLLPPFKCDIQQVFLEYGGYNYNTEQKIQWRTNSNRVVIPLSTATNNICFIRIV
                     PKNELLLIRCNVFDSVTHRKICGNDSFQRVSAGGIVLEKVEIYGHPSVTLLIEKDEPI
                     GLREPSKADSFSLIIGSHHKITIDV"
     gene            <244294..>245595
                     /locus_tag="HG535_0D01220"
                     /db_xref="GeneID:59236138"
     mRNA            <244294..>245595
                     /locus_tag="HG535_0D01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288247.1"
                     /db_xref="GeneID:59236138"
     CDS             244294..245595
                     /locus_tag="HG535_0D01220"
                     /inference="similar to AA sequence:RefSeq:NP_010193.1"
                     /note="similar to Saccharomyces cerevisiae RAM1 (YDL090C);
                     ancestral locus Anc_2.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144142.1"
                     /db_xref="GeneID:59236138"
                     /translation="MPNSLSRLKFINKNLLGRKRPTIISVVKDEEKDQETIMSIMKEV
                     ETDTTIAYNEVLEKCNEQYRSKVNPVLNKDFHQMYIEGWFSHDLPPQMSALDASQPWM
                     LYWLANSMKVLNKNGLTDEIKERIAEKVFAISPQGGPFGGGVGQLPHLASNYAAINAL
                     ALCDNIGGCWDKLNLKAIYEWLMSLKQVDGCFKTCSGIGETDTRGVYCALSVASMLGI
                     MTPELCEGVEDFLISCQNYEGGFGGCAHEDEAHGGYTFCAIASLSILAAIDRIDTSKL
                     ALWCSQRQDNAEKGFCGRSNKLVDGCYSFWIGSTASILEWHGCAECVNKEALKEYILY
                     CCQSSKRPGLQDKPGTNPDFYHTNYVLLGLAIAENAVFITSKEGDNKSKEQVLIEEPS
                     SATHFNSPSCLTAINPIYGLPVEELFNFSTHFRHKKSSCSS"
     gene            <245851..>247191
                     /locus_tag="HG535_0D01230"
                     /db_xref="GeneID:59236139"
     mRNA            <245851..>247191
                     /locus_tag="HG535_0D01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288248.1"
                     /db_xref="GeneID:59236139"
     CDS             245851..247191
                     /locus_tag="HG535_0D01230"
                     /inference="similar to AA sequence:RefSeq:NP_010192.1"
                     /note="similar to Saccharomyces cerevisiae UBX3 (YDL091C);
                     ancestral locus Anc_2.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144143.1"
                     /db_xref="GeneID:59236139"
                     /translation="MDLFRRILHGGEVPFTPIPGTFPEPQTQQETQTQRRDGSEQEET
                     SRPTTRRTILSRRTIAMMVLQLPLVILHYIMSFMITMVSLIKPLYALQGFYKRKSMRT
                     SDGKSRLNNLLELLSNESERTLNSEDSGLTTYSFGSLYSLENGSFCQDIVQGSYTDLL
                     NACSEQCKFAMIYLHDSLLDNSTEYVNGLLCTEQFTTLIKKYQILLWFSDVSTSEGLQ
                     VANALKVRQFPFLGLLSLKAENKIELFGRMEGSLTQYKANFLENMLGKAYSKLLQIRQ
                     QRQNNALQQLIREQQDNRYNESLSADQRRERERATQRDTMNQAIEQARLKMLWLLWRK
                     STLAPEPSSDSGIPTCKVAIRADSGERVIRRFDASLPIEEIYAFVELQRTPNTLDAEE
                     SQNTGAPPRGYHHQYEFTLVSPVPRKELEPSTVIHDETAIFPSGTIIIENVNRD"
     gene            complement(<247300..>247734)
                     /locus_tag="HG535_0D01240"
                     /db_xref="GeneID:59236140"
     mRNA            complement(<247300..>247734)
                     /locus_tag="HG535_0D01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288249.1"
                     /db_xref="GeneID:59236140"
     CDS             complement(247300..247734)
                     /locus_tag="HG535_0D01240"
                     /inference="similar to AA sequence:RefSeq:NP_010191.1"
                     /note="similar to Saccharomyces cerevisiae SRP14
                     (YDL092W); ancestral locus Anc_2.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144144.1"
                     /db_xref="GeneID:59236140"
                     /translation="MVNEGCLSIEEFLPKISEYFKAANEKEVTVRVSTKRLVKGEPVE
                     GNREFDATNNPHFDISRKAQQTHFKDVSQEVYPLLIRISYLSDAKKNKCSTVVKADDL
                     DKFWQNFSAVIKGSMKGLIKKKKKKKGKAVVAKPKKGKKLKR"
     gene            <248267..>250240
                     /locus_tag="HG535_0D01250"
                     /db_xref="GeneID:59236141"
     mRNA            <248267..>250240
                     /locus_tag="HG535_0D01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288250.1"
                     /db_xref="GeneID:59236141"
     CDS             248267..250240
                     /locus_tag="HG535_0D01250"
                     /inference="similar to AA sequence:RefSeq:NP_013876.1"
                     /note="similar to Saccharomyces cerevisiae YMR155W;
                     ancestral locus Anc_2.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144145.1"
                     /db_xref="GeneID:59236141"
                     /translation="MRPPSRSEQATCFVGSGIVALGAGTPYLLSFYAPQLLAKCNLPV
                     SNLSTLSLAMSLGSSLLGFFAGIVIDKSVAGSCLIGALCTFSAYSILHYCYVHELANV
                     PLIAFGLTLVGFGSVSGFYAAVKCCTTNFPHHRGTAGAFPVALYALAGMLFSTICTEV
                     FGDDVEGIFKFLTYVCSSMIFVGCWTMKIMVTPKARKVKRRNSSIDQQVPNSRGSNSN
                     MSETPSTQPIMISSERQGNEIPHSFPVHSQNRNGSLSSTSSSSLASSFQSLWSNKRSD
                     SFIWSKDLPGSLSFWGWGRVRDEDALSESPSAHPFPPPSMPQLPPLSRTRQSYSSTNS
                     SPRRQRFDSFTNLDRTDSFKRDQPGAHVLQRGTNNEVFTNMEDSTRNSIYKESSSWKN
                     SHVFRTMKKPRFILYFIILATLQGIGQMYIFSVGFIVQTQVYSTSPEKYKLNPESIQS
                     LQVSIISILSFLGRLSSGPFSDLLVKKLKAQRLWNIVVAGILFVYASLQMLQVSHVNL
                     SAIMEGPDNIKNISFCSALFGYGFGILFGTFPSIIADAFGTEGFSTIWGLSTSGGLFT
                     VKYFCSVLGVDLQNHVEDGKKYCEKGTVCYSHTFHLTAFFAMLVTVFTLAVITVSFWE
                     RKHRHELMPDSHHVEYLLTEEDENEEHEGSTQV"
     gene            complement(<250414..>252909)
                     /locus_tag="HG535_0D01260"
                     /db_xref="GeneID:59236142"
     mRNA            complement(<250414..>252909)
                     /locus_tag="HG535_0D01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288251.1"
                     /db_xref="GeneID:59236142"
     CDS             complement(250414..252909)
                     /locus_tag="HG535_0D01260"
                     /inference="similar to AA sequence:RefSeq:NP_010188.1"
                     /note="similar to Saccharomyces cerevisiae PMT1 (YDL095W);
                     ancestral locus Anc_2.362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144146.1"
                     /db_xref="GeneID:59236142"
                     /translation="MASDKRTRSASEGQNPVIDFDVKQGPVRPYIVSEPQEKLAKVRT
                     VYSLKERFLVSCLAVFTVIVRMRNLSWPNAVIFDEVHFGGFATKYIKGLFFMDVHPPF
                     AKMLFAWVGILGGFDGDFDFETIGKLYPASTPYVLMRSVAAISGALTVLLLYFTLRSS
                     GVRVWVAFASAVCFAVENSFVTISRYILLDAPLMVFIAASVYAFKRYEIYPTGTWASY
                     KFLTFTGIALGLAVSSKWVGLFTISWIGLLCVWRLWLFLGDLSKPVCSTLKIAVAKGT
                     FLLGIPTVLYMVFFYIHFQTLTENSDGSGFFSPEFRSTLNGNTIPTDILAEVGVGSTV
                     TMRHLGTMGGYLHSHSHEYPTGSQQQQITLYPHLDANNEWYITLYNQTNTTITSFENL
                     VEGTKVRFLHPSTQRRLHSHDHKPPVSENSDWQKEVSAYGFEGFEGDANDDWIIEIDK
                     SLSTPGPAQERVRAIETKFRLRHAMSGCYLFSHEVKLPQWGFEQQEVTCAQSGKPELL
                     VWYVEGNENEFLPQDAERVSYKTPSFLEKFIESHKRMWHVNKNLVDSHVFESLPSSWP
                     LLLRGIGYWSSEHRHVYLLGNAILWWSVSLFTVVFSFIVIFELISWQVGKPILQDSDV
                     INFHIQVMEYLLGFLIHIIPSFMMKRQLFLHHYLPAYYFGILAFGHALDIVVSYVFRK
                     RKVVGYALVASFTVACICFFQFYSPLIYGTPWTKDLCQKSQWLSGWDYGCDNYFNTYE
                     EYDNEIIEPSQQPSVTPVSSIVAHNKPSDSVDQEAQNQQQIDLDTFDEMLNEPGQKRF
                     VDQNGNPLDIEDVRRIIAEEGGGIHKIEERVVE"
     gene            <253322..>254599
                     /locus_tag="HG535_0D01270"
                     /db_xref="GeneID:59236143"
     mRNA            <253322..>254599
                     /locus_tag="HG535_0D01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288252.1"
                     /db_xref="GeneID:59236143"
     CDS             253322..254599
                     /locus_tag="HG535_0D01270"
                     /inference="similar to AA sequence:RefSeq:NP_010186.1"
                     /note="similar to Saccharomyces cerevisiae RPN6 (YDL097C);
                     ancestral locus Anc_2.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144147.1"
                     /db_xref="GeneID:59236143"
                     /translation="MCSVEAARDLVEKKQYDKAEQVFLDLLSKDYNESTGKVTERQNE
                     QEACILGLGNLYIVTGAKEKLREFIPRSTDHMMQFAKPKTAKVLKTLIEEFEKVPDSY
                     DDQIYVCQKSIEFAKKEKRVFLKQSLTIKLATLYYYKRQYKDALELNAELLREFKKLD
                     DKPSLLDVHLLESKVYHKLRNLAKAKASLTAARTAANSIYCPTVTMAELDLMSGILHC
                     EDKDYKTAFSYFFESFESFHNLATHNSYDKACHVLKYMLLSKIMLNLIDEVKNILNAK
                     YTKETYQSKGIDAMKAVAEAYSSRSLLEFNTALKQYKDEIMGDELIRSHFNALYDTLL
                     ESNLCKLIEPFECVEVSHISMMIGLDAQQIEGKLSQMILDKVFHGVLDQGNGWLYIYE
                     TPHQDATYDCALELVGQLDKVVDQLYEKASVLY"
     gene            complement(<254637..>255395)
                     /locus_tag="HG535_0D01280"
                     /db_xref="GeneID:59236144"
     mRNA            complement(<254637..>255395)
                     /locus_tag="HG535_0D01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288253.1"
                     /db_xref="GeneID:59236144"
     CDS             complement(254637..255395)
                     /locus_tag="HG535_0D01280"
                     /inference="similar to AA sequence:RefSeq:NP_013877.1"
                     /note="similar to Saccharomyces cerevisiae TPP1 (YMR156C);
                     ancestral locus Anc_2.360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144148.1"
                     /db_xref="GeneID:59236144"
                     /translation="MVMFHRLTLLPYLIKHTPKNALPEISGANGPLKVYAFDLDHTII
                     KPKTAGSRFSTSADDWDFMNFSPGRSALDKLLSIVIEDATAQVVIFSNQGGVITVPSN
                     SKSCTKYVEKIRLILKAISLEKDGNRLLERLWIYSSPKKPASFTRKQNKSSLLTKPMK
                     VVKTLKKLNKPAPKLEEPMLMDPEIFTKMRKPETGMMQEFKKDLESIYPTVISIEVCH
                     YCGDAAGRKQDFSDSDKQFAKNLDVPFKLPEDVF"
     gene            <255564..>256124
                     /locus_tag="HG535_0D01290"
                     /db_xref="GeneID:59236145"
     mRNA            <255564..>256124
                     /locus_tag="HG535_0D01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288254.1"
                     /db_xref="GeneID:59236145"
     CDS             255564..256124
                     /locus_tag="HG535_0D01290"
                     /inference="similar to AA sequence:RefSeq:NP_010185.1"
                     /note="similar to Saccharomyces cerevisiae SNU23
                     (YDL098C); ancestral locus Anc_2.359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144149.1"
                     /db_xref="GeneID:59236145"
                     /translation="MSNFGRRTWDREEYAKLASEGQLTHEQSLKSSLTPAQFQQLKRK
                     YTNFHGLMQDAIKNLNTKVLTTGLSSYKKGKQFGFYCELCNLTFKDTMQYIDHLNHKT
                     HQLKFESIFDEPLINDTRDNDMIEKEEFEGIYHSIIDQFISLHGTKKPRKSKKASIRQ
                     ALLQKEEHPTELELAMGFKAFGNANR"
     gene            complement(<256179..>256901)
                     /locus_tag="HG535_0D01300"
                     /db_xref="GeneID:59236146"
     mRNA            complement(<256179..>256901)
                     /locus_tag="HG535_0D01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288255.1"
                     /db_xref="GeneID:59236146"
     CDS             complement(256179..256901)
                     /locus_tag="HG535_0D01300"
                     /inference="similar to AA sequence:RefSeq:NP_013878.1"
                     /note="similar to Saccharomyces cerevisiae YMR157C;
                     ancestral locus Anc_2.358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144150.1"
                     /db_xref="GeneID:59236146"
                     /translation="MQAITRAAKLCRSRTLRGIPSAYKSGNAFATTTLRFYSSNSAQS
                     RRKDEAPSFKKIFLIGIIGTVIFVEAVRSLDKNKPKTTYSEQEFADVMSGLRRRVAAF
                     PAGQLDVKFILTGNKKDVEKLVDQYDLLIDPIEVVEHYRSSTNDSYEALLNDLYDRYG
                     AQKYSQNLPKGLLVMLIGRYMKEKCLPNSTVVIINFPSNIQDSIKFENEVSVVSKIYV
                     PHASMGSEVCKYYQTVKKVQEF"
     gene            <257103..>257570
                     /locus_tag="HG535_0D01310"
                     /db_xref="GeneID:59236147"
     mRNA            <257103..>257570
                     /locus_tag="HG535_0D01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288256.1"
                     /db_xref="GeneID:59236147"
     CDS             257103..257570
                     /locus_tag="HG535_0D01310"
                     /inference="similar to AA sequence:RefSeq:NP_013879.1"
                     /note="similar to Saccharomyces cerevisiae MRPS8
                     (YMR158W); ancestral locus Anc_2.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144151.1"
                     /db_xref="GeneID:59236147"
                     /translation="MSLVKLANSCAHIQNCSRVRSTLTSIPYTKLHLQFAYSLYKHGF
                     LSSLQKGSTKGPDETTVEITPDNISTRRLWIGLKYRENKPIISACTLISKPNTRVYLT
                     HNDMRKLCSGSSVRLIKPLQPGELMLVRTDTDVIDINEAIAKKIDGEVLCRVK"
     gene            complement(<257648..>258622)
                     /locus_tag="HG535_0D01320"
                     /db_xref="GeneID:59236148"
     mRNA            complement(<257648..>258622)
                     /locus_tag="HG535_0D01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288257.1"
                     /db_xref="GeneID:59236148"
     CDS             complement(257648..258622)
                     /locus_tag="HG535_0D01320"
                     /inference="similar to AA sequence:RefSeq:NP_010184.1"
                     /note="similar to Saccharomyces cerevisiae BUG1 (YDL099W);
                     ancestral locus Anc_2.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144152.1"
                     /db_xref="GeneID:59236148"
                     /translation="MTDQDEEVKRIKQLEDARKRVEELKKKSKKNKDKKNRDKKNAQQ
                     NQESKSSEHEGSVDAPEQTEDVFERDEAAKDSSVQLTEGELSSDQGQEATPGFGEART
                     QEHAHKSGPETKKRTEDEQKEETGSEAEKIPSSTEQSENNEDSQGEQEVHEAKTEVKS
                     SDSSNPPLQNDTHALFDEGQGNETDFMATIQKEKDQNELENLKEQLETVIKENKTMKF
                     INMDHETEIEELQNEIELLNKELDTARRELASVRLQLDTKESEIRSLGQQQQQTDSVD
                     FGVSNSLRQTASNGPQVIVDRASLDKWRNWNVDMTTWRSIGSGAIVEF"
     gene            <258829..>259893
                     /locus_tag="HG535_0D01330"
                     /db_xref="GeneID:59236149"
     mRNA            <258829..>259893
                     /locus_tag="HG535_0D01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288258.1"
                     /db_xref="GeneID:59236149"
     CDS             258829..259893
                     /locus_tag="HG535_0D01330"
                     /inference="similar to AA sequence:RefSeq:NP_010183.1"
                     /note="similar to Saccharomyces cerevisiae GET3 (YDL100C);
                     ancestral locus Anc_2.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144153.1"
                     /db_xref="GeneID:59236149"
                     /translation="MDLSIEPNLHSLITSSTHKWIFVGGKGGVGKTTSSCSIAIQMAL
                     AQPQKQYLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAV
                     SRSNANGGSGESDGLSNLLQGGGLAELTGSIPGIDEALSFMEVMKHIRNQEKGEGESY
                     DTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITGNFGPMLNSLAGTGNIDITGKLNQ
                     LKENVELIKSQFTNPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLF
                     AEHDLEHNCKRCQARWKMQKKYLDQIDELYEDFHVIKMPLCAGEIRGLDNLRKFSKFL
                     DKEYDPSKDGEVIYELEEKN"
     gene            complement(260062..260134)
                     /locus_tag="HG535_0Dtrna6M"
                     /db_xref="GeneID:59236663"
     tRNA            complement(260062..260134)
                     /locus_tag="HG535_0Dtrna6M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:59236663"
     gene            complement(<260871..>261245)
                     /locus_tag="HG535_0D01340"
                     /db_xref="GeneID:59236150"
     mRNA            complement(<260871..>261245)
                     /locus_tag="HG535_0D01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288259.1"
                     /db_xref="GeneID:59236150"
     CDS             complement(260871..261245)
                     /locus_tag="HG535_0D01340"
                     /inference="similar to AA sequence:RefSeq:NP_013882.1"
                     /note="similar to Saccharomyces cerevisiae ATG16
                     (YMR159C); ancestral locus Anc_2.354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144154.1"
                     /db_xref="GeneID:59236150"
                     /translation="MDQGYITKLQDRDVIESRFCDLFRDVPIALRDEDINATKQNNLK
                     STVNRLRKELKDKDAEVRSLREVIKVKNNDSEKLNNELISLNIENNLVGHKYAQLEEE
                     HEKLVKRWLERVHQEFDVLNAR"
     gene            <261391..>263700
                     /locus_tag="HG535_0D01350"
                     /db_xref="GeneID:59236151"
     mRNA            <261391..>263700
                     /locus_tag="HG535_0D01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288260.1"
                     /db_xref="GeneID:59236151"
     CDS             261391..263700
                     /locus_tag="HG535_0D01350"
                     /inference="similar to AA sequence:RefSeq:NP_013883.1"
                     /note="similar to Saccharomyces cerevisiae YMR160W;
                     ancestral locus Anc_2.353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144155.1"
                     /db_xref="GeneID:59236151"
                     /translation="MSEASHDAPSKIVTWGSWWRGRGLETDAQDQDENDVTAGSTALK
                     TSTTAVPENLSNEREVHNSSTVGTAENVQNSATAGWYSSIVSRVSSIPLFNNQTIDVV
                     IDGNTRYSQLSEGQIQILELEAVQTIVRRSNSWVWYRNLTHFNEGTSSWIEQTGIVSV
                     YGTGSSKCPLPLKHYPIPDSSSGYHVYLTDSLILPTDSPLKMLHDQSLLSRVSTAARN
                     YYNFPSEKHLYLKKTTEGLLKEGRALIISVVGYLPEKYEKYSLEEQRSAEYLSRKLAL
                     SLQHEQPAEIISLSIECPLHTKDLKTVFQECVGLLQNWKDLFKDVSSIFFTCVYHSVP
                     LTILLAKHILKDHESLEINATTPVGILAMESDLQGYRFWDHSSDATSSSEQSYQKVQQ
                     MREKQLFQGVSKNEREILSKIRLYRKLDSEESRLVQSNLDWLLYHWRGFRFNFFCKLY
                     DNFMTASQKLAVDYNHPKIFRNIWCDGRHMGHDTRHPLQLNIPDVQTKTPKFECTLEV
                     PEKRIFEVTLLNSILLALNLGNTKFVPIMKLISPFFISRTFNQNTMSPNLKKQTQTEL
                     KNWLQEMDLKWRTNETDEQSIGELPDKVSSVHKFMEFSHYHDMRTPELMKVYSNIYDD
                     DSVYQTFIENTIKTRSLLGEKHLTLLGDHSAPRSILNTVNQYDLVWKFHEFLSEFMRL
                     RNLPQQPEAKCLKFTISLNYSFWEQAYYDPILFKKDTSEAIKHLEHIWENYQSWDPST
                     RGLKQLKSVLSVLSLYNNPSEMVQDVAYK"
     gene            <263816..>265407
                     /locus_tag="HG535_0D01360"
                     /db_xref="GeneID:59236152"
     mRNA            join(<263816..263839,263911..>265407)
                     /locus_tag="HG535_0D01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288261.1"
                     /db_xref="GeneID:59236152"
     CDS             join(263816..263839,263911..265407)
                     /locus_tag="HG535_0D01360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144156.1"
                     /db_xref="GeneID:59236152"
                     /translation="MIDPSLKRERSDEVHEYSKRYQIENGSRQRKLIGILVNLIPGKE
                     QKISIFDSAITTIGRSRSCDVVLMESDISTIHCQLCTIRMNVDGIKRQLINIVDKSRN
                     GTYVNSNRLSRRDYILKNGDKLVFGKSCSFLFRYVGFEYSEEDNGGRKQEDPAIKNDD
                     AVFKKPQLGTKPTTIESSATWKKTRQTSVFDTYVIGKELGVGHYATVKEGINKRTGEI
                     VAIKIFHSQLNDDQKKNKQFREEISVLLRVKHPNIVNLLDTFTEPVSKSQIQKYLILE
                     KIDSGELFDRIVRKTNLSVEETKALFKQILVGLKYLHGENIIHRDIKPENILLNITKR
                     RHSHEIQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTSTLCGTPSYVAPEVLKKTEYS
                     SKVDMWSAGVLLYVCLCGFPPFSDSLSPPSLKEQILGGIFAFYSPYWDEIDDSILHLI
                     SNLLVVNPSERYSVEEAISHSWVKGSPQTSTASAEIERLVISPEKIPKTYSELSKL"
     gene            complement(<265469..>268771)
                     /locus_tag="HG535_0D01370"
                     /db_xref="GeneID:59236153"
     mRNA            complement(<265469..>268771)
                     /locus_tag="HG535_0D01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288262.1"
                     /db_xref="GeneID:59236153"
     CDS             complement(265469..268771)
                     /locus_tag="HG535_0D01370"
                     /inference="similar to AA sequence:RefSeq:NP_010181.2"
                     /note="similar to Saccharomyces cerevisiae POL3 (YDL102W);
                     ancestral locus Anc_2.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144157.1"
                     /db_xref="GeneID:59236153"
                     /translation="MDNAEETTSDLKRAGDDEAPENGIVFEKRLRLQSQDHGVGSEPV
                     STIEIIPTDSFRKYNEQGYKAKNNEVHGKELASTFEEELSQMEHELAESEETEASYKR
                     KPLPANFDPATYDMSFQQLDAEQSTLHGFSDDGTSTVVRFFGVTEEGYSILCNVTGFQ
                     HYLYLPVPNLPGTSDQNEIDGFLRYLNENFDNKVSRIEQVARQSIWGYSGDNKLPFWK
                     IYVTYPNALNKIRTAFERGHLTYKSWFSSGITTYDNIAYTLRLMIDCGIVGMSWITLP
                     KKKYKMIADNERVSTCQLEVRVNYRDLVSHEPEGEWSHSSPLRILSFDIECAGRIGVF
                     PEPQHDPVIQIANVMSIAGARKPFIRNVFTVDSCAPITGSQVFSHKTEVEMLKNWRDF
                     VVAADPDVIIGYNTSNFDFPYLLDRAKALKVDIFPYFGRLTNVKQEVKDSVFSSKAYG
                     TRESKTVNIDGRLQLDLLQFVQREYKLRSYTLNAVSAHFLGEQKEDVHYSIITSLQNG
                     DSETRRRLAVYCLKDAYLPLRLLEKLMALVNYTEMARVTGVPFSYLLSRGQQIKVVSQ
                     LFRKCLQIDTVIPNMQSQGSDEQYEGATVIEPIRGYYDIPIATLDFNSLYPSIMMAHN
                     LCYTTLCDKKTVERLGLKIEEDYVVSPNGDYFVTSKIRRGILPIILEELIGARQRAKK
                     DLKNETEPFKRDVLNGRQLALKISANSVYGFTGATVGKLPCLAISSSVTSFGRNMIML
                     TKQSVEEKYSIKNGFEHDAVVVYGDTDSVMVKFGTNDLKESMRLGAEAASYVSTLFKH
                     PINLEFEKAYYPYLLINKKRYAGLYWTNPDKYDKLDQKGLASVRRDSCPLVSIVMNKV
                     LKLILIDRNVERALAFIAETINQILHNEADISKLIISKTLAPNYTNPQPHAILTERMK
                     KRDGFGPNVGDRVDYVIIGGNDKLYNRAEDPLYVLEHNIQIDSRYYLTNQLQNPIISI
                     ITPILGEKRANAMFVVKSIKISTGNMKGGLMGFIKKVDSCKNCKSPLKKGEGPLCLNC
                     IQKSGELYIKSLYNVRELEEKFARLWTQCQRCAGTLHNEVLCSNKNCDIFYMRVKAKK
                     ELQENVEQLSKW"
     gene            <269338..>270012
                     /locus_tag="HG535_0D01380"
                     /db_xref="GeneID:59236154"
     mRNA            <269338..>270012
                     /locus_tag="HG535_0D01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288263.1"
                     /db_xref="GeneID:59236154"
     CDS             269338..270012
                     /locus_tag="HG535_0D01380"
                     /inference="similar to AA sequence:RefSeq:NP_013884.1"
                     /note="similar to Saccharomyces cerevisiae HLJ1 (YMR161W);
                     ancestral locus Anc_2.350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144158.1"
                     /db_xref="GeneID:59236154"
                     /translation="MVESSYTVEQEKIALEVLSKNKQEFYEILKVNRSADDQEIKKSY
                     RKLAIKLHPDKNPHPRASEAFKVINRAFEVLSDAEKRQMYDRLGRDPDDRSMPSGSSS
                     SYQAGFPQEAFFGRRHADPREDIFDYLFNMGGGSPFGGPFGNHPFGSPFMNGGGASTF
                     TFGGPGGFRVYTNTPRHAQQRQRQRQQQQQQEGDREQDVNQSIRVLLPLLVLFLVPLL
                     ERFVFG"
     gene            complement(<270302..>275233)
                     /locus_tag="HG535_0D01390"
                     /db_xref="GeneID:59236155"
     mRNA            complement(<270302..>275233)
                     /locus_tag="HG535_0D01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288264.1"
                     /db_xref="GeneID:59236155"
     CDS             complement(270302..275233)
                     /locus_tag="HG535_0D01390"
                     /inference="similar to AA sequence:RefSeq:NP_013885.1"
                     /note="similar to Saccharomyces cerevisiae DNF3 (YMR162C);
                     ancestral locus Anc_2.349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144159.1"
                     /db_xref="GeneID:59236155"
                     /translation="MSSSSGKRKRSVSLRTQMFNKHLYDKFYKRKDQGIEMEDIQENG
                     GNDSDGNNGNREEDEIYEEYEEELEEDEESNNRSTKPPGTFTRILDGIMNRTREIHSK
                     DGRHIPIILDHDTAEYKHYSSPKWDQLIDERLGVPYCKNRITSSRYTVYTFFPRQIYA
                     QFSKIANAYFFLVAILQMVPGWSTTGTYTTIIPLCVFMSISMAREAWDDFRRHRLDKE
                     ENEKEAEVLLKIKVGSRPSSQESALSKSTKTEHARSFASLNVTNQSKSGPNFTQFNNF
                     EMLKERHSVFTEKKQWQNLRVGDFVLLKQDDWVPADMLLLACDGDNNECYVETMALDG
                     ETNLKSRQPHLELCKLARSASGLANINTKVTVEDPNIDLYNFEGNLEMRGNQNGSLLK
                     FPLGPENVIYRGSILRNTQNVVGMVIFTGEETKIRMNALKNPRVKAPKLQRILNGIVA
                     FMVLVVACVSFFSYLGHVLVNRKFIDQNQAWYLLQTDAGVAPTIMSFIIMYNTMIPLS
                     LYVTMEIIKVMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTE
                     NKMIFRKFSLCGTSWLHDVDPGDEPIKAVTSRVNNDVEVISYDSRGILDQFSLQNDSN
                     DDHSVHGVFAGRKSVEYKGNSTATYTGRPSMKSLYGKGDPTLFSTKTPQTTEGPAPLK
                     TSYELIEYVQKHPQTVFAQKAKFFILSLALCHTCLPKRNENFPEREDAIEYQSSSPDE
                     LALVTAARDLGYMVFNRNAQSLTIKTFPNGFEDEPQLDDYEILNYIDFNSQRKRMSVL
                     VKMPNEPDRVLLICKGADNVIFERLSNRDVAFQKLNEVNANTKERKDAEAELIIQQRM
                     SLERLANEDDVINNKLRSSLSSASKGSLSLQAVRKSMSRNANNRHDPEMQIDSIDQFL
                     NTIKRNDDEIGDVINQSRKSLHKQQQEKYGSRKSVDHGQASNGSPHKNVSQHGGVPSY
                     TNSILNYIGDDNLMSNEEFVIERTLQAIDEFSTEGLRTLLYSYKWISTSEYDEWAQRY
                     HKAKTSLTNRKTKIDEVGEEIEEELHLLGATAIEDKLQEGVAESIEKIRRAGIHMWML
                     TGDKRETAINIGYSCKLIYDYSTVVILTTNDENIVSKMNVITQEIESGNVAHCVIVID
                     GATLGLFENNPTLMSVFIELCTKTDSVICCRASPSQKALMVSNIRNTRKNLVTLAIGD
                     GANDIAMIQSADIGIGIAGKEGLQASRSSDYSIAQFRFLTKLLFVHGRYNYIRTSKFV
                     LCTFYKEIAFYLTQLIYQRYTMFSGTSLYESWSLSVFNTLFTSLPVLCIGMFEKDLKP
                     VTLLTVPELYTTGRLSQAFNLSIFLQWIILGTCNSLLITFLNVIAWGETSLSDNTLYP
                     LGVVNYTALIFLINIKCQFVETHNRNWLAFTSVIISCIGWLLWCCIIPRLQKAGKIYD
                     VQHGLYETFGNDITFYATVLVLISLPIMVDIVYKTFIVMIRPTDTDIFARLEQRSEVR
                     KKLEFGAYNEMKQGWTWERDPGTFKTYRDRVFSPRSRANSSASSKNESQMENGRTRTN
                     TTSTSDPENITSNKGEWALNNYDNDKYEMLPSGKLIKRQIAEEDIDSNKNGKSKDKRT
                     SIIPKKLRFTLKDNDEEDEEIRAIIEQRMHDLE"
     gene            <275606..>277024
                     /locus_tag="HG535_0D01400"
                     /db_xref="GeneID:59236156"
     mRNA            <275606..>277024
                     /locus_tag="HG535_0D01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288265.1"
                     /db_xref="GeneID:59236156"
     CDS             275606..277024
                     /locus_tag="HG535_0D01400"
                     /inference="similar to AA sequence:RefSeq:NP_010180.1"
                     /note="similar to Saccharomyces cerevisiae QRI1 (YDL103C);
                     ancestral locus Anc_2.348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144160.1"
                     /db_xref="GeneID:59236156"
                     /translation="MSIMEEFIKAGQGHLFEQLDQLPVEDQKHFMENLKSVSARISPK
                     KLVHDCKEALKLAAANSKTDICIEPLPESSYESIIDNEKARAKYGDLGREAIRRGEVA
                     VILMAGGQGTRLGSLKPKGCYDIGLPSGKSLFQIQGEKILRLQELTGAQKPIPWYIMT
                     SEPTRKNTEEFFVEKEYFGLSPKQVTFFNQGTLPAFDLKGEELLMSSPTALVQSPDGN
                     GGLYRALKDNCIVDDFVAKGIKHVYMYCVDNVLSKVADPVFLGFAIENGFDLATKAVR
                     KRDFSESVGLIATKDGKPCVIEYSEISPELAQGQNKDGLLNLRAGNIVNHYYSVDLLK
                     RELYDWCNNMPFHIAKKKISFYDNKTGETYKPTEPNGIKLEQFIFDVFPSVPLEKFGC
                     LEVDRTEEFSPLKNGLGSSNDNPATSREAYLTLGTSWLKNSGAKVADGVLVEVSSTLS
                     YAGEQLSQFKDVQFNENGTFVD"
     gene            complement(<277143..>279281)
                     /locus_tag="HG535_0D01410"
                     /db_xref="GeneID:59236157"
     mRNA            complement(<277143..>279281)
                     /locus_tag="HG535_0D01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288266.1"
                     /db_xref="GeneID:59236157"
     CDS             complement(277143..279281)
                     /locus_tag="HG535_0D01410"
                     /inference="similar to AA sequence:RefSeq:NP_013886.1"
                     /note="similar to Saccharomyces cerevisiae INP2 (YMR163C);
                     ancestral locus Anc_2.347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144161.1"
                     /db_xref="GeneID:59236157"
                     /translation="MRPELEPSNFEKSGLKMFSSRFPKRNSGIRHPFSSSITFPLLSS
                     EETLSDGTSVDAGGIEYSTQWKRASDRASAEALHDYSPTIVNSETFSKTSALYGSGIN
                     GHVKNSWNDIINDIFQELPFDPNDQFLEEFQYAIVSSDCLNDTGTNRLPCSLGKSIMD
                     FHKKSHSCTGAAVASIATKYGRLQVVSTNKFVLTKTLNYLETILVSFKTLRFLQKLRS
                     NKVKATEKIVTALLIIIYVSIQQELFHLQYTKYKALITLKETLKNLQKFSSLLSKYHL
                     KFKELSVFKTFASECIDNSFKSTLPFIRDLLSSTLDLFFYKVKIVTTNLLSVTNTTTL
                     TKYCEIYSLHNSDLFHYLNNPAIEIEEKAKRFHILKKFTLCCLLSINHFDIRNDLTTS
                     NVLLNFFPDFDIQSTECFHVRDTDKYNIVTDYLHELNTFIITLCSSLNGHKSVLYASE
                     GLTSSSSSESHQEIQTQRQKKYSNDLRNCQKTSMMVNSLKRLEDTLLQSPNGEFSSET
                     NEIVTATLEKLLTLWRGKARKNKQDTKLSPTLSSNRGFSLNVLQSSTSSILTDPTATR
                     KAYLDSAIDFNEVEETQSDIEIDSESEDPNTIKFLQQKKGYRPKDKFQGLSDEELRGK
                     LNEGILKFAVENNRGKERLRTQKSFELLRKATRKEKYRQFETRPSTVRDASTKYSSNM
                     TSGSPYKLKFSSEESIPVLYEVRELLGESH"
     gene            complement(281126..281199)
                     /locus_tag="HG535_0Dtrna8V"
                     /db_xref="GeneID:59236665"
     tRNA            complement(281126..281199)
                     /locus_tag="HG535_0Dtrna8V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59236665"
     gene            complement(<282292..>283509)
                     /locus_tag="HG535_0D01420"
                     /db_xref="GeneID:59236158"
     mRNA            complement(<282292..>283509)
                     /locus_tag="HG535_0D01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288267.1"
                     /db_xref="GeneID:59236158"
     CDS             complement(282292..283509)
                     /locus_tag="HG535_0D01420"
                     /inference="similar to AA sequence:RefSeq:NP_013887.1"
                     /note="similar to Saccharomyces cerevisiae MSS11
                     (YMR164C); ancestral locus Anc_2.346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144162.1"
                     /db_xref="GeneID:59236158"
                     /translation="MSEFSFHVNEEKDDSIQAQPKSKANYKRELNMIVSDAMAKNSKQ
                     LLYAHIYNYLISNKRYESAKQFLLEADVPIYEQRNAKQGNTGGISNVQGPKDLLPTKM
                     LMDCEDTFLLEWWKCFSALHGSVGGTTGTVNTNHADQVPIIPMTHADPVNVATLSRLQ
                     SETLSSKANPNGFQQPLSSMFPTMNPYALYGNPQAYWSSNFAPNQLEPQQLQQQLQQQ
                     QQQQQQQQQQQQQQHQHQHQHQHQHQQKQQQQQQQQQQQQQQQQQQNQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQLQQLQQQQFIHQQQQQSEANSRNFADGNIA
                     FMQQQAQQYQFYLQHQHLQQQQMQILQQQQQQQQQQQQQQQQQQLQQQQQQQQQRQRQ
                     QQSKNQKQQRLKK"
     gene            complement(<283980..>286379)
                     /locus_tag="HG535_0D01430"
                     /db_xref="GeneID:59236159"
     mRNA            complement(<283980..>286379)
                     /locus_tag="HG535_0D01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288268.1"
                     /db_xref="GeneID:59236159"
     CDS             complement(283980..286379)
                     /locus_tag="HG535_0D01430"
                     /inference="similar to AA sequence:RefSeq:NP_013888.1"
                     /note="similar to Saccharomyces cerevisiae PAH1 (YMR165C);
                     ancestral locus Anc_2.345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144163.1"
                     /db_xref="GeneID:59236159"
                     /translation="MQYFGRAIGSVSKTWSSLNPATLSGAIDVIVVDHPDGTLACSPF
                     HVRFGKFQILQPSQKKVEVLVNGKSTNIPMKLGDSGEAYFVFETTSDVEGIPNELLSS
                     PVISATSSPPESPKSSRTELDNSYEISTNDEDNENNNENENNDNSNDRRGNSNDQKKE
                     SSGPSTLEEPDFLDINDVGPDADLNIPLLTGKDSVPISKTKIFQEKLNKKLTQIHIPS
                     KLDNNGDLLLDIEGYKPNKDKVHNADNQLKQLLQEELGTEFDISNFIKEDSEGNVRIV
                     NPFEKHLGTPLVSPPASADESASNLESKFDSADSSAFSLSSDSESHLESKENSETSSG
                     HHYIKTLRLSSDQLKCLDLKYGENEVTFSVDQGRAVTTAKLFVWRWDVPIVISDIDGT
                     ITKSDALGHVLTMLGKDWTHVGVAKLFSEIYKNGYNVMYLTARSAGQADSTRSYLRSI
                     SQNGNHLPAGPVILSPDRTMAALRREVILKKPEVFKIACLNDIRSLYFDQKSMKGESV
                     DDEEGENPDEKPTPFFAGFGNRITDALSYRTVGIPSSRIFTINTEGEVHMELLELAGY
                     KSSYVFINELVDHFFPPVACIDDEQRSIASTPGSPQNNTMDMEANTDSNFLFRSNQEN
                     RFTDANFWREPILKLDDLSELNDSDVEQPSEARPLATDKKESSELHKYNTGDRSWSSQ
                     YDADLCTPKKKRATSSRDEIGKRIYLGLGSPLSSPKINYIDTKDLAQGLDKISLSKPA
                     PAISGVSKVSVMDDVHSPSTKEAGQLSSDHDGDDEYNHDTDEEEEGLDDEFDEDEFID
                     T"
     gene            complement(<286945..>288063)
                     /locus_tag="HG535_0D01440"
                     /db_xref="GeneID:59236160"
     mRNA            complement(<286945..>288063)
                     /locus_tag="HG535_0D01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288269.1"
                     /db_xref="GeneID:59236160"
     CDS             complement(286945..288063)
                     /locus_tag="HG535_0D01440"
                     /inference="similar to AA sequence:RefSeq:NP_013889.1"
                     /note="similar to Saccharomyces cerevisiae YMR166C;
                     ancestral locus Anc_2.344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144164.1"
                     /db_xref="GeneID:59236160"
                     /translation="MWNYTSSIPVAHYHHDHPHMKPTRAFAHQGAGDDDDSDKDDDNN
                     KQNGSARRSLEENNSPLLLCIVAGGIGGAIGDTSMHSLDTVKTRQQGAPSVPSYRNML
                     SAYRTIFMQEGFRKGLYGGYCAAMLGSFPSAAIFFGTYEYFKRKFIDHWKINETISHL
                     SSGFLGDLFSSIVYVPSEVLKTRLQLQGKYNNPYFNSGYNYKNLRDTVKTVIKAEGAG
                     ALLFGYKATLARDLPFSALQFAFYEKCRQWAYKVENKDIMKDELSLSSEIITGAVAGG
                     LAGILTTPLDVIKTRVQTQQPINPNKYTSSAKPANLSNSLFFSLRTVYKSEGILGFFS
                     GVGPRFIWTSVQSSIMLLLYQIALRDLNEFFPRSDKIK"
     gene            <288367..>289743
                     /locus_tag="HG535_0D01450"
                     /db_xref="GeneID:59236161"
     mRNA            <288367..>289743
                     /locus_tag="HG535_0D01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288270.1"
                     /db_xref="GeneID:59236161"
     CDS             288367..289743
                     /locus_tag="HG535_0D01450"
                     /inference="similar to AA sequence:RefSeq:NP_010179.1"
                     /note="similar to Saccharomyces cerevisiae QRI7 (YDL104C);
                     ancestral locus Anc_2.343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144165.1"
                     /db_xref="GeneID:59236161"
                     /translation="MRAMKGSMISLHYSLFSHLWQYSHLDKSFLFSVPGRKAEARRLS
                     DRWKRSKANKSANRGCPLLDVQYTDQCYMNALGATRRVAWSKIWGFVSRGYKILAIET
                     SCDDTCVAILNRHTKNEPPKVLAHLKDTLNSDSYGGIIPTKAHVHHQLKIGSLTLQAL
                     RETEASDIDLICVTRGPGMPGSLSVGLDFAKGLSVAWKKPMIGMHHMLGHLLLPRMST
                     NGQAPCFPFLSLLVSGGHTVLVLSKSVLEHEVLCDSMDIAVGDSLDKCGRELGIKGTM
                     IAKEMEKFIDQDPLCSKNVKIKMKLPNPLQNKPSRVDAMAFSFSPFISAVKNNLEKPL
                     QEYSEEEIRSMAFQVQEATFAHIITKLKKVIELNRESLGNVKHFVCSGGVGANKRLRV
                     LLERSFANDFESFHYPPLDLCSDNAMMIGWAGIELSEFSGLRSSLDMTPIRKWPLSDI
                     LNVSGWVH"
     gene            complement(<289772..>290959)
                     /locus_tag="HG535_0D01460"
                     /db_xref="GeneID:59236162"
     mRNA            complement(<289772..>290959)
                     /locus_tag="HG535_0D01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288271.1"
                     /db_xref="GeneID:59236162"
     CDS             complement(289772..290959)
                     /locus_tag="HG535_0D01460"
                     /inference="similar to AA sequence:RefSeq:NP_010178.1"
                     /note="similar to Saccharomyces cerevisiae NSE4 (YDL105W);
                     ancestral locus Anc_2.342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144166.1"
                     /db_xref="GeneID:59236162"
                     /translation="MSNPSNKRARSPGDADEEGVSKRRGAEGYNVETRDIGAGTEFEV
                     LQAYRKFEEAMNQDRVQVARTGDIKIAMDSLDKVDALYKKVEGTKNNGLFAHDARAMV
                     CISELAEISVRNLKFDDGKSLVNLHDIVNSLKKYMLKEYLASSGGSENLITSDAYTVS
                     NSESPNGSPKEPKESAASHVEGDLEVSEVDRFKEGIIRRTHLQQFATYNEFDQFNWSR
                     MGALFEHLSKMPQSVDHLLGPLSLTRKARSVINRRERETVGAAVTAEKVTQNSLSSVQ
                     EATTPEHVRRCFKVLLKKKGHEAINLYEFIIDPISFSKSVENLFYASFLVKEGRVVME
                     EDAQGFPCVRIKEELPRDPQEKAIEAQKRRDAQQNHIIFQLDMPSWRTFIDKFNIKVA
                     FLE"
     gene            <291642..>293837
                     /locus_tag="HG535_0D01470"
                     /db_xref="GeneID:59236163"
     mRNA            <291642..>293837
                     /locus_tag="HG535_0D01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288272.1"
                     /db_xref="GeneID:59236163"
     CDS             291642..293837
                     /locus_tag="HG535_0D01470"
                     /inference="similar to AA sequence:RefSeq:NP_013890.1"
                     /note="similar to Saccharomyces cerevisiae MLH1 (YMR167W);
                     ancestral locus Anc_2.341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144167.1"
                     /db_xref="GeneID:59236163"
                     /translation="MGASIRRLDESVVNKIAAGEIIISPVNALKEMMENSIDAGATSL
                     DVLVRDGGIKLLQISDNGSGISKEDLPILCERFTTSKLSKFEDLESIATYGFRGEALA
                     SISHIARVTITTKTAADRCAWKASYSDGKMLEPPKAVAGKDGTVILVEDLFYNMPSRL
                     QALRSPSEEYGKILDVIGRYSIHSKSIGFSCKKFGDSQFALTVKMDSTDEDRIRTVFG
                     NSVSKNLLDIALDADTELNIMSVKGKVSNPDFNCKRSIPPVFFINNRLVSCNPLARAL
                     RQVYSNYLPKGNKPFIHLSIMIDPKSVDVNVHPTKREVRFLHQDQIIEKINSQLNENL
                     SHIDTSRSFKASSILTGRQLGSSLETGSKANEHYQHISATQNSGFVQKDYEAKTSKRY
                     ENKLVRTDASQSKITSFLQSNPTPLIRGSSQVLNNKDAVPNSDISNDLEEPTQVATLS
                     SREFTKGNKSYKIVTKERVNVNLSSIKRLREVVDNSTHKELTNVFANLTYVGIADEER
                     RLATIQQDLKLFLVDYGAVCNELFYQICLTDFCNYGSIELHSDSKENLCLVNLLIGFQ
                     HLEKDEINRIVEKIWEMRDMLLEYFSIRLESDEKDVDQHVGSIRLSGLPLLLKGYNPP
                     LLKLPFFIYRIGTKVNWEEEELCLDGIMRQIALFYVPEIIEQVDECDQSLSEEDKITF
                     VAKSNEMSSTLENVIFPCIKRRFLAPQKLVTDVIEIANLPGLYKVFERC"
     gene            complement(<293854..>295710)
                     /locus_tag="HG535_0D01480"
                     /db_xref="GeneID:59236164"
     mRNA            complement(<293854..>295710)
                     /locus_tag="HG535_0D01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288273.1"
                     /db_xref="GeneID:59236164"
     CDS             complement(293854..295710)
                     /locus_tag="HG535_0D01480"
                     /inference="similar to AA sequence:RefSeq:NP_013891.1"
                     /note="similar to Saccharomyces cerevisiae CEP3 (YMR168C);
                     ancestral locus Anc_2.340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144168.1"
                     /db_xref="GeneID:59236164"
                     /translation="MRDGASAETKRSAHPCPICAKRKVKCDRLIPCTNCVKRGQEKEC
                     IEANRKSELETNSYLSFTKILQLWQKYEYWIMDIGLLKTDNTKVADNFVDVSDDLQEC
                     KYWMTFLKRDQSFKLLDYSMERLGALYFGCFSDIGELYLLLEEYWQRRDMESGNTEDP
                     PLFSSDDYYSDTLLWSLFTLTVYYMPLKELRKVIPLPLNHQPLSKSIREENDEQKWTE
                     DVKIDIIGAFTECTVSQLYCAKFLSTADVRLVQIYLILANTSFPWTNICLANSMRIIC
                     FQISKAFHLNDFKLSMSDSTLLRLTKLNCEKLWYRLCICDYLHSNPNSNICFHTELSS
                     LLQHAAYLEDLPNVDVYQSEQNFEVFFWKIVSLDRDLDQYLTKDIKPPLKTLDAIQRQ
                     IEIFNEKHSMEQESNILKSDFEKFLITYLLRMISWKLYKIYFIYHDAANSFDKSIHYA
                     KSLISLIVRNIRQSKKIIFNSHYMVLQSVVRISSFYAFYSLFKQSDAVEELNLDISEL
                     ISNLPSVFKSKLVNLQYLLSRFSYLRTIWTTVQLKDTSDYLKHPVIEILQNDVDSVSQ
                     RFQQFPSLIRNVNSISRKRSFDDHQSNVIEHNSLRQIISRFESQHPIESAIA"
     gene            complement(<296144..>297655)
                     /locus_tag="HG535_0D01490"
                     /db_xref="GeneID:59236165"
     mRNA            complement(<296144..>297655)
                     /locus_tag="HG535_0D01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288274.1"
                     /db_xref="GeneID:59236165"
     CDS             complement(296144..297655)
                     /locus_tag="HG535_0D01490"
                     /inference="similar to AA sequence:RefSeq:NP_013892.1"
                     /note="similar to Saccharomyces cerevisiae ALD3 (YMR169C);
                     ancestral locus Anc_2.339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144169.1"
                     /db_xref="GeneID:59236165"
                     /translation="MSLFEILNAPQVGWDDKVPVGLFIGNEYVASEGNEKIDTFNPAT
                     GEKLTSFYAAGVNDVDKAVKAARKCYKTVWSKTSAEDRGKLLYRLGELIEKNRHKLAA
                     LETLDSGKPYHSNAQGDLDQIIQLTRYFAGGADKYTKGQTVPLKHEKYALTFKVPYGV
                     VGQVIPWNYPLAMASWKIQGCLAAGNTIVIKPAENTSLSLLYMAQLFTEAGFPSGVLN
                     VVPGLGSVAGAALANHPDVDKIAFTGSTAVGQKIMQIAAQSNLKDVTLECGGKSPAVV
                     FDDADLDNSVEWIAGGILYNSGQNCTANSRIYVQETIYDEFLKKFKSHIQSEWRFGTR
                     LDPFDKECTLGPVISEVQYKKIRAYVDHGVNEEKLNIITLGDFPANSKGYFIPPIFFT
                     DVPQISKLNKEEIFGPVAVISKFKDYDEAIELANDTAYGLASAVFTENIRLANRFVRD
                     INAGTVWVNSSNDEEISVPFGGFKSSGIGRELGESGVTAYCQTKAAHFNISDY"
     gene            <297934..>299448
                     /locus_tag="HG535_0D01500"
                     /db_xref="GeneID:59236166"
     mRNA            <297934..>299448
                     /locus_tag="HG535_0D01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288275.1"
                     /db_xref="GeneID:59236166"
     CDS             297934..299448
                     /locus_tag="HG535_0D01500"
                     /inference="similar to AA sequence:RefSeq:NP_013893.1"
                     /note="similar to Saccharomyces cerevisiae ALD2 (YMR170C);
                     ancestral locus Anc_2.338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144170.1"
                     /db_xref="GeneID:59236166"
                     /translation="MTLTKEISLPSGAKYTQPLGLFINNENVDSSCEDVVKSYNPATG
                     EAIVAIQAADPKKDVDRAVKAARDAFGGWKNLPATEKRDLFYKLCSLIEENLELLAEV
                     ESLDTGKPVETNAKYDIQELIAVLKYYAGWIDKNNGQSFVPQPNKLCYTVHQPLGVVG
                     CIIPFNYPLAMMSWKWTAIATGNTAVFKSAEQTPLSILFFAQLVAKAGFPPGVFNVIS
                     GLGETVGDSLVKHLGVNKIAFTGSTKVGQIIQRNASVNLKPITLECGGKSPLMVFDDA
                     DIDQAVKWTAFGIFNNMGQICSGTSRCFVQESSYEAFLTKLAKHVEDEYIVGNPIHAK
                     TVVGPQISKDQQSTVQKYIKIGIDEGCRVVLGGLGLPEIVENDEQLSKGYYVKPTILA
                     DVKNHFKIAQEEIFGPVIVIGTFKDFDDALEIANDVQYGLGSAIFSKDLVKCHKFAHN
                     VEAGMCWINSSNDVDINVPFGGAKMSGFGRELGSYGLSNFTSVKSVYVNLGDQL"
     gene            <299842..>301392
                     /locus_tag="HG535_0D01510"
                     /db_xref="GeneID:59236167"
     mRNA            <299842..>301392
                     /locus_tag="HG535_0D01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288276.1"
                     /db_xref="GeneID:59236167"
     CDS             299842..301392
                     /locus_tag="HG535_0D01510"
                     /inference="similar to AA sequence:RefSeq:NP_010177.1"
                     /note="similar to Saccharomyces cerevisiae PHO2 (YDL106C);
                     ancestral locus Anc_2.337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144171.1"
                     /db_xref="GeneID:59236167"
                     /translation="MSGYGESEEHFASDFNTGFDILSEENHEEEQHQQQPEHGSRLEW
                     EHNGDDQHESHDIAHGGSRAAGDEGEVLGNSHNSIEIMKPSKFEGDILPNEANPNSNY
                     EDDKRHSRPRRTRARGEALDLLKKEFNSNPNLTSQRRKKISESTGLPEKNVRIWFQNR
                     RAKYRNKKGEQRDASNGAADQGGSDPLARYSSPDCLTFFDKIPLNINNNYYFIDICSI
                     TVGSWNRMKSGALRKDNLEIIKDLSNLSPISINEIMSNATDLLVLISKKNFEINYFFS
                     AMANNTKILFRIFFPINAVINCSLSLETDDIIESSSGQRDGDKTESKVVGSRKDEDGD
                     KEFNEKFAELKITVSRPPNFAVYFLDASDEATKNQWSICEDFSEGRQVNDAFVGGSNI
                     PHALKGSQSSLKFMNSLILDYNSTNQIIPPPPVPNAHDTGLLDVQPLSLQQQQQPFFD
                     HYDATGDLLNINRGSPSIVESVHQDNINLQETNNTNLLSLPHENHLPSISDFFKNSNE
                     LTDDNRWL"
     gene            complement(<301755..>303488)
                     /locus_tag="HG535_0D01520"
                     /db_xref="GeneID:59236168"
     mRNA            complement(<301755..>303488)
                     /locus_tag="HG535_0D01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288277.1"
                     /db_xref="GeneID:59236168"
     CDS             complement(301755..303488)
                     /locus_tag="HG535_0D01520"
                     /inference="similar to AA sequence:RefSeq:NP_013894.1"
                     /note="similar to Saccharomyces cerevisiae YMR171C;
                     ancestral locus Anc_2.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144172.1"
                     /db_xref="GeneID:59236168"
                     /translation="MISVASLLISLSVLDDGVFCHLIPRSLLNFDEGDTSEYDVPLQS
                     GEEVSISSDEDEINLLLFSLVTMILVYAFVCCVYILIRFFVRNVFARDNRISLLNDDD
                     ENRRHRRTTERLNARWPNILDDQELVKNKLVRLSPEEQFYYKQGEEYIKQNPPLIVPH
                     AQSSQEQIEDPVIDDTTRQYINDEGAYAWEFQPDPNLPNDTIIVENKTEITFLNFNYE
                     ASIMTNLPIPRINRVYYCEFKIFELNNSGDNGGSFASNHLEDGQTISFGLSTCPYPYF
                     RLPGKHHHSIAYDSNGARRFNDSFELEPKLGTLFPRLEKGDVVGIGYRSNSGTVFFTR
                     NGKKLKEDSVGGHVKGWKFKYVYPIVGSNVPCKVHVNFGTYGFVYIEANVKKWGYAKS
                     NGTKLPPPSYEEYGQDTLLESGCEDEGSDNETNSSINDGDIIDSQGELLPPPPSFQYS
                     TSPNFENSLGRNVEEIDLDSLPIEPPSYSDDEQSSKLKSNAPKVGSSSRHINPGVQAI
                     EEEVDGFTDDEHEDDPDNVGDMENLNGNDATANDENDENGNNGNNGNNGNTGNNGDTK
                     GNTLANQFIQD"
     gene            complement(<303911..>306661)
                     /locus_tag="HG535_0D01530"
                     /db_xref="GeneID:59236169"
     mRNA            complement(<303911..>306661)
                     /locus_tag="HG535_0D01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288278.1"
                     /db_xref="GeneID:59236169"
     CDS             complement(303911..306661)
                     /locus_tag="HG535_0D01530"
                     /inference="similar to AA sequence:RefSeq:NP_011374.1"
                     /note="similar to Saccharomyces cerevisiae HUL5 (YGL141W);
                     ancestral locus Anc_2.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144173.1"
                     /db_xref="GeneID:59236169"
                     /translation="MLNFTGQSRRRNINLGNRTVTSKQDLLAKAQLEREKRAQNRQRE
                     QAAIVLQCYIRRHQAIKMLFTDLLPSIPKEKVKHIIPAFGCLLHTFLTKESTLEIIKH
                     SSSLTTYPGTLGNLQIFSLISSYDDASIMVETLKCINLKKETKEAFLNALKSFLKKTR
                     SLEEESARALLHVMMVWKLNSSEIITPLFEINASEALYPKIVLDFYQFLASEGIFPKP
                     NKNSSSLLENLSYIYFNTPEKQKGLEHCIASCFRNLHYTPVNRDLEAYVTELYETSFI
                     DKIAGMIEDPNSYDIDMENVIGYIEGAADDNSKNSMLIALLSRSSFLRQSYIAFKQHN
                     NVWTSEDQSRASFILFTRLLQMHLLVSTDHELLSGSSGFTDQDLTEFTTDLKHFVFSN
                     IWEPTSESKTNMADAALPLLQKLYLRDSRLHFCSTKNDPQFWCNKNPEFLRVSPFKYI
                     EDYERLYREYADRREDMFSEADDDTGVDDLGSMKYEILNHLSLSYKNSVSTRQFKKLE
                     ILIKAPFFIPFEQRVNLFYMFIAIDKQRLNLSDDSQMMALLMPWNLGAHSRQSATISR
                     EHVLEDACNAFNGIGERFKSKLAVTFVNEFGPEAGIDGGGITKEFLTSVSDEGFKGDK
                     YHLFDTNDQHELYPSTEFDSQKLTYMWFMGKIVGKCLYDHVLIDVTFADFFLKKILNY
                     SSKFISSFDDLYSLDVSLYSNLVKLLSMSSEQIEALDLSFEINSNKNDSQVVQLIPNG
                     SNIKVSKSNVLLYIFKVADFKLNRSLNKQIRNFHGGMSMVIAPHWMEMFNSVELQMLI
                     SGGGKDIDLKDLRDNTEYGGYLDTDKSIQAFWEILKEFSPEERLNFIKFVTSVPRAPL
                     QGFGSLEPKFGIRNAGGELDRLPTASTCVNLLKLPDYQNKELLRRKLLYAINSGARFD
                     LS"
     gene            <306888..>308636
                     /locus_tag="HG535_0D01540"
                     /db_xref="GeneID:59236170"
     mRNA            <306888..>308636
                     /locus_tag="HG535_0D01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288279.1"
                     /db_xref="GeneID:59236170"
     CDS             306888..308636
                     /locus_tag="HG535_0D01540"
                     /inference="similar to AA sequence:RefSeq:NP_011373.1"
                     /note="similar to Saccharomyces cerevisiae GPI10
                     (YGL142C); ancestral locus Anc_2.334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144174.1"
                     /db_xref="GeneID:59236170"
                     /translation="MSNVLLLILALRVLNSFLTRTYFQADEFWQALEPAHFKAFGYGH
                     LTWEWEHGLRSYAFPLLFELGYRSVKLLMIIQNHFLAAIAYIVDIIPLTTDWGSKLTY
                     YADVYSTICEYYMVLYTPKIIMSAVAATGEYYTIKWIQKIYLLTMDKSSDSKAVERLP
                     KLTQISVLLTLTNFFNCFIITRTFINSFEMCSTCVALFYWDWSGGVFIESKEFTTSLA
                     IAMFTCLQRPSNGLIWLILGGYLILNLLFAGQTMKIAYLLRKVALVLISTVACNALID
                     YYFYGSFVLPVFRFLKFNLTTSLSSFYGVAPWHFHVAQSLPIILGYSIPLFAYGMLTP
                     QTKKKFPHFWMNPYVQVKTVIVFNLVIYSLLQHKEFRFIYPLQPLFILISSVSAINIL
                     DRFKANQNKLKNLTYALSFISVLVACILNLLLEGGVISVVIDLHKGSDIHSIGFIMPC
                     HSTPWQSHLHRNDINTLWSISCDPPLHLLDDSDAQNKLLLYMDRSDYLYENIPKFIHN
                     NFPPLTSPLNEGLEKEFRYEWPQYLIIFEHLDDAFMKSFLQGTPYVQSTRYFNTFSHW
                     DHRRRGDVIVYKRTDL"
     gene            complement(<308631..>309872)
                     /locus_tag="HG535_0D01550"
                     /db_xref="GeneID:59236171"
     mRNA            complement(<308631..>309872)
                     /locus_tag="HG535_0D01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288280.1"
                     /db_xref="GeneID:59236171"
     CDS             complement(308631..309872)
                     /locus_tag="HG535_0D01550"
                     /inference="similar to AA sequence:RefSeq:NP_010176.1"
                     /note="similar to Saccharomyces cerevisiae MSS2 (YDL107W);
                     ancestral locus Anc_2.333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144175.1"
                     /db_xref="GeneID:59236171"
                     /translation="MDSMPCAFHIRTKSEVRKGTLLTALLACRIYYGPAMFRLSVQIA
                     KRYYGNFSALKRPPFNEIFPPKRMINKILFDLDSRYASGKLYVVYESVYNNLDKENYT
                     REFPNSFNASDVMIMKKVLEKVRHRTKSINKHLLELENSLLDSAAEMGNKDAVALLAF
                     DVLKDPSQNTSEDVEYSKLLIKDLYKRKHHLTLKLTGDLAFKNNNLKEAENYYKQFLD
                     VEDDTFLAGEVYGQLGLIGLRASNLADAERFFLKSIQLSPLKYSVHSYFYLSQMYMSS
                     DPLKARTLMENCATQGFKESFRSLGYLEMNYFKDYYKSQEWFKLGMELFDIECFIGYF
                     DCCCTLKEWAMANKCYKSLQRMAEINPKYRPLLEEFDVARSDKIMTSSQYSFQPVFNK
                     ELIGEAKATEQSIFRSSKWGL"
     gene            <310110..>311315
                     /locus_tag="HG535_0D01560"
                     /db_xref="GeneID:59236172"
     mRNA            <310110..>311315
                     /locus_tag="HG535_0D01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288281.1"
                     /db_xref="GeneID:59236172"
     CDS             310110..311315
                     /locus_tag="HG535_0D01560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144176.1"
                     /db_xref="GeneID:59236172"
                     /translation="MYTVPGLVLSRMLRSFSVSCATRSMDYSHVIVGGGVVGLAIAAE
                     LSKVKSNSVVLLEKNDMIGAETSSRNSEVIHAGIYYPSDSLKTKLCIEGKKIIYNELD
                     PLKTGVSWRKCGKWVVSQTGYEDSIVEQFYRKCKDLNVDVMLLTSEQAKRIEPSVLVK
                     KSVLNSPTSGIIDSHSLMEYLSGVIQSNDGEVITGSEVVDLQYKEGQGYVVAANDRFG
                     DEASIIELRTENLINAAGLYADRICNMLLPNERHMKQYYARGNYFKLSRGGFPPVHRL
                     IYPVPPKNVNSLGTHLTIDLDNQVRFGPDLEYVKSPTDYSPNPANIPAAYEAISTYYP
                     YISLQNLEVSYSGIRPKLGGPGDKTFRDFYIKEEDGFPGFVNLLGIESPGLTASIAIG
                     RYVKRIYHD"
     gene            complement(<311407..>312379)
                     /locus_tag="HG535_0D01570"
                     /db_xref="GeneID:59236173"
     mRNA            complement(join(<311407..312296,312364..>312379))
                     /locus_tag="HG535_0D01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288282.1"
                     /db_xref="GeneID:59236173"
     CDS             complement(join(311407..312296,312364..312379))
                     /locus_tag="HG535_0D01570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144177.1"
                     /db_xref="GeneID:59236173"
                     /translation="MEYTKEKKVGEGTYAVVYLGTKQSTGRSIAVKEIKSSAFKDGLD
                     MSAIREVKYLQEIQHENVIELVDIFLASENLNLVLEFLPSDLEVIIKDKSILFTPADI
                     KSWMLMTLRGVHHCHRNFILHRDLKPNNLLIAPDGQIKVADFGLARTVPSPHEILTSN
                     VVTRWYRAPELLFGAKHYTSAIDVWSVGVIFAELMLRIPYLPGKSDIDQVEVTFRALG
                     TPTDRDWPDVSSFPAYNKLQMYTPPSREELRRRFIAASENALDYLCGMLTMNPQKRWN
                     TVQCLESEYFKEAPSPTEPSKIKIS"
     gene            <312553..>313758
                     /locus_tag="HG535_0D01580"
                     /db_xref="GeneID:59236174"
     mRNA            <312553..>313758
                     /locus_tag="HG535_0D01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288283.1"
                     /db_xref="GeneID:59236174"
     CDS             312553..313758
                     /locus_tag="HG535_0D01580"
                     /inference="similar to AA sequence:RefSeq:NP_011372.3"
                     /note="similar to Saccharomyces cerevisiae MRF1 (YGL143C);
                     ancestral locus Anc_2.331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144178.1"
                     /db_xref="GeneID:59236174"
                     /translation="MISRSLFPRLSFNKYFRLGPTAKKWFSSAAENGFIIDELHPSLI
                     KRVVKYVDDMHSLEALLSQGESFDETTQKRYAKVSFIKDMYERYQQQLQGLEELQELI
                     EEDPSLRDEAEIEFTRLLPDLKGTSNELLNRLIPPHPFAEKPCILELRPGVGGIEAMI
                     FAQDLLNMYTGYAHSKRWKYRIISKNENQSGSGIVDAILSIDEPGSYDRLKYEAGVHR
                     VQRVPATETKGRTHTSTAAVVVLPQMGDDKEVDSFERTFKPDEIRIDVMRASGKGGQH
                     VNTTDSAVRLTHYPSGIVISMQDERSQHKNKAKAFAILRSKLAEKERKEKEDKERSAR
                     KDQVSTIDRSDKIRTYNYPQNRITDHRSGYNLHDMEGIMSGERLDEVIDAIQKFDCDL
                     KAKELLSAD"
     gene            <313953..>315986
                     /locus_tag="HG535_0D01590"
                     /db_xref="GeneID:59236175"
     mRNA            <313953..>315986
                     /locus_tag="HG535_0D01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288284.1"
                     /db_xref="GeneID:59236175"
     CDS             313953..315986
                     /locus_tag="HG535_0D01590"
                     /inference="similar to AA sequence:RefSeq:NP_010174.1"
                     /note="similar to Saccharomyces cerevisiae YDL109C and
                     ROG1 (YGL144C); ancestral locus Anc_2.330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144179.1"
                     /db_xref="GeneID:59236175"
                     /translation="MTNDEPGNLLFFNKSSVGIGDLERYVITYDLYEGDEIPDDVKLD
                     SLWLKVKNIEGLSFRAAYLMGPFMLYCDVRTEDYHHSQKIIASADQPRFESTLQAQQD
                     CIVELSVHRLKPRYVWVVDILSQIVFTTNTKVSFEINVANTKNSLCGEQDCGINNSVS
                     DKITVTRLTTLDVWNLPAEIGLPKKAKHLVILTHGLHSNVSTDMSYLMEQIYKKQENY
                     PDEQIVVKGYTKNVCQTEKGVKYLGTQVANFIIDELYDESVTKISFVGHSLGGLVQSF
                     AIAYIAVKFPWFFEKVKPVNFIGIASPFLGIVTDNPAYINLLLSFGVIGKTGQDLGLE
                     KDSGNNEALLHLLPGEPLKSVLQKFKRRTLYMNAVNDGIVPLYTASMLFLDYDEILQQ
                     LEKRKLQGLQINSSNIDLVSQSHFLSRNIISPFVKILGILAPQKFPSNNPSLPRISFL
                     ESMVSTLVPPLPEKLYITDPSSRNPVIIHDKVYTEEDLPPIAEGGIDAFEGTHNILLD
                     QFMMDRGKPKCQKLEERIAREWHQGLSWRKVVVALKPDAHNNIIVRRRFSNAYGWPVI
                     DHLIDAHFSGEDEESAYEELADKINSDVTNNLSPRSIPDSSDIEPNKNFAWITRVENP
                     RLFDEGPTGMISTMSEMIESFAKSRNALGNDVNLESSTNNNLISYESLDSNSM"
     gene            complement(<316022..>318070)
                     /locus_tag="HG535_0D01600"
                     /db_xref="GeneID:59236176"
     mRNA            complement(<316022..>318070)
                     /locus_tag="HG535_0D01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288285.1"
                     /db_xref="GeneID:59236176"
     CDS             complement(316022..318070)
                     /locus_tag="HG535_0D01600"
                     /inference="similar to AA sequence:RefSeq:NP_116577.1"
                     /note="similar to Saccharomyces cerevisiae TIP20
                     (YGL145W); ancestral locus Anc_2.329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144180.1"
                     /db_xref="GeneID:59236176"
                     /translation="MALTSVHDVLEVEKRISAINEKREQLALRLKRAQEVSVGGNGGG
                     NHNVGDGIMDTMGTDVDSEEYLRSIAKDITSNATSLEGIRRLRTKYGALRVLDVLERA
                     FKQRETKDLALVELGSLREEMDGFEEETSLQELDRVGKRVASVRERLGDDSDEGLAAY
                     NQLNGAVSLRAKVLCGQFKDRLLESKWDTSATISSDTMGDLRRRSTDLYKLSLLIIGN
                     LNHNQSSFFWNFQCIANNFEIKFTYHFHDDSLKMETFFKYMNDYLNKNLYRCISIFHD
                     EVHGITRQLIHEQFIDHVLQPIREKVVSGLSHADSKVLISLISEILNTDKNLETFFHY
                     HGRGMISLVPAEIWDMWLAYEVETATNQFDKLISNPKEMVESSSDFIKLLNKVYSYLK
                     PFYGLEFEPLKKYKLLSCSQIFIKLSSLYLDRLLTINSLGDTHTGEDELNQTLMKLQN
                     INIVYERIIELSEEYIFIHLTDVVNEWESKNYTTLFQNVLEDYRKIMEESVQPTVVHR
                     VKKLLKESLRNYFKLGVWSTVANPDSDTATSELVDAIKLITRIMMKLDSLSIPLAVST
                     CIKNELLNIIVNYFIESILKLNKFSKQGLDQFELDFRTIRDALNLSNDNTNAQEGVLF
                     ELVKVLSLKYDPDGQKFFGTAYIKELNYRDLKNHLRIKTLTDFEIQDALYRIAYGNIL
                     "
     gene            <318382..>318747
                     /locus_tag="HG535_0D01610"
                     /db_xref="GeneID:59236177"
     mRNA            <318382..>318747
                     /locus_tag="HG535_0D01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288286.1"
                     /db_xref="GeneID:59236177"
     CDS             318382..318747
                     /locus_tag="HG535_0D01610"
                     /inference="similar to AA sequence:RefSeq:NP_010173.1"
                     /note="similar to Saccharomyces cerevisiae TMA17
                     (YDL110C); ancestral locus Anc_2.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144181.1"
                     /db_xref="GeneID:59236177"
                     /translation="MCSAGGIRRPVQIEEFKTAIGEMTKEELTRLEQEIENSISHLNR
                     SNSRLQRYIAKLQGTHAGGDEEESEELDMEKVEDGDLQLYQESLRENDILLKNSVERL
                     EALRQEDLYRSSHSGTPEV"
     gene            <318854..>319615
                     /locus_tag="HG535_0D01620"
                     /db_xref="GeneID:59236178"
     mRNA            <318854..>319615
                     /locus_tag="HG535_0D01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288287.1"
                     /db_xref="GeneID:59236178"
     CDS             318854..319615
                     /locus_tag="HG535_0D01620"
                     /inference="similar to AA sequence:RefSeq:NP_011369.1"
                     /note="similar to Saccharomyces cerevisiae YGL146C;
                     ancestral locus Anc_2.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144182.1"
                     /db_xref="GeneID:59236178"
                     /translation="MLLLNASSYVFIVTLYGGIGVCDIVGSVGPEFSPNVHLQLDVMP
                     LKASLHFLPQQMETCVELRSPFEDCTELVFTFAVDDTIPTNGNSGRLSRMQSRISKQA
                     LSFQIINSETREKIRGKRCLKAGTTIVEIDSRGYNYFTVCFINLSFDSSWTAIDTVKN
                     VDIKVTANDFESNPSELARQMKDDTILILQNSAEMLTEIADTDKSTNLITMESYRRDL
                     NEEVFSKLLYSEIIFIIALLASQLLVASYLIKENG"
     gene            <319844..>320638
                     /locus_tag="HG535_0D01630"
                     /db_xref="GeneID:59236179"
     mRNA            <319844..>320638
                     /locus_tag="HG535_0D01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288288.1"
                     /db_xref="GeneID:59236179"
     CDS             319844..320638
                     /locus_tag="HG535_0D01630"
                     /inference="similar to AA sequence:RefSeq:NP_010172.1"
                     /note="similar to Saccharomyces cerevisiae RRP42
                     (YDL111C); ancestral locus Anc_2.326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144183.1"
                     /db_xref="GeneID:59236179"
                     /translation="MLSVTEKLYLYDSLAGSPTVRPDGRLPHQFRPIEIYTDFLPSSN
                     GSSRIIASDGSECIVSVKVKVVDHTVSDDLLQVEVDIAGQRDDSPQVETITAFLNKVL
                     EPTVGIDTSNLTLTKKYSFKIFIDVLVLSSYSHPVSLISFAIYSALKSTYLPKLVSSF
                     DDLEVEEYPTFHDHDLVKLNINPPLVFVTAIIGDNIFMDASASECDVSSNGLIVTWLD
                     GKVIAPIRTTILSDNDVKGFNPQIIPKAIKMIEQYAGDILQALENL"
     gene            complement(<320711..>324985)
                     /locus_tag="HG535_0D01640"
                     /db_xref="GeneID:59236180"
     mRNA            complement(<320711..>324985)
                     /locus_tag="HG535_0D01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288289.1"
                     /db_xref="GeneID:59236180"
     CDS             complement(320711..324985)
                     /locus_tag="HG535_0D01640"
                     /inference="similar to AA sequence:RefSeq:NP_010171.1"
                     /note="similar to Saccharomyces cerevisiae TRM3 (YDL112W);
                     ancestral locus Anc_2.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144184.1"
                     /db_xref="GeneID:59236180"
                     /translation="MSTALFLSNYLTKEAQAALLTDLTNHEKFEQVVDILNSQLVDIS
                     DNAKLCRLLFEKLILKISGVIDVIRSSDNHIHQYSEILESDELKTLAELACKLPHVWA
                     LYEDWLSEKLVRHSVERKEKLFRGDFYDKVFQQLISEFKTKGDTIAKEYDDVEFIALM
                     KVLELSYTFASEASLISCNKLDAIVIGLLACDDETLANTCSNLIKWRVSQISKKCNQS
                     AIFDLLTLKSLKETFKGKHNGAWQQKIGLTLLLRLLLQTPPSPQLVNFMQTDIWDHIK
                     NALIHDSHEYRKLGLSILKLSIQKSSDNMESFESPLFFWNSSEKIKTIQAWEKFTTLY
                     EIVSLESALNQIQAASDYILELFNDPFLPPTWGLILFSTGLRAPMEGIRKYMMSLLFQ
                     VDDPAVFSADIDVLKESILPSAMEAHYFASDGKSCLYGERLVEFVTSVISNSGDQISA
                     ILEALLDVLVKYGTSYDPARIYLSYGVLKSLKEKHVRVISLQHLRYIKKLFEFESEEV
                     LFETTIKSIYLKFLLHVDKSVTPVQWIQAIVTHLKCNENNYKYLTPLMDIFKDFAVTY
                     FDPNTAINEISQYISNDPTFEVLSVILFENDSVIINKSFLLELAISNESVNSYAKEAT
                     DILSQLLLVEDSTSYKSTSLLLDLSCFSSLTWKSIKLKPLFDSLFSDFCPDKLFFFVA
                     AFKKVTDYSTEFDDLKFTEVKDLYSTIQQQIKKSTSIFFKIRDKTYSAYFDFVLVYMK
                     SHSLEVADLTELLNLLKENIDRDNGNFEGNLQVSNICSYLLENYATFQTQENNNPIFS
                     VFLIVSTMWESITSERLVLKQRSLHLSTINCLFHSKVLHYACLTENHHSNSVSQKLCE
                     YGQDILEQAQSRRGVLPLLSSSICSFIKRYGELLGTKNSKYDWIVYLMASIFAMEQSK
                     VSIFQIKPVIAELYDKNICLYSESKNGLYLDIYKSNEIAAKISVIETLITSPASFKEK
                     FVCRLSELENFLTANRKTDGDEERERLLKWQLFVLCIPDINPIMMLEIAEKMIFNGFL
                     TEFSPSIRVYMEWSIALALAENYEEEAAIFLEDKVFSVMNEHSKPILVVGAERICFIV
                     LKALKGKANIQRFMERFTSTLVSNATSNKPLVRHFSNSLTLSYWPLFQKEIKDKTLRN
                     IFEELYKNAQSQKNEGHYRAGDAILWSLYEDITLTGLFGGVLKKIMDHDLPYITKQQF
                     KTHLQVKNSIPIGEDECDLWVGERVTKPKEKITSNSPPTSSQFQTKSGAWEAMFDIDD
                     NETMRNVKRSELIIVSSLVDKAPNLGGICRLCDVLGVGLLTVQDLRVKNHPQFKRVAV
                     TADRWMPIQEVTVEQITEFMRGKKKEGYTLIGLEQTDQSIKLDENFKFPKKSLILLGI
                     EALGIPGHLLSELDICVEIKQFGVIRSMNIQTATAVIAHSYTVQHM"
     gene            <325294..>327288
                     /locus_tag="HG535_0D01650"
                     /db_xref="GeneID:59236181"
     mRNA            <325294..>327288
                     /locus_tag="HG535_0D01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288290.1"
                     /db_xref="GeneID:59236181"
     CDS             325294..327288
                     /locus_tag="HG535_0D01650"
                     /inference="similar to AA sequence:RefSeq:NP_010170.1"
                     /note="similar to Saccharomyces cerevisiae ATG20
                     (YDL113C); ancestral locus Anc_2.324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144185.1"
                     /db_xref="GeneID:59236181"
                     /translation="MNVNDENGYSNYSTQPLNMSAVEHVTHDDEPATSGSNLLAAAVD
                     TAGVEDHDEADDGRSLSEASGSKESSDLKASSVDQSMVHTAITVNDNPFIDQEEKLFG
                     INGNGSTEVYDGRSAKVKPFQNGKSLVNPNDIYQDDLEDLLPLNHGPSETTRNSSGDD
                     SISVSNHNGVPPSSHNDIVAVGNAKHEINRRPKAQILEANKLSEGQGRTYIAYTIRYE
                     DSLVRRRYSDFESLRNILVKLFPMTLLPPIPEKQSFKTYGKAIAGSKSNYLLPSEGTG
                     SVDLSLSVINGSVNNSDERLIRHRIRMLTGFLNKLLQNEEITKTTIISDFLDPNNSNW
                     NDFVTSSATFSSLPKSVLQCNPLDPTNTTRIHASLPVVHSTSQSILNKDSSSATLESK
                     DGFVTIEQDYKRYESILNNGLYKYNRRITKNFHDLKCLIKELGEAYAQFATNQNRGAD
                     LAEQFSHISDTFDEYSIQLDNLVGKFYYNINEPLSECVHMAGSAKDLIKYRKLKLMQT
                     DMIKKSLQNKKQQLAKLQEHEKDVQDVESQVNEEVGSSQKINLQHPQPRSYSGKLFNK
                     FNKLATMVKESVSYQDPDLHTTMESLKKDIKELEKSSKVCESDMTVITEVIKDQQLSA
                     FSKQREQELVSILENYSKYMREYAEKNLEIWREIKAKQAQ"
     gene            complement(<327385..>328254)
                     /locus_tag="HG535_0D01660"
                     /db_xref="GeneID:59236182"
     mRNA            complement(<327385..>328254)
                     /locus_tag="HG535_0D01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288291.1"
                     /db_xref="GeneID:59236182"
     CDS             complement(327385..328254)
                     /locus_tag="HG535_0D01660"
                     /inference="similar to AA sequence:RefSeq:NP_010169.1"
                     /note="similar to Saccharomyces cerevisiae YDL114W;
                     ancestral locus Anc_2.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144186.1"
                     /db_xref="GeneID:59236182"
                     /translation="MVFIGDKGCRFTSDILEFFTNRFSLFDENLLDENTIVLVTGGSG
                     GLGLELVKRLLVCKNKVIIVDIHPPTTDFGTADRVVFYRCDITDYDQVEELYNRIKYE
                     HGTVSILLNNAGLTSISLLKSSSNDDMRRVIDVNFIGAYNMIQIFLPEMIKNNRGYVV
                     NIASILGVITPARLSSYGASKAGLIALHISITRYLRSNYGKNNIKTLLVCPGKLKTTM
                     FQNVETPSKFLAPDVEPSKLAKRILTSIECNATNTLSYPYYTNIVPFFKELNWPHIKA
                     FKKFSGMNKVTAI"
     gene            <328750..>329865
                     /locus_tag="HG535_0D01670"
                     /db_xref="GeneID:59236183"
     mRNA            <328750..>329865
                     /locus_tag="HG535_0D01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288292.1"
                     /db_xref="GeneID:59236183"
     CDS             328750..329865
                     /locus_tag="HG535_0D01670"
                     /inference="similar to AA sequence:RefSeq:NP_010168.4"
                     /note="similar to Saccharomyces cerevisiae IWR1 (YDL115C);
                     ancestral locus Anc_2.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144187.1"
                     /db_xref="GeneID:59236183"
                     /translation="MNDAPEFIRLKRRRDEGSVNSLLIDDQKPVKRVKFVFKLTRTVE
                     QQFYETDGQNSTPLLKLADNEHHHFVLEQNRKRRRESQDKNRGDDDARHQSFDDPLED
                     SSDGDGLPPEISQMLKQHLSLKGTDPDASPTTKIRKRSKRHYTGQAAPVISMPSLDYV
                     YDIYHLEKVTEDEMSKFEKSDVGYVKIVNRDVDLIPDEETDSANAASDDQDSNEEGFY
                     QNDYPEDEDDDRSILFGSEGEEVAADETADLIQSLYDSDRMPSSTENGIELKEQKEYI
                     ELFNQLGSSGDILNSLNAMNFVDLDDRDEDAAVLNYSDLEECCDNEDEMNDTVDDALD
                     HEVEYARNTFFKSDVEDPLAVHRDIIFGKLQDMINKT"
     gene            <330230..>330805
                     /locus_tag="HG535_0D01680"
                     /db_xref="GeneID:59236184"
     mRNA            <330230..>330805
                     /locus_tag="HG535_0D01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288293.1"
                     /db_xref="GeneID:59236184"
     CDS             330230..330805
                     /locus_tag="HG535_0D01680"
                     /inference="similar to AA sequence:RefSeq:NP_011368.3"
                     /note="similar to Saccharomyces cerevisiae RPL9A
                     (YGL147C); ancestral locus Anc_2.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144188.1"
                     /db_xref="GeneID:59236184"
                     /translation="MKYIQTEQFIEIPEGVTVNIKSRVVKVTGPRGTLVKNLKHIDVT
                     FTKLSSKQIKVAVHNGDRKHVAALRTVKSLVDNLITGVTKGYKYKMRYVYAHFPINVN
                     VVDKDSKKFVEIRNYLGDKKVRLVPVREGVDIEFSANQKDEIVLSGNSVEDVSQNAAD
                     IQQICRARNKDIRKFLDGIYVSEKGVIAEEE"
     gene            complement(<331023..>333197)
                     /locus_tag="HG535_0D01690"
                     /db_xref="GeneID:59236185"
     mRNA            complement(<331023..>333197)
                     /locus_tag="HG535_0D01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288294.1"
                     /db_xref="GeneID:59236185"
     CDS             complement(331023..333197)
                     /locus_tag="HG535_0D01690"
                     /inference="similar to AA sequence:RefSeq:NP_010167.1"
                     /note="similar to Saccharomyces cerevisiae NUP84
                     (YDL116W); ancestral locus Anc_2.320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144189.1"
                     /db_xref="GeneID:59236185"
                     /translation="MEIDGPKDVDFFLKSANTLKDFEIEGLDGKTLPDPFNIIKEFRS
                     IAGEASLKFSKTDSEASLDWELEAKLWHILELLLNYRTSDHDLDTIDVHPFNSNAVME
                     KELLQKNRELYQIWIVIVWIQDNMKPVERPSNLPTSKWSNTIISGGLKSCDLDFPLRD
                     SEAEIDPRDKEEDNVFFRYLFELLIAGKFEEAIEACGLTDNLTMSMILTGMQEYMDPN
                     IDTQLGDELETHQGIKKHALWRRAVFSLSQNLELSSYERAIYSFLAGDIPPDKVLATS
                     SWDLALLFYLNKILQTEIENYLLQNNKIEKGELILGGLSSQSPSIQNVLDIISARYES
                     ESEHPLRVLIAAVILDTLPSVLHSSVEVLLDIIKGVTTEDYLGENPYLLRVVTHISIV
                     LDIISPGFVSSSDKSKLITAYVSIMKLRGLYEIIPIYISFLEEEDIIEAFSFILSTLK
                     HPEIRTKQIEIANFLKLPTSNILRKTTQRVFMETEDDYTPKGEIEVTTVVSEVDKHLI
                     LGVEWLIEGKLYIDAMDSVIALSRRFLLNGRIKSLEYFMDHNNIENLIKNYDLEKISN
                     RIFADEGDDKTKELLDYRLLIDELKKHEEWQKIVGLLNSESNIPSLIEKFQEYSRGTH
                     DLIKGFLVELSELESHADKDIFFEIRALYTPYLIIELHKGLVEAASLLRIPTFIKDAL
                     NIANLVANEADKIYLLFQSSGKLKEYLRLVARTATLTGSDFL"
     gene            complement(<333476..>336094)
                     /locus_tag="HG535_0D01700"
                     /db_xref="GeneID:59236186"
     mRNA            complement(<333476..>336094)
                     /locus_tag="HG535_0D01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288295.1"
                     /db_xref="GeneID:59236186"
     CDS             complement(333476..336094)
                     /locus_tag="HG535_0D01700"
                     /inference="similar to AA sequence:RefSeq:NP_010166.1"
                     /note="similar to Saccharomyces cerevisiae CYK3 (YDL117W);
                     ancestral locus Anc_2.319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144190.1"
                     /db_xref="GeneID:59236186"
                     /translation="MSVSVQQLAPPFKVKARYGWSGQARGDLGFLEGDVMEVTKITGD
                     WFYGRLLRNRKCSGYFPNNFVNVLGEKMNQNNANETKVYSKSQPTSPVKVVIPPIPAR
                     LNPRSSVSSSSSSSSLRDVKKKDSSMYKISQHHSTPNLPEVHVHDKLDYGRYKNTRTK
                     KRTSPEFNRYINEADNIPPLPPIPCADKHHGNLTQQKMPKSSSLNDVSTTRSARDPRI
                     SHNGLQAYNGDRNYYYSPSKRSSVTDDSNSSDLFSNSKYMDGSTTSSEDSFALMSDFS
                     ATSAGSLARHRFAQSFSDSLERSQTFSSLESINSGSGNGKMGGILRKLMPRGHPNYSN
                     SPNSPISPTAEYPKLPDIQNLKITSTHDDARDWLTVKAQLNRSRSLTKYEKHPRYIRV
                     LEQNHDLVLHPQDAVSNGLNTNEVRYNGQPGLIDIELAGLNLEYIDDMTRKRCIKDGS
                     MTLSTWSQTTFSARYSTTAETLRGIYIFCAETFELVDDNGGTDFSKPPRDLEKILYSR
                     HCTPFQLTCLFKELSKALGITCEMVYGFLKTPVNDNSDYKYNHCWLRVLVNKEWRFID
                     IILGNISNPIHEFVNNKKITKAEDDYFLVEPLQFIYTHIPQREYEQHIIPSIDRLSAL
                     YLPLVFPSFFKYGLSLYKFSTALSYLEDSEIYECSLEIPSDVELFASVVVSTDDVQRK
                     HSYGKMELALVQVKSHKSDSTRRIAVVKAVLPPGVKKGSLYLHAGLRGEQTSVVNVHP
                     LSMMVPLYHSGTEMKYEFTVRKPSESIQKVEMYIVEPQNRYLFQNNEYNFEIIQKSFD
                     GIIYERSSPTRNRRQPMIIKAPSGKRYEFEKNDPHFAYGTSRTTITVKEPGIWKALVA
                     ADSGCGSCTFAEWLCL"
     gene            complement(<336610..>337740)
                     /locus_tag="HG535_0D01710"
                     /db_xref="GeneID:59236187"
     mRNA            complement(<336610..>337740)
                     /locus_tag="HG535_0D01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288296.1"
                     /db_xref="GeneID:59236187"
     CDS             complement(336610..337740)
                     /locus_tag="HG535_0D01710"
                     /inference="similar to AA sequence:RefSeq:NP_011367.1"
                     /note="similar to Saccharomyces cerevisiae ARO2 (YGL148W);
                     ancestral locus Anc_2.318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144191.1"
                     /db_xref="GeneID:59236187"
                     /translation="MSTFGYIFRVTTYGESHCKSVGCIVDGVPPGMTLTEEDIQPQLT
                     RRRPGQSKLSTPRNEKDKVEIQSGVEFKKTLGTPIAMLIRNEDQRPHDYSDMDNFPRP
                     SHADYTYLEKYNLKASSGGGRASARETIGRVAAGAIAEKFLAQVSNVQIVGFVTQIGS
                     IKMNRDPFDPSFHHLLNTITREKVDSAGPIRCPDPNLAGGMVKEIEKYRGNQDSIGGV
                     VTCVVRNVPTGLGEPCFDKLEALLAHAMLSIPASKGFEIGSGFEGVSVPGSKHNDPFY
                     FDEEKQKLRTKTNHSGGIQGGISNGENIYFSVAFKSVATISQEQETADYDGKPGVLAA
                     KGRHDPAVTPRAIPIVEAMTALVLADALLIQKSRDFAKSVTH"
     gene            <339092..>343468
                     /locus_tag="HG535_0D01720"
                     /db_xref="GeneID:59236188"
     mRNA            <339092..>343468
                     /locus_tag="HG535_0D01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288297.1"
                     /db_xref="GeneID:59236188"
     CDS             339092..343468
                     /locus_tag="HG535_0D01720"
                     /inference="similar to AA sequence:RefSeq:NP_011365.1"
                     /note="similar to Saccharomyces cerevisiae INO80
                     (YGL150C); ancestral locus Anc_2.317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144192.1"
                     /db_xref="GeneID:59236188"
                     /translation="MSLASLLNREDKDIVRRASTPSSGETVVKANGGSESTQRDRERF
                     VERLNRDFDVISQRDLLEHGYQDWKFINFQEFELISEWNNQSKDWSQNDESFRKLYKD
                     MNAIQKEWNSYSKYKEYKAALVEEINEKQRKEQLKKQQLQQQEHQHQQELQEQQQQLQ
                     QENGGTLREHHNGTANDGDKKKRKRRAKRTVTQEVSAQEPDENVENLKRKRKFAEVVD
                     ADVQSGDDNSNKLQEEDTHDVSPKNEQDDRIIDEGESVTEDQENHSEEHEEPDDVEDD
                     LAGGEDDKTSVDDAEEEMIDQEIPIAEDDEYDDNDKDFSPDDENRLKGSGKKNKNVNL
                     DSERSRIVRELIKMCNKNRSAKAKKRRFTNSTVIEYNPLDSKLVLKITLKQFHVKKLK
                     RLINEAKRIAALEEAAKSNPDDQLGSLSPASKKRKILAKNGAVNGNLFAEVNSLASSN
                     INSETKDGLPTYGLRMTAKEARAIQRHYDNTLFTIWKDMARKDSAKVARLVQQMQSIR
                     AANFKKTSSLCAREARKWQFRNFKQVKDFQTRARRGIREMASFWKRNEREERDLKKKA
                     EKEAIEQARKEEEVRENKRQAKKLNFLLTQTELYSHFIGRKIKTNELEGTMSDSQLAH
                     SMDLGHDGIDLDNTEANKNEFHNIDFDNEDDEQLRIKAAQNASNALAETRAKTKQFDD
                     DANGEELNFQNPTSLGEITIEQPKILACTLKEYQLKGLNWLANLYDQGINGILADEMG
                     LGKTVQSISVLAHLAENNNNWGPFLVVTPASTLHNWVNEITKFLPQFKILPYWGNAND
                     RKILRRFWDRKNFRYTKDSPFHVMVTSYQMVVSDVGYLQKMKWQYMILDEAQAIKSSQ
                     SSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDSHDEFNEWFSRDIES
                     HAEANTKLNQQQLRRLHMILKPFMLRRVKRNVQSELGDKIEIDVLCDLTQRQAKLYQV
                     LKSQISGAYDAIENAAGNDDASDQNLINTVMQFRKVCNHPDLFERADVSSPFRFVDFG
                     RAGATGKNGEIADVFYSTKNPIKFHLPRLIYDDLLLPNYENSITAAAKLVNHTMNILN
                     PNINKELTQTLSLLTGLASSKFAEILNKSLVERILDFSREKEPLPERLSLLYEGDLNF
                     NPRYEIPVVDKLKRVQNLGKITTDGVLSSLLNIKESVYTQQYLNSLHPAFHPGASAAP
                     ISIDVKGCSNVSGKVERELFDPVMSTALSGIPVETQYNMHITKGIPVEKFPVSELHPP
                     ALNKFFSSYISMPSMDRFITESAKLKKLDEMLVDLKKGGHRVLIYFQMTKMMDLMEEY
                     LTYRQYKHIRLDGSSKLEDRRDLVHDWQTVPDLFVFLLSTRAGGLGINLTAADTVIFY
                     DSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLVRGTIEERMRDRAKQKEHVQQVVMEGK
                     TMDKKIKTIEAHSDEVNMELKQ"
     gene            complement(<343617..>346943)
                     /locus_tag="HG535_0D01730"
                     /db_xref="GeneID:59236189"
     mRNA            complement(<343617..>346943)
                     /locus_tag="HG535_0D01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288298.1"
                     /db_xref="GeneID:59236189"
     CDS             complement(343617..346943)
                     /locus_tag="HG535_0D01730"
                     /inference="similar to AA sequence:RefSeq:NP_011364.1"
                     /note="similar to Saccharomyces cerevisiae NUT1 (YGL151W);
                     ancestral locus Anc_2.316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144193.1"
                     /db_xref="GeneID:59236189"
                     /translation="MKALIEYEINRQDIDTHSSIGLSSRIFSDCGMEFESVSKLALRC
                     ADRQIAAADFLNLYKEFYNEKVTNRLEHADTPNDDSELSNICSTLASDFVELLTTHDL
                     LILADYAVEVLFVNYNSNLVRCFLPHMYSIENISMLQHFLSHSCSFFANLTDAIVIDQ
                     VCADLSDSILPNILSTNATGGNNLIIARSKLLHDILACIPSNVTISSDSVRDNLHELT
                     SQLSKINKLLFKKLNYIIESKLVFKDAQVSLKRDSTHEAISSPSITSPQFIASPFSMA
                     KNTMTKGNNNLKYQDMKLLRYFKNIWLNNKIFNWETGHPEYLQKYASIASSVFQESHI
                     KLQPFDLAIADLIETSFTCFAQFVSNKQYHQSNSYFSLLERQWIIFITKQIPLLVLQH
                     VPESPQIVTTALDNIDGKVMKSIRTYYSEKDDFKNRNEDLFDNYPSTSLDIRHDFIKN
                     LIRLNLQSPNVIMKYLREDQMIDVKALLVTDDLVLKNSQGVQEVVKDIDSFISTSLDS
                     LEVELIGNSASENCDGVQQILNDFENISPTKQKELSHCLISMLDDATKNLDFNRVTKI
                     CALLSFNFSHSLTSMLAFVTPSKVCEILMRFVDKTWQTSVDVKRKEFGDSEFETMNIF
                     LSFSWSLLLLIVIAQTYDFSLINVAVKSPHLRTQDSFTLLFISKLTEIPDVFSLDLEK
                     PNDKEIQMASNLMVENWLKDLFINGSISDSLLQSINAKQLSLLVPFIFKQILLGFEVG
                     SINKVSDVVGGLEYFLQPFMLIGLIKVVYWLEQYLCSLKSDTISDGLIENIFMLLNVI
                     FNPSSLNEDSASFHSAVLRLNATKLLKVLRRFRVQSQSNYGIYSSEATGNPDLELLIK
                     KFLTVLQISPNYNIDPRILNTENDYPQKHLGYSSFLILNETPINKIMTNQINSFWNLH
                     SSTYYNLDYLNYIIDLVTPRYFLVDVFRTLEYKLATYGVPGTRNKIISVESESVLNYF
                     FYFLVLNDIKSPADALELLSLMDSNSANSIVDGAYLKLEGSPKQETAPDDDFDMLFGE
                     NDTSIQGAEDLPVSQPNNEIQANQDTIVPIRRSFGLIIHEMKKNYELAVSSGDVSKEN
                     YDKICKYHEKYLQVLKSCNF"
     gene            complement(<347044..>348084)
                     /locus_tag="HG535_0D01740"
                     /db_xref="GeneID:59236190"
     mRNA            complement(<347044..>348084)
                     /locus_tag="HG535_0D01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288299.1"
                     /db_xref="GeneID:59236190"
     CDS             complement(347044..348084)
                     /locus_tag="HG535_0D01740"
                     /inference="similar to AA sequence:RefSeq:NP_011362.3"
                     /note="similar to Saccharomyces cerevisiae PEX14
                     (YGL153W); ancestral locus Anc_2.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144194.1"
                     /db_xref="GeneID:59236190"
                     /translation="MSTVQKDRKQLLESAVSFLSDPSIKNAPLTKKVEFLQTKGLSQE
                     EVEAALRQSQDQSKPENLADNTQWSAVPTRNDYVYEAVPPPLPRRDWKDYFIMASVSA
                     GLIYGVYEFTKRYVVPNILPESKSKLEQDKKEIQDQFSRVDKVLDAIEQEQEAFRVRD
                     QEKLAELDVTLGQLKKCLEYTTRTREKMEDDFRMLKLEMTNLQNSIDKFIIKKDNSAA
                     LEKINSELNSLKSLIKNSGFAEGSHGSSAESLGRNKSPIPNNAVPSADSIPSAADILA
                     KLNMNKKDKSIDSNEPAWKKAREESLGSSTYSIPEWQKSPLNQVTVPNWQHTLEQAEE
                     EQEKATETQQSD"
     gene            <348266..>349093
                     /locus_tag="HG535_0D01750"
                     /db_xref="GeneID:59236191"
     mRNA            <348266..>349093
                     /locus_tag="HG535_0D01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288300.1"
                     /db_xref="GeneID:59236191"
     CDS             348266..349093
                     /locus_tag="HG535_0D01750"
                     /inference="similar to AA sequence:RefSeq:NP_011361.1"
                     /note="similar to Saccharomyces cerevisiae LYS5 (YGL154C);
                     ancestral locus Anc_2.314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144195.1"
                     /db_xref="GeneID:59236191"
                     /translation="MEDLFSDLQSSEIWSGVLLVDYQNSNLDDPYTFEEALRFLPFEV
                     QRKILSKRISTARNASLSNALLQTFGCSVASSTTMNELCLKYGTFGKPYLDNDHSIAF
                     SMSNGQQYVVQYLVKTAGETVDVGIDIASKQDYINDQDIDVFRAIFSTMEYEQLESCS
                     QYNEKRELFSYLWSLKECYTKLVGCGLNCDLSLIDFGKPRILESPAVIHRTINNTSVT
                     FYSQWLEPEKEEVVTVCHYTSSATERFLTMPPKFYKLTLDDLIKYFTSHIEKEKECT"
     gene            <349449..>350342
                     /locus_tag="HG535_0D01760"
                     /db_xref="GeneID:59236192"
     mRNA            <349449..>350342
                     /locus_tag="HG535_0D01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288301.1"
                     /db_xref="GeneID:59236192"
     CDS             349449..350342
                     /locus_tag="HG535_0D01760"
                     /inference="similar to AA sequence:RefSeq:NP_010164.1"
                     /note="similar to Saccharomyces cerevisiae YDL119C;
                     ancestral locus Anc_2.313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144196.1"
                     /db_xref="GeneID:59236192"
                     /translation="MSEGFSKTRSHLVGGFFGGLSAAITLQPLDLLKTRIQQSKTTSI
                     WSIISQLNSPIELWRGTVSSAIRTSVGSALYLSSLHMMRVALASNKGSEFTLNKSSRL
                     PQLQMYENLLTGALARGLVGYFTMPITVLKVRYESTFYKYTSLGEATRHIYKEEGIKG
                     FFRGFGPTCLRDAPYSGIYVLLYEKTKTILPSILPSRMINQDIDGNFTTYTSTTVNAL
                     SAIFSASLATTITAPFDTIKTRMQLEPSKFRSFFGSLDQIIRHEGFFTIFSGLSMRLA
                     RKALSAGIAWGIYEEIIKRFM"
     gene            complement(<350420..>351511)
                     /locus_tag="HG535_0D01770"
                     /db_xref="GeneID:59236193"
     mRNA            complement(<350420..>351511)
                     /locus_tag="HG535_0D01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288302.1"
                     /db_xref="GeneID:59236193"
     CDS             complement(350420..351511)
                     /locus_tag="HG535_0D01770"
                     /inference="similar to AA sequence:RefSeq:NP_011360.1"
                     /note="similar to Saccharomyces cerevisiae CDC43
                     (YGL155W); ancestral locus Anc_2.312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144197.1"
                     /db_xref="GeneID:59236193"
                     /translation="MHTQFATEKHVKYLKRHLGLLPSSQQSHDVNKMAIIFYSLVSLS
                     AIGIDVAKEYGSSAQWICRHRIALESSGSKVALSGFVGSLTLDIPNTNTVSLPNTLFA
                     LLVLRLLKCDEFFCSVRNRETICAFVSTCQVAEDGSFTSVLANKHFLPSPLDASDLRF
                     CFIAVEILCLLGCRKLQDYSKYINVDKLIAYILSQQCDSGGFGSYGEPHAGYTSCALS
                     TLSLLESLACLTDEFKELTLLWLVHRQVSDEGCMQLQCKNPFFDEEDHGGFQGRENKF
                     ADTCYAFWCLNSMNILQFNTSATLGTFESAKMYLLSRTQNTIIGGFSKNDVDDPDLYH
                     TCLGVAALKLIEGTFNGVLFLPSAIDVSS"
     gene            complement(<351811..>355053)
                     /locus_tag="HG535_0D01780"
                     /db_xref="GeneID:59236194"
     mRNA            complement(<351811..>355053)
                     /locus_tag="HG535_0D01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288303.1"
                     /db_xref="GeneID:59236194"
     CDS             complement(351811..355053)
                     /locus_tag="HG535_0D01780"
                     /inference="similar to AA sequence:RefSeq:NP_011359.1"
                     /note="similar to Saccharomyces cerevisiae AMS1 (YGL156W);
                     ancestral locus Anc_2.311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144198.1"
                     /db_xref="GeneID:59236194"
                     /translation="MGYENIGYDPQFKSVQSIYENRLRQFTDNGDYRDLNLPKFYDKA
                     RISLDDKHVKVWWYQVAFEKGSSPVSPDKRPSWKSIIDQDKAGKLEFRKASMGQPFGP
                     SWSTTWFKVELSLPSEWRDSSERLVFEWNCENEGVVIDAKRLIPATAFSGGDRKEYIL
                     PKNEDGKYFFYIEAGNNGMFGCGSGGTINPPDDNRFFHLRNADIVWPDWEARALYIDY
                     WMLTDAARELPGDSWQKHKARQIGNEIIDMFDPNDRSSVSKCRDFVKKEFFDKFIESD
                     KVYSEGDSQIVNNVFAMGNCHIDTAWLWPFAETKRKVVRSWSSQCTIMDEYPEYQFVA
                     SQGQQFKWLLEEHSEFFNKVLIPKIQQSQFFPIGGSWVENDTNIPGGESLARQFFFGQ
                     RFFLKYFGLKSTVFWLPDTFGYSSQIPQICQLSGIDKFLTQKLSWNNINSFPHSTFNW
                     AGIDGSQLLTHMPPGNTYTASSHFGDVLRSAKQNKTAETYPSGLMLYGIGDGGGGPTR
                     EMLEKMRRIRSMSNRNGNIVPKLHVGKTIDDFYDDILSKTNNGKKLATWCGELYFEFH
                     RGTYTTQALTKKLMRLSEINLHDLEWLATKASILHQNSYEYPVNKINDLWEDVLLCQF
                     HDVLPGSCIEMVYKYEAVPMLQTVIDKCQSLIKEAVKCLKKQSENGISVKTIVWPEQL
                     EVPKKSDSFSGVNVSMKDDAIVLGNSELSIEISKMSGSIISIIDKKSGTQFLDLKNGR
                     NKLGANQFVIFDDKPLSWQAWDTELYSVNQYNYLTKLESINILESSKYIGTVEVVIAI
                     SENCKIRSQISLAAVQSGTVGESRIDITTHVENWNLRNKFLKVEFPVNVRNDFASYET
                     QFGITKRPTHYNTSWDVAKFEVCHHKFADYSEFNKGVSILNSSKYGFATHGNLMRLSL
                     LRSSKAPDAHADMGSHEIKYSIYPHRGPLSSKTVKLALEFNYNYEYMISAEIYEDFEN
                     IIKIRGDSNVILSNIKRGEDDQDLHSNYALSKKSDDSSMVVRVYESLGGESNATLLTS
                     LPISRVEKIDNLELKILGKVEFSCCKENKKIKEIPITLRPFEIASFKLFF"
     gene            complement(<355325..>355558)
                     /locus_tag="HG535_0D01790"
                     /db_xref="GeneID:59236195"
     mRNA            complement(<355325..>355558)
                     /locus_tag="HG535_0D01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288304.1"
                     /db_xref="GeneID:59236195"
     CDS             complement(355325..355558)
                     /locus_tag="HG535_0D01790"
                     /inference="similar to AA sequence:RefSeq:NP_014383.1"
                     /note="similar to Saccharomyces cerevisiae PBI2 (YNL015W);
                     ancestral locus Anc_2.310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144199.1"
                     /db_xref="GeneID:59236195"
                     /translation="MAPKSFIVTLKDSAPDIEVEKFKKTVGNLGGSITHEFSLIKGYT
                     VKLPEELHINKLKDGFDSMIASVEEDKEVSIQK"
     gene            complement(<355857..>356399)
                     /locus_tag="HG535_0D01800"
                     /db_xref="GeneID:59236196"
     mRNA            complement(<355857..>356399)
                     /locus_tag="HG535_0D01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288305.1"
                     /db_xref="GeneID:59236196"
     CDS             complement(355857..356399)
                     /locus_tag="HG535_0D01800"
                     /inference="similar to AA sequence:RefSeq:NP_010163.1"
                     /note="similar to Saccharomyces cerevisiae YFH1 (YDL120W);
                     ancestral locus Anc_2.309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144200.1"
                     /db_xref="GeneID:59236196"
                     /translation="MMRRLSIIKNCRGFGTKLLQHNAAPVARRSVRSPALHSYIFVPT
                     IVNCSRSFAVGSTDGHGIPKEILQLSAERYQKESDTLLEALLDKLEALSDRYPDKIPD
                     VEYSQGVMTLEVDEVGTYVINKQPPNKQIWLSSPVSGPNRFDLYQDQWVSLRDDTKLL
                     EILTHEMNDAIPQEQGSISL"
     gene            <356639..>357043
                     /locus_tag="HG535_0D01810"
                     /db_xref="GeneID:59236197"
     mRNA            <356639..>357043
                     /locus_tag="HG535_0D01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288306.1"
                     /db_xref="GeneID:59236197"
     CDS             356639..357043
                     /locus_tag="HG535_0D01810"
                     /inference="similar to AA sequence:RefSeq:NP_010162.1"
                     /note="similar to Saccharomyces cerevisiae YDL121C;
                     ancestral locus Anc_2.308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144201.1"
                     /db_xref="GeneID:59236197"
                     /translation="MNFYTFLIAFVLVVIFAILLPIVSGIGTFKVEKQQRGSTNAHLK
                     DKRGVKFELSSNTESFGTASSTNRKERNFDIHSRTGLKKRVIGKYDEDPNTYDYDVNE
                     FINEDAEEEKRAQVERLQKFDGSKEKAYEELV"
     gene            complement(<357391..>358071)
                     /locus_tag="HG535_0D01820"
                     /db_xref="GeneID:59236198"
     mRNA            complement(<357391..>358071)
                     /locus_tag="HG535_0D01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288307.1"
                     /db_xref="GeneID:59236198"
     CDS             complement(357391..358071)
                     /locus_tag="HG535_0D01820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144202.1"
                     /db_xref="GeneID:59236198"
                     /translation="MISQKDGRENGLEYEEETPQLPRDVFFCRFSHFFFTNKRFSLVF
                     FGVLIIMLLLIWFQRHDEVAIFFLMFFGSLTMILLGCFALLIAYKIEFTKENELLFLK
                     QVVIIRPGLDSRKWDTIAGNLNRVFYQNSREATPYFFYDGESCQSCFRSKFLNPYLKI
                     ENQGERGSSNEQHQSSGNGAAHDLNEPPVQRSQKLELEPYIKEAVKAYQESVDDFWNS
                     LMRDESIV"
     gene            complement(<359637..>361958)
                     /locus_tag="HG535_0D01830"
                     /db_xref="GeneID:59236199"
     mRNA            complement(<359637..>361958)
                     /locus_tag="HG535_0D01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288308.1"
                     /db_xref="GeneID:59236199"
     CDS             complement(359637..361958)
                     /locus_tag="HG535_0D01830"
                     /inference="similar to AA sequence:RefSeq:NP_010161.1"
                     /note="similar to Saccharomyces cerevisiae UBP1 (YDL122W);
                     ancestral locus Anc_2.307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144203.1"
                     /db_xref="GeneID:59236199"
                     /translation="MNSLRESISRTISIHFIEPYNRIFSGKQNLSFTLVIIFVSTAFI
                     FVRNKKSIMENIRGATRNFNQNGTFRRWMPRIGQMDPRVLEKGGYIAGLLNDGNTCFM
                     NSVIQSLASSTELMSFLDQEIQTKENMQSELTVECETTDESLDTTSDNSNSNQKKSKN
                     KVYGRSKRSTNKQSKELSEKEESVPDLSFTIALKEMLDKLNTKYYNEKPYFKTNKLLK
                     TMTKTPHKNMLLGYDQEDAQEFFQNILSELEKNVKSLYQDEPDKKPIPESELPDDALI
                     GQAHLNKVGTVYIPTEQIQPNIILEDHKERYYSPFKLITPLDGITVERIGCLQCGENG
                     GIRYSVTSGLSLNLPNDDMGSAIKLTDLLNEWIKPEIIDGVECNRCALQAVHEHLLEQ
                     LKQYKSKKENTIPEKLIKAFKTRIEELEEILAKPVIDDEDYKKLHTENMVRKSSKSKQ
                     ILISRPPPLLAIHINRSVFDPRTYMIRKNNSKVIFKPRLNLSPWCCDIDELNLDARLP
                     MSKKEVVVSDSGEDENSGEEYYAKLHQTYEKEFEDSDEDEYDNTAQKGTGYTNRDISN
                     YDPLNRDVESSSSISNYEEDAEDEESAEYLEETDALGNTIQKVIHKSNEISHSDDDDN
                     LVSVEIRENGAHSLSSESESEDVEIETEVEHPVLPLSSASSAPYSVPAGPLTYVLRSV
                     IVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTPGVFMLFYEYDYHAASG
                     RMSEDIEAEQSAFDKIEISNKRQADGSEGLTED"
     gene            complement(<362565..>363914)
                     /locus_tag="HG535_0D01840"
                     /db_xref="GeneID:59236200"
     mRNA            complement(<362565..>363914)
                     /locus_tag="HG535_0D01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288309.1"
                     /db_xref="GeneID:59236200"
     CDS             complement(362565..363914)
                     /locus_tag="HG535_0D01840"
                     /inference="similar to AA sequence:RefSeq:NP_014382.1"
                     /note="similar to Saccharomyces cerevisiae PUB1 (YNL016W);
                     ancestral locus Anc_2.306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144204.1"
                     /db_xref="GeneID:59236200"
                     /translation="MSEAQQQEEPQVVETPQSEVISHQMENENQKSPETVSQGAEGSG
                     SSAEKDTTPVVPANAIKGGRETSDRVLYVGNLDTSITEEILKQYFQVGGPIANVKIMV
                     DKNNNKANYAFVEYHEAHDANIALQTLNGKQVENNVVKINWAFQSQQTSPDVETFNLF
                     VGDLNVDVDDETLRNAFKDFPSYTKAHVMWDMQTGGSRGYGFVSFSNQEDAQKAIDAM
                     QGTELNGRQLRINWASKRENNNSHNMSNNQRRHNNGPRAPGGFRPFHNGNRGMSMPSP
                     ASMGLPPQLAGVIPPQAVGAPPSGPTVPPPVNPQAVDAVIRRAPPRVTTAYIGNIPHF
                     ATEADLIPLLQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALSSFPFQGRNLRTG
                     WGKERAGLVPMITQQQQPMHHIMHDQQHMQMQQDAVQEQHQQQQQQQQQQQQQPQQE"
     gene            complement(364589..364662)
                     /locus_tag="HG535_0Dtrna4I"
                     /db_xref="GeneID:59236655"
     tRNA            complement(364589..364662)
                     /locus_tag="HG535_0Dtrna4I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:59236655"
     gene            <366733..>367806
                     /locus_tag="HG535_0D01850"
                     /db_xref="GeneID:59236201"
     mRNA            <366733..>367806
                     /locus_tag="HG535_0D01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288310.1"
                     /db_xref="GeneID:59236201"
     CDS             366733..367806
                     /locus_tag="HG535_0D01850"
                     /inference="similar to AA sequence:RefSeq:NP_012183.2"
                     /note="similar to Saccharomyces cerevisiae YIL083C;
                     ancestral locus Anc_2.305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144205.1"
                     /db_xref="GeneID:59236201"
                     /translation="MSSNSQKRKIHSSITEISHAIDRSISENVFPIAKTSDEDKYFLT
                     NPSPPYLEELVKEAASFIELQHSSNRERIVLVTSGGTTVPLENNTVRFIDNFSAGTRG
                     ASSAEQFLKNGYSVIFLHREFSLTPYNRFFTHNVGSCFLDYFNEIGTVKEDFRAEILE
                     KKKLYEKYTNDEKRLILLPFTTVNQYLWSLKSIAKLLNSKGSLFYLAAAVSDFFVPYS
                     RLPEHKIQSRDYGDTTEANNDVNSTTTPDGKLVVNLDPVPKFLRRLVESWAKQAMIVS
                     FKLETDINVLIKKATQALDRYNHQLVVGNLLQTRNKEVVFVDQENRKGDWIKLDHSEN
                     VIEALIIPEVIKHHDRWIKLQED"
     gene            complement(<367881..>369341)
                     /locus_tag="HG535_0D01860"
                     /db_xref="GeneID:59236202"
     mRNA            complement(<367881..>369341)
                     /locus_tag="HG535_0D01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288311.1"
                     /db_xref="GeneID:59236202"
     CDS             complement(367881..369341)
                     /locus_tag="HG535_0D01860"
                     /inference="similar to AA sequence:RefSeq:NP_014372.1"
                     /note="similar to Saccharomyces cerevisiae SAM50
                     (YNL026W); ancestral locus Anc_2.304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144206.1"
                     /db_xref="GeneID:59236202"
                     /translation="MENFHESFIDGSPKPTSNETIGVAKPSETLANEQHKALTELFAK
                     NANSPISVGAVVAENSQSIRAGTLQKYFDATILQAVNFHELCEQADILNQKLIQHGLV
                     EQVSQSLDSRGIYSLPLANMQYPSMIYSGEAIPKDIPVIDIVSRLQLVPIKRFIAKTG
                     TNIGNNEGDGYLEFQLRNMFGAGESLKLDFTKGTKTHSSYVLNYNQPVTAWWIWDSML
                     FKNNLTGLLINGFRTNLRSGFVGSSAFNHELSYATEWRKSKVASLNASDTLLFQAGDD
                     LKCSLGHTVVLDKRDNPVSPSKGGFMKLYNELALGKFWKSQIELSQNISWLKNDFITV
                     SCTTKAGYIKNLKPDTNSLKTYDKFQNGGANDIRSFTVKGLGPKDLFDSIGGDAFVAY
                     GVSLFSRLPIKRWAHSNFRLHWFLNGGKLINHNNASLYTLINELSSQHSLSTGVGIVL
                     RHPVARFELNFTLPLACHTGDAVRKGFQYGIGISFL"
     gene            complement(<369600..>371210)
                     /locus_tag="HG535_0D01870"
                     /db_xref="GeneID:59236203"
     mRNA            complement(<369600..>371210)
                     /locus_tag="HG535_0D01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288312.1"
                     /db_xref="GeneID:59236203"
     CDS             complement(369600..371210)
                     /locus_tag="HG535_0D01870"
                     /inference="similar to AA sequence:RefSeq:NP_014371.1"
                     /note="similar to Saccharomyces cerevisiae CRZ1 (YNL027W);
                     ancestral locus Anc_2.303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144207.1"
                     /db_xref="GeneID:59236203"
                     /translation="MCDAQRYGEKLPDKPQRAENEKGYKKDDLRLNIPSFEKLERNAE
                     HVNYVSLLQSDDGSHNHEGFIGSLLPNSNYTQSGAEEHGPQQTVNQYLGLDADLLFSP
                     SSSSSHRNVVTPTLKIECHEDVWQDMLPSSHAYAQDLNETSTQQDIQYLNPFTPSRYH
                     NDVYKSDTESSYASSMYQTPTIAPMDPAISPVMSYLTTGDDEIDDILSINSEVSATSN
                     ISLPLNSGGYKYITNLNDLDNLLTVPESDFTTFYDSTEPSLPSDNPDQQPFGFPPVIS
                     IQEFQENEQKGSRPLYEKEDIFSSSVVPIKLEEQEDIPKNALLSPDNVGDISHEEKRH
                     GRIAKRRSYSSTGASSRSSHRSFSRSVSPDEKARAISGDSERLLELANLHPATPREGS
                     DNKASNSSPLDDTETSQSLSGENKKKHGQKVTAAFACELCGKRFTRPYNLKSHLRTHT
                     NEKPFICNICGKAFARQHDKKRHEDLHTGKKRYVCGGVLKDGTPWGCGKKFARSDALG
                     RHFKTESGRKCIAPLFAEAAREKQLQND"
     gene            complement(<371876..>373162)
                     /locus_tag="HG535_0D01880"
                     /db_xref="GeneID:59236204"
     mRNA            complement(<371876..>373162)
                     /locus_tag="HG535_0D01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288313.1"
                     /db_xref="GeneID:59236204"
     CDS             complement(371876..373162)
                     /locus_tag="HG535_0D01880"
                     /inference="similar to AA sequence:RefSeq:NP_013709.1"
                     /note="similar to Saccharomyces cerevisiae TRM12
                     (YML005W); ancestral locus Anc_2.302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144208.1"
                     /db_xref="GeneID:59236204"
                     /translation="MPYELLLTDSTLIKDIKLELESEKKFVKPIYQDGRYKVIRTTIT
                     EDDHPLLAKQKSYLLRKYTAGRLCDKNDENNIVGFTRSFLKARNVANFEELISHLPIR
                     YTVYTPLLLFNNSKEKSFNHIKWREFFQLVGLPVKDEYCKQMLSKVFVKLKLTHVAIN
                     MPIIEADVMRRPFNIYPLYGELVSPALDVRAEELWDSPTETDFQSTLWCHTIQNGIHQ
                     YWAPMFTMFSRGNIKEKKRILDKFQDIEGNDVVDMYAGIGYFTLCYLKRNARKVYCFE
                     INPWSVEALRKGLDANAIDPQRCKIYNESNENCTARIREAVTRKMRIRHINLGLLPTS
                     KPSWPLALEVIRLQYSTSSMNIVSLHIHENVHIIHLQDDSFITKTLNALKAIDKDMCY
                     EAKHLERIKTFAPDIWHICLDVDVKCLELSSLVPLT"
     gene            <373373..>374446
                     /locus_tag="HG535_0D01890"
                     /db_xref="GeneID:59236205"
     mRNA            join(<373373..373385,373494..>374446)
                     /locus_tag="HG535_0D01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288314.1"
                     /db_xref="GeneID:59236205"
     CDS             join(373373..373385,373494..374446)
                     /locus_tag="HG535_0D01890"
                     /inference="similar to AA sequence:RefSeq:NP_012182.1"
                     /note="similar to Saccharomyces cerevisiae SDS3 (YIL084C);
                     ancestral locus Anc_2.301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144209.1"
                     /db_xref="GeneID:59236205"
                     /translation="MNQELSRKDKRRHNIETKVSKIYHNFILDKDSHYKNRLTSLQTD
                     LTTLHQGNNKAYIRKVRDLEEARDLELVRLRLYEEYRVSRSSIEFQEDIESAKAEHEK
                     LVKLCKEKLYESIEQKIKQLQEDRLLMDVANTHSYAMDYTRTKFQKYTRSHTASGWES
                     SSNELGRESQNESATDTGNERRFLRKRVGVKGVNGSSRLGKNADESDFQTNSSSNVVT
                     NLNGKISTLSRQTNNEPRTDVNSDTDFLQSISDSGNLHTLLFGEKESESKANDKKKHR
                     TSQRYTAKAAPPLQSLKPDEVKDDIAFIRQLTSQPPAPFKSRVVE"
     gene            <375226..>376809
                     /locus_tag="HG535_0D01900"
                     /db_xref="GeneID:59236206"
     mRNA            <375226..>376809
                     /locus_tag="HG535_0D01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288315.1"
                     /db_xref="GeneID:59236206"
     CDS             375226..376809
                     /locus_tag="HG535_0D01900"
                     /inference="similar to AA sequence:RefSeq:NP_012181.3"
                     /note="similar to Saccharomyces cerevisiae KTR7 (YIL085C)
                     and KTR5 (YNL029C); ancestral locus Anc_2.300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144210.1"
                     /db_xref="GeneID:59236206"
                     /translation="MLKWNLHFKRRCRRILGKYRVIISCLVIILFPTLLVLTLGARNS
                     STSLANEEIITKRDGVFFKGCVDTPEYLEDPYYTKMNATFVMLTRNEEMDEVLKTMQS
                     IETHFNQWFQYPYVFLNNEPFTEEFKLRITSMTNAEVDFGMIEETDWEFPEDIRDTFA
                     FKNAIQEQGDRGILYAHMESYHKMCRFYSGIFYKHPLVRRHEWYWRLEPDVEFFCDIS
                     YDPFYEMAKTNKKYGFTVVLPEIYWSVPNLFRYTRAFIRENRVKVGNLWNLFVTNYDI
                     LDTDDEELSEFVNHEEDVEPKMSEKVAIDHMFDTKEFDEDSMGMHMLIRRAKSKIPTK
                     EDKFDNQEYNLCHFWSNFEIARIDVFDNDFYNSYFEFLEKSGGFWRERWGDAPIHSLG
                     LGMMLDVDDIHYFRDIGYRHADVQHCPKNWNGFQQEKKVGHGQLPYMPFEDRFKRRAG
                     LWNSYDTGTAAGSGCRCKCSKRRKDIEDRAYECIDLWASLVSASDSFLESGGFVPNMN
                     AQEIESSIERDYESHFAAQ"
     gene            complement(<376983..>377294)
                     /locus_tag="HG535_0D01910"
                     /db_xref="GeneID:59236207"
     mRNA            complement(<376983..>377294)
                     /locus_tag="HG535_0D01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288316.1"
                     /db_xref="GeneID:59236207"
     CDS             complement(376983..377294)
                     /locus_tag="HG535_0D01910"
                     /inference="similar to AA sequence:RefSeq:NP_014368.1"
                     /note="similar to Saccharomyces cerevisiae HHF2 (YNL030W);
                     ancestral locus Anc_2.299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144211.1"
                     /db_xref="GeneID:59236207"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <378015..>378425
                     /locus_tag="HG535_0D01920"
                     /db_xref="GeneID:59236208"
     mRNA            <378015..>378425
                     /locus_tag="HG535_0D01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288317.1"
                     /db_xref="GeneID:59236208"
     CDS             378015..378425
                     /locus_tag="HG535_0D01920"
                     /inference="similar to AA sequence:RefSeq:NP_014367.1"
                     /note="similar to Saccharomyces cerevisiae HHT2 (YNL031C);
                     ancestral locus Anc_2.298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144212.1"
                     /db_xref="GeneID:59236208"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <378731..>379210
                     /locus_tag="HG535_0D01930"
                     /db_xref="GeneID:59236209"
     mRNA            <378731..>379210
                     /locus_tag="HG535_0D01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288318.1"
                     /db_xref="GeneID:59236209"
     CDS             378731..379210
                     /locus_tag="HG535_0D01930"
                     /inference="similar to AA sequence:RefSeq:NP_012179.3"
                     /note="similar to Saccharomyces cerevisiae YIL087C;
                     ancestral locus Anc_2.297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144213.1"
                     /db_xref="GeneID:59236209"
                     /translation="MENPADAQGRLKSPVPEKPNGKQLFSYTDTPTPALLNCSMLLLT
                     PIISPATVSPVSVAQRSASSRLANMLTKPKYLGPTKKTALLFGGAQALGAWMIHDGDL
                     ESGCGFLAAWSTLYLIVGGRGSLKSLRYGKVWPLMLSTISLGNAYLYGRRFISGGFS"
     gene            complement(<379248..>380072)
                     /locus_tag="HG535_0D01940"
                     /db_xref="GeneID:59236210"
     mRNA            complement(<379248..>380072)
                     /locus_tag="HG535_0D01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288319.1"
                     /db_xref="GeneID:59236210"
     CDS             complement(379248..380072)
                     /locus_tag="HG535_0D01940"
                     /inference="similar to AA sequence:RefSeq:NP_014366.3"
                     /note="similar to Saccharomyces cerevisiae SIW14
                     (YNL032W); ancestral locus Anc_2.296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144214.1"
                     /db_xref="GeneID:59236210"
                     /translation="MTGSNNETGEASAIDSLIENEAEIIRLIQKDVSMLRDNGNGNDI
                     HRIINEDKILKGEFEHILQRFHDNCKREDGQLLEEDEEDLFDKDEHMTKSEEKREFQS
                     EAQQEEVIPPENFSHVAGEIYRSSFPRVENFQFLQTRLKLKSILVLIPEEYPAENKEF
                     LEKSGIKLYQVGMSGNKEPFVNIPSDLLTKALEIVLNPDHQPVLIHCNRGKHRTGCLI
                     GCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDKEIITLANKKNWLPIQW"
     gene            <380348..>381730
                     /locus_tag="HG535_0D01950"
                     /db_xref="GeneID:59236211"
     mRNA            <380348..>381730
                     /locus_tag="HG535_0D01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288320.1"
                     /db_xref="GeneID:59236211"
     CDS             380348..381730
                     /locus_tag="HG535_0D01950"
                     /inference="similar to AA sequence:RefSeq:NP_012178.1"
                     /note="similar to Saccharomyces cerevisiae AVT7 (YIL088C);
                     ancestral locus Anc_2.295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144215.1"
                     /db_xref="GeneID:59236211"
                     /translation="MEPTATVLSSSANLLKTIVGAGVLAVPYAFRNDGILVGSLLILL
                     AAVTSAFGLFVLGKCSKTLINPRNSSFFTFCMLTYPSLSPLFDLAMFIQCFGVGLSYL
                     VLIGDIFPGLFGGTREYWILGSALLIVPLCTLRKLDSLRYSSILGLFALGYISLLVLS
                     IFVYDVILTDNYKAFRGDVYWFKVYDYSGLLSTFSIIIFAFTGSMNLCSIINELEDNS
                     LSNISTVIGWSLSIATTLFMAIGITGYLTFGSNVSGNIILNYDADSPWVFLGKLCLGT
                     MVILSFPLLFHPCRISVNNMIVWGKLKFEKQPHSELNTRSSEIPIRLSIQDDDNESLA
                     SDQTHESHEAVVSVENNTSITHDVPFPQRRFYVSTAILLFVMFFLSLRVTSFALVLSL
                     VGATGSTSISFTLPGLFGYKLIGTDSLAVGQMVSPKDRFYRGCSALLVWFGLAVTFFS
                     LYVIFFHGNN"
     gene            complement(381867..381938)
                     /locus_tag="HG535_0Dtrna6E"
                     /db_xref="GeneID:59236661"
     tRNA            complement(381867..381938)
                     /locus_tag="HG535_0Dtrna6E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAG"
                     /db_xref="GeneID:59236661"
     gene            complement(<382631..>383632)
                     /locus_tag="HG535_0D01960"
                     /db_xref="GeneID:59236212"
     mRNA            complement(<382631..>383632)
                     /locus_tag="HG535_0D01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288321.1"
                     /db_xref="GeneID:59236212"
     CDS             complement(382631..383632)
                     /locus_tag="HG535_0D01960"
                     /inference="similar to AA sequence:RefSeq:NP_014373.3"
                     /note="similar to Saccharomyces cerevisiae SSN8 (YNL025C);
                     ancestral locus Anc_2.294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144216.1"
                     /db_xref="GeneID:59236212"
                     /translation="MSGSYWTSTQRNKWQFTKDSLAKEREKLWIMECQLFPQGLNIVM
                     DGKTNGSERSMTKNIAITHRDLHYDRDYNLRIYCYFLVMKLGRRLNIRQCALATAHVY
                     LSRFLLRVSVREINLYLLVTTCVYLACKVEESPQYIRTLVSEARSLWPEFVPPDPTKV
                     TEFEFYLIEELQSFLIVHHPYKSMEQIVDVLKEPPFELRLSQDELQSCWSLINDSYIN
                     DAHLIYPPHIIAIACLFITICIRGRSAKNSLSSSTASADTMNQDDPVFMKTLKQQELF
                     NRFIAESQVDLEEVMDTIQGLITLYEHWDKYHEPWIKFLLHALYLRPGTPPPSVSSS"
     gene            complement(<384745..>386223)
                     /locus_tag="HG535_0D01970"
                     /db_xref="GeneID:59236213"
     mRNA            complement(<384745..>386223)
                     /locus_tag="HG535_0D01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288322.1"
                     /db_xref="GeneID:59236213"
     CDS             complement(384745..386223)
                     /locus_tag="HG535_0D01970"
                     /inference="similar to AA sequence:RefSeq:NP_012176.1"
                     /note="similar to Saccharomyces cerevisiae ICE2 (YIL090W);
                     ancestral locus Anc_2.293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144217.1"
                     /db_xref="GeneID:59236213"
                     /translation="MPKLSQSFLQGMRMALACFYLVSILISIPVAFKVGGLYCGLSFT
                     VTIFNLYFITTTLSIIARSYGNHFHVVWTTFLYYLQHFVIASLLYLFLSGFSNDELTR
                     VLEDGSQPEKSFVDMLKSNVFSSHSNWMLYYYYYRFIVQPWQFTLSHFTAFFALSEGF
                     FAVLGIQAIGETNRWLLYERNSNTWIISSLLTSGGVITASLYYLYRIYVTPIWNLSIQ
                     TASLLGFTLSLVCGLGLYGIISKSGSVIESSLFFAYIVRCIYEISPKLATAATDEILE
                     VFKEAWQRHQRTLSGTNSLLSYYHDIVLSNFEMVWDSIVTRTKQSDPLYQKSSYLTLE
                     RFSKLWFRLKPVWGLVKNFTASVPSSINGMFQVTLKMAAESVSPAIVINLCFRILIFY
                     SATKIIPALQRKSPTELRKSRRMLSLIYWYSPCILIAMYTHLILQYSGELSGDLCLWG
                     CNSKWFNSDQPKILVDSWGFWNWCNIFWTILIYGSELIGGKK"
     gene            <386666..>388822
                     /locus_tag="HG535_0D01980"
                     /db_xref="GeneID:59236214"
     mRNA            <386666..>388822
                     /locus_tag="HG535_0D01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288323.1"
                     /db_xref="GeneID:59236214"
     CDS             386666..388822
                     /locus_tag="HG535_0D01980"
                     /inference="similar to AA sequence:RefSeq:NP_012175.1"
                     /note="similar to Saccharomyces cerevisiae YIL091C;
                     ancestral locus Anc_2.292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144218.1"
                     /db_xref="GeneID:59236214"
                     /translation="MSIAGNYASKDGNANSFKKRGRKELRTIKRADHRYNKENGPVIS
                     DKDIGHIDSVVQDKESAGKRRKHIRSDEEDDENKERAYQALLTILKSEHPKRKPQKKI
                     KNDRKEPLEGSDGEAETVTEIEELEDNLERVADEHQSDEEVMDAEDDVEDVKDPFEFH
                     FNQVSEQFINKLDRGFKDKEIKYKTKKFYMGDKEQMIFSKPELSMDSDKQLIVPDISK
                     PSLHSYFLKQRLKVQNDLLDSNTNNLTTLQKEIVDPMFQYNDLLYEYESYGKDEDEYR
                     YLYVLHVLNHIYKTRDRILKNNQRLSDNPDAECLDQGFTRPKVLIVVPTRDTAYSVVE
                     KIISESGIDQVDKKSKFRDQFYQDSVPPSAKPKSFQKVFKGNSNDFFVLGLKFTRKAI
                     KLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEITIFDQLHSIEFQNFSHV
                     LSIFDHLNKIPQEQHDTDFGRVKMWYINEQAKLLRQTMIFTRYVSPMTNSLINNRCRN
                     WAGRWKNHHVVAPADSSIEQLGFNIRQIFQRFDIGGASIVDEPNSRFKYFTSVVIPGI
                     VNSTGYEDGILLYIPDYADFIRIRNHLKDKTTLLFGDINEYSDQRQLGSARALFQQGR
                     VKVLLYTERLHHFRRYEIKGVKSVIFYQPPTNPEFYNEVIRFIAKSSFLGDADLNIST
                     VRCVYSKLDGLALERIVGTKRAAVLTHAQNEVYEFK"
     gene            complement(<389008..>389226)
                     /locus_tag="HG535_0D01990"
                     /db_xref="GeneID:59236215"
     mRNA            complement(<389008..>389226)
                     /locus_tag="HG535_0D01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288324.1"
                     /db_xref="GeneID:59236215"
     CDS             complement(389008..389226)
                     /locus_tag="HG535_0D01990"
                     /inference="similar to AA sequence:RefSeq:NP_878158.3"
                     /note="similar to Saccharomyces cerevisiae YNL024C-A;
                     ancestral locus Anc_2.291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144219.1"
                     /db_xref="GeneID:59236215"
                     /translation="MSALFNFKALLQVLLLLICSCTYIHTQWPSILDRYKAHGVYGAF
                     WKMARIGERASPYVSLACIIMAVNQLNS"
     gene            <389776..>390561
                     /locus_tag="HG535_0D02000"
                     /db_xref="GeneID:59236216"
     mRNA            <389776..>390561
                     /locus_tag="HG535_0D02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288325.1"
                     /db_xref="GeneID:59236216"
     CDS             389776..390561
                     /locus_tag="HG535_0D02000"
                     /inference="similar to AA sequence:RefSeq:NP_012173.3"
                     /note="similar to Saccharomyces cerevisiae RSM25
                     (YIL093C); ancestral locus Anc_2.290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144220.1"
                     /db_xref="GeneID:59236216"
                     /translation="MKVQTNAVNVLQRTSAYLRSGLLLNTPAWYEVVASLPPSNKFTR
                     EPRLVNPSSNENIACLKEASQHPNAKGLYKTRTKRSERRITANRLYKAPQLKFVEDKL
                     REIFYQQHPWELSRPKILVENEGGEEYDWCNIQQLGKPLDGESVVQRTLYLLKRQKEF
                     IEAYDQARFEFYRLRMQQEVEQQVAQEEAEMFGSVYGPSAIEFGVEQEQKVIDAWKQR
                     AIEETELLSARRANPSESWSSNANEENEREQRRDEDGTEEVIL"
     gene            complement(<390673..>393510)
                     /locus_tag="HG535_0D02010"
                     /db_xref="GeneID:59236217"
     mRNA            complement(<390673..>393510)
                     /locus_tag="HG535_0D02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288326.1"
                     /db_xref="GeneID:59236217"
     CDS             complement(390673..393510)
                     /locus_tag="HG535_0D02010"
                     /inference="similar to AA sequence:RefSeq:NP_014375.1"
                     /note="similar to Saccharomyces cerevisiae FAP1 (YNL023C);
                     ancestral locus Anc_2.288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144221.1"
                     /db_xref="GeneID:59236217"
                     /translation="MSYVKQWKREAIIHLSLMTIDNLVVGDIDHQQGHVSNVGNDEEM
                     AFYEKSVREIARGDSYVCMICTVEMDYTCSMYACGKCYRVYDYECIREWALKSTKRTA
                     DGSWKCPNCLHVSKQVPAKDKPRCWCGKVVRPDANPMDPNSCGQTCNARICRHGCSQI
                     CHLGPHEECMRTISIKCRCGKHKKDVFCHEFHDAKERGRFRCENKCGKSLHCGRHACK
                     RLCHSKSCGPCPEVLTTTNTDLSLVCYCGNTHFKSIKCKDIRMAKKPSENANGDTWVG
                     LFSCSKIRSVEYSCHQHSFLEGCKSNPSIDGKNRCPFSPKFMKTCPCGKTTLKHLTTK
                     RKVCTDPIFTCESRCGKKLRCGKHTCPFKCHEGPCMDPCIQTNILNCSCQQRKFITPC
                     NFKHMPSCNIKCESLMSCRRHRCIERCCSGKPAAEVRRKTPYGSNELQDESLVEAEHI
                     CLKDCNLMLSCGKHKCQRKCHPGKCPPCLESSSDDLVCPCGKTVVEAPVRCGTKLPTC
                     DYPCIKVVQGLYQCGHKPMPHTCHPLDRPCPPCTAPVQKRCKCGKRDTVRTVCFQNDV
                     SCGQICNKPLQTCRHNCQKLCHSPGNCQRKCKGTCNAEKKYCDHKCTRPCHGKESCPD
                     TPCTAIIKITCSCGLLEKEVVCGAFSRASSPACTESLPCDDSCEMRKRQLELKTAFGI
                     SDEANASSTSGLISHEKLVSSATTFEELELPFTEVALNVYSKHFAWCSSIEKVLNSFM
                     DDSQKNSLHFKPMKPPQRSFIHELAKAYKLYSESQDREPKRSVYINKMEGSGYGKPLL
                     SLNESLPIYVSFKELEKERKSDHFESKTTVRLINYTSMDTPKIKPAEKNAFIIKNIAR
                     GTTEQDLERIFSTYLKHTLVKNPRYKLDAAGKTAFIFPEDYTNVNVNVQEDLERLVGH
                     FDFIIKDLFVAETVGLCKFDVRLLAEDQIGL"
     gene            <393791..>394900
                     /locus_tag="HG535_0D02020"
                     /db_xref="GeneID:59236218"
     mRNA            <393791..>394900
                     /locus_tag="HG535_0D02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288327.1"
                     /db_xref="GeneID:59236218"
     CDS             393791..394900
                     /locus_tag="HG535_0D02020"
                     /inference="similar to AA sequence:RefSeq:NP_012172.1"
                     /note="similar to Saccharomyces cerevisiae LYS12
                     (YIL094C); ancestral locus Anc_2.287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144222.1"
                     /db_xref="GeneID:59236218"
                     /translation="MLRSSSLRAAAKRAYASAPKSMTIGLIPGDGIGKEVIPAGKQVL
                     QSVQSKHGLKFDFIDLYAGWETFQKTGKALPQETVQILKNQCQGALFGAVQSPTTKVE
                     GYSSPIVALRKELGLFANVRPVKSVEGTKDRKVDMVIVRENTEDLYIKLEKTYIDPKT
                     GTRVADATKRISEVATRRIAQIALDIALQRLKTYGHATLTVTHKSNVLSQSDGLFREV
                     CKDVYETQKDKYGQIVYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVG
                     SLGVVPSANVGPEIVVGEPCHGSAPDIAGKGISNPIATIRSTALMLQFLGHNESAQDI
                     YKAVDANLRDNQVKTPDLGGKSSTQDVVDDILSRL"
     gene            complement(<394945..>396441)
                     /locus_tag="HG535_0D02030"
                     /db_xref="GeneID:59236219"
     mRNA            complement(<394945..>396441)
                     /locus_tag="HG535_0D02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288328.1"
                     /db_xref="GeneID:59236219"
     CDS             complement(394945..396441)
                     /locus_tag="HG535_0D02030"
                     /inference="similar to AA sequence:RefSeq:NP_014376.3"
                     /note="similar to Saccharomyces cerevisiae YNL022C;
                     ancestral locus Anc_2.286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144223.1"
                     /db_xref="GeneID:59236219"
                     /translation="MNVYRDATWVLEYVEEEDKKGRIEGSMQSLVLRACTRYKLKSNP
                     KHIYALVDSAWKYKPYLEIIMKKSDILKDIPKKKGSPMYSRLTVLLLCHDLLFSKQKR
                     IQMGKLPIKEYVLKHKTRLHSELVKLKLKLKVKDLSQLIEKEEISNDVTPVRWIRINP
                     LRCPGNDVNSVLAELEKKFTQRVDHWKDIVPGCIYHDDFIPNVFGIHPQDKITSHELY
                     RQGKVIIQDRASCFPAHILNPDKNDVIIDACAAPGNKTTHVAAHLLPKCEKGQLTKIY
                     AFEKEPRRAQVLQKMTNIAGCGKAVKINVGDFTKLAIPDQYKDVTGLILDPSCSGSGI
                     FGRKYVDSLNRAKRLQDQEKKHQQNDKEENDLILEEEEQAVASDDPDLQSRLSKLSSF
                     QFQVVKHAMSLPNAKKIVYSTCSVHPEENEKVVIDLLLDRKVQEWGWKVAGRENVIPD
                     WPRRGIKGEFDQVFRKETAKCQELADSCIRALPREDGGIGFFAVCFER"
     gene            <396703..>398832
                     /locus_tag="HG535_0D02040"
                     /db_xref="GeneID:59236220"
     mRNA            <396703..>398832
                     /locus_tag="HG535_0D02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288329.1"
                     /db_xref="GeneID:59236220"
     CDS             396703..398832
                     /locus_tag="HG535_0D02040"
                     /inference="similar to AA sequence:RefSeq:NP_014377.1"
                     /note="similar to Saccharomyces cerevisiae HDA1 (YNL021W);
                     ancestral locus Anc_2.285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144224.1"
                     /db_xref="GeneID:59236220"
                     /translation="MSVEVVKKEEMHTLDRKHKLEDSQSELVDGHDSSSWQSNGKKKQ
                     VIVPICTPKIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
                     NGLIKDPTLIGADDIGDLMLKIPARAATDEEILQVHSKEHLDSIEKVSKMNREQLLKE
                     TESGDSVYFNNDSYFGAKLSCGGVIEACKAVVEGRVKNSIAVVRPPGHHAEPEAAGGF
                     CLFSNVAVATQNILKNYPESVRRILILDWDIHHGNGTQKAFYEDDRVLYISIHRYEGG
                     KYYPGTIHGRYDQVGESKGAGFNCNITWPVAEVGDSEYMLAFEEVVMPMAREFRPDFV
                     IISSGFDAAEGDTIGRCHVSPSCYGHMTHMLKSLARGNMCVALEGGYSLDAIAKSALS
                     VAKILIGEPPDELPDPKKTPKIEAVEMINKVIRIQSKHWNCFKYKNGNAGYKFNEEIT
                     ESLISRTFPLQKAIREEQLRQLAKNYGFITLPLNEIEVPEDTILCSPDIFQEKTIIIL
                     VHDTPEIWAAGDTITGLIDPSTSIIVDSTLDFLKWAVDRKYGVIDVNVPQSLYEQDNY
                     SAMITAQEILLNLWDNFIKFLPSIAKVAFIGVGDAYSGIVHLLGHRDTRTLVKSSVSF
                     VGRKPLKPLVPLVDESLSDWYFKNSLVFTDKNHPCWVDNENKKPRKKFGRVLRCESDG
                     LSSNMQERFEEGTDFILDSFEEWSDSD"
     gene            complement(<399023..>401065)
                     /locus_tag="HG535_0D02050"
                     /db_xref="GeneID:59236221"
     mRNA            complement(<399023..>401065)
                     /locus_tag="HG535_0D02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288330.1"
                     /db_xref="GeneID:59236221"
     CDS             complement(399023..401065)
                     /locus_tag="HG535_0D02050"
                     /inference="similar to AA sequence:RefSeq:NP_012171.1"
                     /note="similar to Saccharomyces cerevisiae PRK1 (YIL095W)
                     and ARK1 (YNL020C); ancestral locus Anc_2.284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144225.1"
                     /db_xref="GeneID:59236221"
                     /translation="MNQPNIGKYAPGTVLTVGSHQCKVLNYITSGGYAQVYTAEMFPN
                     DGTSESNVVCLKRVIVPDKPSLNTLRAEVDAMKLLKDRKYVVSYIDSHAAKSSLQNGS
                     YEVFLLMEFCAGGGLIDFMNTRLQNRFQEFEILNIMSQVTQGIAAMHALIPPLVHRDI
                     KIENVLISQRGEYKVCDFGSVCGVIRPPKNPQELAYVEHDIMKSTTAQYRAPEMIDLY
                     RGFPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRYEFPAQPLYSGRLKNLIQ
                     TMLMESPIQRPNICQVLEEVSRMQGLPCPIRDFYLLRAMEQNDRSKDLQNYQLYNSKT
                     HPTLGHSSIPIINTHHINSLPSMQQATPVPQQMHQITTSNTLSTFIPVPQIQQARSSA
                     HLDDLKSHFQTAKVADVEGGKMYGLQNYQSAHSNLSIASTSPEKSGRGKISQMMQSNP
                     IQYHRGSLYVDSETQTFDTSTSLESKEPRDLSLPKPTVDTMQLTRRALAQSASKTGSS
                     ISTNLTAKDQGRSLSPDTLDNHREKPYSLNTKTNDLSSDHTLQYPRLNPVKKLDSKYE
                     RDGPSREDSKQAIQKRVHELLNSSEESLQGNSPKEDHDRENADRQTQPIFPHSRKGKA
                     TPPPLPPKPAHLRPKKPAKPNFLRGAKIKKEDQIAVLDGEVEGLTRNVRKEVASTL"
     gene            401574..401647
                     /locus_tag="HG535_0Dtrna5I"
                     /db_xref="GeneID:59236658"
     tRNA            401574..401647
                     /locus_tag="HG535_0Dtrna5I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:59236658"
     gene            <401910..>403094
                     /locus_tag="HG535_0D02060"
                     /db_xref="GeneID:59236222"
     mRNA            <401910..>403094
                     /locus_tag="HG535_0D02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288331.1"
                     /db_xref="GeneID:59236222"
     CDS             401910..403094
                     /locus_tag="HG535_0D02060"
                     /inference="similar to AA sequence:RefSeq:NP_014363.1"
                     /note="similar to Saccharomyces cerevisiae YNL035C;
                     ancestral locus Anc_2.283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144226.1"
                     /db_xref="GeneID:59236222"
                     /translation="MDETPSYKSLECIDFGANNWCLAFQPLYKHALLTSLSNGEVHHL
                     DWDTGKSKQVTETGDISCNDLKVINSDYNNGTLYAVASGSSVKIFDIRSQNAVALLKN
                     DKNAPFLSLDSRHNFLASGTELSGVDAEILMHDIRKWNVPVKTFIDSHHDDVTDLKFH
                     PSDPHILLSGSTDGYTNIYDLRHQDEEDCLHQVINFASIHSCGWLSPKRIYTLSHMET
                     FAIHELNDITDEAREPKPLDFCDVRETWNCGYVIDIYPGFIAAGSSQQNCGFLKLLPF
                     ENEIVEVKNSIVIPSAHGNEVIRDVYIPPEQSDLLYSCGEDGCVRIWKGRKALNVPSE
                     FWEYSAKLDVLSDSTPVPVQPNTLDAEATKRPIEVIHSDSRKEKNKKNSKKSQSKRYK
                     PY"
     gene            <403312..>404664
                     /locus_tag="HG535_0D02070"
                     /db_xref="GeneID:59236223"
     mRNA            <403312..>404664
                     /locus_tag="HG535_0D02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288332.1"
                     /db_xref="GeneID:59236223"
     CDS             403312..404664
                     /locus_tag="HG535_0D02070"
                     /inference="similar to AA sequence:RefSeq:NP_014358.3"
                     /note="similar to Saccharomyces cerevisiae YNL040W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144227.1"
                     /db_xref="GeneID:59236223"
                     /translation="METEASVKRTYVGSLRCQRESLLLDGFKTFVISSDPIENNGKKA
                     KGVKKYEVELQDTILFPEGGGQPSDTGFLKLIGDAQNVNIPVDYVHRAGLHAKHEVDR
                     HIEPGTEVEITVDADRRLDYMQQHTGQHLLSAILDTKYKLNTVSWSMGGVPTEKKPQL
                     EINDYFNYVELDGKLSFEEVSEISKIIEDYIILNHQDISVEESTPEQQADVKTHKVPD
                     DYDLEKGILRTIHIGSLDANPCCGTHLTSTSQIGSFLILPNQTNIRGNNSRLYFICGN
                     RVAKYGRLANEILFKSKNILSCPEQEITGKIEKMKDQIQKSSKREQFWMKELATYDAE
                     KISQKLNDTGKAFLLRDEFGALDYLLQVSKELSSTISNFSEYEIVLCGREKQSASGSL
                     IILSESGDKIVKISDSLFALLETLKGGGGKKGGKWQGKIANFSDSQYNASLDYLSTNF
                     "
     gene            <404920..>406656
                     /locus_tag="HG535_0D02080"
                     /db_xref="GeneID:59236224"
     mRNA            <404920..>406656
                     /locus_tag="HG535_0D02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288333.1"
                     /db_xref="GeneID:59236224"
     CDS             404920..406656
                     /locus_tag="HG535_0D02080"
                     /inference="similar to AA sequence:RefSeq:NP_014359.3"
                     /note="similar to Saccharomyces cerevisiae BDP1 (YNL039W);
                     ancestral locus Anc_2.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144228.1"
                     /db_xref="GeneID:59236224"
                     /translation="MSSVVNKSGVRFTPKTRQRRLLTTARTVQPSIVANEERSQADKS
                     GDGNENEDTAVETRETVSQNAHDASADEDEGDEEDEDDNDTYVADTKLGPLEKLDGTH
                     INAKLKVPSTVSSSSRRRHSSRLDSLGGATSAKPLFKPGFNEPSIGNDGRRLSTISNS
                     TTRKVRLSSISEKDVALQALKRSRMSARTSISKKSGSAHRISIVSRMSSPDANVHTAT
                     AVPKSEGKKESSADLFQRTDSLYEKYTIKNLQEIPKNIQDFDSNRYTLDEEEFTMAEL
                     CKPKLPIGEPSENFERAKQACKAKIEKRKLRRELRHKARLEFKSLKSLRKEEQEKELE
                     ERKKATEKLLNSDVPESQGSHAAIQLKMGPDGKLIVDEDSTVVDRHKNASMENAHKQK
                     LDENPFENLYNSATYGRNAYTDPWTTEELIKFYKALSMWGTDFNLIAQLFPYRTRKQV
                     KAKFVNEERKHTIIVELALQSKLPPDFEQYCIDTKKEIGTVSEFNERLNELKVKHEEH
                     LRAIDAAKANAKEEDLKSFKLSDGDDSKKKTSGGFTRDQLKVYRKSEIVLGTIEEKRK
                     QAIKEAEEYAMG"
     gene            <406866..>407414
                     /locus_tag="HG535_0D02090"
                     /db_xref="GeneID:59236225"
     mRNA            <406866..>407414
                     /locus_tag="HG535_0D02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288334.1"
                     /db_xref="GeneID:59236225"
     CDS             406866..407414
                     /locus_tag="HG535_0D02090"
                     /inference="similar to AA sequence:RefSeq:NP_014360.2"
                     /note="similar to Saccharomyces cerevisiae GPI15
                     (YNL038W); ancestral locus Anc_2.281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144229.1"
                     /db_xref="GeneID:59236225"
                     /translation="MSIIESISLEPLMRQRYSLEIHQNSNGGILRITMVPTWNTNKNA
                     MNLLIVALGTITGIFTLARYVQLSNTGQLFSIATIFFLLSLIFRRPTMETLTVLANYG
                     VQIRKVRGLAFLPRSFNRHWFAETEFIPRDQVVDVVINEGFVRGFQVIFYLAVLVKES
                     TKLRLLFAVCKHVFSLTTRALY"
     gene            <407661..>408632
                     /locus_tag="HG535_0D02100"
                     /db_xref="GeneID:59236226"
     mRNA            <407661..>408632
                     /locus_tag="HG535_0D02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288335.1"
                     /db_xref="GeneID:59236226"
     CDS             407661..408632
                     /locus_tag="HG535_0D02100"
                     /inference="similar to AA sequence:RefSeq:NP_012170.1"
                     /note="similar to Saccharomyces cerevisiae YIL096C;
                     ancestral locus Anc_2.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144230.1"
                     /db_xref="GeneID:59236226"
                     /translation="MGRPLKGKSGAKSLKAALQRHQTHDQLAQQYRKKAENKLKKKSQ
                     PSTKVKKNQEMQKLMQSNFVPFEKNQTLLLIGEGDMSYAKSIIEEGYVVPENLIVTSY
                     DNSISELELKYPHSFHENYHYLLGQNVKLFFKIDAKNLTKSFKLSKKTPWNKVLGPTW
                     KNKILQNILFNFPHTGKGIKDQDRNVADHQELVLGYLRSCKELFELVNKPIMTNLSNY
                     NQGYDIKESQNNQEITSEGYGKFLLTVFTGEPYDSWMIKTLAKSIGLCVQRSGKFHWD
                     LYPSYQHRRTNSEQDTTKPAKERDARVYVFEKFERKKKKNQASDEDD"
     gene            complement(<408669..>410177)
                     /locus_tag="HG535_0D02110"
                     /db_xref="GeneID:59236227"
     mRNA            complement(<408669..>410177)
                     /locus_tag="HG535_0D02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288336.1"
                     /db_xref="GeneID:59236227"
     CDS             complement(408669..410177)
                     /locus_tag="HG535_0D02110"
                     /inference="similar to AA sequence:RefSeq:NP_012169.1"
                     /note="similar to Saccharomyces cerevisiae FYV10
                     (YIL097W); ancestral locus Anc_2.279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144231.1"
                     /db_xref="GeneID:59236227"
                     /translation="MGSLMNEPDTDFHLKLNEQLFHIPHELVRKNVKQVQKLIDRETA
                     VLQKLFTEMNKLLESNTLEQDKLALVKLNDIIKHVDHIEKRLNKRGEEELKLLNRIDS
                     RIKFFKELEESKASRDVSRLTEWYQKFTNLLVGDYLMRNSTVRSNSSVPENISNEDEK
                     YWNPGVVFLRQQNLKTLLDYDILLSANRISKALTESHDLGPLLSWIGENKSFLKRNYS
                     FLEFEARLQEYVELIKTANFIDAIACFRNYLLQFMESNFADLKLASGLLVFIKSCEYN
                     QIMSQSKISYDQERNNNIPNGKSEACFTTRDQIYKHFFHKKVLPKPSLPYSSNDFNLN
                     YCNKNLDFERYTDLLDEKRWSTLNDLFTKEYYSMYGISHQEPLLMYLSLGISALKTKE
                     CVNHRVVISSDNEKLDSFIDENVLTSNCPVCSEEFAPIAKNLPYAHHTESKLFENPVM
                     LPNGNIYDAKKLKLLATTLNRKNLCSLDDGKVMDPIDKNIYSESEFITMYPT"
     gene            complement(<410540..>411649)
                     /locus_tag="HG535_0D02120"
                     /db_xref="GeneID:59236228"
     mRNA            complement(<410540..>411649)
                     /locus_tag="HG535_0D02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288337.1"
                     /db_xref="GeneID:59236228"
     CDS             complement(410540..411649)
                     /locus_tag="HG535_0D02120"
                     /inference="similar to AA sequence:RefSeq:NP_014361.1"
                     /note="similar to Saccharomyces cerevisiae IDH1 (YNL037C);
                     ancestral locus Anc_2.278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144232.1"
                     /db_xref="GeneID:59236228"
                     /translation="MMSYRNSMVAKSAAKRTFASIATTEKVLPKKYGGRFVVTLIPGD
                     GVGKEITDSVVSIFEAENLPIDWDRVDISGVDRKEDVKAAVDSLKRNKIGLKGIWHTN
                     AADQAGGGSLNVALRKELDIYANVALFKSIEGVKTRIPNVDLVVIRENTEGEYSGLEH
                     ESVPGVVESLKIMTKAKTERIARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNTVT
                     RIGEGEYPDVKVDSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLV
                     AGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMILSAALMLNHLGLETSSARISKAV
                     HEVIAEGKSTTKDIGGSSSTTDFTKAVIEKLSSYK"
     gene            <412222..>412713
                     /locus_tag="HG535_0D02130"
                     /db_xref="GeneID:59236229"
     mRNA            <412222..>412713
                     /locus_tag="HG535_0D02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288338.1"
                     /db_xref="GeneID:59236229"
     CDS             412222..412713
                     /locus_tag="HG535_0D02130"
                     /inference="similar to AA sequence:RefSeq:NP_012168.3"
                     /note="similar to Saccharomyces cerevisiae FMC1 (YIL098C);
                     ancestral locus Anc_2.277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144233.1"
                     /db_xref="GeneID:59236229"
                     /translation="MGPLQSEALHAYKAVIKAMVRSNKKSKIALRLGEKKQEIAVLTY
                     KRMNVVREMNVKNIDVLRKSRLVRDLQSLNRKVETLKNSDPSRDRKLHFIEDSGSIKK
                     EFLSHALNERNIIHFKDVASFLTNQREYDELIERYNPGTKLSQEEIVKRTAERVGLNV
                     PFQ"
     gene            complement(<412800..>414668)
                     /locus_tag="HG535_0D02140"
                     /db_xref="GeneID:59236230"
     mRNA            complement(<412800..>414668)
                     /locus_tag="HG535_0D02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288339.1"
                     /db_xref="GeneID:59236230"
     CDS             complement(412800..414668)
                     /locus_tag="HG535_0D02140"
                     /inference="similar to AA sequence:RefSeq:NP_012167.3"
                     /note="similar to Saccharomyces cerevisiae SGA1 (YIL099W);
                     ancestral locus Anc_2.276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144234.1"
                     /db_xref="GeneID:59236230"
                     /translation="MGFEKAKGCNKFRNFTVVLTVVFLALVTLLKSKDHYSVTGDPLV
                     GHSHRNDVDGANRSGNNITIVDFFKPYDPAYPTSAPTSRFFKKINLRPLSPYSIPRVN
                     FTVWIDEQYDISFERLLLNIGDQNLANYDSLRGNNVLEGVIIASPSQNEPNYFFQWIR
                     DSAIAMNTIVFNLFSLDAESAESAGLNVTLAGTVLKYLKNSYELQRLENPSGSGVDSD
                     LLKGLGEPKWNVDNRPFLDAWGRPQNDGPSLRTLTSFHFLRELQKNSVSLEDVIAQYE
                     SHFQHELDLPFENERELYENIIFWDLQFVVKNWKDNTFDLWEEIQGQHFFTSIVQISS
                     IKVAIAFLKDHEKDWSDLQEFVNDLETCYDELTSFIFEESGFLNPNKNFIVETPSMLH
                     SRSGLDIAVIIGSILTHNYELSNSSNSIPFDVDDSGVLNTLYSMVRSMEIIYPINHQR
                     AKLKTGVALGRYPEDIYDGVKTSEGNPWFLSTAYASELLYRLILRNYQFGDDLIISLD
                     NWESEFWTLIFEGFDDYVAEDNLNYNGNSNGNKNTYQLVIPFNSPAFNQTMLSIFDLA
                     ESFLDKIREHVSDDGNMSEQFNKYTGYLQGAENLSWSYGAFWTSCNVRSKVLELLQ"
     gene            <416166..>416804
                     /locus_tag="HG535_0D02150"
                     /db_xref="GeneID:59236231"
     mRNA            <416166..>416804
                     /locus_tag="HG535_0D02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288340.1"
                     /db_xref="GeneID:59236231"
     CDS             416166..416804
                     /locus_tag="HG535_0D02150"
                     /inference="similar to AA sequence:RefSeq:NP_014362.3"
                     /note="similar to Saccharomyces cerevisiae NCE103
                     (YNL036W); ancestral locus Anc_2.275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144235.1"
                     /db_xref="GeneID:59236231"
                     /translation="MISDSPFTLSHDSKLDDLLQANKLWAQQMNHVHPSLFPEFNGKG
                     QQPHTLFIGCSDSRYNETCLGVLPGEVFTWKTVANICSHKDLSFKATLEFAIRCLKVN
                     KVVICGHTDCGGIKTCLTHQREPLRENKCEHLHEYLQDIDDLYHENKSSLKRYTDLTS
                     QSKYLSQCNVARQFNRVMENETVQEAVQEGILAVYGLLYNVDSGLLEKVTSN"
     gene            complement(<417752..>418378)
                     /locus_tag="HG535_0D02160"
                     /db_xref="GeneID:59236232"
     mRNA            complement(<417752..>418378)
                     /locus_tag="HG535_0D02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288341.1"
                     /db_xref="GeneID:59236232"
     CDS             complement(417752..418378)
                     /locus_tag="HG535_0D02160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144236.1"
                     /db_xref="GeneID:59236232"
                     /translation="MQIMVQFTHFELLVLRQCRRHILRVHHMNILVRSIAILYDYHLQ
                     HLLRISVQLQVFSSSRGKLLELCSSRLLRRQHVRQLILKAIENTLFSLVPHRLLRDLE
                     RIRKRLRYIRLVRSYFCLVMALALVAPQTSKIQPLVIIERAVRKNHLIEIHMMHWESR
                     RSVVLNQRHPPNSALIVGSKKMISRNVAKNSLKTHFTNILPSSLYTIQ"
     gene            <418478..>419968
                     /locus_tag="HG535_0D02170"
                     /db_xref="GeneID:59236233"
     mRNA            join(<418478..418559,418845..>419968)
                     /locus_tag="HG535_0D02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288342.1"
                     /db_xref="GeneID:59236233"
     CDS             join(418478..418559,418845..419968)
                     /locus_tag="HG535_0D02170"
                     /inference="similar to AA sequence:RefSeq:NP_012165.1"
                     /note="similar to Saccharomyces cerevisiae XBP1 (YIL101C);
                     ancestral locus Anc_2.274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144237.1"
                     /db_xref="GeneID:59236233"
                     /translation="MRGLIHVPRTGQEEHDHSLQDSCLRSLGSFSTAYTDLHWNNLVR
                     DLKSQMLEMYKDYLIDEKGLGRNEVEDLSITDIIKRIRGGYIKIQGTWLPLEIAKLLC
                     ARFCFPIRYLLVPIFGEQFPEECETMFNNIHKQVGSNLTTINQTSYLSPNPWMDVNSS
                     VMSPINQYAFMPTQKRKKKNDYAAARKKLLPNYVAVPEVKHFVNKSPSPSFSRRNSTM
                     SWGPESSHFMMRKCSNENLPPISTIMDTLSQQILPVPVNDSYNYNQSQYQYQTPHNVS
                     INGSTFTPHQQVFSEPTVQTLSHLATFYTTNGHRYSYPGNVYLSNQKQSPIMENFSND
                     YFAPKSNQASYAPTHDYSAWNNIYSTERSAEYWLPKTNNDYSKVQNSQRNESVKYPAT
                     NQGPFSESR"
     gene            complement(420160..420232)
                     /locus_tag="HG535_0Dtrna4T"
                     /db_xref="GeneID:59236656"
     tRNA            complement(420160..420232)
                     /locus_tag="HG535_0Dtrna4T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:59236656"
     gene            <420410..>422896
                     /locus_tag="HG535_0D02180"
                     /db_xref="GeneID:59236234"
     mRNA            <420410..>422896
                     /locus_tag="HG535_0D02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288343.1"
                     /db_xref="GeneID:59236234"
     CDS             420410..422896
                     /locus_tag="HG535_0D02180"
                     /inference="similar to AA sequence:RefSeq:NP_014357.1"
                     /note="similar to Saccharomyces cerevisiae COG6 (YNL041C);
                     ancestral locus Anc_2.273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144238.1"
                     /db_xref="GeneID:59236234"
                     /translation="MDFIDYESFAVIDQSSGEDATNSLPEPSSTLNISSFREESKTQQ
                     DEFKLPYFLNNGTADENGKKSSLYDKMAVYANLSIESLNLNEPKTSKKEQPVDTVPQF
                     NEPTKAALPSSGISDFLSGKSSKTTDAANMVLSRKLSNVLTDYILTNYKSRTQLRKSL
                     DFLEENEDQLPFDTEKLIDSGYIGTLARRSLRSDIENELLKEHLIVLEEFRPIVRRIK
                     RFSSSVETIRVAGDDILKDNESVDEDEASVMNELTSLHTNLSSLRLKKSLLVSLQKLF
                     SLTQVEDDVIFNGTVDLEFFRVADKVLSIKKHATYLLSLPDAKAGTSLINKLNNTLKS
                     INNKVYNYLVDFIYHYESSSNYYGEKTLEVNTKKLNVFRKGLIYLTNDLEYFNEFLKK
                     VTTVRSKIVLDEFLSVFDYDPKDSLPIAISAHDPLRYIGDVLASVHSSIANEADFVKS
                     LFQFQVTQLEAGSETTKLQNEEYLDSLDVKLLNQIVQSLSNSCRIRIEQIVRFEENPV
                     TNLEIVRLLKLYQIMFERKGINAQSSIISSLKMLEVLSKEKITNSFTKIIDGISAIGN
                     ENNDTMPPEWLADYISRLVEFFEAYERGKDSDSNENDALASASFLKKAVEDPIQNKLS
                     KMIQNEFPTARKNEEVRSSLLTMQINCFDLIKSRLQPFSTTIFAQNEETSAIYQKITD
                     KLQQFINRMLELQNKLLFENSGLELYYNLLNMIFPISSIQDELDYDMYLSLSDNALME
                     LDTIMNKVHAKLTDYLPQALTDLQENLLFRLTSPSIADEISETCFENLFKFYINFRRI
                     LMHLYPDRKEKITSILNFTEEEFKTLIGLN"
     gene            complement(<422948..>424216)
                     /locus_tag="HG535_0D02190"
                     /db_xref="GeneID:59236235"
     mRNA            complement(<422948..>424216)
                     /locus_tag="HG535_0D02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288344.1"
                     /db_xref="GeneID:59236235"
     CDS             complement(422948..424216)
                     /locus_tag="HG535_0D02190"
                     /inference="similar to AA sequence:RefSeq:NP_012163.1"
                     /note="similar to Saccharomyces cerevisiae DPH1 (YIL103W);
                     ancestral locus Anc_2.272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144239.1"
                     /db_xref="GeneID:59236235"
                     /translation="MAEVTKTARRRFVGIKKDDYSNSSSGNDKSAVVHRPRTRINATR
                     AINHIPDEILNDKELNESVKLLPPNYNFEVHKTIWNIKKHSAKRVALQMPEGLLMYSL
                     VISDILEQFCNCETVVMGDVSYGACCIDDYTARALDCDFLVHYAHSCLVPIDITSIKV
                     LYVFVTININEDHIIKTLQRNFAKGERLATFGTIQFNPAIHSIKDKLLNDDGHMLYII
                     PPQTRPLSKGEVLGCTSQRLDKKQTDAMVYIGDGRFHLESSMIHNPEIPAFRYDPYSR
                     KFTREYYDQKRLVELRSEAINAARHGKTFGLILGALGRQGNLATLEKLENSLKDSGKK
                     VVKIILSEIFPQKLAMFDDIDVFVQVACPRLSIDWGYAFSKPLLTPYEANVLLQKDVM
                     FTDKYYPMDYYESKGYGRGQNPVHEGQINT"
     gene            <424396..>425874
                     /locus_tag="HG535_0D02200"
                     /db_xref="GeneID:59236236"
     mRNA            <424396..>425874
                     /locus_tag="HG535_0D02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288345.1"
                     /db_xref="GeneID:59236236"
     CDS             424396..425874
                     /locus_tag="HG535_0D02200"
                     /inference="similar to AA sequence:RefSeq:NP_012162.3"
                     /note="similar to Saccharomyces cerevisiae SHQ1 (YIL104C);
                     ancestral locus Anc_2.271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144240.1"
                     /db_xref="GeneID:59236236"
                     /translation="MLTPKFEVTQDDEFVFVTVIISSIRFNAAGLEMVVNDNVFVFHL
                     SPYYLRLRFPYNIVDDERSTAKYQAGNETIKIQLPKEEKGKFFEDLDVPTKLLARQGD
                     LIGADTIDENKKEATGPLIQEIDVTPKTLEVENIQSVGEAFNWEIEQTPHDVADGLLA
                     IKYGFENQYNSIIQVSVSNGNDINELNDPEHTSANDRVEERLQKENLKFDPEYYVSEY
                     MIFKHESPEDLEINGIQEILKYTPPVVKEYLKWYKKSNEDDKAMPVEFTEKEQNQMHE
                     NIPRKEYLVSDAKRLYITILSLLFAHVFTLLETEGTQNPEIPWTIGKLTPQISSLDQQ
                     LLTDDAIKYHSIIKAAIVTGIRRSLSYPLHRNYELSLKAWTFVYYLLRGGKRLVIKCL
                     LNIHEVFRYHDVYYVYNKMLLDDLCSWFISQGNETVIKSLAIETKKEIDLLTKEDIGF
                     ECMSDFNPETGEPIWENMTIKEMEILAEIQYQESQLASDQQS"
     gene            complement(<425900..>427039)
                     /locus_tag="HG535_0D02210"
                     /db_xref="GeneID:59236237"
     mRNA            complement(<425900..>427039)
                     /locus_tag="HG535_0D02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288346.1"
                     /db_xref="GeneID:59236237"
     CDS             complement(425900..427039)
                     /locus_tag="HG535_0D02210"
                     /inference="similar to AA sequence:RefSeq:NP_014356.1"
                     /note="similar to Saccharomyces cerevisiae BOP3 (YNL042W);
                     ancestral locus Anc_2.270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144241.1"
                     /db_xref="GeneID:59236237"
                     /translation="MNTPNNSNSPMDDEQQQQPKSLMEVLFGTKLKDSDISERAIERA
                     LDYKVEQERTKQQYYRLENINRSIELFKLARDLGVPSQEISRLFSAESSHVPAVPAVA
                     KSGAGTNPTPSAPPLSRNATKNGRSSSLESGSGGADSLSRQPLSYRFPPAGSNLLPRP
                     VSLTNSSRELSSWRTNSPARIGASAVAALNDSIVIKEEDNHTAESPFSRKSTYHNRNL
                     SLPITKLYNATIPSGMTSILSFNKEDAENSSTQSTIPTTASTSNPQALTFSSSHTTTT
                     SNNKSHAPSNGNTNATTLRKPSGVAKKHRRTRSASSFGVIDLNVIDEAKQRDMQGRSS
                     HEKHHEYDEKTCSESSSRNESPVRKASDSTDIKALNPVAKLLNNS"
     gene            complement(<427583..>428228)
                     /locus_tag="HG535_0D02220"
                     /db_xref="GeneID:59236238"
     mRNA            complement(join(<427583..428089,428205..>428228))
                     /locus_tag="HG535_0D02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288347.1"
                     /db_xref="GeneID:59236238"
     CDS             complement(join(427583..428089,428205..428228))
                     /locus_tag="HG535_0D02220"
                     /inference="similar to AA sequence:RefSeq:NP_014354.2"
                     /note="similar to Saccharomyces cerevisiae YIP3 (YNL044W);
                     ancestral locus Anc_2.269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144242.1"
                     /db_xref="GeneID:59236238"
                     /translation="MNQLGTLAQVSRFTENLSMDKIKSEFNNIQSRLSSIRPPQEFFN
                     VKNVSKPQNFADLQSRVSYNLKYYSTNYAAIIALLSIYTLLTKPLLLFVIVFVFLSLA
                     GINKLNGQDLVTPFGTLKTNQLYTAVMFVAIPLGFLASPISTLLWLIGASAVTVFGHA
                     SFMEKPIETVFEEETV"
     gene            <430596..>432680
                     /locus_tag="HG535_0D02230"
                     /db_xref="GeneID:59236239"
     mRNA            <430596..>432680
                     /locus_tag="HG535_0D02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288348.1"
                     /db_xref="GeneID:59236239"
     CDS             430596..432680
                     /locus_tag="HG535_0D02230"
                     /inference="similar to AA sequence:RefSeq:NP_012161.1"
                     /note="similar to Saccharomyces cerevisiae SLM1 (YIL105C)
                     and SLM2 (YNL047C); ancestral locus Anc_2.267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144243.1"
                     /db_xref="GeneID:59236239"
                     /translation="MSKHNTMTSNVSGMLSQKQNNLQQLQNLQNHTKSLTSNEVPPST
                     NGFAPGSISGSSQPQFQQPAPYPLEGLTSETTAQNTLTGQQIRSDSGSTYRRVQSVQL
                     QSPQQINGSPGLQQGFQQVIPQGSSQGHPQMQSQVQSQGFPSQMQSSAPVGYSTMTTN
                     TSGRPLQGRNSLTSTSNISRARTSAHRQRNSLINQHDPRSPLVVLMPTSAQPTEILAN
                     RFSAWRNIIKSIIIYLTETASIQDEIVRQQLRLTHAIQFPFFVIENQHQPTTSEEKAS
                     QKFFLPLGNGSIQDLPTILNQYHGSLASHASRASKELTNDVIPRLEDLRRDLLVKMKE
                     IKSLQSDFKNNCGRELQQTKQDMKHFLESIEEATFGTAKQDPYLTKIILDKQIRKQLT
                     EENFVHEAFDNLENSGAELERVVVMEIQNALTLYARLLGEESQLVFDILISKLDNGFF
                     NKDPQFEWENFILRDPNFIVPNLPMRKMKEIVYKHQYNPLIHEIKSGVLERRSKFLKS
                     YSKGFYVLTPSFLHEFKTADRKKDMIPVMSLSLSECTVTEHSKKGSADDRFVVHAKQN
                     GIIHRGHNWVFRADNYETMMSWFEDLKILTSTSNIQEKTKFVTEKLNLQPDGRPKPKS
                     SSAQTSVTNTPTRPHVEIASANNFPTSTPRLDDQTNTNTTSSIPDTNDIQLDAIPNIY
                     VDAPERPTKEVR"
     gene            complement(<432797..>434524)
                     /locus_tag="HG535_0D02240"
                     /db_xref="GeneID:59236240"
     mRNA            complement(<432797..>434524)
                     /locus_tag="HG535_0D02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288349.1"
                     /db_xref="GeneID:59236240"
     CDS             complement(432797..434524)
                     /locus_tag="HG535_0D02240"
                     /inference="similar to AA sequence:RefSeq:NP_014350.1"
                     /note="similar to Saccharomyces cerevisiae ALG11
                     (YNL048W); ancestral locus Anc_2.266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144244.1"
                     /db_xref="GeneID:59236240"
                     /translation="MTALYTIAQALFIFAIILFALSRTDLSALTLEPPPKYRVRINDC
                     MKKIESNPTKNVQLNFGAWKNGAVRRNMILASSRPCEYTNGRGKNNRISIGQSDKLNR
                     QEFINNLVPQFRKQKRILFGFFHPYCNAGGGGEKVLWKAIESTLSKNDDNIALVYTGD
                     LDASVDVILQNVRNRFDYNLDKDRIVFIYLSKRRFVDSKMWPHLTLLGQAVGSILLTL
                     EAILKCPPDVWCDTMGYPFGYPIVNFFTKIPIVTYTHYPVISSDMLNKLKNTNSHNLR
                     TFLKYCYWKAFMLAYKFVGSFVTIAITNSTWTCNHIKQIWSSSEPRIIYPPCSTEKLI
                     VNDSKWNRKNQAVVIAQFRPEKRHELIIKSFAQYLAATEDVSESPTLILIGSTRSQED
                     KDYVAYLNKLATGEFKIPTSLIEFHTDCPYSAIQKYLKESSYGINAMWNEHFGIAVVE
                     YIASGLIPMVHASAGPLLDIVVPWDTTRKEQAKHNTTETRTGFFFRDKTDPDFKDVSD
                     SNKYPDLSELFVTVTNLTDEEKFSLSKRGRECVLFKFSDMKFNQDWTEVLIQLESFVR
                     QVNESKKNL"
     gene            complement(<435355..>436029)
                     /locus_tag="HG535_0D02250"
                     /db_xref="GeneID:59236241"
     mRNA            complement(<435355..>436029)
                     /locus_tag="HG535_0D02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288350.1"
                     /db_xref="GeneID:59236241"
     CDS             complement(435355..436029)
                     /locus_tag="HG535_0D02250"
                     /inference="similar to AA sequence:RefSeq:NP_012160.2"
                     /note="similar to Saccharomyces cerevisiae MOB1 (YIL106W);
                     ancestral locus Anc_2.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144245.1"
                     /db_xref="GeneID:59236241"
                     /translation="MRENGGPVVTDFNYTPSHQKQFLQPAVGTTVSSHQDLKQIVEMT
                     LGSEGVLNQAVKLPRGEDENEWCAVHCVDFYNQINMLYGTITEFCSPQSCPRMIATNE
                     YEYLWCFQKGQVPVAVSAPKYVECLMRWCQDQFDDESIFPAKLSGQFPPKFISKYVVQ
                     MLRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFSQEFELLRPADFGPLLELV
                     MELRDR"
     gene            <437182..>439782
                     /locus_tag="HG535_0D02260"
                     /db_xref="GeneID:59236242"
     mRNA            <437182..>439782
                     /locus_tag="HG535_0D02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288351.1"
                     /db_xref="GeneID:59236242"
     CDS             437182..439782
                     /locus_tag="HG535_0D02260"
                     /inference="similar to AA sequence:RefSeq:NP_012159.1"
                     /note="similar to Saccharomyces cerevisiae PFK26
                     (YIL107C); ancestral locus Anc_2.264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144246.1"
                     /db_xref="GeneID:59236242"
                     /translation="MFKNDIFDTAVPSPSDSECEPTEPLGRGNVNSGGQSESENRTET
                     GPNEDRKSGRGQMKHVRIVVDEDTSGGDEEAYDEDDEDGGEDDGNEGEERTSRLPSLP
                     TFQKRPLSDTPVTSTWNSPSSSADTTPLTSPEASSTNLAQMHRALLRPGATATRGNLS
                     APMVPTTNNNASNGNIATSTVLPMGATGAISPSKFQHPARRPTTIDVPGLTKSKSSPD
                     GTISREDPGSKLVIVMVGLPATGKSFITNKLSRYLNFSMYYCKVFNVGNTRRQFAKEH
                     GLNDQDSNFFDPKNSKYSKLRDKWALDTLDQLLDYLLEGPGSVGIFDATNTTNERRKV
                     VLETIRKRNAHLKVLFLESVCSNKSVVEKNIQLKLFGPDYKGKDPESSLRDFKERLVN
                     YMKAYEPIEDEENIQFIKMIDVGKKVIAYNIQGFLASQTVYYLLNFNLTERQIWITRN
                     GESEDNVLGRLGGDSNLTRRGENYARALAKFMDFQRAKFYADECEKQHNKIHQNGGVD
                     TNSNDNDTDNNKKNKNDKVKFNNDDDEGYQCNEFFVWTSMRNRSIETAKYFNEEEYPI
                     KQMRMLDELSAGDYEGMTYPEIQDEFPDEFEERRKDKLRYRYPGIGGESYMDVTNRLR
                     PVITEIERIQDNVLIITHRVVARILLGYFMNLNKDIICNVDVPLHCVYCLELKPYGIT
                     WALWEYDEVNDRFFKVPQSEMNTTKVKENELVFAERRYSVVPTAPPSASSPSSDSLPK
                     RSSSSRSSSLSRVEEGNESSKTSETKGDIHPTSLTSVPFPPPISSGANLIDGGGTSIS
                     TSRQRLAMPLQSHPKPSVLTNNNSENSKLVRSPKKGFEIDQLNEKLSKLKANASENET
                     LKSIDKKITD"
     gene            complement(<439989..>442064)
                     /locus_tag="HG535_0D02270"
                     /db_xref="GeneID:59236243"
     mRNA            complement(<439989..>442064)
                     /locus_tag="HG535_0D02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288352.1"
                     /db_xref="GeneID:59236243"
     CDS             complement(439989..442064)
                     /locus_tag="HG535_0D02270"
                     /inference="similar to AA sequence:RefSeq:NP_012158.1"
                     /note="similar to Saccharomyces cerevisiae YIL108W;
                     ancestral locus Anc_2.263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144247.1"
                     /db_xref="GeneID:59236243"
                     /translation="MRITGSNHIELFNLQDKAQLSSPCLIVHGKCSKSTDAKMMQVSH
                     PQLAPVTYPINEGFFKATIMLTPGENILTFVTDTNVSKTVTCSYTPLLQNPPVHMCLL
                     IAKDSPLAYDCPKIQRDREGGNGLDLAIKKLKMGAHLMQAFTNEQMLRAGFGNRTFRF
                     EEEFGPDYTFKQQTEMRNSVKIHIIRCNKTTSELRNHDLAQQNPKASNAGGLFGIAME
                     TLKGYGGPFAAENKPVQAAVMFLDTHWDGNFITAHAALGGGDDRIKLAIFGSHGLYSW
                     PTCIEDVVPYFMDDTRTSLNEVANDSGECGTHWETLNVTLGAFMHEIGHLLGCPHQVN
                     GVMLRDYVRLNRSFLTKEAFSSKNNSYGAASPIYPKEECTWNRLDLVRFLYHPSFTLP
                     ADYYDASYLRPGMLGNFIAPQPSLYPIGKGECNISGETGIFLIELICGDLAHGSIEYL
                     PKSLGGSGPQRNIVVSLDDLRSRLPKDKIEQFGNSFALKVLSVNASEVTIPNFPSFLN
                     VEPIPMKKYGFSSEVVGFKSQLFGNPNGGQDAGIIPIDIRNVTALRIFHGGALDGVRV
                     YMRRPTSTNAPPIPPRNSIKKLVHSFKAATVNENNTDSVLFGKQTNDFTDVVLEPGEY
                     LTGFNVRSGGWVDAIQVLTSEGRVSRMMGGAGGGLGELSPPAGQYILGLQGRIGQWVD
                     AFGIIYGPL"
     gene            <442661..>445381
                     /locus_tag="HG535_0D02280"
                     /db_xref="GeneID:59236244"
     mRNA            <442661..>445381
                     /locus_tag="HG535_0D02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288353.1"
                     /db_xref="GeneID:59236244"
     CDS             442661..445381
                     /locus_tag="HG535_0D02280"
                     /inference="similar to AA sequence:RefSeq:NP_012157.3"
                     /note="similar to Saccharomyces cerevisiae SEC24 (YIL109C)
                     and SFB2 (YNL049C); ancestral locus Anc_2.262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144248.1"
                     /db_xref="GeneID:59236244"
                     /translation="MSHHKKRVYPQAQYGQTPVQQPMAPLNANGVYPPGGASSGVYPQ
                     MQQPGESQQPLQQQFFTPVQQQLNQQIDQTTVALENMQLHNVPVVDPNAAFYQQQQQA
                     QMPMQSQVNMPVQSDGMHARGGKAMNQLYPVDLLTELPPPINDLTLPPPPLMVPPERM
                     IVPSESSNASPDYIRCTLNAVPKTNSLFKKSKLPLALVIRPYQHLQDDINPPPLNEDG
                     LVVRCRRCRSYMNPFVTFIDGGRKWRCNFCRLSNDVPMQFDKTTSGVPSNRYERNEIK
                     HAVMEYLAPKEYTMRQPPPSTYAFILDVSQNAIKTGLLATTTRTLLETLDNLPNHDDR
                     TRISILCVDNSIHYFAIPLDEESDQVTMMDVCDLDEPFFPRPNSMVVPLNACRNNLEK
                     LLNQIPEIFQFNIMSKFALGPALKSAFNLISGIGGKIIVVSSTLPNIGIGKLQKRNEN
                     GVVNSSKESAQLLNCQDSFYKTFTIDCSKSQITVDVFLASEDYMDVASLSNLGRYTGG
                     QTHFYPGFSATKLTDVTKFTNEFSKHLCMDISLETVMRARGTTGLRMNAFFGHFFNRS
                     SDLCAFSTMPRDQSYVFEVTMDDSIVGDYCCFQIAVLLSLNTGQRRIRVITVSLPTSE
                     SLPEVYASADQLAMTAYYTQKAVEKAGSNLEDARDYLNKTVQDILSVYKKEIVVSNTA
                     GGAPLRLCANLRMFPLLMHSLTKHMAFRPGIVPSDHRAASLNNLESIPLKYLIKNIYA
                     KVYSLHDMPDDVGLFDDNGEIILPKPINASASLFERYGLYLIDNSNELFLWIGGDAVN
                     ELVLDVFGIGDIFEVPIGKQELPFVENSEFNERLRNIIAKVREHNDVITYQSLYIVRG
                     ASLSEPVNHASAREVATLRLWATSTLVEDKVLNSESYREFLQNTKMKITK"
     gene            <445746..>446524
                     /locus_tag="HG535_0D02290"
                     /db_xref="GeneID:59236245"
     mRNA            join(<445746..445762,445816..>446524)
                     /locus_tag="HG535_0D02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288354.1"
                     /db_xref="GeneID:59236245"
     CDS             join(445746..445762,445816..446524)
                     /locus_tag="HG535_0D02290"
                     /inference="similar to AA sequence:RefSeq:NP_014348.3"
                     /note="similar to Saccharomyces cerevisiae YNL050C;
                     ancestral locus Anc_2.261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144249.1"
                     /db_xref="GeneID:59236245"
                     /translation="MTEFKVNCSVSRKDLYEGEVKLERKTGLRDIVPEFELIEVSSAQ
                     SPVEVSTQLEQDEFEFPLFSFAHAEVQESNEDEANKANYDESGNKTELQLTKITLRES
                     PCETFKQERPQSYYFARYSKEELTTFEESAIDYDTIFKDAKIGPIVGWERSSRKTVVD
                     ITQCNEEIERAILREERQRRARPSKRQRLGKRLGAEREREREAKDKQIKKLLKKKFHK
                     RGGKKNKKSTTSSKMARISPFPK"
     gene            complement(<446554..>447702)
                     /locus_tag="HG535_0D02300"
                     /db_xref="GeneID:59236246"
     mRNA            complement(<446554..>447702)
                     /locus_tag="HG535_0D02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288355.1"
                     /db_xref="GeneID:59236246"
     CDS             complement(446554..447702)
                     /locus_tag="HG535_0D02300"
                     /inference="similar to AA sequence:RefSeq:NP_014347.1"
                     /note="similar to Saccharomyces cerevisiae COG5 (YNL051W);
                     ancestral locus Anc_2.260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144250.1"
                     /db_xref="GeneID:59236246"
                     /translation="MSGEQLEDFEALLDTDFSAIQFSNDLLKATNGGPSTAELDLGTS
                     IKKINYDIGEINLRIDDTIKTNHNGLMDEVFRVKSLQKTTAAGLKPSLEYLDMSYQRL
                     QNEVLEPHSKAQKLQNVLSKVHQTSSLLRDALVYIHLVSRMQSLLEEQTTLTTERSLQ
                     LASIHTQLRLNMEKNANLTSLRLIKKLEAEVALPNKKEVLNFIAVTLSKQCTNYDKSR
                     DNTETVAKLMKSLYGLSKQEYVSTIHKIVLTSIALSAQTLAKTLNSIKTFPTAFEEVV
                     SRGSIIYQLEEIMRKEKVEKFNLLNEFMSQMRPKPLSPTKLFWSRIASNFKKEFDLSY
                     TRGGPVGKSLSRHETMIADTIKQAMSNNAAINSYLDMMLASVSILQND"
     gene            complement(<447826..>448941)
                     /locus_tag="HG535_0D02310"
                     /db_xref="GeneID:59236247"
     mRNA            complement(<447826..>448941)
                     /locus_tag="HG535_0D02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288356.1"
                     /db_xref="GeneID:59236247"
     CDS             complement(447826..448941)
                     /locus_tag="HG535_0D02310"
                     /inference="similar to AA sequence:RefSeq:NP_012156.1"
                     /note="similar to Saccharomyces cerevisiae YIL110W;
                     ancestral locus Anc_2.259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144251.1"
                     /db_xref="GeneID:59236247"
                     /translation="MSFSFGFNSNDLSDDELEGESQLSATNSAKYSSVSNNGNPLDED
                     RLKAADVLQPELVDLSDLLTSLNNVRISFEQFKTPKKHVTLYRRELFDVKHQLMSEVG
                     DSDDPLQNVELDILLGETSEDLRKNVYEGGLKSWECSIDVVETISDEADLVNDFDCVL
                     ELGCGTSLPSEYIFQRYLQQSVTHGLRLILSDYNKSVLRLVTIPNLIITWAKTTLSNE
                     QWNLLQQSGNSSDVTIQDDELLLTPTLLDAFYQDIQSRNISLVFISGTWGRFFNKIAE
                     SQIVVNTSLLLITSETIYQPENLPVVAETLIEMLLANLHKSKALIAAKDIYFGVGGSI
                     VELEKYLNIAIKNRSIPLSLNTYKIDAGLKRSIVSLE"
     gene            complement(<449295..>449753)
                     /locus_tag="HG535_0D02320"
                     /db_xref="GeneID:59236248"
     mRNA            complement(<449295..>449753)
                     /locus_tag="HG535_0D02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288357.1"
                     /db_xref="GeneID:59236248"
     CDS             complement(449295..449753)
                     /locus_tag="HG535_0D02320"
                     /inference="similar to AA sequence:RefSeq:NP_014346.1"
                     /note="similar to Saccharomyces cerevisiae COX5A (YNL052W)
                     and COX5B (YIL111W); ancestral locus Anc_2.258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144252.1"
                     /db_xref="GeneID:59236248"
                     /translation="MLSSFSRVSRIAHSAGLRLASTQALSKAAIGDLASRWESMPPAE
                     QNDIVTKLSERQKLAWKDLSDSEKQAAWYISYGEWGPRRPVHAKGDGSYILKGVVVGL
                     VFSFGLFAFSRQFAQDAPITMNKEWQLKSDEYLKSKNANPWGGYSQVQSK"
     gene            complement(<450337..>453666)
                     /locus_tag="HG535_0D02330"
                     /db_xref="GeneID:59236249"
     mRNA            complement(<450337..>453666)
                     /locus_tag="HG535_0D02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288358.1"
                     /db_xref="GeneID:59236249"
     CDS             complement(450337..453666)
                     /locus_tag="HG535_0D02330"
                     /inference="similar to AA sequence:RefSeq:NP_012154.1"
                     /note="similar to Saccharomyces cerevisiae HOS4 (YIL112W);
                     ancestral locus Anc_2.257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144253.1"
                     /db_xref="GeneID:59236249"
                     /translation="MSTVSGSDLPVKKRTLSSYLSNVTSRREELEKLKFQQDVKREDI
                     IQEDVKQEDVKQEDVKQEDVRQENVKQENLKQQQEQDSVETEQTLKQAIRGLEKKELT
                     TEPQTEQQYDHEIDRNRQDIPYNHKEVDTRKSDEKSSAQSSLQEQVLEFKQTALISGS
                     DQFNVQESVPQTERSGSEDRSPEAPVKPLYRNDLHRALRDPENKAYEQELSSEGNNEN
                     HIRHNDDEKLETNSDEIDSDAPTEPASPPKPRRRRLIRADRLSSLSPRNNVFDNDSDS
                     ELSDIDELKSLQLSSSILHEDSSPTRQARHNYRESQQSSSPRKGSPKKPRAHFAVSKV
                     PKQKRGLYRDAGGRTRLQIACDKGNYDLAKKLIEEENYDVNDQDNAGNTALHEAALNG
                     HLELVKLLKKHGADVNIQSFEMFKDTPLIDASANGHLDVVVYLLDHGADPTISNAKDL
                     TAYESIEEESDLDEQEREIVHGIRNCLRSAARKRNNAELPVGKISENAAPIGERASPT
                     INRQIEEPLGDYEFFWTDITSKAGREKLFKASKDGKLAYVGAYLENGGRVDVKSFFEA
                     VKFGHEDIASLFLAFGAEVNAVLKDGTTALMNSVGRGHVGTVKLLIAAGADPTKKNKK
                     GHTALYYAQNSAMGVLEPEEIEILRETIKKYAYDNEKDGKIRKDAADGISSKKKTIPV
                     RNKEDESDNEIQEATNSSLPQNHEGEMNSDAGGIFNDKDNAVAKPNDKGNDSNDSNYN
                     SPSCDAEHIVNTGRKRKTLSPIPLPTKRQALSPGSMPLTENSDAISTAKILNSDIKVD
                     QASGNVVVRANEETPEEKEQKLKAEEEYIQKRLQNKKKKEQELLRKLAEDEEKREQEK
                     QKQKVEEVRKLERQQKERQMELGKRKQEAELARRKEVRAMYPLGLKLIDFRDNKDYLD
                     YLPLYYIEKRSIRDGSDAEGDVRYVLDLQVCVILKDKTIFSSQSAIKERIEVSPAHNQ
                     QLWNVLRFILLCGGYRNSRNDYKYFVDLYGNSLEARIQFETNEYRKFLQLPLHWIRWD
                     DINIDDPLMRERIQREMIELSLIDPSTTGPSPIFSHSSTPASSSEALPQAPETRKLPI
                     KFQHRESTSWLSDPSSARPMW"
     gene            complement(<454394..>455833)
                     /locus_tag="HG535_0D02340"
                     /db_xref="GeneID:59236250"
     mRNA            complement(<454394..>455833)
                     /locus_tag="HG535_0D02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288359.1"
                     /db_xref="GeneID:59236250"
     CDS             complement(454394..455833)
                     /locus_tag="HG535_0D02340"
                     /inference="similar to AA sequence:RefSeq:NP_012153.1"
                     /note="similar to Saccharomyces cerevisiae SDP1 (YIL113W)
                     and MSG5 (YNL053W); ancestral locus Anc_2.256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144254.1"
                     /db_xref="GeneID:59236250"
                     /translation="MVEEGANNASTMLNGHSKSPRSLQAKNTKNLFLNIGDNNATGTD
                     SKRASGYLPNSTAKPMIIGTFNGNGHSQQQVTKVLTPTSNSKYSPSSPIFKRNDTSIY
                     SLPSAVCTSPLYAARKCRSNSNLRSLSNKSERVQSPSLSVNTKELQSLASGRSRSQTM
                     SSSLATSTPLAAESGGKKTWVIPEQGSFNISQRGSYNLKSNFNDDVDVSFSKVYKENA
                     YPNGPLLVIPRKIFLYSEPNLEEILSFDVVINVAKEIVDYTNLIPRDGKLEYYHIPWT
                     HSSKISLDLEYLTNIMRVAVLENKRVLVHCQCGVSRSASLIVAYIMRYFDMSLNDAYG
                     QLKQVATEMSPNMGLIFQLMEWSEQLSQKKDAISTKNEENKLNKCQSVEAHIAIDQEN
                     SPSLESFGIPISDFSSQNDITLSPENTPKTSDDFFKTSSASSSASTSSSTIVESQVTP
                     ESLEMPSELKGYIPTSSEVSVSSSSSIWR"
     gene            complement(<456703..>459894)
                     /locus_tag="HG535_0D02350"
                     /db_xref="GeneID:59236251"
     mRNA            complement(<456703..>459894)
                     /locus_tag="HG535_0D02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288360.1"
                     /db_xref="GeneID:59236251"
     CDS             complement(456703..459894)
                     /locus_tag="HG535_0D02350"
                     /inference="similar to AA sequence:RefSeq:NP_014344.3"
                     /note="similar to Saccharomyces cerevisiae VAC7 (YNL054W);
                     ancestral locus Anc_2.255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144255.1"
                     /db_xref="GeneID:59236251"
                     /translation="MSEDDHKITVETETVEAPVSSLLMSTAEANRPSSVKQNAGAGAG
                     AGGVGSSNAAGTAAGAAVSAADAESVTLDEGGLANSQGQRRSQSNTNGLPESQSHVAS
                     GSKPLLVRDGAVGGSTVPGTNINLIDLNPLSPHVTQTSLRNKKSSLLIDSSLSHKGKK
                     ARDTEEVPKHSTTGSKKDGDSALVASSEDAHKKSDSSQNHTLQHSISNHSSKNGSAVP
                     TPLMLPVAATAIDSKSSKTLERSKAPLMHSREILLEDNNALTNSLALNNSNNNNNNTS
                     SNKAGSSTNSNEDPLNVRHRSSSGHRAGDEDSDHELDATNKQTKADVFAARLASAVGE
                     NEISDSEETFIYESAANSTKNTVTPIRIDMQLDQSQSQQVNHGIASKMSVPVLNNNAK
                     LLTRLKDTRHTSMGALPLNASTKNVNSPQFTPMNNVLTGMPTSSLANTSTNAPQADDL
                     KSMSSSNRQNNNVNSNNNSNSRQIDMQSVKSFVSEPRSPDKRMSLISLTKGTNNIGVT
                     NGNRNGNTYSTNNINSNAPISNSNNTNNINNTTNTNNNNNNNNNNNTSNNLYNNSMNN
                     TNNNNNAFSTSRKPSVSNSTLRHFTSSQAAVPRTKAPSSDGISSAVINPANNGKRNLR
                     TTASKLFDANGAPLRRYSGVPDDVNLEDYIEQSNGHLMTTTSNSIKRDDRLKNYMENN
                     HLNDFKRASHDLTDFEHTSAIQEVAEERTDQEADEDDMRSMFYYNHRGDLEARPQISD
                     YDQDDDDEELDDDNQDDHYYNYSYGNDYVSNSNINPNSNLNRQGRYFGTLPSTLQPNG
                     VYSHNGPFNPNANEYTSLQPKKQFLRDPLGYSPHNFYTRKSSWAKIKHFIYFTFVVVS
                     LLTVGFILGFLLATNKELQDFNIIIIDNILSSADELLFDITATAFNPGFFVLQIQDVN
                     LDIFAKSAYIGKTKELQDEDKPPAMETLKLGTVYKLETPLKFAGGFIKRNYDVSVSSV
                     KLLDPGAKLDSPEDNESRFLSPGQDKDDETKKWRSLIKHDYDLIFRGNMKYKIPFFRS
                     EKSIAVQGSVEVHPDKDDDDQNTSHTSSPIVLL"
     gene            <460994..>461839
                     /locus_tag="HG535_0D02360"
                     /db_xref="GeneID:59236252"
     mRNA            <460994..>461839
                     /locus_tag="HG535_0D02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288361.1"
                     /db_xref="GeneID:59236252"
     CDS             460994..461839
                     /locus_tag="HG535_0D02360"
                     /inference="similar to AA sequence:RefSeq:NP_012152.3"
                     /note="similar to Saccharomyces cerevisiae POR2 (YIL114C)
                     and POR1 (YNL055C); ancestral locus Anc_2.254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144256.1"
                     /db_xref="GeneID:59236252"
                     /translation="MAPPFFSDINKGINDLLNRDYYHNSVAAFDVSTVAKNGVKFNLK
                     AKQTVKDGPLAADVETKVSDKATGLTLTQGWSNSNNLNTKIELTDLTPGLKSELVTSL
                     VPGVSKAAKLNVNFVQPFFTARGAFDLLKGPSFVGDLTLAHEGIVGGAEIGYDITGGS
                     LSRYAVALGYSAGDYSLGLSVNNAQLTTVSFFQKVSPILQVGAKAVSTPKQLANVNIE
                     FATLYLPDATSQVKAKVADSGVVALAYKQQLRPGVTLGVGASFNALSLSEPVHKLGGS
                     LSFSA"
     gene            <462355..>467382
                     /locus_tag="HG535_0D02370"
                     /db_xref="GeneID:59236253"
     mRNA            <462355..>467382
                     /locus_tag="HG535_0D02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288362.1"
                     /db_xref="GeneID:59236253"
     CDS             462355..467382
                     /locus_tag="HG535_0D02370"
                     /inference="similar to AA sequence:RefSeq:NP_012151.1"
                     /note="similar to Saccharomyces cerevisiae NUP159
                     (YIL115C); ancestral locus Anc_2.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144257.1"
                     /db_xref="GeneID:59236253"
                     /translation="MSTIGEEIGTITSENFGFKKLGQSTILPSYDEKVPFAALQNFDI
                     SNTNNRYVAASADKIVIGELQLLRDFIQNDSHDDASFLWESNLRDIILVKIFSNDTVI
                     AILKNGTVYSVSLSRLGDLKEVHNFSHGIVQSFASKRQNRGFVLESNGTLHTYDPVSG
                     ETHNILDSVASFDVFDNVIYTFGKDYTIRAHSLEFNDGKVELKYEVNTPTEMVEEFHD
                     QYFPLSINVLDTNHFLLVYGLLNSESDDEVIYDHKMFIMNNSSTEPIFQESFDITPAF
                     GSVLRYPAYYNLRLFDLVPESKITNIITSSCSSEVTIWDSKEVVQPSQDSERAVLPIS
                     KITDNDTNPVGIALDISTTGVIANPCPGVDVVEELPLIYILNNEGSVQIVGLYHSSAI
                     KQGRFNINALREYTTEEEVEEERVTSNVSDMSVKKGDDEGHSDRDFSKLTLVSSVDVE
                     TGKSNPIQRSTPPKERQATDTEGPLLSSTASGKSFFDGDKTTCATTSIAGSPVNTKEQ
                     SDINKTFIDKQSENSGFGSTYGKPAFGKTEFGKAESGPTVGKLSFGKTALGATEASSP
                     FGKPSFGKTEFGATEASSPFGKPSFGKTEFGATEASSPFGKPSFGKTEFGATEASSPF
                     GKPSFGKTEFGATKASSPFGKPSFGKTEFGATEASSPFGKPSFGKTEFGAMKASSPFG
                     KPSFGKTEFGATEASSPFGKPSFGKTEFGATKASSPFGNPSFGKTAFGTAEASPPFDK
                     MQFGSQESGSAFGKPLFGKTGFGSTESSASFGSLAFGKTQIGGGGSGAAFDKPSFRST
                     EIVAEKTSSQDEKPSLGRTEFSSAKVSSPFGKAQPISANSGSTFMKAELDKMPSSSTD
                     TSSSDNKDHAPVFGKPEFGKAQFSNAQFDKEFGKSGFRGNLPSSQSDSLKAGKQPFSG
                     FASFNSQTGKLDNPFLSSSNSPSPFANLSDLSLKTSEKNLKTALNDKGEEEVDYSEVI
                     PKDANAEGQTVPVQNKQASDEKSSPIAETADKNVITNEKKSIELRKMGTSIKKEEGNM
                     SEQDQDLRVEGIEESQPEYESEFKGTETGSEMQSVISSNSLANDKAELQDSEKGESIQ
                     DSVVNRDLSDNSSSTNEELTNLSDSTIEDTASLTKLSNNDLTKENSISSIAARLKDSA
                     NILETGSTIRQSKVKSDVDKSLSPSSSFNNDMKTSSNLGFTFKNMGSTKERRKNLISE
                     TNADTNNSYSTIKGASPVISDTENSKINPEVHQTVKEGSFMRNDDPAHISNNYSEQKE
                     KREHCTSTIAGPKHENSGVFKTEVANAKSSKQKESADLEVQKKESRQQSNSKDSNSEE
                     SYDALDDFTQDELESAMDSDQVTYNSEKQNTDKEVQTTEVSLEEASTQAVPSIVSQSN
                     QTNPIKYCDFQVQAFENNEVHLATAHLPRPLKEYLTGAMLGQIEYFSQNPTTRLIEKS
                     YHLLCAEMEVLLDNITFLNEFLQDQSMNNLFERTVESLPNLYTWRLTEARKFQDIMTE
                     KVANFSNVSKVQTVYEEISKLTNEDFKSLSNEIKRCKEIYEQLQYSEQNININGLRDH
                     QLKMRMQLREKMSQVYTRLDNVEKSLQVLKLCTVQKDKLGGISLFETLSRDLSGRQNL
                     LSNIERLREELHDLKVGELYVKEKKENDTPLIKGEMETLSIVNVGLSLHNKKELGNIL
                     KYRSLDI"
     gene            complement(<467495..>468646)
                     /locus_tag="HG535_0D02380"
                     /db_xref="GeneID:59236254"
     mRNA            complement(<467495..>468646)
                     /locus_tag="HG535_0D02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288363.1"
                     /db_xref="GeneID:59236254"
     CDS             complement(467495..468646)
                     /locus_tag="HG535_0D02380"
                     /inference="similar to AA sequence:RefSeq:NP_012150.1"
                     /note="similar to Saccharomyces cerevisiae HIS5 (YIL116W);
                     ancestral locus Anc_2.252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144258.1"
                     /db_xref="GeneID:59236254"
                     /translation="MAFDLQNIVRPKIYNLEPYRCARDDFQEGILLDANENAHGPVPQ
                     ALLNTSLHRYPDPHQIQLKNAIAEYRNKTNSCDNIKEELTAENLCFGVGSDESIDALI
                     RACCVPGKDKILVLPPTYSMYSVSSSINDVEVVKCPLIVEDNSFQMNTDAVHDLLKKD
                     PLIKIVFLTSPGNPTGAKIETSRIEQLLQSWDKGMVVVDEAYIDFSGGSTAALVNKYP
                     NICVLQTLSKSFGLAGIRLGITFSSKEMSRVLNAMKAPYNISSSTSEFALKAFEDSSL
                     KAMEDNAKKINTEKLRLLKRLTSLKNVDDEHVGGLDANFLMIRIKDGDNELAQKLYYK
                     LATESKVVVRFRGNELGCSGCLRITVGTPEENDILFREFSKILAELTAA"
     gene            complement(<469630..>470148)
                     /locus_tag="HG535_0D02390"
                     /db_xref="GeneID:59236255"
     mRNA            complement(<469630..>470148)
                     /locus_tag="HG535_0D02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288364.1"
                     /db_xref="GeneID:59236255"
     CDS             complement(469630..470148)
                     /locus_tag="HG535_0D02390"
                     /inference="similar to AA sequence:RefSeq:NP_014342.3"
                     /note="similar to Saccharomyces cerevisiae OCA2 (YNL056W);
                     ancestral locus Anc_2.251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144259.1"
                     /db_xref="GeneID:59236255"
                     /translation="MPESTNYIPPLSFSPVVSTDVSLYRSGYPMPLNFPFIRDQLHLR
                     TIIYVGDKQELSQEYQDFLATENIKFHNIFMDSCRDPAVDERMNEVLKLVLDIDNYPI
                     LIHSNKGKHRVGVVVGIIRKVLQGWSLTGIYQEYGIFSGGLKGEADMEYVTMFETCLK
                     VPKEKVPRFAIF"
     gene            <471653..>472615
                     /locus_tag="HG535_0D02400"
                     /db_xref="GeneID:59236256"
     mRNA            <471653..>472615
                     /locus_tag="HG535_0D02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288365.1"
                     /db_xref="GeneID:59236256"
     CDS             471653..472615
                     /locus_tag="HG535_0D02400"
                     /inference="similar to AA sequence:RefSeq:NP_012149.1"
                     /note="similar to Saccharomyces cerevisiae PRM5 (YIL117C)
                     and YNL058C; ancestral locus Anc_2.250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144260.1"
                     /db_xref="GeneID:59236256"
                     /translation="MLSIMGAARDLPRLSTSRATSAATSAVSSSTRTSSSYTATVTPP
                     SPSGNPNIFHSDSRPDGTVFIAVGSIVGAIIAALFLWWIITNVISRRIARKALYGGLE
                     SQSKGHGSSPLEYSYGDDKDMFLPLRGLPDAYEERASRSKSRLFVNGGGSDKSNLRDS
                     TSWDSLPEFQPDAHDLNPVEKVNAIQDNVFNHYKRNSLFVSPVMEVLQQQQQQQTNRS
                     RATESENDSKTCLSSSLTPPSGELNRPERAASPERKLKKTPGNDYHKRNGSTLGITPV
                     DSSVSQSNIASSDSSTNKKNGHRKQVPSMYLEDMLEGNDKLNLQ"
     gene            complement(<472756..>473469)
                     /locus_tag="HG535_0D02410"
                     /db_xref="GeneID:59236257"
     mRNA            complement(<472756..>473469)
                     /locus_tag="HG535_0D02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288366.1"
                     /db_xref="GeneID:59236257"
     CDS             complement(472756..473469)
                     /locus_tag="HG535_0D02410"
                     /inference="similar to AA sequence:RefSeq:NP_012148.1"
                     /note="similar to Saccharomyces cerevisiae RHO3 (YIL118W);
                     ancestral locus Anc_2.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144261.1"
                     /db_xref="GeneID:59236257"
                     /translation="MSFLCGSSSSSKKPIEKKIVILGDGACGKTSLLNVFTRGYFPEV
                     YEPTVFENYIHDIFVDGRHITLSLWDTAGQEEFDRLRSLSYSDTDTIMLCFSVDSRDS
                     LANVQHKWVGEIADHCEGIKLVLVALKCDLRSSDNDAKAINPAVIQQQRSQPDTVDMK
                     NNLSDSNSGMNNAKNDYISYEEGLAMAKKIGALRYLECSAKFNRGVNEAFTEAARVVL
                     TDEMKNNKKEESDSSCSIM"
     gene            <474481..>479670
                     /locus_tag="HG535_0D02420"
                     /db_xref="GeneID:59236258"
     mRNA            <474481..>479670
                     /locus_tag="HG535_0D02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288367.1"
                     /db_xref="GeneID:59236258"
     CDS             474481..479670
                     /locus_tag="HG535_0D02420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144262.1"
                     /db_xref="GeneID:59236258"
                     /translation="MTIKPEYRDELCVTLLTELLAYQFTSPVRWIETQNVILNDFKAE
                     RIIEVGPSPILANMAKRTISANESCEMAKASLLRKEVYCTSNHLDKIYYNGEPPMVMN
                     KENEKQNVGQLVAVPETASPSPSSNLSTVDSRHRLNIDVKLNAEHLAKAIVSSKLRAS
                     RYSELNMTKSLKELCHGKSTLQNEIKSDLIKEFATFSEDNIEDTALLDICSDITVDGL
                     GPVVLPQVMKFVGKNLTGRFSTLKYLRAYLTNEWSMVDPNPFLVYLTYSNDSISHNCT
                     SETICKELIDKCCHSFAASENAFVIYNPVSTENSDDIELLKPSTISMEQFGSFKDQLC
                     RLHTEQNNILSTHICEHSNRATTTTNEELQQMKDKMTCLENEFGKDLLNNSIDLMFSS
                     KKVRVYSSSWNWVRQDVLNFCHLDLTETTRNSLTDIRKKMKDIQNRVDPISLKMLQYF
                     VDNQCHDGPKKELLNVLIKDCVNIIKLNPVYSGELESFGFQIVENGNSKVIDEKVNLE
                     VYIKTMSLGKGTNEVQKNTSVVSSKLDIDVSSYYKIETDLFQVYSKIIQYALASSNSN
                     PSELWGQFKSLYEQILIFLKNSDQIASYFRAIVSDALSAINKPLYSKTENILVEDYSV
                     DSSSDDESETSADEETVVSETAKSHSILPKKEKSIDSCAIPVGVIPFLHIKRHSHTNE
                     NWVYDKSNTQVFLNNLLNIGRNGISLRGKTILLLVSHFGNDFTREVIKALVQTGGTVL
                     LATDDYKLETTRTLQKIYHQHGAKGSHLVVLPLNHASQVDVKRLCDYIYSKYGDIDYL
                     LPLNAPKREKSVFDVSSEDELQMRATILNVLRLLGNIVRIKKSKKIETRPTFVLLPLS
                     PTFGSKPCNGFLSESYSSLNKVLDMWHIEDWKNEISICGCVYGWTIETGEDMDISVTD
                     LEHLGIRTFSPSEMAFNVLGLLTYDIVSLSQDSPIVADLNGGLHTLPSVMPVLNAMKA
                     HTFEQNLIKKTLQAETHLDFSNKKKESIVNATVISPRGNISIDFPALLNYSELHGSFN
                     GSSLEGLIDSSHMVVVTGFSEIGPWGNARTRWEMESSGTFSLEGCIEMAWIMGLIKYE
                     KSNDYCGWVDSKNGAPVEGLHIKEKYEPTILKHAGIRIIEPELFCGYNPSKKQMLQEV
                     VLNFDLQPVRTSAELGEQYKLEQGERVEIIPLEDDECLVHFLKGALLYVPKALDTQRT
                     VAGQIPSGWDARSYGLPDEIVSQIDPITLFSLVSTAEALISSGVTDPYEMYKYVHVSE
                     VGNCVGSGIGGMKSLQAVQLLRNKGENIQSDILPETFVNMTAAWINMLLISSSGPIKT
                     PVGACATSVESLEIGYETIRAGKAKICIVGGVDDFHESVSHEFANMGATSNSTEEMAS
                     GREPQEMCRPATSTRNGFMESQGAGIQIIMRGDLAIQMGVPIYGVVGLTSTASDKISK
                     SLPAPGKGILTCARELSNKPRFNISKLDIKYRKRQLEFRIKEINNWREQEILLGSYPG
                     LVDELVQKQIVEAKSLWGSDFWKTDPNIAPIRGALSVFGLSVDDLNVVSCHGTSTKAN
                     EKNESQIIDKMMEHLGRTKGNPLPAVFQKHLTGHPKGAAGAWMLNGCLQMMNSSVIPG
                     NRNADDIDSSFQHFEHLLFPSASLRVGAVKASMLTSFGFGQKGAMALVFNPNYLLASL
                     SEDEYTLYAQKRAQRERIAQNFFVHGLVNNNIVQIKTSAPYSKEEEERVYLDPLIRFP
                     VNH"
     gene            <479886..>482153
                     /locus_tag="HG535_0D02430"
                     /db_xref="GeneID:59236259"
     mRNA            <479886..>482153
                     /locus_tag="HG535_0D02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288368.1"
                     /db_xref="GeneID:59236259"
     CDS             479886..482153
                     /locus_tag="HG535_0D02430"
                     /inference="similar to AA sequence:RefSeq:NP_014339.1"
                     /note="similar to Saccharomyces cerevisiae ARP5 (YNL059C);
                     ancestral locus Anc_2.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144263.1"
                     /db_xref="GeneID:59236259"
                     /translation="MTSSTMSRDSSLAPLKVCVIDDPPLLEAQEKFDDRSSYDTSTPI
                     AIDFGSSHVRAGFTSSKRPSHIFTNKLTRYRDRKISRTMTFIGNDVCLDQTVRAQART
                     PFDGPLVTNWEYVEEIMEYTFNHLGVQGDGGVSNPLLLTERMATIQSQRTNWYQLLFE
                     CFDVPGVAFGIDALFSYYGNNSSNSTGLVIGCGNEDTNVIPIIEGRGILTDAKRINWG
                     GHQSVDYLTNLMSLKYPYFPAKLSNFQFETMYQDYCYVSTNYEKDIDSYLTLQSLEAK
                     NIVVEAPFTEVIQPQKTEEELRIQIEKRKESGKRLQEQAKQKRIERLVQKEEEFEYYC
                     QVREQLKDQNKKKVLSILQNAGFDDERDFKKYLYNLERSLKRSQVVNADDVEDVDQDQ
                     ELDDKFDLLDIPDEDLTEDQVKEKKKQRILKASSDARNKVKEEKERLAQEAEEREVQD
                     RQWRESDLVGWIKDKRKKLSELVNRRKEKIKIKNEMKDRKSQISQNRMKNLATLAEDG
                     ARGNSKRTRQQATIDNDPNDTFGANDDDWSVYNDITQNPEALEQIIEEEYKEIVDLEG
                     VLLEHDPNFTDEDTMDAQYDWRNSVLHLFLRGPRPHDSENSHEQHQMHLNIERIRVPE
                     VLFQPTMGGEDQAGITELCQNVILGKFGSSPRGLSPITSSMASNVWITGGNARLPGLK
                     ERMVREFTEFLPARTPFSINITSEPALDCWKGMAKFANNEVDFKKGFVTRKEYEEYGP
                     EYIKEHNLGNVNYFE"
     gene            complement(<482340..>484268)
                     /locus_tag="HG535_0D02440"
                     /db_xref="GeneID:59236260"
     mRNA            complement(<482340..>484268)
                     /locus_tag="HG535_0D02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288369.1"
                     /db_xref="GeneID:59236260"
     CDS             complement(482340..484268)
                     /locus_tag="HG535_0D02440"
                     /inference="similar to AA sequence:RefSeq:NP_014338.3"
                     /note="similar to Saccharomyces cerevisiae NOP2 (YNL061W);
                     ancestral locus Anc_2.247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144264.1"
                     /db_xref="GeneID:59236260"
                     /translation="MGSRRAKNKQKDPPSIEEFQARKDKKLKREREKSKKSIASDENN
                     KVKKQKTDSRSKQKVNGARSKTKSKKASKEDKTSITEDSEDSALENSQTEEVEHRDDG
                     LPEVDLEELSKAKKSLFDDDDDDQEDEDDELKDEFDLEQEYDYEEDADEQPVFSDEEG
                     IDLEDLNAANMEELSRKLDEENAAEEQDAEKELTGADQLQPRADVLPTQEEEELMAQQ
                     APDLTTIRTRMIEIVKVLEDFKNLGAEGRSRTDYTDRLLKDICEYFGYTPFLAEKLFN
                     LFSPAEALEFFEANEISRPITIRTNTLKTRRRDLAQALVNRGVNLQPIGPWTKVGLQI
                     FDSQVPIGATPEYLAGQYILQAASSFLPVVALDPQENERILDMAAAPGGKTTYISALM
                     KNTGCVFANDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKVIGGFDRILLDAPCS
                     GTGVIGKDQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDSHSKSGGIIVYSTCSVAVE
                     EDESVVDYALRKRPNVKLVETGLQIGKEGFTSFRGKKFHPSVKLTRRYYPHTYNVDGF
                     FVAKFQKIGPSPHDDNQATPREKELAARQEALEEGIIHSDFSTFNDEEDKKYIQKSQK
                     NSLLKKGINPKAAKSEKK"
     gene            <484547..>486028
                     /locus_tag="HG535_0D02450"
                     /db_xref="GeneID:59236261"
     mRNA            <484547..>486028
                     /locus_tag="HG535_0D02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288370.1"
                     /db_xref="GeneID:59236261"
     CDS             484547..486028
                     /locus_tag="HG535_0D02450"
                     /inference="similar to AA sequence:RefSeq:NP_014337.3"
                     /note="similar to Saccharomyces cerevisiae GCD10
                     (YNL062C); ancestral locus Anc_2.246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144265.1"
                     /db_xref="GeneID:59236261"
                     /translation="MNPNKRLGFNQHVILRLPSNNFKIVELKPDGSISLGKFGAFYTN
                     DIVGYPLGTTFEIYYDGSYEPDEKNKNRTPIGKVRVMNTGIDQSDLESTPTPLPMELT
                     NKMSSATNKELINIGNEIQGMTMEEIESLKKQSATHAEIISKMIESHGSFHKKTVYSQ
                     EKYLNRKKQKFSKFFTAEYLSSSAMLQFLLEKGDVQRVMDLSQESIGMLLNLGNIRSN
                     GQYLCVDETGGLLVYAMLERMFGGQTSSALEDVGSIVVIHENEHPNLDLLKFSNYSDQ
                     FIKNHVKAISLLDFFEPPIMEEVKQAFKPLSKEEISSLKSGKKNAYYRRLKWYNTQLQ
                     TIELSKHVEYDGLIIASTLHLPTLVRKLGRKVHGSRPIVCYSQFKETLLELTHVLYKD
                     LNYLAPSIYETRCRPFQSIRGKLHPLMTMRGGGGYLMWCHRVIPAPDPPTNLETTNGN
                     GTDININSNGTNGNDTENDANGMEKNSHGDATAPEMNKKQKTR"
     gene            complement(<486080..>487021)
                     /locus_tag="HG535_0D02460"
                     /db_xref="GeneID:59236262"
     mRNA            complement(<486080..>487021)
                     /locus_tag="HG535_0D02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288371.1"
                     /db_xref="GeneID:59236262"
     CDS             complement(486080..487021)
                     /locus_tag="HG535_0D02460"
                     /inference="similar to AA sequence:RefSeq:NP_014336.1"
                     /note="similar to Saccharomyces cerevisiae MTQ1 (YNL063W);
                     ancestral locus Anc_2.245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144266.1"
                     /db_xref="GeneID:59236262"
                     /translation="MPRISPSSVRACNRVNRFLRLLLPACRTVERSNLEFKWISNELS
                     SLEHLNTNRKLREAIYNACLQRFRYLPLQYILGSQPFGSLELVCRKGVLIPRWETEEW
                     SYELAHRIRKNATNNKQKMVIWDLCSGSGCIALLLKQELQAFKDVNITALDISQKAIS
                     LIKRNMARNGIKDVSVISADVLHNPPNPGSMIDILVCNPPYISEDSFVKETSRSVKIH
                     EPRLALVGDKEFYQNLIEHWLPKINSFVYEIGDINQADFVHNAIINDTELNTVWSTGV
                     KRDANGNPRVLYGFRKNGKNNTSFKYHELFDNFGKLN"
     gene            <489154..>490311
                     /locus_tag="HG535_0D02470"
                     /db_xref="GeneID:59236263"
     mRNA            <489154..>490311
                     /locus_tag="HG535_0D02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288372.1"
                     /db_xref="GeneID:59236263"
     CDS             489154..490311
                     /locus_tag="HG535_0D02470"
                     /inference="similar to AA sequence:RefSeq:NP_012147.3"
                     /note="similar to Saccharomyces cerevisiae RPI1 (YIL119C);
                     ancestral locus Anc_2.244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144267.1"
                     /db_xref="GeneID:59236263"
                     /translation="MDIFQSDLGLFQENSRASDGIRLNTDRPFMYLARNDDCPFDYKP
                     IDMDNEESPTSCREFEDTTNSLKRESISSSSLSSLCTTLSSNNISKDLNGSPTINTKA
                     LTTTVKMAGATTAGSTTTTTPATTTSEKTDTVSPAEKEMKIPRASAYDNEHQRKTRKK
                     WKKTEDLALMEMLLQYSHLLNFVEYFKPMKKFWIKISLVLKQHHGFERNARQCHDRFK
                     VLYFKAMKLNEKTLGSNPDITKTLFLQTRNTFIFCNGNITLKSPPAPLQSVSDVSSPD
                     SQGFVHHNNRHTNNDNPNYHKNFKNYNDLNDLNDPPHISNAQFMSFLQQPLVDMRQAP
                     YNSAQQYFVNGLINLQTQIDVLKTQLQASERRNTELTRLVESLHAGRYNTR"
     gene            <492108..>493331
                     /locus_tag="HG535_0D02480"
                     /db_xref="GeneID:59236264"
     mRNA            <492108..>493331
                     /locus_tag="HG535_0D02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288373.1"
                     /db_xref="GeneID:59236264"
     CDS             492108..493331
                     /locus_tag="HG535_0D02480"
                     /inference="similar to AA sequence:RefSeq:NP_014335.1"
                     /note="similar to Saccharomyces cerevisiae YDJ1 (YNL064C);
                     ancestral locus Anc_2.243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144268.1"
                     /db_xref="GeneID:59236264"
                     /translation="MVADTKLYELLEVSATATDIEIKKAYRKSALRYHPDKNPSEEAA
                     EKFKEVSSAYEVLSDPQKRDIYDQYGMEGLSGSGGPGGPGGFGGFGDDIFSQFFGGGG
                     AQRPKGPQRGRDIKHEISVSLEELFKGRTTKLALNKQVTCKTCKGLGGKEGAVKKCTA
                     CNGVGIKFVTRQMGPMIQRFQTECDVCHGTGTIIDPKGRCKVCLGKKVVNERKILEVH
                     VDPGMKDGQRIVFKGEADQAPDIIPGDVVFVVSEKPHKDFKRVGDDLVYEAEVDLLTA
                     IAGGAFSLKHVSGDWLKITIIPGEIISPGMRKIVEGKGMPIQKFGGYGNLLINFKIKF
                     PENHFTTEENLKKLEEVLPPRKQEVIPEGVHVEECILSEFDSSKYNSNGRGQSYDEDD
                     DEGHGGAEGVQCASQ"
     gene            complement(<493694..>495379)
                     /locus_tag="HG535_0D02490"
                     /db_xref="GeneID:59236265"
     mRNA            complement(<493694..>495379)
                     /locus_tag="HG535_0D02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288374.1"
                     /db_xref="GeneID:59236265"
     CDS             complement(493694..495379)
                     /locus_tag="HG535_0D02490"
                     /inference="similar to AA sequence:RefSeq:NP_014334.3"
                     /note="similar to Saccharomyces cerevisiae AQR1 (YNL065W)
                     and QDR1 (YIL120W); ancestral locus Anc_2.242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144269.1"
                     /db_xref="GeneID:59236265"
                     /translation="MVHDVQLSQDSDSIASEGPYQENSQVPHCMASMSTEDVNSKSFG
                     GKENIGSLSRTTTREIADTAEHSEASTLQDFGEEKTEEPPYTLLSYAQKWGMVALLTM
                     CTFWSSLGSPIYYPALKQLERKFNVDEDMVNVTVVVYLLFQGIAPTVSGGVADIYGRR
                     PVIIGGMIIYVGVSAALACCNSFGVIIFLRCVQSACISPTIAISSGVVGDFTLKHERG
                     TFVGATSGFALLGQAFGSLIGAALAAAWDWRAIFWFLVIGCGTSLAIVFCLLPETKRT
                     IVGNLSIQPKNVVNRTPIFLLKRVQKRFRYDRPDISTLDKNVPKLDLISPLKIISKPE
                     IILSLFPAGLQFAMWTLMLAAISSQLTSSPYNYKLTIVGVCYLPGGIGGLFGSLITGR
                     IIDICYKYYLKKFEERKKQGLIAEEAEFNIFRARVMAGLPQNFIAVVSFLLFGWSVDK
                     GWHISAVLITSCVSSFCTMSTLSTSSTLLVDLYPNRSSTATSCFNFIRCILSAIFMGC
                     FAKMKTSMTVGGTFSFLCALVFVGNFLLYFPMRSGMKWRRQRALKSELKLMTK"
     gene            complement(<496034..>497827)
                     /locus_tag="HG535_0D02500"
                     /db_xref="GeneID:59236266"
     mRNA            complement(<496034..>497827)
                     /locus_tag="HG535_0D02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288375.1"
                     /db_xref="GeneID:59236266"
     CDS             complement(496034..497827)
                     /locus_tag="HG535_0D02500"
                     /inference="similar to AA sequence:RefSeq:NP_012145.1"
                     /note="similar to Saccharomyces cerevisiae QDR2 (YIL121W);
                     ancestral locus Anc_2.241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144270.1"
                     /db_xref="GeneID:59236266"
                     /translation="MKTFDNDSSTSANQKSSRELPSYTGNSERERYRSVPVCDTYVDN
                     EHEQEHGSECDFDNDQDDAVGSESLNSLEEETILTRTRSEKQEPHFSSPPYSRFGRRA
                     KLALVIQCAFTGFFSTIAGAIYYPVLTVIEQEFNISEEAVNVTVVVYFIFQGVSPTIM
                     GGFADSLGRRPVVLFSVMVYFVACVGLACSKTYGQIVGLRCLQAAGIAPVIAINSGIM
                     GDVTTRMERGGYVGYVSGFQVVGSAFGALIGAGLSSRWSWRAIFWFLAIGSGICLIVS
                     FIILPETKRTVTGNGSIPPKQIVNKAPILGLPMVRKSLHLDNPDYDTLLPPTKINILA
                     SLSVFMIPEISAVLLCAGLQFAMWTTHQTALSIVLSKNYHLSVAKIGLCFLPAGICTL
                     ISVVTSGRYLNWSYERNIVKHREWIKTEEAKFMTEHKIDIQEARKLMEGDFRYTFNIF
                     KARLQPALVTILISCCGFISFGWCIYAHAPIAALLCLSGFSSLFSNCILTMSVTLIVD
                     LFPSKSSTATGCLNLFRCILSAVFVVALSRMAASMTYGGVFTLMGGLTGASSFVLLTI
                     ITHGKKLTYKRRQQENLIIEKNAERAAAATN"
     gene            complement(<498469..>499716)
                     /locus_tag="HG535_0D02510"
                     /db_xref="GeneID:59236267"
     mRNA            complement(<498469..>499716)
                     /locus_tag="HG535_0D02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288376.1"
                     /db_xref="GeneID:59236267"
     CDS             complement(498469..499716)
                     /locus_tag="HG535_0D02510"
                     /inference="similar to AA sequence:RefSeq:NP_012144.1"
                     /note="similar to Saccharomyces cerevisiae POG1 (YIL122W);
                     ancestral locus Anc_2.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144271.1"
                     /db_xref="GeneID:59236267"
                     /translation="MSADKANVESQTPDAGQMSAESSEINTENVGERAEKQPKSDVQT
                     TISSSEATTDRSRGPAPSSASSTTAESSVTLKLKILEQLGIKNISALNKEDDEFLSYF
                     LQIKLEQERKDVEKLRDCNLEKLNFILDKCSSSETLTSQSVNDIIDIFSNRGHATPRQ
                     ENDFDIYPSDRKRKRLEPPIMRHNARQGVASDYARESQFQYAPLGPEHGHSQGRSQSQ
                     FQLQQPFMFPYHFQYQGGQGPNRWLPQQLGPQGQILAGLGPQNLSPRSNSDATTAESV
                     SGSNPRTTSQNVSSGISTTASQNLAYPPANPTYATPTSYLMPPGSTRRPPGLMAQQNT
                     NQESTQAGIPNYLPPTQQFQPHSRFKGEGVPIRRQGNHRRSQSSITPSSNYSLRSPIK
                     ELQATPQKPVNFLIHTPKYPPPT"
     gene            complement(<500919..>502235)
                     /locus_tag="HG535_0D02520"
                     /db_xref="GeneID:59236268"
     mRNA            complement(<500919..>502235)
                     /locus_tag="HG535_0D02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288377.1"
                     /db_xref="GeneID:59236268"
     CDS             complement(500919..502235)
                     /locus_tag="HG535_0D02520"
                     /inference="similar to AA sequence:RefSeq:NP_012143.2"
                     /note="similar to Saccharomyces cerevisiae SIM1 (YIL123W)
                     and SUN4 (YNL066W); ancestral locus Anc_2.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144272.1"
                     /db_xref="GeneID:59236268"
                     /translation="MKVSSVTLAACLLGSSAIVSGLPHLHVKRDDDCITTVNDSHKHK
                     RAVAVEYVYETITVDNSGQPITSAATKPAVSYSGVSSVLTSTLVPEISSTATASAVSS
                     SAAPVSSSSVATSVSSTTTSSSEVPSASSITSSSVTTSSAAGTSSTATSSVSSVSSST
                     SSSSGGLAGDLNSFSPPTEKFSDGTIPCSHFPAGQGVVPIDWMNQGGWSGIENPDTSV
                     GGSCSEGSYCSYACQSGMSKTQWPSNQPSDGRSIGGLYCKGGFLYRSNTDHDYLCEWG
                     VQAAEVVSELDKDVAICRTDYPGTENMVIPTFVQAGNSSPLTIVNQDTYYTWRGMKTS
                     AQYYVNNAGVSVEDGCIWGEPGSGIGNWAPLNFGAGSASGVSYLSLIPNPNNKSPLNF
                     NVKIVAADSSANVIGECAYENGSFQGGSDGCTVSVTSGMAKFVLYN"
     gene            complement(<503231..>504292)
                     /locus_tag="HG535_0D02530"
                     /db_xref="GeneID:59236269"
     mRNA            complement(<503231..>504292)
                     /locus_tag="HG535_0D02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288378.1"
                     /db_xref="GeneID:59236269"
     CDS             complement(503231..504292)
                     /locus_tag="HG535_0D02530"
                     /inference="similar to AA sequence:RefSeq:NP_012142.3"
                     /note="similar to Saccharomyces cerevisiae AYR1 (YIL124W);
                     ancestral locus Anc_2.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144273.1"
                     /db_xref="GeneID:59236269"
                     /translation="MYQHYTSDDFYYMSSLRFARMPFFKGLVSCSSKKLKHIKNAIRS
                     RFIPSQYYSIRIKYPTSKMSNLSNRKIAVVTGASQGIGYHVSRELAQHNYKVYACARH
                     TEAIEKLAENFAEGVIIPCHLDISKVVEIKKFKEKLGLELPGQRLDLLFNNAGQSCTV
                     PAIDVTDAMVEQCFQVNVFGHINMCAQLAEFLINAKGTITFTGSLAGIAAFPFGSIYG
                     ATKAAIHQYARVLHLEMRPFGVRVINTITGGVATDIAEKRPLPDHSYLNFKEGIEAFD
                     RRREMAKRNHPTPVEEYAKQVVGDILSSRDPLDVYRGKLARLLTLVYTFLPYWLIEWG
                     VEKKFRLHAAYKVLREKQH"
     gene            complement(<504526..>507591)
                     /locus_tag="HG535_0D02540"
                     /db_xref="GeneID:59236270"
     mRNA            complement(<504526..>507591)
                     /locus_tag="HG535_0D02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288379.1"
                     /db_xref="GeneID:59236270"
     CDS             complement(504526..507591)
                     /locus_tag="HG535_0D02540"
                     /inference="similar to AA sequence:RefSeq:NP_012141.1"
                     /note="similar to Saccharomyces cerevisiae KGD1 (YIL125W);
                     ancestral locus Anc_2.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144274.1"
                     /db_xref="GeneID:59236270"
                     /translation="MLRTVSQLSSRNMLRRCLLKNAGSHSRPLGGSLLCAARGARGFA
                     SGTDTFLSTSNANYIDEMYEAWQKDPSSVHASWNAYFKNMGNMNIKSSSAFQAPPNLV
                     SGPTGAENLALDKPMGTTVDENVMCHLKIQLLCRAYQVRGHLKAHIDPLQISFGDDKT
                     KPVPKELTLEYYGFTERDLDKQINLGPGILPRFARDGKTKMTLREIVSSMEKLYCSSY
                     GVQYTHIPSKEKCEWLRERIEIATPYQYTIDQKRQILDRLTWATSFESFLSTKFPNDK
                     RFGLEGLEVAVPGIKTLIDRSVELGVEDVVLGMAHRGRLNVLSNVVRKPNESIFSEFK
                     GSTAQDDIEGSGDVKYHLGMHYKRPTTSGKYVNISLVANPSHLEANDPVCLGRTRSIL
                     HAKNDLEKKDKALSVLMHGDAAFAGQGVVYETMEFLNLPEYSTGGTIHVIFNNQIGFT
                     TDPRFARSTPYPSDIAKAIDAPIFHVNANDVEAVTFIFNLAAEWRSKFHTDAIIDVVG
                     WRKHGHNETDQPSFTQPLMYQKIAKQKSVIDVYTEKLIIEGSFTKADIEEHKKWVWGL
                     FEEAFEKGKEYKPNSREWLTAAWENFKSPKELATEILPHEPTNVPADTLKHIGKVISS
                     APEGFEIHRNLKRILNNRGKSIDTEKGIDWSTGEALAFGTLALEGYHVRISGEDVERG
                     TFSQRHAVLHDQNSENIYTPLKNLSEKQGDFTISNSSLSEYGVMGFEYGYSLTSPDYF
                     VMWEAQFGDFANTAQVIIDQFIAGAEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERF
                     LQLANEDQRFFPSEEKLKRQHQDCNFQVVYPTTPANLFHILRRQQHRQFRKPLVLFFS
                     KQLLRHPLARSELSEFTDGSFQWVIEDAEHGKSIGTREETKRLVLLTGQVYTALHKKR
                     AELGDKTTAFLRIEQPHPFPFAQLRDTINSYPNLEEIKFCQEEPLNMGSWSYQAPRIA
                     TVLKETEKYKDFNVQYCGRNPSGAVAAGNKTLHTAEEEAFLSEVFGQQQ"
     gene            complement(<508907..>509482)
                     /locus_tag="HG535_0D02550"
                     /db_xref="GeneID:59236271"
     mRNA            complement(<508907..>509482)
                     /locus_tag="HG535_0D02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288380.1"
                     /db_xref="GeneID:59236271"
     CDS             complement(508907..509482)
                     /locus_tag="HG535_0D02550"
                     /inference="similar to AA sequence:RefSeq:NP_014332.1"
                     /note="similar to Saccharomyces cerevisiae RPL9B
                     (YNL067W); ancestral locus Anc_2.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144275.1"
                     /db_xref="GeneID:59236271"
                     /translation="MKYIQTEQFIEIPEGVTVNIKSRVVKVTGPRGTLVKNLKHIDVT
                     FTKIGSKQIKVAVHNGDRKHVAALRTVKSLVDNLITGVTKGYKYKMRYVYAHFPINVN
                     VVDKDSKKFVEIRNYLGDKKVRLVPVREGVDIEFSANQKDEIVLSGNSVEDVSQNAAD
                     IQQICRARNKDIRKFLDGIYVSEKGVIAEEE"
     gene            complement(<509748..>513815)
                     /locus_tag="HG535_0D02560"
                     /db_xref="GeneID:59236272"
     mRNA            complement(<509748..>513815)
                     /locus_tag="HG535_0D02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288381.1"
                     /db_xref="GeneID:59236272"
     CDS             complement(509748..513815)
                     /locus_tag="HG535_0D02560"
                     /inference="similar to AA sequence:RefSeq:NP_012140.1"
                     /note="similar to Saccharomyces cerevisiae STH1 (YIL126W);
                     ancestral locus Anc_2.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144276.1"
                     /db_xref="GeneID:59236272"
                     /translation="MDLISTAPNMIGMEQHQPHPEGLIDVSSDILSDAASSTTDDPKK
                     SLTIHIPKPNSIAQLDQLLYRYRAISDQGKASRVEVEALERAFYEISRDQDVYIQRLE
                     ELRSVKNEECQYDDALLSKQILAFQLLEKDLDIPDNLLSENNDEQENYGSKITTEQEL
                     RPVNVSMDFDQKAIEFKLFDKFTNTTPTELGHYQTETMISSHIAKRISELERLPANLG
                     TYSLEDSLEFTTKDDIPSRIDELKIKALVELKSLKLLTKQKSLRQKLITNVLSQAHHT
                     VPFLRDSPFTMAAQRSVQVRSKVIVPQTVRLAEELERQQLLEKRKKESNLHMKKVTGI
                     IDFVQNRQSNNWSYRDRAIQFGKLGQMTHNQIEKEEQRRMERTAKQRLAALKSNDEEA
                     YLKLLDQTKDTRITQLLKQTNTFLDSLAQAVKVQQNEAKILRGEEIPPITDEEREKVD
                     YYEVAHTVKEKVVKQPSMLVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQ
                     SISLITYLSEVKKEKGPFLVIVPLSTITNWTLEFEKWAPGLNTIIYKGTPNQRRGLQQ
                     QVRIGNFDVLLTTYEYIIKDRSVLAKPDWAHMIIDEGHRMKNAQSKLSYTITHYYRTR
                     NRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEE
                     MLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCRLSGLQHQLYQQMLNHNALF
                     VGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVESVINPTRANSSLLYRVAGKFE
                     LLDRVLPKFKATGHRVLMFFQMTQVMDIMEDFLRLRDLKYMRLDGSTKTEERTEMLKA
                     FNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEV
                     RILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLIESESSK
                     DDDDKAELDDEELNEILARSEGEKEFFDKIDRERIEQERLEAKAEGLSKPLPRLIETD
                     ELPEVFTEDISTHLQPEPVAVGRVRERKKVYYDDGLTEEQFLQAVEDEGSTLEEVIQR
                     RREARTKRQKPRFEEDEGLDTIDNSPEPSYQEPVEDENREPTISDQHIPVVDENESPQ
                     VVAPKRKVRSRKKRTASAVENLPDKQNVTPMEIDEPEKKKPKLKIRLKLKGEPGATGK
                     LETNEKGKVDVKEENEKSLKAKKGKTTNAASNKATCVNDAKLEVSTKITELIDAMRGQ
                     VDETDDHPRTSIFEKLPLKKEYPDYFAVIKKPIALDTISKKNKKGSYESLDDVKNDIQ
                     TMYDNARFYNEEGSWVYNDADKLNVFTDEWFNQNS"
     gene            <514367..>514996
                     /locus_tag="HG535_0D02570"
                     /db_xref="GeneID:59236273"
     mRNA            <514367..>514996
                     /locus_tag="HG535_0D02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288382.1"
                     /db_xref="GeneID:59236273"
     CDS             514367..514996
                     /locus_tag="HG535_0D02570"
                     /inference="similar to AA sequence:RefSeq:NP_012139.1"
                     /note="similar to Saccharomyces cerevisiae YIL127C;
                     ancestral locus Anc_2.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144277.1"
                     /db_xref="GeneID:59236273"
                     /translation="MSSFSKSTEFQATNAVNSLIKRILPGMQKIAVHNKDKKKSKFKQ
                     KGSTAQFIDRNLKERVELNEKNVFLSKKRERKVRKQENKSKRAHNEKLEQQARLQLLV
                     KHQAEGTLTDTECDYLSKLTKRNVLNAKAWDLDEDDEDESIELQRYILEKLSESQKDS
                     RSLNRRKRVKLFKEEIKEKANTSLERKYPGLTPGLAPVGLSDEESSDDE"
     gene            complement(<515055..>518132)
                     /locus_tag="HG535_0D02580"
                     /db_xref="GeneID:59236274"
     mRNA            complement(<515055..>518132)
                     /locus_tag="HG535_0D02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288383.1"
                     /db_xref="GeneID:59236274"
     CDS             complement(515055..518132)
                     /locus_tag="HG535_0D02580"
                     /inference="similar to AA sequence:RefSeq:NP_012138.1"
                     /note="similar to Saccharomyces cerevisiae MET18
                     (YIL128W); ancestral locus Anc_2.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144278.1"
                     /db_xref="GeneID:59236274"
                     /translation="MSNQGVPRFLSDTIISFIANVDANQDKAEQLSAQLADGIVANKL
                     KLLQLVVALKDNLTSEDNSNRRKALFCLSGVLSKISESRLTKKEVSVLFAFYFSKIED
                     EFLVEDSLFGFCSLVQMRYTTIGDVRSVLDYLLNQYKPGSFLAPVRYFTFKIVENIYE
                     KFNDILKKEDDLTYTFVKTFLHIANGEKDPKNLLISFNLNRRISSSLSDIDQFKEDLF
                     DVLFCYFPITFKPPKNDPYNISNNDLKIALRSAISSTSLFAEDAFGNLIDKLTASSPN
                     VKNDTLLTIEACVDNFGGQPSMKYWLPLWNALKFEIMHGSDGGEVTASEPFGSVSSET
                     FELSNFQVALNILRSLANQLIHVDEHAFDTFLSHILEELKPNFQYEKDLKQSCSVLAS
                     IGSANTTSFNKVIECSLPLFLKDTSEIPKLKLVIMNLSFFFDAYITVFNTADPEIMKK
                     IPDASLNQFKDDILIILGKALTGSSKVETTVRTLAVIQFTKMVKMNNYLNREEVALIL
                     QYLTDTILTDTNKTTYHTCLEGLKTIGESYEELVYSVSLKSLLDLLPVTPIADIHLSN
                     NEPVEKEHILKVILDFTTSKHTLIRESLCGLSEKLSLVASQQNAGRYCFLIISSLYTL
                     LVNNINMIREEDSSLIKATIETRLLSALETHGDILLDNHNLMLLSNVLFFINLKTAKE
                     THQTQLIKYQKHFIDDLDILNAPSQLVVPFVKLICALDKDSEFDGVEEVFKKTLALVS
                     DRLSCIKDSQRLGYLELLMILSNKWLKEDSIRAHCDWKDNSRKNLETLIWINKGLLMK
                     NSSLAVEFNNNFLTLLSDKTNGSYIAKLFEIFVIDIVSMERYKGNSWCNNTKTLYKQK
                     FFGEIFHSLVKSYKDASDPMLKSNYLTALSLVLKHTPSQLIETHMDEMLPMLLQALDL
                     PISDVVISALDTLKDTAEKFHQLISPQAQTLVKSLLKLSVPGNYNNVVVRLKSLELLE
                     TLTKIVPLNYTLPMKKEIISSLESVLDDNKRVVRTQCVITRQAFFELGQVPFE"
     gene            <519367..>526899
                     /locus_tag="HG535_0D02590"
                     /db_xref="GeneID:59236275"
     mRNA            <519367..>526899
                     /locus_tag="HG535_0D02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288384.1"
                     /db_xref="GeneID:59236275"
     CDS             519367..526899
                     /locus_tag="HG535_0D02590"
                     /inference="similar to AA sequence:RefSeq:NP_012137.3"
                     /note="similar to Saccharomyces cerevisiae TAO3 (YIL129C);
                     ancestral locus Anc_2.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144279.1"
                     /db_xref="GeneID:59236275"
                     /translation="MDSKPESSSPGVGTTSFKFPSSLQTDGAAILLEAQPDIQTVDPQ
                     HILQQVGFKPNLKKQVDEIAPIIDIPPPLENNEDITRLSLIRSPEHALDHHLSEDDII
                     PKVSASPNHVAVVVNSEGANHSVTEEYVNSLRQRLATDWKSPSEYALHILFTKFVRHA
                     ESKLNACLQYPIVSEPPIVDILGDGVDVMFDKIIESLGHIARKKPKPVIDAMMFWRKT
                     KSEIASLAAESVDKLINGYENEQAKGIPAKSQPLSYNNISRTHSKTLSNGSKISHKRN
                     SSSKSSVGSKNVLESSRIRDLELQIESAKQAAFQADRKSLISIFLLCRVLIEIVKQAP
                     DDSDIDLSDKLEEIVFTQLKTTDPMSISSSIIKSSNWNSFAELLGWMSEKKFLSVSDR
                     FISDLEKLPRLIPTSLEPGVHLLILGMRYLRLKNYPLDKFEESADFMKSISKFFLHAE
                     NPSVKLAYAEVISQLLLPLAGSLTAEVNHPTWVEAMTTLLDAAINLQSESKYWASGFR
                     LTVSVLCTSPADLFSQHWIPLVEKSSKKIRNKDLSARVLFVVGLSRLVWVYLYRCPET
                     LNNTTRTLTKIMALYLNSKRKESWITADLELINPLSDVLVTVGYAYPSFLMENTLSPL
                     IRRSFNGTTLDGISYEKLILAISTYRGLLMTNKKPEFPESDSRYYELGLNDVSVRHSE
                     SLSAIREEICGSFYQLFLLLDSNIGSEVWSPENRHNKQPTTPFEKIAFSFSNESNINV
                     NRNLNIALFATLIETIPSCLCVSSQIPFKSTIEIISRNAVHADLLIAASCQNALKALA
                     SKKNPYTLITWFAKYSFDFDEKTQSSYNMSYLSSIEYRRLLVLYVELLECWLEEFQSS
                     KLEEKKRETGLDGIQLISVEKDLDESSETKMLEWKNTVTVIEEVEGNGLFFLCSQDPA
                     TRKLGIQILRIISKFDEAMMEKTIKGTQGHSRSSSHFAADRGTRLVDLLNECDYQTLL
                     DHKSMAALSDAERDRIAKFNLKYKKGVLIKLAESEYGVDAALWQRVFPKILSIIFESC
                     PVTMALCRSIVCIRLVQVHEIILQIANNVDYRMKDVSPETIVGQWKLFLIVACTSLTS
                     TGNQKLHIPTSNIQHGRKKSQQIFTVQHQKIKSATSIFKMVLPLLNAKSSIIKDAIIV
                     GLSSMNVNIYRAYLENIEKFLTSWKIESSNNQIRLEMFHILAILAWLLREPIISDDIW
                     TLSKLSEFIRHAKTFLEEDVVQCSFEYQPLRSHFAGLLKVFYAVIRERPNLDYLFPFQ
                     ARASCFNYLKEWCGYGEYAYIAEERYASMIRKTPNQRDRTAVAAGVEFQKGRLQTIAL
                     ETMVVLCSDSFTKTLDNVPDLPVIISFDTAGLLSWIEALFLSEDESIRKLGVLALTNA
                     LSNNRENAQFFRDVTVQCISHHSNPGISNLYYTTLCKSLLEMKDFILEEEELVSLGLC
                     GIIAFQEETRSYAADLLSAVETKLRSTSYTKVFKERLGSSSRTVYIATAKEITSIFAD
                     LLSQDLSLKIFSNIVRVLILFPPDLKKYYLILLVPWVNKFSLKTVDDIDTFMVLNNLF
                     YITIELNHKLPMEVEQLWVSLGKGNSFQNIYVSLEYIMAMSINHRNPRFVQIARDVVL
                     YLANVPGSIGLVDALTKNLDPKSIIPIAKTAINEPKESDKYSFIANIWEQLNYKGKTV
                     TFSRTHLSIIFLVNLSTNPSEFLRDHIPSLVHITICLLDHYMPLIRGSACKILCDIIC
                     GMHATHEKSEVTVALLKDKHRLWSYDTLVKDKNGARSPKEMDALIRNIVTIFSEQEGF
                     HINWQRTSLKWATTCSVRHVACRSFQVFRSLLTFLDQEMLRDMLHRLSNTVSDTNHDI
                     HGFAMQILMTLNAITAELNAADLINFPQLFWSITACLSSVHEQEFIEVLSCFTKFISK
                     IDLDSPDTVQCLVATFPSNWEGRFDGLQQIVMTGLRSSNSVDITWKFLDKLNLLRDSR
                     IIANSDSRLLFALITNLPRFLHAMAQKDFASIQTAVDSLISLSDAYNQPSLSRLIDSL
                     SKNKFRSKRDFMSQVVSFISRNYFPTHSAQTLVFLLGLLLNKLGWIKEETMAILKYIL
                     PLVDLKSPEFTGVGADIISPLLRLLLTDYEAKALEVLDFVPTVSGSKLDKDILRICMG
                     NKDVKNSTGNSTTLFGIPDESGWSIPMSAMIAATTRHNVHAVFMTCVVNTAGDEYTED
                     PPVMEDIVEFHADTDYGLERTETNDSLSLAEEKDASLSHMWAELDNLDSFFTKSTAGA
                     SNVPAAGLGILRDRTNSVETTRTEQTFTLDSAPQLYDKKVSELLNGTLTKFPSNVSFK
                     TYLADSFAVDPSNDDLSKEVGPKVAYHSPLLYNKETTPRSRNSNILKSPGSAVLGAVS
                     SNRLKSTESPQDSLFRFEGFLRSSQRGGSRRKWQYQQQHQQLLSQTIHEQTAPAQYDV
                     ESSSSPVRASSASPVLALGTQNNFILNNEANKPFKSVAKQASVKQAGNKQNNKQINGK
                     QGRYQKHYHLPHFSGNKTQTWTTNVHNENE"
     gene            complement(<527025..>529952)
                     /locus_tag="HG535_0D02600"
                     /db_xref="GeneID:59236276"
     mRNA            complement(<527025..>529952)
                     /locus_tag="HG535_0D02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288385.1"
                     /db_xref="GeneID:59236276"
     CDS             complement(527025..529952)
                     /locus_tag="HG535_0D02600"
                     /inference="similar to AA sequence:RefSeq:NP_012136.1"
                     /note="similar to Saccharomyces cerevisiae ASG1 (YIL130W);
                     ancestral locus Anc_2.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144280.1"
                     /db_xref="GeneID:59236276"
                     /translation="MVDQRESAQTSAPEAREDIGNNDVGGGGSGQPGGGKDSLGQCNV
                     SQPPVVQPLVGAHGQQVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQPT
                     KRNQSQAAARLGGEGSGASGASCSAVAGAAGAAPAGAAGSTSSAQRIPSPLPGLPAHH
                     CGGAGAGGGKRHASVNTSGKLAAQLNKYKNLVHEILPQLPDIDSLDLPTFSQIYQNFS
                     SDKGEHSSTLDDTIKEYNLIASHATPLSSTTTTPEGCNSNSNANSINSSHFLNSDIVE
                     SIDGSIQSTVGREIKIILPPKPIALEFMKNAWEHCCVLLRFYHRPTFIKQLDVLYESD
                     PQNYTHDQMEFLPLCYSTMAVGALFSKSVNTDSDEENDDEMKSARDKFLEDEGYKYFI
                     AARKLIDITNARDLNSIQTILMLFIFLQCSARLSTCYAYIGVAMRSALREGLHRCLSQ
                     DSGFSPIEIEMRKRLFFTIHKLDIYVNAMLGLPRSIAPCDYDQVLPVELADENITEEG
                     YFPVNQNGILSSAGIANQHTKLILILDIIVRKLYPIKKTNNLISHEDVTELELKLRNW
                     LDGLPPELIPGLENVPKKYETANRLLHLSFLHVQLILYRPFIHYLSRKVVANHPDSLS
                     IQRARNSISVARTVVNLAKGMVKKNLLMGSYWYGNYTIFYSVAGVLFYIHEAEPCDKE
                     NAKEYNEILKDAELGRNILLQLKDSSMAANRTYNLLNKLFERLNYKTIRLSATHGIST
                     DNISQPQTMPQRQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPIDQIRLSADRNDSG
                     TSISQQSNPYSLETYIDANFAAGLQNQVSPQANSSNQSPFKGVTNTAKTISGVNTINT
                     AATSNFSNNENDIFLNSDNTPLDGLFMFDNNPKELFSEGTSADNSLKGLDQISLSGDQ
                     INGNNAGVSPKLKQEPIDSESYIPGVFDQLDIQLFGRYLPPYMSQQNGNDQQTTPQSD
                     FKQ"
     gene            complement(<529997..>530659)
                     /locus_tag="HG535_0D02610"
                     /db_xref="GeneID:59236277"
     mRNA            complement(<529997..>530659)
                     /locus_tag="HG535_0D02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288386.1"
                     /db_xref="GeneID:59236277"
     CDS             complement(529997..530659)
                     /locus_tag="HG535_0D02610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144281.1"
                     /db_xref="GeneID:59236277"
                     /translation="MTTDEETEIEPTAESRTARTACRETAVTDERWPCPVITARSGQR
                     RKPYAPRPRPTLAALPRHPCPGQRPRPPALRPAAYVSGVCAIDAKSLPVQPSPFSREG
                     FALLPVWLPFGPHLARNGVTLLEPFLRSKQRQLQQETRAFAFLGRFLPFFPIGGSFTT
                     TNRVTGRTGQKGQDRKESFFYFLVGSGSQEKEKIVITQCSLKLHTHTYTYIYSLSVAQ
                     HQ"
     gene            <530916..>533261
                     /locus_tag="HG535_0D02620"
                     /db_xref="GeneID:59236278"
     mRNA            <530916..>533261
                     /locus_tag="HG535_0D02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288387.1"
                     /db_xref="GeneID:59236278"
     CDS             530916..533261
                     /locus_tag="HG535_0D02620"
                     /inference="similar to AA sequence:RefSeq:NP_012135.1"
                     /note="similar to Saccharomyces cerevisiae FKH1 (YIL131C)
                     and FKH2 (YNL068C); ancestral locus Anc_2.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144282.1"
                     /db_xref="GeneID:59236278"
                     /translation="MSIINSADAASHRARQANGGASASSRSKGDLTNAIDLSRYSSQQ
                     HQGLINAVISVLQTPEQATMVSKQFSNERNVASEVQAYAKISGKDWTYYVKDLEISIG
                     RNTDNPQQMNVNMSGNDSNDSNSINVDLGPAKVVSRKHAIIKFNMQHGGWELLVLGRN
                     GAKVNFKRIPVGSSSSPVLLSSGTVLDIGGTQMMFILPDREAFVSQSCVQHLIQKLVA
                     AYGTGIGNNDPNDVNALLYDILRESDYVKQNRFQLHQHQQQPHQQQQVRAFKMYGSNT
                     RPATSGDPNGINYNNDANFTSNGMNSIYDSNSNNRLMNQSYSASNHSISQAGFPQSLD
                     FASDLSRDENKNVKPPHSYATMITQAILSTQEGVISLADIYKYISTNYAYYRFAKTGW
                     QNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISEDYQRDFLNKWNAGKIGKVRRGSSV
                     ARQLQLHLSKFNTLPQQQEYIDRETKIIKPQRMSHPRMPSLDELDTSLSRSTDTQTSF
                     VNIQQQQQQQQQQQQQQHSPQLPSLQSHPDSQSQSHSGISSQAHSEADHTQLESQLQP
                     QTSNLMQPPTSVALVHKNATNNALSSFNNASPAVARSSIAPIITATASTGPHLSPTHS
                     SILRSPTKAFHITAMEAYTPERGSAQNKSPTQSNMNNHNTNSKLLSADDTETILDNNN
                     GNLNLNEKSNTANRSSPGVWNLLQFSSVNNTPAVDSTENGNTNRRSVENNANPSHNNN
                     MPDLKMKDVQSSPLKRQKNQSSTGKELMLDTDGAKISISND"
     gene            <533500..>534153
                     /locus_tag="HG535_0D02630"
                     /db_xref="GeneID:59236279"
     mRNA            <533500..>534153
                     /locus_tag="HG535_0D02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288388.1"
                     /db_xref="GeneID:59236279"
     CDS             533500..534153
                     /locus_tag="HG535_0D02630"
                     /inference="similar to AA sequence:RefSeq:NP_012134.1"
                     /note="similar to Saccharomyces cerevisiae CSM2 (YIL132C);
                     ancestral locus Anc_2.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144283.1"
                     /db_xref="GeneID:59236279"
                     /translation="MAFLNYTEAKLLSVWLSPSPHNIVETIRKKFATNGGVDATVNST
                     VYFLDAINDFPLKEFQNTIPLDNKVVYDNIRISTCLDLQEMMQTVTKIMQQLTMNVLQ
                     KQNSNQESHKPVEILLLINGLNVMFQNTQIKETAPIALLRLRDILLKLRFTANNPQSD
                     GSNLKAAVIFPEEEIIKFSSNQGGEINNNNKRAKRGISNDGNTLAQYIAKFYADAVI"
     gene            <534760..>535647
                     /locus_tag="HG535_0D02640"
                     /db_xref="GeneID:59236280"
     mRNA            join(<534760..534787,535079..>535647)
                     /locus_tag="HG535_0D02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288389.1"
                     /db_xref="GeneID:59236280"
     CDS             join(534760..534787,535079..535647)
                     /locus_tag="HG535_0D02640"
                     /inference="similar to AA sequence:RefSeq:NP_012133.1"
                     /note="similar to Saccharomyces cerevisiae RPL16A
                     (YIL133C) and RPL16B (YNL069C); ancestral locus Anc_2.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144284.1"
                     /db_xref="GeneID:59236280"
                     /translation="MSEPVVVIDAKGHLLGRLASTVAKQLLNGQKIVIVRAEALNISG
                     EFFRNKLKYHDYLRKATAFNKNRGPFHFRAPSRIFYKAIRGMVAHKTARGKAALERLK
                     VFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSSSVGWKYEDVVAKLEEKRK
                     VRSAEYYAKKKAFNKTVLAASAASAESEAAKKLATFGY"
     gene            complement(<535955..>536896)
                     /locus_tag="HG535_0D02650"
                     /db_xref="GeneID:59236281"
     mRNA            complement(<535955..>536896)
                     /locus_tag="HG535_0D02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288390.1"
                     /db_xref="GeneID:59236281"
     CDS             complement(535955..536896)
                     /locus_tag="HG535_0D02650"
                     /inference="similar to AA sequence:RefSeq:NP_012132.3"
                     /note="similar to Saccharomyces cerevisiae FLX1 (YIL134W);
                     ancestral locus Anc_2.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144285.1"
                     /db_xref="GeneID:59236281"
                     /translation="MVDALTPIQKELVAGLTTGALTTVVVHPLDLIKIRLQLLATSTT
                     KLGYRYIFGSISRSADTNPIKGGLLRELYRGLGINLFGNAVAWGLYFGLYRTSKDMLY
                     DYKAVHVSGTKNDVQKDSKMSSLMFLSAGALSGIITAVLTNPIWVIKTRIMSTSSSDH
                     YSYKSTLNGVKRLLSEEGPRSFWRGLIPSLFGVSQGAIYFMIYDTLKYRFSSLRHYSD
                     DEKSNKGLKNSEIFVISSASKLISVTAVYPFQLLKSNLQCFDAREKKYTMNRLINFIY
                     GTEGVKGFYKGLSANLFRAIPSTCITFGIYENLKSLL"
     gene            complement(<537261..>537443)
                     /locus_tag="HG535_0D02660"
                     /db_xref="GeneID:59236282"
     mRNA            complement(<537261..>537443)
                     /locus_tag="HG535_0D02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288391.1"
                     /db_xref="GeneID:59236282"
     CDS             complement(537261..537443)
                     /locus_tag="HG535_0D02660"
                     /inference="similar to AA sequence:RefSeq:NP_014329.1"
                     /note="similar to Saccharomyces cerevisiae TOM7 (YNL070W);
                     ancestral locus Anc_2.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144286.1"
                     /db_xref="GeneID:59236282"
                     /translation="MAFLPSFILSDESKERITKLINITHTVAHYGWVPFILYLGWASS
                     SNKPNVLNLLSPLPSI"
     gene            complement(<537771..>539174)
                     /locus_tag="HG535_0D02670"
                     /db_xref="GeneID:59236283"
     mRNA            complement(<537771..>539174)
                     /locus_tag="HG535_0D02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288392.1"
                     /db_xref="GeneID:59236283"
     CDS             complement(537771..539174)
                     /locus_tag="HG535_0D02670"
                     /inference="similar to AA sequence:RefSeq:NP_014328.3"
                     /note="similar to Saccharomyces cerevisiae LAT1 (YNL071W);
                     ancestral locus Anc_2.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144287.1"
                     /db_xref="GeneID:59236283"
                     /translation="MSALIRAIPRVSRASLLSAARCQTQFQLRCYASYPPHTIIGMPA
                     LSPTMVQGNLAVWSKKEGDKLSPGEVIAEVETDKAQMDFEFQEDGYLAKILVPEGTKD
                     IPVNKPIAVYVEDEGDVAAFKDFKVEDSGSGEPKGKETEKKTEEKPTATSEKKAEPKY
                     ASAQPSAPTDRIFASPLAKTIALEKGIALKNVSGTGPRGRITKADVEAFLKKAPSSSA
                     SATAGSGSAAVNAASASYEDVEISTMRGIIAKRLLESTQSIPSYIVSSEISVSKLLKL
                     RQSLNASAKDKYKLSINDILIKGITVAAKRVPDANAYWLEDKGIIRKFKNVDVSVAVA
                     TPSGLLTPIVKNAESKGLVAISSEVKELVSRAKINKLTPEEFQGGTICISNMGMNAAV
                     TMFTSIINPPQSTILAIGTVRRVAVEDAGSENGISFDDKINITGTFDHRTIDGAKGGE
                     FMKELKTVIENPLELLL"
     gene            complement(<539663..>540610)
                     /locus_tag="HG535_0D02680"
                     /db_xref="GeneID:59236284"
     mRNA            complement(<539663..>540610)
                     /locus_tag="HG535_0D02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288393.1"
                     /db_xref="GeneID:59236284"
     CDS             complement(539663..540610)
                     /locus_tag="HG535_0D02680"
                     /inference="similar to AA sequence:RefSeq:NP_014327.1"
                     /note="similar to Saccharomyces cerevisiae RNH201
                     (YNL072W); ancestral locus Anc_2.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144288.1"
                     /db_xref="GeneID:59236284"
                     /translation="MTELPPTIPGSLNSLHTKNFFSEVPLNLDPQSPIILGVDEAGRG
                     PVMGPMVYAVSYCTKDYQDNILIPKYEFDDSKKLTDPVRRSLFQKMWCPLPEVQDEPP
                     TGSAKRTEIDGVGYATTCITPVDISTGMLRYPPSKNYNLNAQAHDVTMNLIQGVLDQG
                     VNIDHVYVDTVGPPASYQKKLEGRFPHVKFTVAKKADSLYCIVSVASVVAKVTRDILV
                     DSLRSSPGEIIGSGYPSDPKTTAWLRKNQSPLFAWPKEMVRFSWQTCETLMNNPSTGS
                     IPIEWEEQFLNSKKNMAQQWAAKSMVNNEPITLDNWFSS"
     gene            complement(<540778..>542427)
                     /locus_tag="HG535_0D02690"
                     /db_xref="GeneID:59236285"
     mRNA            complement(<540778..>542427)
                     /locus_tag="HG535_0D02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288394.1"
                     /db_xref="GeneID:59236285"
     CDS             complement(540778..542427)
                     /locus_tag="HG535_0D02690"
                     /inference="similar to AA sequence:RefSeq:NP_014326.1"
                     /note="similar to Saccharomyces cerevisiae MSK1 (YNL073W);
                     ancestral locus Anc_2.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144289.1"
                     /db_xref="GeneID:59236285"
                     /translation="MLAYRGSMSALRSGACRRALARLYSSGSRKQLSIDAGTLEFSKR
                     NGILEGKLKQYYPSLSNIRVDPLYKPTTLEKFRADYVVAQEGPVDDESNQFYVNGRVK
                     SIRFSGKKICFIDVYSNQSGAQLQLIINFQRIDRKEQCEFVGSLEFLKVGDFIQAYGF
                     PSYSKSRARTMSLNCTKLPVLLSAAQLSLPPKLSDAAKIKNNRVVDYQVNGVEVLLLR
                     HSILKSLRDFFDSRGFVEVETPILSSKSNGAAAQPFKTTSHSLPKNANELEMRVAPEL
                     WLKRLVVSGLDKVYEIGKVFRNEGVDAIHNAEFTTLEFYQSFTSMEQLIEISEELFKK
                     VLLDLTKSHDNDVLGKLNSVLRENNWKFKRVEFLPTLTKELGVDFSKVNLENADEIYG
                     VLPRDAEIPKNLSSQQLLNKLCAKYIEPLHCNALLPTVIYHHPTVMSPLAKTNPLNPD
                     TTKRFEIFINGQEYINAYEEENCPQLQLAKFEAQQKAGETYNDKESLNVDYNYVEAMK
                     WGMPPIGGFGLGIDRLCMLLLNKKRLEEVIAFGCLDDVNRQ"
     gene            <544028..>545578
                     /locus_tag="HG535_0D02700"
                     /db_xref="GeneID:59236286"
     mRNA            <544028..>545578
                     /locus_tag="HG535_0D02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288395.1"
                     /db_xref="GeneID:59236286"
     CDS             544028..545578
                     /locus_tag="HG535_0D02700"
                     /inference="similar to AA sequence:RefSeq:NP_012131.1"
                     /note="similar to Saccharomyces cerevisiae VHS2 (YIL135C)
                     and MLF3 (YNL074C); ancestral locus Anc_2.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144290.1"
                     /db_xref="GeneID:59236286"
                     /translation="MNDEALSRSSTQATTYSLEGHSHADEMHSTCPPSPTLSDSNQSM
                     IFERNVEDPYMVSAGMNSNPISKHGSTTSLLSRQYSNASQHLQPQFYGGGAGGHRQSV
                     SHPLPHSPPSEGHSPEVVMPKLDRRRTLENFVAPALDASCSIVTDDNADLDDLDIVYM
                     RRPSTLGLDMALGRTKSNSSATITSSQNMNASNNTNTYNNNNYNNNITQTPLLGLSRS
                     YSNSNSSPNPAANANGGGQQQDAKTLRFYSYADMLSDEMASNPSAKNFRRPSLSHSSS
                     LCHLRPNQLKPSLTTNFSNPFIKKRDSVSNPSSASTSNLSRHYSNTVLSRSPTYQPSS
                     QQQERAKCCCVKDDMNEKGSKFQNKDNPNLNVNQSINQNLNANSNPRYAISKVSQRSG
                     KSNFHIESSGSEELSTDDEDDNFHPLTTTSPNVMSPSTFLGPRVSRSSTQNSINSGSP
                     LYSSRTYSNGGNNPISPSIIRRRESGSAFSPHSINNVMMYDDTLQTETVGEALRKKVS
                     NRRDNAIN"
     gene            complement(<546030..>546899)
                     /locus_tag="HG535_0D02710"
                     /db_xref="GeneID:59236287"
     mRNA            complement(<546030..>546899)
                     /locus_tag="HG535_0D02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288396.1"
                     /db_xref="GeneID:59236287"
     CDS             complement(546030..546899)
                     /locus_tag="HG535_0D02710"
                     /inference="similar to AA sequence:RefSeq:NP_014324.3"
                     /note="similar to Saccharomyces cerevisiae IMP4 (YNL075W);
                     ancestral locus Anc_2.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144291.1"
                     /db_xref="GeneID:59236287"
                     /translation="MLRRQARERREYLYRKAQELQETQLEQKRQIIKDALAQGKPLPR
                     ELAEDEQLQKDFRYDQSMKASNDDTERIDDEYAATSGISDPRIIVTTSRDPSTRLSQF
                     AKEIKLLFPGAVRLNRGNYIMPNLVGACIKSGTSDLVVLHEHRGVPTSLTISHFPHGP
                     TAYFSLHNVVLRHDIMNQGNQSEVNPHLIFDNFTTPLGQRVVSVLKHLFSPGPKKDSA
                     RVITFANRGDFISVRQHVYVRTREGVEVAEVGPRFEMRLFELRLGTLDNKDADVEWQL
                     RRFVRTASRKEYL"
     gene            complement(<547163..>549046)
                     /locus_tag="HG535_0D02720"
                     /db_xref="GeneID:59236288"
     mRNA            complement(<547163..>549046)
                     /locus_tag="HG535_0D02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288397.1"
                     /db_xref="GeneID:59236288"
     CDS             complement(547163..549046)
                     /locus_tag="HG535_0D02720"
                     /inference="similar to AA sequence:RefSeq:NP_014323.1"
                     /note="similar to Saccharomyces cerevisiae MKS1 (YNL076W);
                     ancestral locus Anc_2.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144292.1"
                     /db_xref="GeneID:59236288"
                     /translation="MSEERKREVPTPLTVKDHEDDSKFLKVTPNLFTPDRLHLFDSLD
                     LYASLIKCSKNIEQGERLHNISWRIINKAMLKDRDINKDKKREGVKNLYYVLNPMTNK
                     HQVNQQAQHQAQQQGKQQGKQQGKQQLHERQQKAHSQDNLARSHVSRIGSTGSNRQQH
                     TPLRLQSLEPSRKEAPNTSLFTASKQNKSTGALTHTLSNHHAHSTHNNINQNSNHQLN
                     HHHHPFHSISKKEDPQTIVKGFIPNTLITGTKGANSTDGSASQKERSKNNVDDSKQKK
                     NTFYIGASPSPEPGATNTSTSQKTLISRQESLFGKQPTTEVNNGTSASNRSTLFFSSE
                     DEDEDDTDWDDDSLLYDEEEDDHFDDEEEDQYYRRQWDKLLFTKNQGHHSSSAVSSGN
                     VTPTSTSSHDPIKRSLLSGLFLSEHVNHHNNGSRSQNNSNEKLDNEKDPSSTLQRTKT
                     SQSLMSTSVPHTGAKEIYSQRATLETSNVTAVGSVTPPQRVASTNGGLPAALYRSTKS
                     ARGSFSSIISDSTRQCYTGESNAPPAAQTILPTALTTHMFLPNNIHQQRMAASAASEN
                     LGRKIGRNEAHSFIMHEFKEKQARRESMDIPSKNRSKTSLKTRVEISEEEKFSRVYSR
                     RNL"
     gene            complement(<549906..>551348)
                     /locus_tag="HG535_0D02730"
                     /db_xref="GeneID:59236289"
     mRNA            complement(<549906..>551348)
                     /locus_tag="HG535_0D02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288398.1"
                     /db_xref="GeneID:59236289"
     CDS             complement(549906..551348)
                     /locus_tag="HG535_0D02730"
                     /inference="similar to AA sequence:RefSeq:NP_012130.1"
                     /note="similar to Saccharomyces cerevisiae OM45 (YIL136W);
                     ancestral locus Anc_2.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144293.1"
                     /db_xref="GeneID:59236289"
                     /translation="MSGRLIMGGAAAAAAGYMIYEYQQQNERNRSALIPPSTATRDRS
                     SGATVDEKARALSKEVQQRKDESAKWIKEQAEEKKKSVKDEFEHQKAAVQSTAADTSK
                     DASRGWERIKEGVSEDGKSIKEALLGSDDDKKAKDHNKSIFNRSFNEAERAKAIAIGD
                     YDRVNKEFNTLLARFNESKKGMFDSGDALLKQQLDDFKNVVKEKKEALDKASKEYADY
                     TRHNFNEISNKLDEQDEKIRKEGGFFKWLTRTPVKGEKEKSGNETNSTKNNPLAGFGE
                     NAAFFSQEQIEEQLRNKEIGPSEAQKRLDVLKRLKEEGWYQHHQGSSTDEEMAKAAAK
                     GLSGWGESAAQFAQEEIDESKRLANKARNIASREDASKAVDDAWKKLQDAKKTVDETS
                     SKWWSKGKEKTNEISDEASKKYAEAQKNYEAAKKTLSDWSDKSSAKFWSSADDAIRVA
                     QNAADQARDKTQGKLHDSQDNVEQEQLLEE"
     gene            complement(<552278..>553792)
                     /locus_tag="HG535_0D02740"
                     /db_xref="GeneID:59236290"
     mRNA            complement(<552278..>553792)
                     /locus_tag="HG535_0D02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288399.1"
                     /db_xref="GeneID:59236290"
     CDS             complement(552278..553792)
                     /locus_tag="HG535_0D02740"
                     /inference="similar to AA sequence:RefSeq:NP_014322.1"
                     /note="similar to Saccharomyces cerevisiae APJ1 (YNL077W);
                     ancestral locus Anc_2.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144294.1"
                     /db_xref="GeneID:59236290"
                     /translation="MGKFMELYNILNLPAEATTADIKKAYRILALKYHPDKNNHSEES
                     KAKFLKVCSAYEILSDNHKRELYDQYGTTDEIAIKQQQQQQQRGFMGESSFFRSTGPM
                     GMSPGDLFSQFFDNVSSMPMPGFGSRKSNMSGWNVSVPSQSSSTSRGPDIRHSLNCTL
                     SALYYGKKTKLGLNRRRICQSCGGLGGMKKRDCKRCQGQGQITETRRMGPMVQTWTQT
                     CPDCGGSGYLMKNSDLCKDCHGECYIKERKIFDVEVKPGMNHGQAILLPGEADEIITT
                     SYGTEKVVPGDVVITINQVTDQKFQRCNKNGCDLVMRHCKIPLLTSLCGGEIYIDGHP
                     NNRLLKISIIPGEIIKPNCFKSVENMGMPRYINQKDSQGNIITEGYGNLYIQFEVDFP
                     DKLEPETVQNLMQVLKNDKSVKDQLTSQESTVYDRLDDCIEMEDHVLSDFVPNFNDIN
                     STHKKSKHNSGDKSGNRKRARDSFDSQQDDLEFDSDCSSSNDRDKAEPQDCTIH"
     gene            complement(<554828..>555124)
                     /locus_tag="HG535_0D02750"
                     /db_xref="GeneID:59236291"
     mRNA            complement(<554828..>555124)
                     /locus_tag="HG535_0D02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288400.1"
                     /db_xref="GeneID:59236291"
     CDS             complement(554828..555124)
                     /locus_tag="HG535_0D02750"
                     /inference="similar to AA sequence:RefSeq:NP_061493.1"
                     /note="similar to Saccharomyces cerevisiae YMR122W-A;
                     ancestral locus Anc_2.416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144295.1"
                     /db_xref="GeneID:59236291"
                     /translation="MSSSAHTTNSNLVSNGAVAASSVSASSVSSVMSSVSSFASSVTS
                     AASSSASSAASSASSSSSSSNAASPNMVAHPISWKYGIALGAVVAGSFVLGAGI"
     gene            <555917..>556531
                     /locus_tag="HG535_0D02760"
                     /db_xref="GeneID:59236292"
     mRNA            <555917..>556531
                     /locus_tag="HG535_0D02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288401.1"
                     /db_xref="GeneID:59236292"
     CDS             555917..556531
                     /locus_tag="HG535_0D02760"
                     /inference="similar to AA sequence:RefSeq:NP_013129.1"
                     /note="similar to Saccharomyces cerevisiae RPL15A
                     (YLR029C) and RPL15B (YMR121C); ancestral locus Anc_2.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144296.1"
                     /db_xref="GeneID:59236292"
                     /translation="MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRASRPSR
                     PDKARRLGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRALRATA
                     EERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPSHKAIRRDARYNWICNPVHKHRE
                     ARGLTATGKKSRGINKGHRYHNTSSGRRKIWKKHNTLSLWRYRK"
     gene            <557071..>558849
                     /locus_tag="HG535_0D02770"
                     /db_xref="GeneID:59236293"
     mRNA            <557071..>558849
                     /locus_tag="HG535_0D02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288402.1"
                     /db_xref="GeneID:59236293"
     CDS             557071..558849
                     /locus_tag="HG535_0D02770"
                     /inference="similar to AA sequence:RefSeq:NP_013128.1"
                     /note="similar to Saccharomyces cerevisiae ADE16 (YLR028C)
                     and ADE17 (YMR120C); ancestral locus Anc_2.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144297.1"
                     /db_xref="GeneID:59236293"
                     /translation="MSEFKKTAILSVYDKTGLLDLAKGLAEKKVRILASGGTARMVRE
                     AGFPVDDVSSITHAPEMLGGRVKTLHPAVHGGILARNLESDEEDLKKQNIDKVDYVVC
                     NLYPFKETVAKVGVTVAEAVEEIDIGGVTLLRAAAKNHARVTILSDPNDYSTFLSELT
                     EEGDVTQELRNRLALKAFEHTADYDAAISDFFRKQYSEGKAQLPLRYGANPHQKPAQA
                     FVALQEELPFKVLSGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVG
                     IPLSDVEKQVYFVSDIENLSPLAAAYARARGADRMSSFGDWIALSNIVDVPTAKIISR
                     EVSDGIIAPGFEPEALEMLKKKKGGKYCVLQIDPNYIPDSVETRQVYGVNLQQKRNDA
                     IINKSSFREIVSENKALTEQAVIDLTVATIALKYTQSNSVCYAKNGMVVGLGAGQQSR
                     IHCTRLAGDKADNWWFRQHPRVLAFKWAKGVKRPEKSNAIDLYVTGQIPTDDPEKSEY
                     ESKFEEIPVPLTEAERKEWMSKLTNVSLSSDAFFPFPDNVYRAVRSGVKYIAAPAGSV
                     MDKAVFGAADSFNLVYVENPIRLFHH"
     gene            complement(<559757..>561730)
                     /locus_tag="HG535_0D02780"
                     /db_xref="GeneID:59236294"
     mRNA            complement(<559757..>561730)
                     /locus_tag="HG535_0D02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288403.1"
                     /db_xref="GeneID:59236294"
     CDS             complement(559757..561730)
                     /locus_tag="HG535_0D02780"
                     /inference="similar to AA sequence:RefSeq:NP_013837.1"
                     /note="similar to Saccharomyces cerevisiae ASI1 (YMR119W)
                     and ASI3 (YNL008C); ancestral locus Anc_2.419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144298.1"
                     /db_xref="GeneID:59236294"
                     /translation="MNATDGRETTKEAFAYLNQTKHSLLPDDIILGHLVNYPYRLAFS
                     LMEAVNVHYQEAVASSGLLINLQSALDIIGYFFSTYAVACFVIALILNRFVLMASLRS
                     NTRTVLLPVWSRYTVHLMAIVPLVYNITQALCQLEVIAVFPPVEVPFFLARTFLIFAW
                     SHCVETFITTTTNLKPLEESDYTIFELSLQFYFLCQSPQNYAQLQGHLPDFLTALIGR
                     VLIHTVEMLDLRRYRLWSSTILNFFSIGYLAYRVQHSGLDSLPAFTRIRHFPKIFSIF
                     LILLSVLTYLLACLVRKNPFSSRQFDTSELQFHSFMHNWWNHLNCTGEEEFSSVISKL
                     ALLLCSGTESMEKGIHREFSPLNAPQNVHPSYFVSPYMNRISTIPDDADTSAKCVDQT
                     TNSNGTLAFVTRVKLTFNLIKHGVLFYLKGKYKARKGSTNKSLKRSRAKTQTKDCNRF
                     ITDKNYVKFLTKPRKVGTENVKEVLLPDEDLSEDYSPIENDYEDSDTAELEIVDVNNT
                     PSGENMASELSQLLAPNDTQNLHEDMKWFMSVWSILSRTQFTEKRITRSTYASLNPEG
                     ILAEVMVERSSNLKLQSTLYENEKVTDNDTSDQQMELVCVVCRINQRNVVLWPCRCFA
                     ICEDCRVSLGLRGFKSCVCCRSEVHGYSKLNAV"
     gene            complement(562062..562132)
                     /locus_tag="HG535_0Dtrna1X"
                     /db_xref="GeneID:59236652"
     tRNA            complement(562062..562132)
                     /locus_tag="HG535_0Dtrna1X"
                     /product="tRNA-OTHER"
                     /note="codon recognized: UUG; tRNA-Pseudo"
                     /db_xref="GeneID:59236652"
     gene            <562394..>563659
                     /locus_tag="HG535_0D02790"
                     /db_xref="GeneID:59236295"
     mRNA            <562394..>563659
                     /locus_tag="HG535_0D02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288404.1"
                     /db_xref="GeneID:59236295"
     CDS             562394..563659
                     /locus_tag="HG535_0D02790"
                     /inference="similar to AA sequence:RefSeq:NP_013127.2"
                     /note="similar to Saccharomyces cerevisiae AAT2 (YLR027C);
                     ancestral locus Anc_2.420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144299.1"
                     /db_xref="GeneID:59236295"
                     /translation="MSQTVLNNIPQLPADALFGIKQRSSRDARDFKVDLGIGAYRDEN
                     GRPWVLPSVRSAEKAIHEDPLYNHEYLAINGLPELSIGAAKILFGEESHALKEGRIIS
                     VQSISGTGALHIVSKFVAKFLAGRAVYLSEPTWANHKAIFKTQNVKTEAYPYWKSSTK
                     TLDMDGFLGAIKSAPNGSIFLLHACAHNPTGLDPSKEQWPTILDTLASKEHIVIFDSA
                     YQGFASGSLDNDAFAVRLGLEKLAKSCPIFVCQSFAKNFGMYGERVGCFHLVLPQQDA
                     NVDISKINRAISSQLSTIIRSEVSNSPAYGAKIVAKILNSPDLTKQWHKDMITMSSRI
                     TSMRHALRDKLVELGTPGNWDHIVSQCGMFSYTGLTASMVERLETQHAVYLVSSGRAS
                     IAGLNKGNLEHVAKSIDEVVRYCSKDAKF"
     gene            <563927..>564895
                     /locus_tag="HG535_0D02800"
                     /db_xref="GeneID:59236296"
     mRNA            <563927..>564895
                     /locus_tag="HG535_0D02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288405.1"
                     /db_xref="GeneID:59236296"
     CDS             563927..564895
                     /locus_tag="HG535_0D02800"
                     /inference="similar to AA sequence:RefSeq:NP_013126.1"
                     /note="similar to Saccharomyces cerevisiae SED5 (YLR026C);
                     ancestral locus Anc_2.421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144300.1"
                     /db_xref="GeneID:59236296"
                     /translation="MNIKDRSTEFQQSVLVCKKRKKLNIRTQDGMNGQEPRRAKSSEF
                     QTKASAIAHEISSTAQLLSKLAILAKRKPMFNDNPVEIAELSFLIKRKIYTIEHSLVD
                     LSKYQRSRQQSQTSTPGGDSQHSKNVVTLLNTKMKNISGNFKDVLEERQKLEMSNRER
                     WEKISEKQDSSLEDEESSNVNRTTYNSSNPFMSSMIENDENSGNNKQTNNELSLPQDS
                     QLMLMEEGQLSTNQYLQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANV
                     DDIDMNITGAQRELLKYFDRVKSNRWLAVKIFLIIFVFFLVWVLVN"
     gene            complement(<564992..>565684)
                     /locus_tag="HG535_0D02810"
                     /db_xref="GeneID:59236297"
     mRNA            complement(<564992..>565684)
                     /locus_tag="HG535_0D02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288406.1"
                     /db_xref="GeneID:59236297"
     CDS             complement(564992..565684)
                     /locus_tag="HG535_0D02810"
                     /inference="similar to AA sequence:RefSeq:NP_013125.1"
                     /note="similar to Saccharomyces cerevisiae SNF7 (YLR025W);
                     ancestral locus Anc_2.422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144301.1"
                     /db_xref="GeneID:59236297"
                     /translation="MLSYFFGGSNGSSAKSKDLPKKAIVELREQINLLSKKQSHLQTQ
                     IVNQENEARTFLSKNNKNMAKNSLKKKKIYEAQSAKLDGQIDLLEQQLFSIESANLNL
                     ETMRAMKQGAKAMKTMHNGLDIDKVDETMDEIREQVELGEEISDAISRPMYTGVNEVD
                     EDELDEELDMLAQESVPVKETKATEQMNLPNVPDDKIKSTSREELSKEAEDEEDEDER
                     ALRELQMEMGLQ"
     gene            complement(<565692..>566195)
                     /locus_tag="HG535_0D02820"
                     /db_xref="GeneID:59236298"
     mRNA            complement(<565692..>566195)
                     /locus_tag="HG535_0D02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288407.1"
                     /db_xref="GeneID:59236298"
     CDS             complement(565692..566195)
                     /locus_tag="HG535_0D02820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144302.1"
                     /db_xref="GeneID:59236298"
                     /translation="MGEQAQENAIANVWNQGNPFIGRNGACSMPAPNARSISFYLSSR
                     LFYTHGSSCVAWCRDFRILLSRIRPLEWIGYLADLLRVTDQQYNASRESHMLFWFLCF
                     LIYFKNPFKRFFISMVSSKEGNKSGFAGSPFLRDKDHRRVRGITTGSLWNVRVPSVSG
                     SFDCVVI"
     gene            <566524..>567264
                     /locus_tag="HG535_0D02830"
                     /db_xref="GeneID:59236299"
     mRNA            <566524..>567264
                     /locus_tag="HG535_0D02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288408.1"
                     /db_xref="GeneID:59236299"
     CDS             566524..567264
                     /locus_tag="HG535_0D02830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144303.1"
                     /db_xref="GeneID:59236299"
                     /translation="MNIRNSSDAQSRLIPNHQRIISSKQWIIEDKNSKNQVMTKSDGK
                     RTTATTKSDRKSSKELETAKLQMEYNSVKQENDKLKNVIGKLKQEIDIYTNLLNHTNG
                     ACPGTKSKGRSGKYQDNAMMKSLLINTPKRRKKSEVSTTAPAAMRAPTPAPAHASGTK
                     HARQATPKAASAPEPTDIKSTATTPALGATFASASVPGSASVSASGSASVSASPSTPT
                     TSQTSDDMVSPDDLMLMNTLTDVLNHMK"
     gene            <567607..>568143
                     /locus_tag="HG535_0D02840"
                     /db_xref="GeneID:59236300"
     mRNA            <567607..>568143
                     /locus_tag="HG535_0D02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288409.1"
                     /db_xref="GeneID:59236300"
     CDS             567607..568143
                     /locus_tag="HG535_0D02840"
                     /inference="similar to AA sequence:RefSeq:NP_012781.1"
                     /note="similar to Saccharomyces cerevisiae SDH3 (YKL141W)
                     and YMR118C; ancestral locus Anc_2.423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144304.1"
                     /db_xref="GeneID:59236300"
                     /translation="MIVTLGLNRSSRAFFGPSVISRSCRLLISKRLNSNVAKTTFKQE
                     NQLLVAQRKHRPVSPHLTIYQPQITWYLSSLHRISGVVLGMGFFAVTMAFGVSTIFGL
                     GLNTDNLKAFYKEKVPSWADLTMKAGAAYLFVFHFGNGIRHLVWDMGKELSIKGVNRT
                     GIAVLIVAAIGGTSLLFK"
     gene            <568338..>569885
                     /locus_tag="HG535_0D02850"
                     /db_xref="GeneID:59236301"
     mRNA            <568338..>569885
                     /locus_tag="HG535_0D02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288410.1"
                     /db_xref="GeneID:59236301"
     CDS             568338..569885
                     /locus_tag="HG535_0D02850"
                     /inference="similar to AA sequence:RefSeq:NP_012782.1"
                     /note="similar to Saccharomyces cerevisiae TGL1 (YKL140W);
                     ancestral locus Anc_2.424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144305.1"
                     /db_xref="GeneID:59236301"
                     /translation="MHHQTTKLRNQRAKMSIFGRFSIIDTVIMILVYVETVLALTLRL
                     VPQPIISFGTWLINLSETSDEYTMEQKIRHAATIHEICRLFDIDVEDHLVRTEDDYIL
                     TIHRIPPKRRIYNGRVVYLHHGLLMCSDVWVCNLERNKNLPFVLHDLGFDVWMGNNRG
                     NKYSTAHLLRVPKSKKFWDFSIDEFAFFDIPNSVQFVLDRTKVEQLICIGFSQGSAQM
                     FAAFSLSEELNRKVSQFIAISPAMTPRGLHNRIVDAMAKSSPGLMYLFFGRKIVLPTA
                     VLWQRTLHPKLFNLGVDLGCRLLFDWNARNITARQKLASYGKLYSTTSVKSIVHWFQI
                     LHSQKFQMFEESDDILNSLHRPYEVATFPTRTNIKIPILLIYGGSDSLVDIKVMKENL
                     PAKRVFDIRIDDHEHLDLLWGKDVDTLVVLNVIKFIQFFDEPVKIPLLEAQKDVLDLP
                     SPRALDSNSGTNEDNDDNDDNESQTISYHKYNDDYSNKNGMNEISKIFSKQQRMLSES
                     FLDELRL"
     gene            <570214..>571784
                     /locus_tag="HG535_0D02860"
                     /db_xref="GeneID:59236302"
     mRNA            join(<570214..570216,570804..>571784)
                     /locus_tag="HG535_0D02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288411.1"
                     /db_xref="GeneID:59236302"
     CDS             join(570214..570216,570804..571784)
                     /locus_tag="HG535_0D02860"
                     /inference="similar to AA sequence:RefSeq:NP_010175.1"
                     /note="similar to Saccharomyces cerevisiae KIN28
                     (YDL108W); ancestral locus Anc_2.332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144306.1"
                     /db_xref="GeneID:59236302"
                     /translation="MVGEGTYGKVYKARNTITGKMVALKRLRLEGERDGFPITSIREI
                     KLLQSFDHPNISTLKEIMVESQKTVYMIFEYADNDLSGLLLNKQIDIGPAQCKHIFKQ
                     LLLGIQYLHENGILHRDIKGSNILIDNKGQLRITDFGLARKIKASHDYTNRVITLWYR
                     PPELLLGSTTYGFEVDMWGCGCVLIEMFNKSSIFQGQNELEQLDSIFKIMGTPSIEKW
                     PKLFEMPWFFMVMPQQSKRYDNVFKERYGSLIPSENCIKLIEGLLDYNQRTRLTATQA
                     LQSEYFKEDPKPEPLSLEGTPGCHEYEVKLARKQKRAKDVEDQSSKKDISK"
     gene            complement(<571909..>572121)
                     /locus_tag="HG535_0D02870"
                     /db_xref="GeneID:59236303"
     mRNA            complement(<571909..>572121)
                     /locus_tag="HG535_0D02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288412.1"
                     /db_xref="GeneID:59236303"
     CDS             complement(571909..572121)
                     /locus_tag="HG535_0D02870"
                     /inference="similar to AA sequence:RefSeq:NP_690844.1"
                     /note="similar to Saccharomyces cerevisiae HSK3 (YKL138C-
                     A); ancestral locus Anc_2.426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144307.1"
                     /db_xref="GeneID:59236303"
                     /translation="MPNSTKRIQYAHMAKQLESLHSNLLETTRQLERMSEQCNKSVVD
                     QLGKVHASWFIGSNRYFEEEMLGKQK"
     gene            <572276..>572944
                     /locus_tag="HG535_0D02880"
                     /db_xref="GeneID:59236304"
     mRNA            <572276..>572944
                     /locus_tag="HG535_0D02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288413.1"
                     /db_xref="GeneID:59236304"
     CDS             572276..572944
                     /locus_tag="HG535_0D02880"
                     /inference="similar to AA sequence:RefSeq:NP_013835.1"
                     /note="similar to Saccharomyces cerevisiae SPC24
                     (YMR117C); ancestral locus Anc_2.427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144308.1"
                     /db_xref="GeneID:59236304"
                     /translation="MKDNLLENPADLLRDVRDNFIIEEDVESILNIDKRIDEMRNKSH
                     QNTESKKIEVAKLSVQLESRNSKISELQAAMERIKAESEELASQHEIVDYVDELDELE
                     KSIISLRCQLDERIVTFVKNERSMSNDLTLGSPNVPVTQIEGLAATTDDTAEIMNDPI
                     ARANILKLKLCRTMGLIIDEDTNQVIIETADNKVETLPLDDDLSDFFKTKYIWQRIQS
                     RKVR"
     gene            complement(<573057..>573452)
                     /locus_tag="HG535_0D02890"
                     /db_xref="GeneID:59236305"
     mRNA            complement(<573057..>573452)
                     /locus_tag="HG535_0D02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288414.1"
                     /db_xref="GeneID:59236305"
     CDS             complement(573057..573452)
                     /locus_tag="HG535_0D02890"
                     /inference="similar to AA sequence:RefSeq:NP_012784.1"
                     /note="similar to Saccharomyces cerevisiae MRPL31
                     (YKL138C); ancestral locus Anc_2.428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144309.1"
                     /db_xref="GeneID:59236305"
                     /translation="MFGPFKATSTLMGGLLWKIPWRMSSHQKQRVRQRLKDVDEVLRQ
                     VNLGLHVERSEKKGLAYDKAISSKTLLKPRLKTLRLLNKSSIFPKEFQMSSKDKYTVF
                     DKKEKDYRKGIHKVPKFTKLSLRRNPKFY"
     gene            <573645..>573968
                     /locus_tag="HG535_0D02900"
                     /db_xref="GeneID:59236306"
     mRNA            <573645..>573968
                     /locus_tag="HG535_0D02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288415.1"
                     /db_xref="GeneID:59236306"
     CDS             573645..573968
                     /locus_tag="HG535_0D02900"
                     /inference="similar to AA sequence:RefSeq:NP_012785.2"
                     /note="similar to Saccharomyces cerevisiae YKL137W;
                     ancestral locus Anc_2.429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144310.1"
                     /db_xref="GeneID:59236306"
                     /translation="MADSPNTHTGTRLPIWVLGPQEEKEARVNLKSFAYQKCDEFVKA
                     MADCAKTNGIRVFPTCEKQREKMGECLLFYQVDTRYLDEQRDKIVERKINRLEEKIRK
                     REQEK"
     gene            complement(<574090..>576201)
                     /locus_tag="HG535_0D02910"
                     /db_xref="GeneID:59236307"
     mRNA            complement(<574090..>576201)
                     /locus_tag="HG535_0D02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288416.1"
                     /db_xref="GeneID:59236307"
     CDS             complement(574090..576201)
                     /locus_tag="HG535_0D02910"
                     /inference="similar to AA sequence:RefSeq:NP_012787.1"
                     /note="similar to Saccharomyces cerevisiae APL2 (YKL135C);
                     ancestral locus Anc_2.430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144311.1"
                     /db_xref="GeneID:59236307"
                     /translation="MAPLNKKIQKFLKDSIRVAPKISKKGELAELRNGLVSPYPQTRK
                     DAIKKTIQQMTLGKDVSSLFPDVLKNIATNDVEQKKLVYLYVMNYAESHPELCILAVN
                     TFVTDAQDPNPLIRCMSIRTMSMVRVDKILEYVEIPLRRTLQDDNPYVRKTAVICVAK
                     LFQLNQELCIELGVLEDLVSALDDSNPMVVANATAALTEIHGVDPSVVSLPKLINSHV
                     SQFLLALNECTEWARITILGALADYSAKDSLEAQDIIDRVSAHLQHVNPAVVLATIKV
                     IIRNLPQIQQQNFKAISLKLSSALVSIMSTPPEMQYVALKNIRIILEKYPELLVKELR
                     IFYVKFNDPLYVKLEKIDIMVRLVDATNLKQCNLLLTELKEYAMEFEPEFVSKSIQGI
                     TQLAIKYSGEKFVSKALDDLLELVDRTENLKDDCCIAMCDLLRHCPTNEKIASDICAL
                     LNSWAVPESSLISDAAKCNYIWLMGHYPEKFTDLEGKLDQMIENFVQEECMTQASILM
                     TVVRLHTQLPGSTLQNVLEMATTSVNEIDIRDMAMIYWRCLSMPNSDTLVDQLCKSVA
                     PIFENALDNFSTETLEKLLNELSTISSIYFRPQSVRAKRYVLRQNIVRGKRMDELKDM
                     AKNEIAKNMNDDVLLDFGDDEPKTSSSGNVSSNLLDDLDDIFGFNSTGATTSSETKDM
                     QSSTNKMNTSTTNTQDLLNLF"
     gene            <578213..>578924
                     /locus_tag="HG535_0D02920"
                     /db_xref="GeneID:59236308"
     mRNA            join(<578213..578221,578502..>578924)
                     /locus_tag="HG535_0D02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288417.1"
                     /db_xref="GeneID:59236308"
     CDS             join(578213..578221,578502..578924)
                     /locus_tag="HG535_0D02920"
                     /inference="similar to AA sequence:RefSeq:NP_013834.1"
                     /note="similar to Saccharomyces cerevisiae ASC1 (YMR116C);
                     ancestral locus Anc_2.431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144312.1"
                     /db_xref="GeneID:59236308"
                     /translation="MVKAWNLNQFKIEADFIGHNNYVNTITASPDGSLIASAGKDGEI
                     MLWNLSAKAPMHTFSAQDEVFALAFSPNRYWLSAATSSGIKIFCLDPKSLVDELKPEF
                     AGYTKAAEPHAISLAWSADGQTLFAGYTDNVIRVWQVMTAN"
     gene            complement(<579256..>581616)
                     /locus_tag="HG535_0D02930"
                     /db_xref="GeneID:59236309"
     mRNA            complement(<579256..>581616)
                     /locus_tag="HG535_0D02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288418.1"
                     /db_xref="GeneID:59236309"
     CDS             complement(579256..581616)
                     /locus_tag="HG535_0D02930"
                     /inference="similar to AA sequence:RefSeq:NP_012788.2"
                     /note="similar to Saccharomyces cerevisiae OCT1 (YKL134C);
                     ancestral locus Anc_2.432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144313.1"
                     /db_xref="GeneID:59236309"
                     /translation="MLKSTFSRNVTGIKNLWNSGYHARFFATEALPYTSFGASHKANG
                     QLRRTFDDLDYWHDANRDNFTAKTVKGKVLSNLTFGGQSQSNAGLFRNPYLKSPDGLR
                     KFSRHSLMQAESALEDMRSDHSKEGLLKYIMRLDQLSDTLCRVIDLCEFIRSSHPDNS
                     YLEAAQACHEEMFEFMNVLNTDVALCDTLKSVLSNTEISSRLSEEEIKVGKLLLEDFE
                     KSGIRMEPDIREQFIALSQQISVVGQDFINNTDYVQSNYLKIKCEDLRKSGLNSLILN
                     QLSQDISGQCYRVPTNGYVAYSILRSCPDDQIRMKVWAAMHSCSEKQIKRLKQLISLR
                     AVLANLMGRKSFAEYQLDGKMAKTPEQVCDFISTLMDNIKPKAADELKFIHNLKNPNL
                     DKKRMAADSVDGILSDVRPWDRDFYSTVHSIQQRRSAADDEQISSYFTLGTVMEGLSD
                     LFQRIYGIRLEPIIAERGETWSPEVRRLNVVSERDGLIGVVYCDLFERQGKTSNPSHF
                     TICCSRQIYPHELDTSTVQMGRNRDGTRFQLPIISLICNFSSATDSTGKSVCLLQLSE
                     VETLFHEMGHAMHSMLGRTRLQNISGTRCVTDFVELPSILMEHFARDSRVLKEIGRHY
                     ETGAPIPDSLLQSHIQESNFMQYCETYSQAKMAMLDQELHSEKIVKGLETLDVTNLYQ
                     ELERKMKVLVDDKSNWCGKFGHLFGYGATYYSYLFDRAIASKIWDELFSKEPYSRKNG
                     EKFIECVLKWGGSRDPWACIADLFDKPELSKGGTRAMEFIGQAQDL"
     gene            complement(<581822..>583381)
                     /locus_tag="HG535_0D02940"
                     /db_xref="GeneID:59236310"
     mRNA            complement(<581822..>583381)
                     /locus_tag="HG535_0D02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288419.1"
                     /db_xref="GeneID:59236310"
     CDS             complement(581822..583381)
                     /locus_tag="HG535_0D02940"
                     /inference="similar to AA sequence:RefSeq:NP_012789.2"
                     /note="similar to Saccharomyces cerevisiae YKL133C and
                     YMR115W; ancestral locus Anc_2.433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144314.1"
                     /db_xref="GeneID:59236310"
                     /translation="MTFQPWTNKSTMKKVSHRIREVTLPKIYPAVMFRLASRQPSIKQ
                     LRKALITVPFDSRRLLHHDAVLRNTSSLFQSQMRQKNDKLQKLVLSLVGLSAVSYGLW
                     YYYWPHHTFPPSVAATLRKGIWAESDKQQYDYQKALKFYIEAIEECQKLSMDPITDEY
                     TGIELKIAEMYEKLNLMEQANSVYLELLYRYFDALNTPGKVPEDKRPDMIRRDLRVLI
                     KSLEVQSLDVNKDASITKRNLLAHLLLAQEEVLSRSPELKEFFESRKQKANNMFQGKA
                     HDASDFKTFVNTDNIKFNDDGYMILDLKKNSSAWEPFKEEFFTARDLYTAFCLSAKDI
                     SAALSCKMTTVEWMVMADMPPGQILLSQANLGSLLYLQGEKFEAEIFKAEGKRKEIVA
                     DQGDQESDNLIKSLRYLRRNRDICLKMASKCYDSVVQFAKKNNKLRFNMKDQLDPSIS
                     QAIALSTYGLGVLNLHQGVLAEAEKLLKDSMAMAKEIDFDELLKEAQNELKKTAKLKL
                     EKQSPALEINQ"
     gene            <583510..>584628
                     /locus_tag="HG535_0D02950"
                     /db_xref="GeneID:59236311"
     mRNA            <583510..>584628
                     /locus_tag="HG535_0D02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288420.1"
                     /db_xref="GeneID:59236311"
     CDS             583510..584628
                     /locus_tag="HG535_0D02950"
                     /inference="similar to AA sequence:RefSeq:NP_013832.1"
                     /note="similar to Saccharomyces cerevisiae YMR114C;
                     ancestral locus Anc_2.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144315.1"
                     /db_xref="GeneID:59236311"
                     /translation="MCGRYALAFDSNEIAAQFKAYNLEVRPELAKDEYHSRSYNVAPT
                     NDGVVYRTKDKELRYMKWGLVPHWTENVSEFKTYRTFNARLENLQESRMWIQCCNRKR
                     CAIPISGYYEWKTQGKAKYPYYIKRKDNKLMFLAGMYDYVEKEDLWTYTIVTAEAPHE
                     LSWLHARMPIVIVPGSDAWDAWMNPKKVEWSTNGLNSICAAHYDNNALTIYRVSEDVG
                     KVQNNGEHLIKPIFREDRIKAEIRREDESNELPVEEEYERDQTFKDEKKGSSKVPENL
                     EKEAKAAKLKEEASVKEEDNPSGENELYEEKADQPKHALRGASRGQKSSMNEDTGSES
                     NKTGPFATRIRKNSNGAKRLRRDIKTELKEASAKKRRK"
     gene            complement(<584655..>585941)
                     /locus_tag="HG535_0D02960"
                     /db_xref="GeneID:59236312"
     mRNA            complement(<584655..>585941)
                     /locus_tag="HG535_0D02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288421.1"
                     /db_xref="GeneID:59236312"
     CDS             complement(584655..585941)
                     /locus_tag="HG535_0D02960"
                     /inference="similar to AA sequence:RefSeq:NP_012790.1"
                     /note="similar to Saccharomyces cerevisiae RMA1 (YKL132C)
                     and FOL3 (YMR113W); ancestral locus Anc_2.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144316.1"
                     /db_xref="GeneID:59236312"
                     /translation="MSINLGLRRVVALLGYLGNPQERLKVLHVAGTNGKGSVCSYLTS
                     ILQQHKPSLIGKFTSPHLIHVTDSITINGTPIPWNCYEDIRNHLDTLNNSHSLQCTEF
                     ELLTCTALKYFHDVKCDWCVIEVGLGGRLDATNVIPGRCKLACGITKVGLDHESILGN
                     NLAQIAKEKAGIITKGVPFAAVDGSNDISVIKEVKEQCNDKLCELDITEATYADSSVK
                     TKSWEVITPKKLPLNGFYQINNLRVACSMLDNLQQKGHICLSANDIHGGLQNVNWPGR
                     LHELDYCFDSEKKSTVSVLLDGAHNGAAAVELARYLRDKYGDKPLTFVLAVTSGKNLD
                     SLLSPLLRSEDKVITTEFGKVDGMPWIHATPYTELATYIKRKYTKNVETQPLLTKVIP
                     SIVDACHNDGICPIVVCGSLYLCGELLRIHSDNLNS"
     gene            <586102..>586443
                     /locus_tag="HG535_0D02970"
                     /db_xref="GeneID:59236313"
     mRNA            <586102..>586443
                     /locus_tag="HG535_0D02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288422.1"
                     /db_xref="GeneID:59236313"
     CDS             586102..586443
                     /locus_tag="HG535_0D02970"
                     /inference="similar to AA sequence:RefSeq:NP_013830.1"
                     /note="similar to Saccharomyces cerevisiae MED11
                     (YMR112C); ancestral locus Anc_2.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144317.1"
                     /db_xref="GeneID:59236313"
                     /translation="MQPVYVQERLESLSEIDSKLCNLLKIASQVVFTFSELKQGNHDL
                     KPQFEQHVKDFYTDLEGATTNLRKEIKLLDKNVGTRLLPINVNKKATGQDDDKLKEQI
                     ALLERVLTEQN"
     gene            <587368..>588609
                     /locus_tag="HG535_0D02980"
                     /db_xref="GeneID:59236314"
     mRNA            <587368..>588609
                     /locus_tag="HG535_0D02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288423.1"
                     /db_xref="GeneID:59236314"
     CDS             587368..588609
                     /locus_tag="HG535_0D02980"
                     /inference="similar to AA sequence:RefSeq:NP_013829.1"
                     /note="similar to Saccharomyces cerevisiae YMR111C;
                     ancestral locus Anc_2.437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144318.1"
                     /db_xref="GeneID:59236314"
                     /translation="MTPSSRDSFSGPNAESHPDNLSQNGKAKTGTKKDSLDSIEFQSF
                     LIDQLAKVQEQNEDLLARIKRLEKEQEEFYISGQKKMETGFKNVKKCTEDVAAMKEVF
                     KEIVGIMTGERVRFIDHAQESITDGDAQRVSSSSLLASNSRQETRARVRQSISDVAAL
                     NGIPEFKVEESEVYSGFLSPDIYDDTRRSNNGQQRVFGMGSSEQTQNNGGDSDGNEDV
                     QNNETNSHDLWIPTDSGGTPHVDSATSLSMDSIPNYRMNRAIQSVHDVAREYFEGFPG
                     RPSLMFLERRYGSTWRRSSKERTLFAKRMCIIHKINDIRDNPKKYELPERIHRNQAIK
                     VVENIRLGNNNFKGHNCRLSISQLYTYFSKKMDTLQDYSLELKKRGEPRRNHLMRERM
                     ARLERTNAGSESIPTIANHSE"
     gene            complement(<588741..>589460)
                     /locus_tag="HG535_0D02990"
                     /db_xref="GeneID:59236315"
     mRNA            complement(<588741..>589460)
                     /locus_tag="HG535_0D02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288424.1"
                     /db_xref="GeneID:59236315"
     CDS             complement(588741..589460)
                     /locus_tag="HG535_0D02990"
                     /inference="similar to AA sequence:RefSeq:NP_012792.1"
                     /note="similar to Saccharomyces cerevisiae SHE2 (YKL130C);
                     ancestral locus Anc_2.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144319.1"
                     /db_xref="GeneID:59236315"
                     /translation="MTTVVATTGIVNNLHEICKVFAKYISDYIRFLNKFIGHLRKVAT
                     LRFERTTLIKYVKKLRFLHDTLTSYDVYSDINIDGETALANEILPMASFYLKIVELLD
                     MLNFYLTQSLQKEIISKTLNNDLTLPEESISTIEDCYNHFVKFAEWMIESLDIGTPFL
                     QIEVIQFAKKCAIEDNVDLESTNDIFLQEVAPVEDSEEYDNLSKEWSLLLEEKTLALD
                     IHFVQILNHWSEKFDKKKDAK"
     gene            <589814..>591400
                     /locus_tag="HG535_0D03000"
                     /db_xref="GeneID:59236316"
     mRNA            <589814..>591400
                     /locus_tag="HG535_0D03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288425.1"
                     /db_xref="GeneID:59236316"
     CDS             589814..591400
                     /locus_tag="HG535_0D03000"
                     /inference="similar to AA sequence:RefSeq:NP_013828.1"
                     /note="similar to Saccharomyces cerevisiae HFD1 (YMR110C);
                     ancestral locus Anc_2.439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144320.1"
                     /db_xref="GeneID:59236316"
                     /translation="MTENTTLKYTPLQEIDSKIRLANEYFHEKQLKLSKTPSPRKADL
                     KIRSLQLKKLYYAIKNHEQDILDAMYRDFHRSPTETTVLEIIPVYNAILHIIDRLHIW
                     MAPKRIRDNSSPAFMFSKIVIEKIARGSALIIGPFNFPFFLSLLPVAYAISAGNSVIL
                     KPSELVPSCAQLLEEILYDADFPQGMVQVVQGSIPETESLVQSGRFDLIFFTGAPKTG
                     SIIAQEAAKSLTPCVLELGGKSPAFITETLENKYLETTLKRLFFSSFGNSGQICVSPD
                     YALVHESKYSEVVDLAKKILQDFFPRIDESVEYSHMVNEKAYNEVCKKLESTKGTKFT
                     SGGQTPEKLDFFIPPTLVFDVDWNDSLMQSENFAPILPFIKYRDLDDTIERLLRSCDT
                     PLAQYIFSGSDQEIQHILSRVRSGGCVVGDTLIHVGITDAPFGGIGTSGYGSSGGIYG
                     FNAFSHERTILKQPFLVERLLSMRYPPASSFRRSILRVGMERKPWFDRTGKNNIPFLR
                     SVVISVLVLCFSVCFYSYKS"
     gene            complement(<591508..>595206)
                     /locus_tag="HG535_0D03010"
                     /db_xref="GeneID:59236317"
     mRNA            complement(<591508..>595206)
                     /locus_tag="HG535_0D03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288426.1"
                     /db_xref="GeneID:59236317"
     CDS             complement(591508..595206)
                     /locus_tag="HG535_0D03010"
                     /inference="similar to AA sequence:RefSeq:NP_012793.2"
                     /note="similar to Saccharomyces cerevisiae MYO3 (YKL129C)
                     and MYO5 (YMR109W); ancestral locus Anc_2.440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144321.1"
                     /db_xref="GeneID:59236317"
                     /translation="MAIIKRGARNKTAVAPTKRSTNIKKATFDSSKKKEVGVSDLTLL
                     STISDQAINENLKKRFLNGTIYTYIGHVLISVNPFRDLGIYTDAIMETYKGKNRLEVP
                     PHVFAIAETMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASTTHSDQIGKI
                     KDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITNYLLEKQRVV
                     SQIQNERNFHIFYQFTKGASDNYRQIFGVQKPEQYVYTSASKCTSVDTIDDSKDFQDT
                     LKAMQVIGLSQDEQDQIFRLLAAILWIGNITFIEDAEGNAQIRDTSVTDFVAYLLQVD
                     AQLLIKSLVERVLETNHGMRRGSVYHVPLNAVQAGAVKDALAKSIYNNLFDWIVDRVN
                     VSLQAFPGADKSIGILDIYGFEIFDHNSFEQICINYVNEKLQQIFIQLTLKSEQETYE
                     REKIKWTPIKFFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQAFAQRLNLF
                     TTNPHFELRSSKFVIKHYAGDVTYDVNGITDKNKDQLQKDLVELIQTTVNPFISSIYP
                     DAVDKNSKRRPPTAGDKIIKSANELVETLSKAQPAYIRTIKPNQTKSPNDYDDKQVLH
                     QVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLLSPRCSYAGDYTWHGETLEAVKMIL
                     ADASIPEKEYQLGVTSVFIKTPETLFALEHMRDKYWYNMAARIQRAWRRFLQRRIDAA
                     IKIQRAIKERKGGNKFEQLRDYGTKLLGSRKERRSMSLLGYRAFMGDYLSCNEKKSKG
                     SFIKKQAGISDKAVFSIHGESLHSKFGRSAQRMKKTFILTKSHIYIVGQVMTQNTLQY
                     MVDYKIDLKSISGVSMTNLQDDWIGINLINSTQPDPLINTYFKTELITHLKKLNGNIQ
                     IKIGPTLQYQKKPGKLHSVKCQISEAAPKYSDCYKSSTISVRRGHPANSKSKKKPNKG
                     SYANSSYTAPRRHTISKAKQKPSTPISRTVKKAAPPPPGRKQVNSTSLAASAAQAAYH
                     PNGAVVNTHAVNVTASPQQSNTVARQEATSRPLTEPTTASQPAAKTVPPPPPPPQMSK
                     PTEPMFEAAYDFPGSGAPSELPLKKGDVVYVNRHEPSGWSLGKTLDGTREGWVPTAYM
                     VEHKETSSGTASSPAANNYNVSAVSAIISDTAAITLSDDSAAAAPVAQQQSFSDGLAS
                     ALAARATKMRKESDDEDGAQSEEEDDDW"
     gene            complement(<595854..>597911)
                     /locus_tag="HG535_0D03020"
                     /db_xref="GeneID:59236318"
     mRNA            complement(<595854..>597911)
                     /locus_tag="HG535_0D03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288427.1"
                     /db_xref="GeneID:59236318"
     CDS             complement(595854..597911)
                     /locus_tag="HG535_0D03020"
                     /inference="similar to AA sequence:RefSeq:NP_013826.1"
                     /note="similar to Saccharomyces cerevisiae ILV2 (YMR108W);
                     ancestral locus Anc_2.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144322.1"
                     /db_xref="GeneID:59236318"
                     /translation="MIRQTTIKQLAAKRCFKQLASKVGASAQVSGYLRYYSNITRKYS
                     ASAATAVDEERPRPAPSFNAETAEKPSKLNERLRQESEMDTSFIGLSGGQIFHEMMIR
                     HNVDTVFGYPGGAILPVYDAIHDSKAFNFVLPRHEQGAGHMAEGYARASGKPGVVLVT
                     SGPGATNVVTPMADALADGVAMVVFTGQVATSAIGTDAFQEADVVGISRSCTKWNVMV
                     KTVEELPLRINEAFEIATSGRPGPVLVDLPKDVTAAILRNPIPTKSTLPSTALAQLMK
                     RAQDDFTNDNIKKAADLINIAKKPVLYVGGGILNNVDGPRLLKELSDRAQIPVTTTLQ
                     GLGTYNQEDPKSLDMLGMHGCATANFAIQNADLIIAVGARFDDRVTCCIPKFAPEARR
                     AALEKRGGIIHFEISPKNINKIIDTQVSVEGDAAANLEKLLPSVFPVKERPQWLGQIK
                     KWKEEYPYAYMKETPGSKIKPQTVISRLSEIANASGRPVIVTTGVGQHQMWAAQHWTW
                     KTPRTFITSGGLGTMGFGLPAAIGAQVAKPDAMVIDIDGDASFSMTLMELASAVQAGT
                     PIKILLLNNEEQGMVTQWQSLFYQHRYSHTHQLNPDFVKLAEAMGLKGMRLSNQKDID
                     STLKEFVDCKGPVLLEVEVEPKVPVLPMVPAGKGLDEFINFDPDMEREQNELRFKRTG
                     GKH"
     gene            complement(<598276..>599181)
                     /locus_tag="HG535_0D03030"
                     /db_xref="GeneID:59236319"
     mRNA            complement(<598276..>599181)
                     /locus_tag="HG535_0D03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288428.1"
                     /db_xref="GeneID:59236319"
     CDS             complement(598276..599181)
                     /locus_tag="HG535_0D03030"
                     /inference="similar to AA sequence:RefSeq:NP_012794.1"
                     /note="similar to Saccharomyces cerevisiae PMU1 (YKL128C);
                     ancestral locus Anc_2.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144323.1"
                     /db_xref="GeneID:59236319"
                     /translation="MTYEDLPCYFEALPGYFKAFEEKDSLGIDSTIQDPTEFASHTSW
                     EDLYHSIPSDTEKYHYKLLILARHGQGYHNAALARYGLAQWEGHWSMLEGDEYGSWVD
                     SRLTPVGKKQVQATGEELFSPIVKSLGSFPHIFFSSPMRRCLETFVGSWTPNLAEHKE
                     LARDAVIPVNIIEELRETLGEHYCDKRVPHSELIEEYQDFKTTSGHTIQWIFEANYPE
                     HDTLWLPNVRESVGDMDQRVCKGLLKMFNHVQPHQKIVSLTCHSGVIHSTLRNLRHPR
                     VNFLNTGGIVCAVVQLDIDKINTFK"
     gene            complement(<599407..>599784)
                     /locus_tag="HG535_0D03040"
                     /db_xref="GeneID:59236320"
     mRNA            complement(<599407..>599784)
                     /locus_tag="HG535_0D03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288429.1"
                     /db_xref="GeneID:59236320"
     CDS             complement(599407..599784)
                     /locus_tag="HG535_0D03040"
                     /inference="similar to AA sequence:RefSeq:NP_013825.1"
                     /note="similar to Saccharomyces cerevisiae SPG4 (YMR107W);
                     ancestral locus Anc_2.443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144324.1"
                     /db_xref="GeneID:59236320"
                     /translation="MGFWDSFQVYNKDKHSDPRMFGGNHSNIGEQKTTYLYSHEYYEP
                     RTHKKMVENQELVMDGDKLVNARKSSVSSDSSEASGIGGDKIMGSENANTNLVDISQL
                     SPNEFKRLYDSMRKGEPDNRVNR"
     gene            602505..602577
                     /locus_tag="HG535_0Dtrna9K"
                     /db_xref="GeneID:59236666"
     tRNA            602505..602577
                     /locus_tag="HG535_0Dtrna9K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59236666"
     gene            <602718..>604568
                     /locus_tag="HG535_0D03050"
                     /db_xref="GeneID:59236321"
     mRNA            <602718..>604568
                     /locus_tag="HG535_0D03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288430.1"
                     /db_xref="GeneID:59236321"
     CDS             602718..604568
                     /locus_tag="HG535_0D03050"
                     /inference="similar to AA sequence:RefSeq:NP_013824.1"
                     /note="similar to Saccharomyces cerevisiae YKU80
                     (YMR106C); ancestral locus Anc_2.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144325.1"
                     /db_xref="GeneID:59236321"
                     /translation="MSAESTSFIIDASRSMVQDGNVAKAMAYLEYALLEKVKRQRKTD
                     WISCYLSNCHNTKNSQDIPGIYQVQSFVAPISTEQTLNILREVNSYSQDLVNDEVKKE
                     IPDNELQCMIQCLLVASLDLKSQFNKRKLLRQIVIFTDDLNGLDLTPNEIVVLQEELN
                     LRLILVDCCKETSSEDIFGSKWGLLIKAIPGSKVYRINELLIDITSLKFPIIKPVRVF
                     SGELRLGSDPIGLIRNNFDPSADFKCLSIQVEGYPATKHVPSLNRKTVLKKEESGEVE
                     YEPVKSIVEYETLGYDTDKRISISQESVAKAFRYGSDYVVLPSILDEKRFLNTLPGLD
                     VRGFLDRKKMQNYYLTSESRFILADTKSGGIADVTMFNALVDAMLEYDKIAIARFVAK
                     RQTEVQMCILCPLLVDSGVVVPNQVNGENFQRTFILSRLPFAEDERVSDFPRLINRTT
                     TSGKAISQGKDSEQIDALMSQYVDSLDLDAQKYETVPDTKYYSMLNPIAKETSLPLPD
                     DFEGESTNDPSRIPAIHIRRQQQVLLEYIHQKLINRSSEFQIPELPDMLRDIITPHFD
                     SHSAKEQTELVKLLAIKKVEKESKRPDEVYESDDEDNIPSFEEIMAKGAR"
     gene            complement(<605017..>607131)
                     /locus_tag="HG535_0D03060"
                     /db_xref="GeneID:59236322"
     mRNA            complement(<605017..>607131)
                     /locus_tag="HG535_0D03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288431.1"
                     /db_xref="GeneID:59236322"
     CDS             complement(605017..607131)
                     /locus_tag="HG535_0D03060"
                     /inference="similar to AA sequence:RefSeq:NP_012796.1"
                     /note="similar to Saccharomyces cerevisiae YPK1 (YKL126W)
                     and YPK2 (YMR104C); ancestral locus Anc_2.446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144326.1"
                     /db_xref="GeneID:59236322"
                     /translation="MYYWKISKFKFGKSKEDKENEKEKDKKEEAKGSGSSGFFHSNHE
                     RSTSSDSSTFLDNSMDRHSMDRKETMVPSSASIAPVRLSHDASSTASAVREDVASGVS
                     DGPSSDTSRVNHDIPTSSTKHDESVISSSSFHPHNTNTSAGIMTIKVYNGDNFGLPFP
                     ITSNEPILSKLLSSGADAQRTNSLEIDSLTSQLSRIQLQKQGPADDILLPGDQSTKFI
                     PSTIMLPGSTALNPLLYFTIEFDNTVATIEPERGTMAQPVFNKISTFDVTRKMPYLKI
                     DVFARIPSILLPSKTWQQEMCAADEKMNAMLQKINSNQDIHLDSFHLPVNLQFDSAAT
                     IRLFNHHWVELENGYGRINISVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKD
                     TQKIYALKAIRKTYIVSKSEVTHTLAERTVLARVECPFIVPLKFSFQSPEKLYLVLAF
                     INGGELFYHLQKEGRFDLSRARFYTAELLCALETLHDLDVIYRDLKPENILLDYQGHI
                     ALCDFGLCKLNMKDKDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGL
                     PPYYDEDVPKMYKKILQEPLRFPDGFDRDAKDLLIGLLSRDPKRRLGYAGAEEIKHHP
                     FFSQMSWKRLLMKGYIPPYKPPVTSAMDTSNFDQEFTKEKPIDSVVDEFLSESVQKQF
                     GGWTYVGSEQLGSSMPQGRSIR"
     gene            complement(<607401..>609119)
                     /locus_tag="HG535_0D03070"
                     /db_xref="GeneID:59236323"
     mRNA            complement(<607401..>609119)
                     /locus_tag="HG535_0D03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288432.1"
                     /db_xref="GeneID:59236323"
     CDS             complement(607401..609119)
                     /locus_tag="HG535_0D03070"
                     /inference="similar to AA sequence:RefSeq:NP_012795.1"
                     /note="similar to Saccharomyces cerevisiae PGM1 (YKL127W)
                     and PGM2 (YMR105C); ancestral locus Anc_2.445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144327.1"
                     /db_xref="GeneID:59236323"
                     /translation="MSSAVDTIETKPYQDQRPGTSGLRKKTKIFEKEPHYTENFIQSI
                     IEAIPEGAKGALLVVGGDGRYYNDVILNKIGAIAAANGVSKLVIGHKGLLSTPAASHI
                     IRTYKDDNGKKVTGGIILTASHNPGGPENDLGIKYNLSNGGPAPESVTNAIWEVSKKL
                     TSYKIVRDFPKIDLETIGERKYGPLSIDIIDTTTAYVELLREIFDFDLIKKFVMNQRK
                     TKNWKLLFDALNGVTGPYGKAIFVEELGLPEAEVLQNCHPKPDFGGIHPDPNLTYART
                     LVDRVDKEQIEFGAASDGDGDRNMIYGCGPAFVSPGDSVAIIAEYAPEIPYFAKQGIY
                     GLARSFPTASAIDRVAAANGLNCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHVR
                     EKDGVWAIVAWLNILAIYNKHHPENEASIKTIQDEFWLKYGRVFFTRYDFEHVTNEKA
                     DEIVKHLNKFVTTSNVKNSKFPTDPSLVVVDAGDFEYTDLDGSVSSNQGLYVKFSNGA
                     RFVLRLSGTGSSGATIRLYIEKYSDDKSTYHLTAEEYLMPIIKAVTKFLNFQEILGTT
                     EPTVKT"
     gene            <610476..>612465
                     /locus_tag="HG535_0D03080"
                     /db_xref="GeneID:59236324"
     mRNA            join(<610476..610679,610771..>612465)
                     /locus_tag="HG535_0D03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288433.1"
                     /db_xref="GeneID:59236324"
     CDS             join(610476..610679,610771..612465)
                     /locus_tag="HG535_0D03080"
                     /inference="similar to AA sequence:RefSeq:NP_012797.1"
                     /note="similar to Saccharomyces cerevisiae RRN3 (YKL125W);
                     ancestral locus Anc_2.447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144328.1"
                     /db_xref="GeneID:59236324"
                     /translation="MMMAFENIGKRPAQDLAANRIEQPKKRKVEFSDEITSHPAPQDM
                     NENGAFSMEIFRRFVKSGLDEMEKNESTHIDQIAQQIALPSNNTNRISAEHFGVLLDV
                     LSNNINKIDSGRGAILIQAIINFEKWWELPSPTLSKYIFFIRILCSSIPKWWQDVSMI
                     LISGFHLPLEKTACHHEMLKFFLRMIPSSMGFIDLYMIRFFPNNNDTRKKLINYISNV
                     LQLTTYCKELQFQAWSLLMERAISLDVALQNELDELDDDIEDNLSESSDNDNESDSDD
                     APAAAAADDDDDDDDEDNENGEKSDEPEDEQENEILSGDEYDEGEEEYNVQASMNIKE
                     LSCKLDSILTLISTRLGERLTPESLESGEGVSIFNTLSTLFKTHVLPTYYTRSIQYIM
                     FHMSQQQVELMDSFLVTLIDISFSPNETYEKKIKSLQYLGSFIARAKKLSRTQIIFVA
                     SYLTSWLNRYVIEREDEVEQSGGMDRFKHFYAAFQALCYIFCFRYSLFRDADGNWECE
                     LEKFFPRMVLSKFNPLKYCNENVMLMFSRISQHEDVAYCFSIIENNNNERLRGIIGRG
                     DKNKKNSVASAAASTWSLATRQQFIDLQSYFPFDPLFLKQFKSMMKEYYIEWSEAGGE
                     YESDELDE"
     gene            <612655..>614400
                     /locus_tag="HG535_0D03090"
                     /db_xref="GeneID:59236325"
     mRNA            <612655..>614400
                     /locus_tag="HG535_0D03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288434.1"
                     /db_xref="GeneID:59236325"
     CDS             612655..614400
                     /locus_tag="HG535_0D03090"
                     /inference="similar to AA sequence:RefSeq:NP_012798.1"
                     /note="similar to Saccharomyces cerevisiae SSH4 (YKL124W);
                     ancestral locus Anc_2.448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144329.1"
                     /db_xref="GeneID:59236325"
                     /translation="MGLIGTKSDFFIFITPLRVSQTSGCIMYNTDTDTIKDIAYSPSN
                     VKLFDELFTPPTMDDSDTISLAFLISLSVTFAVLMVVLIVVAIYVTFCGADESEYDEE
                     AGLGRNTGGGIHGFFQKKKGGILLDSSFASPGQFDDDAIFQEQEAAQVSKMSAFELDL
                     YYRAKEFQRINPPNVKEFGTFLNESDIQFIKDRGIQSYFLLPSINDNTDQDGNFLPSF
                     LIQDKLDISFTKYNKSSSTIMNYPLPFNKKDAVYFEVKVFKHSGSSNAVFSIGLMTFP
                     YPYFRIPGMSLYSIAYESTGKLRINNPFMASTLLPKLQEGDVVGFGYRFRTGTVFITH
                     NGKKLMDVTQNVGIDLFIGIGSLNAAYTRTYTKDGLLEDPDNVELRELLSEGRDIDLP
                     GDLQTVHDPTSSYEIESDEVELHVNLGQVGFVFIEANVKKYAFGSLYGEIGIPPSYNG
                     TEITKDTILQKGEDIPPKYHDEAQSDTFFGNITINNGSNLSAVASGSRLSSATKNQGL
                     PSISEETEEDNERYERFSSAYDREHNFSNDDLPNNSSTANDENGQDMQENQLNADTGS
                     KRSKKKKKRKKRSKK"
     gene            complement(<614560..>615066)
                     /locus_tag="HG535_0D03100"
                     /db_xref="GeneID:59236326"
     mRNA            complement(<614560..>615066)
                     /locus_tag="HG535_0D03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288435.1"
                     /db_xref="GeneID:59236326"
     CDS             complement(614560..615066)
                     /locus_tag="HG535_0D03100"
                     /inference="similar to AA sequence:RefSeq:NP_012800.1"
                     /note="similar to Saccharomyces cerevisiae SRP21
                     (YKL122C); ancestral locus Anc_2.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144330.1"
                     /db_xref="GeneID:59236326"
                     /translation="MSVKPIDTFITNSVKLFEVNPSQTTFTILYQHRARKYTGEKPNN
                     IPQVSFKTHNGSLSTNYKFTTRKSKDVSRLLSALGPKGVTIAVSKVDKKIRKSTKAND
                     QQIKKKRDNVKQFKSNDIAGISTLLVNTDVKEYVPVQEASSQQTDGKQGSSSKKKKQN
                     KNKNKKKR"
     gene            <615424..>618078
                     /locus_tag="HG535_0D03110"
                     /db_xref="GeneID:59236327"
     mRNA            <615424..>618078
                     /locus_tag="HG535_0D03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288436.1"
                     /db_xref="GeneID:59236327"
     CDS             615424..618078
                     /locus_tag="HG535_0D03110"
                     /inference="similar to AA sequence:RefSeq:NP_012801.1"
                     /note="similar to Saccharomyces cerevisiae YKL121W and
                     YMR102C; ancestral locus Anc_2.450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144331.1"
                     /db_xref="GeneID:59236327"
                     /translation="MDLFRTRSITHESQKKQAAQSKREENGGKGIEKNGNSESVVTPA
                     TDDSTVLSVPIKSNDVDSASNVEYSADIRPLTFNVSRSMLTKEAGPTADAHFRNSLSK
                     VKEKLSKNHKTYNKPDAMIKSLFGSIDREQFEDYLREPHYIKMLKRGKNLKQFRRLFL
                     AQEIVVNDSSFGENSPRVPSLNSEAAPNAIWVTRFSQDGNYMASGGKDGVLRLWKVIA
                     SPLERWHLDFTEENIQALKNKAIVLKQQASPGSAAAPLPNCTGKDTHKNGHSFKTGIS
                     NLYAPVFHPTPFSVFKHHTADILDINWSKNNFIVTASMDKSVCLWHPERDRPLKSFMH
                     PDFVTCVAFHPTDDRFLITGCLDHKCRLWSILDDEVSFEFDCQDLITSIAVSKNDAAY
                     TFVGTFNGYVYILATKGLDYIKSFHVTDKETQEGSFSGNANIKMHHGPRVICLESYRD
                     AVDKSLRLLVTSNDSRIRVFDAKTKKCLEIMKGFQSGSSQTNSQLTMMGNKAIVTCGS
                     EDHWVYAWKIRAQAKSSHVQEKENDQSIKKTGLRGIFSHHKDNDNKHSKNEQHQQRRH
                     SISHNPLHLKSFFQHASGGSNDQIIKNNYSISFHAHHAPVTTVNIAPPVTTKLLSLSN
                     DLICELSLQFYLESDNLDIVTDRAEEKSLDNESDSASVSTSSSNPSISNHSSLLDLYK
                     TEENAKSHEQALPNVVDAIGTIMVTTDSMGVIRVFRADLPVNIRKRVLEKLEEYRMSE
                     TNGRKYASSDSLNTLGQGSIYSANVASGTGNAQCKNNTGVVEDAFCAGVGASKRIRAS
                     SVFKNSLFNHSNASLSSLRTNRGSASSYAPEEDTVKKSPLHGAGDTRLRCDVCNGTKF
                     GTTPMSTQTSRDAGNYCLDCGTMLNNFR"
     gene            <618644..>619612
                     /locus_tag="HG535_0D03120"
                     /db_xref="GeneID:59236328"
     mRNA            <618644..>619612
                     /locus_tag="HG535_0D03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288437.1"
                     /db_xref="GeneID:59236328"
     CDS             618644..619612
                     /locus_tag="HG535_0D03120"
                     /inference="similar to AA sequence:RefSeq:NP_012802.1"
                     /note="similar to Saccharomyces cerevisiae OAC1 (YKL120W);
                     ancestral locus Anc_2.451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144332.1"
                     /db_xref="GeneID:59236328"
                     /translation="MSKEKDDKLNQKTAAQKVTKFGSFVAGGLAACIAVTVTNPIELV
                     KTRMQLQGELSASAQRIYKNPLQGMAVIFRNEGIKGLQKGLVAAYIYQICLNGSRLGF
                     YEPIRGVLNSTFYPDQESHKVQSVAINVISGASSGIIGAVLGSPLFLVKTRLQSYSES
                     IKIGEQTHYRGVYDGLKTIFQKEGFVGLYRGIDAAILRTGAGSSVQLPIYNTAKRILL
                     KNDIMEEGTGLHLVASTISGIGVGIVMNPWDVILTRIYNQKGDLYKGPVDCFIKTVRI
                     EGVTALYKGFEAQLFRIAPHTIMCLTFMEQTMKLVYSVENKIFGYD"
     gene            <619900..>620955
                     /locus_tag="HG535_0D03130"
                     /db_xref="GeneID:59236329"
     mRNA            <619900..>620955
                     /locus_tag="HG535_0D03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288438.1"
                     /db_xref="GeneID:59236329"
     CDS             619900..620955
                     /locus_tag="HG535_0D03130"
                     /inference="similar to AA sequence:RefSeq:NP_013819.1"
                     /note="similar to Saccharomyces cerevisiae SRT1 (YMR101C);
                     ancestral locus Anc_2.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144333.1"
                     /db_xref="GeneID:59236329"
                     /translation="MKLPNVFRSRFVDYATRRNKSTKLNAITNYLVEKSKLYIVWLQE
                     LKISIKLYQKLQNICIAVLSTGPVPEHVSFIMDGNRRYAKKSGLVVKKGHEAGGLTLL
                     SLCYACKKIGVSCVSAYAFSIENFNRSPQEVDILMTLFGSKLDEFAKRAVNFQDPLYG
                     SRLRIVGDISLVSKDLKTKIENAEEVTKDGKDFTLYICFPYTSRNDIFHAMCDLIAKC
                     QNQTLESKNLTIPLLTEDMYLDNFSNKCDLLIRTSGHMRLSDYMLWQVHENADIVFTS
                     TLWPDFDFTKLYVMILKWSFFTTLQRYSERGVTLKDRILFNTPFINRSRPIGPSSVYD
                     SLPKPPIAMSITGETDS"
     gene            complement(<620959..>621606)
                     /locus_tag="HG535_0D03140"
                     /db_xref="GeneID:59236330"
     mRNA            complement(<620959..>621606)
                     /locus_tag="HG535_0D03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288439.1"
                     /db_xref="GeneID:59236330"
     CDS             complement(620959..621606)
                     /locus_tag="HG535_0D03140"
                     /inference="similar to AA sequence:RefSeq:NP_012803.1"
                     /note="similar to Saccharomyces cerevisiae VPH2 (YKL119C);
                     ancestral locus Anc_2.453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144334.1"
                     /db_xref="GeneID:59236330"
                     /translation="MFEIELNSNIKSHLLKLEKDESCSNRHQEIQSFLKKESIPMDAL
                     LDYYNNFWKTDISLKQLMMPLNFHFAPRYTPGLKYTPEFKEHLEKLRVQQQEIDYQNL
                     IRKKDLNSQLTATNNAEEEITFATLNKAIREQVTTVFNVLVSVASVVVAVWYWTGSST
                     EFALHYRVIACLFFGVLVLIADVVVYNSYLNKVKDAKTRERNKKETKRIVKKIII"
     gene            complement(<621851..>623833)
                     /locus_tag="HG535_0D03150"
                     /db_xref="GeneID:59236331"
     mRNA            complement(<621851..>623833)
                     /locus_tag="HG535_0D03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288440.1"
                     /db_xref="GeneID:59236331"
     CDS             complement(621851..623833)
                     /locus_tag="HG535_0D03150"
                     /inference="similar to AA sequence:RefSeq:NP_013818.1"
                     /note="similar to Saccharomyces cerevisiae MUB1 (YMR100W);
                     ancestral locus Anc_2.454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144335.1"
                     /db_xref="GeneID:59236331"
                     /translation="MRDSNHRSVLGNRPVVTITPTVYDRRALDVDSNIPLINSLNHLT
                     YLTSNSEKVRETLASDGALERLVSILHGCYIPLFQLLGHDLKHVSKHKHAEMIWRQKN
                     LAMCAWKWTLAFQCLVLTGTRGTEQIRKKVVSSGVVPLLATELDNYLIYHKNYDHFTG
                     AQLDIDLPSLETEESYLKLRKDSSETYEEYIEYITGREPLRLSNDKDFVYEELSRPSM
                     TLPSDFVDIWCSDSKCHHKNAGNSRDDAIHSCKHHNDSEETLADKEPNEDCYFQLDEE
                     DDHQLSITIPRDFFLGRIVPKQDDVIWSLQLLAFISKYTYMKQQLQNVELIETLSFRA
                     ILGRVKERIKLTRNPIETLKLPLAKDTDMLDAYPIGTEKRPEIDPFLVELQKLVDECR
                     DTQTKSDSNAMFGNQRSYGFRDTSNFTVTDKSRVLQEKHLVRDFEEKWNYDNLSIDLD
                     DDTWTYINSKRHLNLFPLVERCTVSHENPHDMVYWSSVIMRNSCRKNEITGVRQCANF
                     DCGKWEDYPRQFAKCRRCKRTKYCSRECQLKAWTYHRFWCHEGGSSVESSGGNTGETT
                     PGTAQNSDTSTTATRTIHGNIPLADTLVSAANDHEPNATIIENTSVTISAEDSGAEAN
                     ITTAATLERVAAPTEPLDIIQNRNVIDHSHHLSENR"
     gene            624743..624815
                     /locus_tag="HG535_0Dtrna6A"
                     /db_xref="GeneID:59236660"
     tRNA            624743..624815
                     /locus_tag="HG535_0Dtrna6A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:59236660"
     gene            <625217..>625804
                     /locus_tag="HG535_0D03160"
                     /db_xref="GeneID:59236332"
     mRNA            <625217..>625804
                     /locus_tag="HG535_0D03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288441.1"
                     /db_xref="GeneID:59236332"
     CDS             625217..625804
                     /locus_tag="HG535_0D03160"
                     /inference="similar to AA sequence:RefSeq:NP_012805.1"
                     /note="similar to Saccharomyces cerevisiae SBA1 (YKL117W);
                     ancestral locus Anc_2.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144336.1"
                     /db_xref="GeneID:59236332"
                     /translation="MSQPKVLTPEVLWAQRSSESIPEENYLLVTIAVPDCEEPEVKVS
                     EKTLDFSAVSKGHVGDEQPHHYKLKINFYKDVDSSKTLKKIANGQHYFLKIFKKDLGI
                     EYWPRLTEEKVKYSYIKTDFNKWVDEDEQNSVPEAAAAAGPDFNEMLMNGNPDMEMLK
                     QQLAQGGGGMPDLSAAGLGEELGDYENEEEEEEEK"
     gene            complement(<625905..>626888)
                     /locus_tag="HG535_0D03170"
                     /db_xref="GeneID:59236333"
     mRNA            complement(<625905..>626888)
                     /locus_tag="HG535_0D03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288442.1"
                     /db_xref="GeneID:59236333"
     CDS             complement(625905..626888)
                     /locus_tag="HG535_0D03170"
                     /inference="similar to AA sequence:RefSeq:NP_013817.1"
                     /note="similar to Saccharomyces cerevisiae YMR099C;
                     ancestral locus Anc_2.456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144337.1"
                     /db_xref="GeneID:59236333"
                     /translation="MARHKKTENYNKHETRYFKERNLQGNQIKMSVQSNESEVILTHP
                     DDSSCSTTILKYGATVISWKLKGDEQLWLSSGAKLDGSKPVRGGIPLVFPVFGKNASD
                     ELLSKLPQHGLARNSTWEFLGQTKSNPPTVQFALYPEIANQEMTALWPVDFSLILTVE
                     LGLEHLKTSIEVNNPSKTDSLKFNWLFHSYFRIEDVEGAFVSNLVGMKVYDQLLKETY
                     VDKHPVITIHEEKDLIYQNVDDDRIIQIVNKGVALHTIKRINLPDAVVWNPWIEKSKS
                     MGDFEPKSGYQHMICVEPGHVHDFITLEPGQSWKAAQLLDKTSIAFQRVEL"
     gene            complement(<627055..>628545)
                     /locus_tag="HG535_0D03180"
                     /db_xref="GeneID:59236334"
     mRNA            complement(<627055..>628545)
                     /locus_tag="HG535_0D03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288443.1"
                     /db_xref="GeneID:59236334"
     CDS             complement(627055..628545)
                     /locus_tag="HG535_0D03180"
                     /inference="similar to AA sequence:RefSeq:NP_012806.1"
                     /note="similar to Saccharomyces cerevisiae PRR1 (YKL116C);
                     ancestral locus Anc_2.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144338.1"
                     /db_xref="GeneID:59236334"
                     /translation="MTNRQDEFPPAPKLKQNEFANDDTINRSQVVDEAIAFGDRTPLA
                     LVIPKFDSVNMLPTPMTYTPPSSQQRSPLGHSLNVPKRRGEVNLLQRFENGSQLRVVS
                     ELPPFADPLQKRISSLPTVSETSSTADVERAAPSFNDTESDDDILTGYLLDDLTTPLK
                     WRRVEEIGSGNFSTVYLYHSLRPVDYKFKQVCVKRIKFPKELLDENVRGQILYTDLLS
                     RLESSLTRELAILKSLNHPCIVKLYGVNNPILIESKKPLRNLMLKNKQLPRCDMIMSY
                     CPGGDLLMAAASCNGNLELWLIQRIFAELVIAVQYLHENFVIHRDLKLENVLLKYSLN
                     EIYNMKDSIDFTHKNIIELADFGLCKKIEAGELCTARCGSEDYVSPEILMGVPYDGRL
                     SDTWALGVILYGLLEDRLPFDAPPNSSSRQRNRATSHRIARYDWKWVRLASEDLKAKE
                     IVENTLTRKSHRWDINKIFLSAFVKDTAISLIFQHRNVQQKKKEIE"
     gene            complement(<628822..>629901)
                     /locus_tag="HG535_0D03190"
                     /db_xref="GeneID:59236335"
     mRNA            complement(<628822..>629901)
                     /locus_tag="HG535_0D03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288444.1"
                     /db_xref="GeneID:59236335"
     CDS             complement(628822..629901)
                     /locus_tag="HG535_0D03190"
                     /inference="similar to AA sequence:RefSeq:NP_012808.1"
                     /note="similar to Saccharomyces cerevisiae APN1 (YKL114C);
                     ancestral locus Anc_2.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144339.1"
                     /db_xref="GeneID:59236335"
                     /translation="MSTFVRSTTSKYKFGAHISAAGGISKSILNAFNIGCNAFAMFLK
                     SPRKWVSPQYTTEEIEKFKLHCKEYGYDPLTDILPHGQYFINLANPDIEKAEKAYDSL
                     LDDLHRCEQLGVGLYNLHPGSSLNADHNEQIKQLAKYLNKALKETKFVKIVLENMAGT
                     GSLIGSELQDIRNVIDLIEEKDRVGVCIDTCHTYAAGYDISTKDSFDKFWNDFDEIIG
                     FKYLSAIHLNDSKAPLGANRDLHELLGEGFLGLEVFRLISHCDKLVNLPIILETPQKK
                     DEGYGEEIKLLEWIETRDEDDKEVQEKNTALQAKGEKARKEQLSKFEAKKKKSTNSKR
                     KLSAKPENSIQDQLKQHKRLKAKKE"
     gene            complement(<630139..>631284)
                     /locus_tag="HG535_0D03200"
                     /db_xref="GeneID:59236336"
     mRNA            complement(<630139..>631284)
                     /locus_tag="HG535_0D03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288445.1"
                     /db_xref="GeneID:59236336"
     CDS             complement(630139..631284)
                     /locus_tag="HG535_0D03200"
                     /inference="similar to AA sequence:RefSeq:NP_012809.1"
                     /note="similar to Saccharomyces cerevisiae RAD27
                     (YKL113C); ancestral locus Anc_2.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144340.1"
                     /db_xref="GeneID:59236336"
                     /translation="MGIKGLNAIISEHVPTAIRKSDIKAFFGRKVAIDASMSLYQFLI
                     AVRQQDGGQLTTETGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPTLKSHELDKRT
                     SRRAETEKKLAEAIDQVEKMKQERRLVKVSKEHNEEAKHLLELMGIPYVNAPTEAEAQ
                     CAELAKKGVVYAAASEDMDTLCYRTPYLLRHLTFSEAKKEPIHEIDTELVLKGLDLTI
                     EQFIDLCIMLGCDYCESIKGVGPVTALKLIKEHGSLEKIADFFESGEANAKWKIPENW
                     PYKEVRELFADPEVIDGKDVNLKWTQPKEDELIEFLCVQKRFSEERVKAGIKRLHKGL
                     KSGTQGRLDGFFQMVPKTKEQLDAAAAKAKLAKKNAKTKGKVGKRGN"
     gene            <632117..>633721
                     /locus_tag="HG535_0D03210"
                     /db_xref="GeneID:59236337"
     mRNA            <632117..>633721
                     /locus_tag="HG535_0D03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288446.1"
                     /db_xref="GeneID:59236337"
     CDS             632117..633721
                     /locus_tag="HG535_0D03210"
                     /inference="similar to AA sequence:RefSeq:NP_012810.1"
                     /note="similar to Saccharomyces cerevisiae ABF1 (YKL112W);
                     ancestral locus Anc_2.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144341.1"
                     /db_xref="GeneID:59236337"
                     /translation="MTSLYEYKHPIINKQLASGTDDQSGRKFPSLEAWYDVVNDYEFQ
                     ARCPIILKNSHRNKHFTFACHLKDCPFKVLLSYCGNQSGNIQDDLEGGVQHEHSHHGD
                     SLVSMDQKAKLPGQEQDGKIKGNDGEGSHQVDNGDHNHNGHGDNVGPDTRKYTDADAE
                     DDDVSAAIAAAVAAVQDVRGKEEGQFGEEYMSAPALHGAAAGGQSTEAVVRGPFIVTK
                     IEPYHNHPLESNLSLSKFVLTKVPRILQHDLNFDQILESLCNEEDNTVSKFRVSQYVE
                     ESGLLDILKERYGLTDADIDKKLLSHISRRVTTYKARFVLKKKKNGDYGTVSQNTGNG
                     NASGASHYGQRSGRGASMNSRSTGDQGEHHLHQMNHHHHQLQQAIQRAVDDHENAGSH
                     GHLQSLEDSNLNPELNDDAEAQAAAQAAMGEAAALKRSVQEMVDQEETDDENARKRQM
                     MKLTASMHSNLVNDDGSLVSLDDTQDDKLPRDVAEQLRLLSSHFKEVEAHNMGNQSGG
                     DGEDESKLIVKDEIPDENIQPELRGQ"
     gene            <633988..>635817
                     /locus_tag="HG535_0D03220"
                     /db_xref="GeneID:59236338"
     mRNA            <633988..>635817
                     /locus_tag="HG535_0D03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288447.1"
                     /db_xref="GeneID:59236338"
     CDS             633988..635817
                     /locus_tag="HG535_0D03220"
                     /inference="similar to AA sequence:RefSeq:NP_013816.1"
                     /note="similar to Saccharomyces cerevisiae YMR098C;
                     ancestral locus Anc_2.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144342.1"
                     /db_xref="GeneID:59236338"
                     /translation="MLTPRVRLLLIRRLITVGPIVTPLRHTITRKYSTNGTKLLEDEA
                     LKDNGAKNEKGPATSNSPVDTKPWYLSMVDRDISQNLSAVENEYINLPDESPESLLKI
                     TKYLKGEMGLKDILIFDLKEKKSGDYNTAVTKISDFVIIATARSAKHCQSTFVQLNAM
                     LKQTFKSVAYVEGNVNSKEERKKFKRMARKSNLGKSWGANSGTTSTGFAKDSEAWFMI
                     DCNVDKIFVNILTERRRGELNLEELYAPESERDKYQLRQKSTATQPKDDNLLQVGEEN
                     NVLSGLRRLAYQRRQYSTSSPINTEPTKEHFKDFLKKALNEKNFEEAHSIIKQSQELE
                     SLSLLQTITDSLANVNVTTDAINEIDKWQDIFEYCWPLPLPMETSFQYWSLRMKFLKM
                     LNVANPQLYPCSKIIDDYLIRKKTSGFYLSSDDLLQYLQLVKINLNLIQGGNYWDLLK
                     SNENIVKALKVFNELNLANDHIIVSMLLKLMVMENNTSIKLHSLYEVIDFLCCQRDNL
                     SSNVIVAVLETLASVKDWNKFFQFWEVGIKGVVPGQDYRPWSKFIRIILNSNDIELMQ
                     KLIEEGHLLWIKRNEVEITNDLIEQLRKLFRRTDYDLKSYLDI"
     gene            complement(<635814..>636752)
                     /locus_tag="HG535_0D03230"
                     /db_xref="GeneID:59236339"
     mRNA            complement(<635814..>636752)
                     /locus_tag="HG535_0D03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288448.1"
                     /db_xref="GeneID:59236339"
     CDS             complement(635814..636752)
                     /locus_tag="HG535_0D03230"
                     /inference="similar to AA sequence:RefSeq:NP_012812.1"
                     /note="similar to Saccharomyces cerevisiae KTI12
                     (YKL110C); ancestral locus Anc_2.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144343.1"
                     /db_xref="GeneID:59236339"
                     /translation="MPLILLTGYPCTGKTTVARELVALLQKRLESDPQLAKKNYNIIY
                     HSDKSLGIKHSDYISSKNERKLRSEIISAVKRDLTKTNIVIVDSLNYIKGFRYQLHCE
                     VKNVSTTYCLIQTMCPVDQILEWNQQRGEPEDVWDRELLDQLIQRYEEPNAQTRWDSP
                     LFPVLTTQDSISDFIDDITVAVFNRAANSRDSLSKALQKPNSATILKPASQTNFIQKL
                     DSETTLVVKKIMNHIKTLQSIGNSNCSARVIVSEGVTDINDDNCFYVDLPTISISLPH
                     LQRLKRQFVTLNKLRDMDEKRIVPLFADYLSKNLND"
     gene            <636935..>637996
                     /locus_tag="HG535_0D03240"
                     /db_xref="GeneID:59236340"
     mRNA            <636935..>637996
                     /locus_tag="HG535_0D03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288449.1"
                     /db_xref="GeneID:59236340"
     CDS             636935..637996
                     /locus_tag="HG535_0D03240"
                     /inference="similar to AA sequence:RefSeq:NP_013815.1"
                     /note="similar to Saccharomyces cerevisiae MTG1 (YMR097C);
                     ancestral locus Anc_2.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144344.1"
                     /db_xref="GeneID:59236340"
                     /translation="MFMPRYVFPTYNIAKQDFKGHQLKALRKLDSLKPQIQLICEIRD
                     IRAPLSTRNVLIDKIIDKRFHEKLVIYTRKDLMTHNPEYLQKLSAWHEQIGENYIMIN
                     SKRAPDVANVLKTLQWYKKKYHDNLDGIPPPMGYKVLVSGMPNVGKSTLINSLRYLGS
                     DANRGKKVARTGAEAGITRSTSELIRIGAAHDQLYLIDTPGIGLPGRLNVGNKMIVLS
                     LCGCIKQGVIDPIIEADYLLFLMNLQRGATERSSFLQWYPAIGERPSNDIYEVLERMR
                     KNRKSTLEDLARSWIQRTILSHDLIFDKELLLPADDFSFRDYVRNEVASSASFGMSTE
                     NTRRTTRQNDSSLFRKHIQ"
     gene            <638913..>640418
                     /locus_tag="HG535_0D03250"
                     /db_xref="GeneID:59236341"
     mRNA            <638913..>640418
                     /locus_tag="HG535_0D03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288450.1"
                     /db_xref="GeneID:59236341"
     CDS             638913..640418
                     /locus_tag="HG535_0D03250"
                     /inference="similar to AA sequence:RefSeq:NP_012813.1"
                     /note="similar to Saccharomyces cerevisiae HAP4 (YKL109W);
                     ancestral locus Anc_2.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144345.1"
                     /db_xref="GeneID:59236341"
                     /translation="MSVTKHLPIQPYPGIHSAVGSDAHDHAGSGNATAKECSKGLKIR
                     TSRHWVLPPRPKPGRKPNHSHDSSKKKKQAQSQTQSQVRTQAQTPVPEPVQAEKSNKG
                     LLKKEIISIKLENNKLKVELGQLVDNLQDLKQKYNLARQKSHDNDLIKEKAKQKPKDK
                     ARPKKTTNTSMSASAGTKANPKKREYLDDSTFAFLKFEDESDEMRTESESVGLSPILI
                     SNAKMNCTSSISSCKTILTDDEDILTVSSSTPNSLFSSDLQHSSSISSASSINVTAAS
                     TTNHQLNNRASPGKNTVAASNDLRFLDSYEQMHFYDKYMCAEPVAQPVLEAEHQHQQH
                     QPQQQQQSLHSIKEEDSDFPLMSLASNDNENVLSFLQQNNDSELPSFTSDPSKPCYNG
                     LFFNSKPSYETDDLFQNISVPQDTDDTLMTTTTATTATTATTSFYVPPSLEELMEEQD
                     GGTKFFSMINTTTTTATTIPANADDDDDALNLHNYDDDFDMLKVEVFDMVN"
     gene            complement(<640481..>641365)
                     /locus_tag="HG535_0D03260"
                     /db_xref="GeneID:59236342"
     mRNA            complement(<640481..>641365)
                     /locus_tag="HG535_0D03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288451.1"
                     /db_xref="GeneID:59236342"
     CDS             complement(640481..641365)
                     /locus_tag="HG535_0D03260"
                     /inference="similar to AA sequence:RefSeq:NP_013814.1"
                     /note="similar to Saccharomyces cerevisiae SNZ1 (YMR096W);
                     ancestral locus Anc_2.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144346.1"
                     /db_xref="GeneID:59236342"
                     /translation="MSELKIKSGLAQMLKGGVIMDVVNPEQAIIAEKAGACAVMALER
                     IPADMRKSGQVCRMSDPKMIKDIMASVSIPVMAKVRIGHFVEAQILQALEVDYIDESE
                     VLTPADWEHHIKKNEYNVPFVCGAKNLGEALRRIDEGAAMIRTKGEAGTGDVSEAVKH
                     ITKIKGEIAEYKKTLKTDEEIKAKAKELRVPTELLMQVLEQGKLPVVNFAAGGVATPA
                     DAALLMQLGCEGVFVGSGIFKSSNPEKLAKAIVEATTHYNDAAKLLQVSSDLGDLMGG
                     ISVESIKQSDKRLAEIGW"
     gene            <642002..>642634
                     /locus_tag="HG535_0D03270"
                     /db_xref="GeneID:59236343"
     mRNA            <642002..>642634
                     /locus_tag="HG535_0D03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288452.1"
                     /db_xref="GeneID:59236343"
     CDS             642002..642634
                     /locus_tag="HG535_0D03270"
                     /inference="similar to AA sequence:RefSeq:NP_013813.1"
                     /note="similar to Saccharomyces cerevisiae SNO1 (YMR095C);
                     ancestral locus Anc_2.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144347.1"
                     /db_xref="GeneID:59236343"
                     /translation="MGKCVGILALQGAFIEHIQHLEKCITENKYDLSVTTVKTPEELE
                     ICDALIIPGGESTSMSLIAQRTGMYPHLLKFVHDPSKAIWGTCAGLIYLSKELSNEKE
                     LVKPLNLLKVKVKRNAFGRQAQSFIKDCDFSSFIPDCTDFPTVFIRAPVIETILDPQE
                     VLPLYTLDNGLIVAATQGKNILATSFHPELAENDSRFHDWFIKKFVLKQL"
     gene            complement(<642621..>643907)
                     /locus_tag="HG535_0D03280"
                     /db_xref="GeneID:59236344"
     mRNA            complement(<642621..>643907)
                     /locus_tag="HG535_0D03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288453.1"
                     /db_xref="GeneID:59236344"
     CDS             complement(642621..643907)
                     /locus_tag="HG535_0D03280"
                     /inference="similar to AA sequence:RefSeq:NP_013812.1"
                     /note="similar to Saccharomyces cerevisiae CTF13
                     (YMR094W); ancestral locus Anc_2.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144348.1"
                     /db_xref="GeneID:59236344"
                     /translation="MDIRLFLQLPVDIRCLVYFQLDGEFTLAGPQCIEKLYAAETVQV
                     LTGLYKRTKYQKLIHKELYHWFSQYLDIFEYSPALIDKWLEYSLWLRYDGIVLDSLRL
                     NHVYGGELLGQIDCVELGNKLRLAYFKDSMIQLWYTYREYVRWIANIGTEMDIDYVRV
                     NLENYTSAKLDTLLHDLKQNEMLPFINCILLEDEKEDDLSMKYHQDLDEDSPYQLTDV
                     SVISIIKNMESMKNLIEIGVRGYHLYETLINMHGVRDNPGKTINYIVRSRIKKINLTQ
                     IPKLGLCDLTRWENLRELTLINVQEINLNMLVIPSKCQVLNVRKVNTLNWWLLLDAIE
                     ARIQENHFQKWKNDSPYGYTTLKRINNSSIDDLDKIEECKTLVFNALGSLNLIRIQDV
                     QQIKGNKIVVPSNLYDNKRILLHGTTMRTVKEIIVV"
     gene            <644083..>645201
                     /locus_tag="HG535_0D03290"
                     /db_xref="GeneID:59236345"
     mRNA            <644083..>645201
                     /locus_tag="HG535_0D03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288454.1"
                     /db_xref="GeneID:59236345"
     CDS             644083..645201
                     /locus_tag="HG535_0D03290"
                     /inference="similar to AA sequence:RefSeq:NP_012814.1"
                     /note="similar to Saccharomyces cerevisiae SLD2 (YKL108W);
                     ancestral locus Anc_2.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144349.1"
                     /db_xref="GeneID:59236345"
                     /translation="MAPQIDELKIDLKKWEHSFIKDRGREPTKDDIKRLPDVKKLYKQ
                     YSALKKGNTSQDTKERVFAENRSPKKNLAASLESISLVELGPTPQIHGKAMSIFEMGI
                     SPIKQPNPMDETLDHPFAVVPTSKSGYFWSDRDDEKSVKRQLQFTDTIPNSSPFKNQQ
                     VHLRPKYYGPNSPLKLSDTNIELSLVQWQPIRGTPRKHKTDVNEINSFSPSPLVKRPL
                     TKSLLELVQEQEAIVEEFKNMSAEHDSLMNLEQSTEPEELSEQETAGQGPSKPKRRIL
                     RRFAPAATHETVKRNISEELIKLKQRHVNEFYGNQVFAEPEESEQHEKDPNKAENTTV
                     KKTVKRKNKKYNLVSNNFKRLRLPKKGSSKKFWGKRRR"
     gene            complement(<645319..>646860)
                     /locus_tag="HG535_0D03300"
                     /db_xref="GeneID:59236346"
     mRNA            complement(<645319..>646860)
                     /locus_tag="HG535_0D03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288455.1"
                     /db_xref="GeneID:59236346"
     CDS             complement(645319..646860)
                     /locus_tag="HG535_0D03300"
                     /inference="similar to AA sequence:RefSeq:NP_013811.1"
                     /note="similar to Saccharomyces cerevisiae UTP15
                     (YMR093W); ancestral locus Anc_2.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144350.1"
                     /db_xref="GeneID:59236346"
                     /translation="MSSNRQRIVTSRAPVLPQQTTPEQRYWRQYASAQLVKEHNSVTH
                     IAFNPQHPHDFAVTSSTRLQIFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDAT
                     GLVSVYDSYNPRVLLLSINASTHPTHVTKFHSQDSKSLVTASDDRVTRLWDISHAYEP
                     QLELTGATDYVRTLCFVPSAPHLVVTGSYDGFLRLYDTRSSGATPVHMFKHNDPVESV
                     ISIGPTQIISGGGSNFKVWDLASNKKLYERGNFNKTVTCLDYVENYEQGSHSALIASS
                     LDGHVKVFDPLDNYRVKFGWKFSGAVLSCALSPSDAQGNKHLVAGMSSGLLAIRTKKK
                     EKKEKVFDSEQIVLSVSKKSNNFQRMMRGSAYEGDQEHIIHNDKTKPQRRVRAFERNL
                     NHFKWSEALDSAFVPGMAKELTLTVLEELRKRGKIRVALYNRDESSLEPLLNWCLKGI
                     EDVRAAPVVSDWIAVVIELYGGVLESSPILKEMVLNMKNKVRQEVYKAKEAQKIEGML
                     QLLTS"
     gene            <647475..>649307
                     /locus_tag="HG535_0D03310"
                     /db_xref="GeneID:59236347"
     mRNA            <647475..>649307
                     /locus_tag="HG535_0D03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288456.1"
                     /db_xref="GeneID:59236347"
     CDS             647475..649307
                     /locus_tag="HG535_0D03310"
                     /inference="similar to AA sequence:RefSeq:NP_013810.1"
                     /note="similar to Saccharomyces cerevisiae AIP1 (YMR092C);
                     ancestral locus Anc_2.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144351.1"
                     /db_xref="GeneID:59236347"
                     /translation="MPSIQFDSVIPPQPATQRNFTTHLSYDEASNAIAYPCGKSAFVR
                     FFDEDEIAIQFTGHGTASVTVVRFSPIKGSQYICSGDDSGKVIVWGYARDEKSKSIQT
                     TIKSEFQVLAGPITDISWDFEGRRLCVVGEGRDKFGAFISWDSGNTLGEISGHSQRIN
                     ACHFKQSRPMRAITVGDDGAVVFYQGPPFKFITSDRVHHDQGKFVRDVQFSPGNGEYA
                     ITVGYDRKIVCFDGKTGEFVKYVEDKKNGEEIGGGIFALSWIDGDRFVTASADGCIRV
                     WAVKSSKIVQKWQFSGKSLENQQVGVVAIKNDQIVSLSLDGTLNFFRIGESSIVKTIK
                     GHNKGITALTVSPLLSGSYDGRIMDWSTNPETMHNDHSNLIVAIDNSMPPKYASVSWD
                     DTLKISGIPKYEFKGQPKVSSSANDSGIMAAVTDKDVLMILDSYKGEILHEISLTEPA
                     SAVGITGDVVAVGLAQSYNIQVFRASDLSVSYTLSTPLRANASCISISPSKKYLAAGD
                     VMGKILLYDLETKNVTTSRWAFHTSRINAISWRPSDTDVEDLVATASLDTNIFIYSVK
                     RPMRTIKYLNAHKDGVTAVLWDTSASLVTAGSDSCIKKWSVDFE"
     gene            <649553..>650908
                     /locus_tag="HG535_0D03320"
                     /db_xref="GeneID:59236348"
     mRNA            <649553..>650908
                     /locus_tag="HG535_0D03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288457.1"
                     /db_xref="GeneID:59236348"
     CDS             649553..650908
                     /locus_tag="HG535_0D03320"
                     /inference="similar to AA sequence:RefSeq:NP_013809.1"
                     /note="similar to Saccharomyces cerevisiae NPL6 (YMR091C);
                     ancestral locus Anc_2.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144352.1"
                     /db_xref="GeneID:59236348"
                     /translation="MNSELEDGNESSDTGSRGASRSRKRASRASSARPQYQLDMEDVD
                     VQRNEEDDEEYHDEDEDLGDDRQAGDDDVEEVVVPSVSRRGRPSKRRRGDITDDNKSE
                     TEDSRSGSAVPPGMFAKRPHHAFPVDSSGAPLSVINEEYDLPDDPEGETKITEDGDLL
                     GNRQFLVRSFTVKDKGQRKYMLSTEPARAVGFRDSYLFFQYHPNLYKFILSQDQKNEL
                     IDRGVLPYSYRSRQIALVTARSVFKEFGAKIIANGRNITDDYYATRLREEGRVVEGTY
                     VKDQSKRGSVRGSTGLEFASTNSINPAKNAVEFFVRRNQNQVSSGTGVDPSSKMTATN
                     WLYQHAAACSRLNSDMYYDRVRVLLIERQGLRDPYTNTLHIPGSTQSSRVVARYRKPS
                     NKQELANDHCITYETVIEDQDLTRNKTGLLDVPRELFDDIVSDDVREAILEQQTFEKA
                     I"
     gene            <651467..>653962
                     /locus_tag="HG535_0D03330"
                     /db_xref="GeneID:59236349"
     mRNA            <651467..>653962
                     /locus_tag="HG535_0D03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288458.1"
                     /db_xref="GeneID:59236349"
     CDS             651467..653962
                     /locus_tag="HG535_0D03330"
                     /inference="similar to AA sequence:RefSeq:NP_013807.1"
                     /note="similar to Saccharomyces cerevisiae YTA12
                     (YMR089C); ancestral locus Anc_2.472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144353.1"
                     /db_xref="GeneID:59236349"
                     /translation="MLGISRPYARIIARKWVHSRAGRALVTSHISPLTYNRQIHTYSP
                     LLLKQNDHDNDSRDKGSRDNDQKKKDADASSEDLEAIEKEVMRFLKEAKKGTNEDLER
                     QKKNLDEKIKRLQGTVARQQARLDKDDKLVGESKSGATNKNEDPFNFHSRQAEEMHKR
                     INDQKKKESEDLKKSLNDPNASMSNNIGFVQVGLISLLLSFLLNVFAEAEEQREITWQ
                     EFRAKLLAKGYVSKLIVVNKSFVKVLLNDTGKNQPENNGHDYYFFTIGTVESFERKLL
                     KAQDELKIESDFRIPVVYVQEGNWARAMFQILPTALMIAGIVWLTRRSASAANGGRGG
                     IFGMGKSKAKQFNTETAVKVNFKDVAGCDEAKEEIMEFVSFLKEPSRYEKMGAKIPRG
                     AILSGPPGTGKTLLAKATAGEAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTARENAP
                     SIVFIDEIDAIGKARQKGNFSGANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDI
                     LDKALLRPGRFDRHVNIDKPELTGRQAIFEVHLHKIKLAGNIFDLKNRLAALTPGFSG
                     ADIANVCNEAALIAARNDSHSVKLEHFEQAIERVIGGVERKSKVLSPEEKRVVAYHEA
                     GHAVCGWFLKYADPLLKVSIIPRGQGALGYAQYLPGDLYLLSEQQLNDRMTMSLGGRI
                     SEELHFSSVTSGGSDDFKKVTRMATAMVTELGMSPKIGWINYQKKDENDLTKPFSEET
                     GNIIDSEVHRIVRECHARCTTLLKENADAVERIAQLLLKKEVLTREDMISLLGKRPFP
                     ERNDAFDKYLNESETDRIKKSEHHKDDATNVEP"
     gene            <655494..>657188
                     /locus_tag="HG535_0D03340"
                     /db_xref="GeneID:59236350"
     mRNA            <655494..>657188
                     /locus_tag="HG535_0D03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288459.1"
                     /db_xref="GeneID:59236350"
     CDS             655494..657188
                     /locus_tag="HG535_0D03340"
                     /inference="similar to AA sequence:RefSeq:NP_013806.1"
                     /note="similar to Saccharomyces cerevisiae VBA1 (YMR088C);
                     ancestral locus Anc_2.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144354.1"
                     /db_xref="GeneID:59236350"
                     /translation="MEPLDETSYLLPREATEDHNELEEVYHRHNLSIPKGPILISLWL
                     GSFISSLDGTVVANIMNRVAEEFSESDKKQWMATSFLLTNTAFQPLYGKLSDVTGRRF
                     ALLTAYFFFSIGCVFTCFAQNVTQFSIARAICGIGGGGMNACSSIIVSDICSAQERGI
                     YQGYANIVFGLGQMLGGPLGGLFIGTIGWRAIFAIQVPIIILCTIIALFKLDIKLVHV
                     PVGSKRFSAENLARIDIFGSLSLTATICGLIFLCSTDLNKLILTVITLLSFFLFMWIE
                     LYYAKERILPIELLKGSFGLCSIATLASSFIIFGDLFRSPIYLQLIHNIGVTKSGLYM
                     VFPSISVAAGSLVTGAVLRRTKMNLATCSYLIASAGICLQLIGLVINSVLTSIVTPDS
                     TSTNISPFLDELVSFSSDSVVWKIIYICASVFVGFGYACLLVATLVSIVFSVEKSQQA
                     TMTGIFYLWRSIGNVLGASLTLVVFENALGKMLWDYMFNKSDHGDYTFKEKEYTKLLK
                     DSSYLRDHFSTAVVGGLLKVYKSALVMSYAPNIAVGIIGVTAAFILIRAHREAKTP"
     gene            complement(<657227..>658048)
                     /locus_tag="HG535_0D03350"
                     /db_xref="GeneID:59236351"
     mRNA            complement(<657227..>658048)
                     /locus_tag="HG535_0D03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288460.1"
                     /db_xref="GeneID:59236351"
     CDS             complement(657227..658048)
                     /locus_tag="HG535_0D03350"
                     /inference="similar to AA sequence:RefSeq:NP_013805.1"
                     /note="similar to Saccharomyces cerevisiae YMR087W;
                     ancestral locus Anc_2.474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144355.1"
                     /db_xref="GeneID:59236351"
                     /translation="MKVVLCDTNETVCRLWRQLLQGLSPYSARIHHGELCEAMKELES
                     GQKERDTDNGAPGTKAVGNCSIAIVSPGNSFGFLGGGFDLGIRDYFGGVPFEGWLREA
                     LHCSYSPVGSVKAIDVTSYSRNLRNNVKYVVYTPTVVAPCRSLFEASRAVRTGYEPVF
                     NATWSALTGTPKDVETLVMPGMCTGYVGVPASVSCKSMAFALKLYLLENDVSEELKNV
                     LIMCFLGYPFKPFWAKECMKECELLGIEWEDLDKFDVKVDDIDRLLPFNRPCPTV"
     gene            <658681..>659976
                     /locus_tag="HG535_0D03360"
                     /db_xref="GeneID:59236352"
     mRNA            <658681..>659976
                     /locus_tag="HG535_0D03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288461.1"
                     /db_xref="GeneID:59236352"
     CDS             658681..659976
                     /locus_tag="HG535_0D03360"
                     /inference="similar to AA sequence:RefSeq:NP_012816.1"
                     /note="similar to Saccharomyces cerevisiae AAT1 (YKL106W);
                     ancestral locus Anc_2.475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144356.1"
                     /db_xref="GeneID:59236352"
                     /translation="MDRSKGIRTLGKRFFASIDKIPRAPPDRILGLTEKFNEDRNKKK
                     VNLTVGIYKDAWGQVTTFPSVAKAQRLIDADLVLNTDLSYLPITGCPDYSEHVLNFLF
                     KESCPLSGPKLLKEGRVSFTQTLSGTGALAVASKLLALWVSQTVWLPQPSWSNHRNIF
                     RSNGFTNVKEYPYYKDGRITVEEWLDHLRSAVDKNSKTRDCILLHACCHNPTGLDPTK
                     EQWKQILDTIHELGMIPIIDMAYQGLESGNPPKDAYLLRLCLDESLYKSWPHGLFVCQ
                     SFAKNMGLYGERVGSLSVVTPPFQPETKDNVDSQLKQIVRSIYSSPPGYGSRVATMVL
                     SKSFLKMQWYKDVEFMVSRLSQVRKEMHELLEWPSLIDFDRQHGMFYYTGLNPKQINA
                     LRNDYSVYMTMDGRISLSGINDCNIEYVCKALKSVTKTI"
     gene            complement(<660148..>662910)
                     /locus_tag="HG535_0D03370"
                     /db_xref="GeneID:59236353"
     mRNA            complement(<660148..>662910)
                     /locus_tag="HG535_0D03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288462.1"
                     /db_xref="GeneID:59236353"
     CDS             complement(660148..662910)
                     /locus_tag="HG535_0D03370"
                     /inference="similar to AA sequence:RefSeq:NP_012817.1"
                     /note="similar to Saccharomyces cerevisiae YKL105C and
                     YMR086W; ancestral locus Anc_2.476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144357.1"
                     /db_xref="GeneID:59236353"
                     /translation="MFSKQRHSREASQPINTGALAAASAIGKATINNGRAVDRTKLPF
                     YNQVPNEIKRSSSMMGSRQNSLQRGMSAGRNNSLSNRSSMSSGSHHNIHNSRPVSYIG
                     GGNNSRSQSLESQRRNSSRNNSLISRKRESNGDLQRAFHEFGGVQASGVIHQPSEAPR
                     MVKRYVPSANGLIAIEVPVQDNEGAKSRSSSLRRSASTNGLSLSRSGSLTRKKTINAP
                     SKTQQKRHSSLTESSSVSSSSVSSSKLHSASTRAATNSMAPHPLIETYVVEETEQELH
                     QEDVVRPIKVSESKEIQLQANREPKSELESELKVDAPDINLKGKEKGRNTTEAVSSTD
                     EHSKGNPIEPLEETVVINEKVIKHDEAITEEKSESSPVTKKMVETTVDDSLRTELNSE
                     LKHSDTADTEFFDSKEVIEPLPVVNHFNGQEEETILPISTHTRGGTSLAQHLRAMNPY
                     LSQVENAEDKQAQATDNGKLTAESSKGNDKDLYKVPSPMKSALKKSTTRSSNTSSVYS
                     EYSPANDAYLSLTTAENTRLNAKLVKTETPSYKPRHPARPQSMVNSAANRSSSPVARD
                     GHKTKRESTGQPQKVTRNSVYKTSNDSNASVAINAAKVSVNSRKPMTSTSNTTKFHQN
                     GSEEQARKTSHTSKRNSSINNDILYPREPPAKKSSFEKLRNQESSHMGFKKLSLRDET
                     IVADNLGNDQGYKKGYAGNDVGKMSNKQRNDSAVNAYDANRNFLQNSGWKSRIHDSDS
                     EEDVALFSSAGTSGSTQATSNDNQPDSSNGGKGFSFFKNKNKSKQQSNETEVNFSPPQ
                     PRYLDANLTKEKSAADSTHSTPNKINKKLSRMSLRSSSTGDVHELRSLETPKSDKSQK
                     RYHSHATMNTGNNSNNNDNNNNNNKGEVMKSKTLRANTVVDDGTPTKKKNALGKKLKK
                     LFGRKS"
     gene            complement(<663307..>665481)
                     /locus_tag="HG535_0D03380"
                     /db_xref="GeneID:59236354"
     mRNA            complement(<663307..>665481)
                     /locus_tag="HG535_0D03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288463.1"
                     /db_xref="GeneID:59236354"
     CDS             complement(663307..665481)
                     /locus_tag="HG535_0D03380"
                     /inference="similar to AA sequence:RefSeq:NP_012818.1"
                     /note="similar to Saccharomyces cerevisiae GFA1 (YKL104C)
                     and YMR085W; ancestral locus Anc_2.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144358.1"
                     /db_xref="GeneID:59236354"
                     /translation="MCGIFGYCNFLVERSRGEIIDTLVEGLQRLEYRGYDSTGIAIDG
                     DQVDSTLVYKQIGKVSALKEEIAEQNPNREVTFASHCGIAHTRWATHGEPKQSNCHPQ
                     ISDPHCDFVIVHNGIITNFRELKTLLLNKGYKFESDTDTECIAKLFKHLYDTNLQNGH
                     ELDFHELTKLVLLELEGSYGLLCRSSHYPDEVIATRKGSPLLIGVKSDKKLKVDFVDV
                     EFPDDDSKPETPLGYNKVNGGLKNLNGGTVNGRKMRPYEQNGGQNNLLPIAANEFNLR
                     HSQSRAFLSEDGTPNPVEFFLSSDASSVVKHTKKVLFLEDNDIAHIYDGEIHIHRSRR
                     EVGASMTRSIQTLEMELAQIMKGPYTHFMQKEIFEQPESTFNTMRGRTDFENNSIMLG
                     GLKAWLPAIRRARRLIMVACGTSYHSCLATRSIFEELSEIPVCVELASDFLDRLSPVF
                     RDDICVFVSQSGETADTMLALTYCLERGALTVGIVNSVGSSISRVTHCGVHINAGPEI
                     GVASTKAYTSQYIALVMFALSLSDDRVSKLERRKEIIQGLKLIPEQIKEVLQLEDKIK
                     YLCENDLKDQKSLLLLGRGYQFASALEGALKIKEISYMHSEGVLAGELKHGVLALVDE
                     NLPIIAFGTRDSLFPKVVSSIEQVTARKGHPIIICNKNDEVWENKAKSINMQTLEVPQ
                     TVDCLQGLLNIIPLQLISYWLAVNKGIDVDFPRNLAKSVTVE"
     gene            complement(<666117..>667667)
                     /locus_tag="HG535_0D03390"
                     /db_xref="GeneID:59236355"
     mRNA            complement(<666117..>667667)
                     /locus_tag="HG535_0D03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288464.1"
                     /db_xref="GeneID:59236355"
     CDS             complement(666117..667667)
                     /locus_tag="HG535_0D03390"
                     /inference="similar to AA sequence:RefSeq:NP_012819.1"
                     /note="similar to Saccharomyces cerevisiae LAP4 (YKL103C);
                     ancestral locus Anc_2.478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144359.1"
                     /db_xref="GeneID:59236355"
                     /translation="MSEERQIIEQLTKTLELLRVERNEKAHESSSVRGGFSSSGHELN
                     GVEPSRSFEDYSNAYIDFTFENPTTYHVIDYASKMFEKSGFEYLSEKENWDAKLSKGS
                     KFYTIRNGTNLSAFVVGKKWTLEKGVGVIGSHADALTAKLKPSSKKDQVEGFGLLGVA
                     PYGGTLNDMWFDRDLGIGGRVLYKDSDNHIKSKLINSAPHPIAKIPTLAPHFGAPAVG
                     PFDKEDQAVPIISYASAEPDKGITEDEKNSPLSDKHDISVLRYIAKLAGVEVKQLVQL
                     DLDLFDVQKGVIGGISSDFLFAPRLDDRLCTFAAVNSLVEYSQSINVEEMDTFVDVTL
                     FDNEEIGSLSRQGAKGGLLESVVNRVSSAYFKDQDKDVDLRTLYANSIILSADVNHMF
                     NPNFASVYMKNHSPKPNVGVTLSLDPNVHMSTDVVGTAFVEELARLNDDKVQYFQIKN
                     NSRSGGTIGPSISSQTGARAIDLGIAQLSMHSIRAATGSKDIGLGIKFFRNFLKNWRP
                     VYDQFEDL"
     gene            <668636..>672844
                     /locus_tag="HG535_0D03400"
                     /db_xref="GeneID:59236356"
     mRNA            <668636..>672844
                     /locus_tag="HG535_0D03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288465.1"
                     /db_xref="GeneID:59236356"
     CDS             668636..672844
                     /locus_tag="HG535_0D03400"
                     /inference="similar to AA sequence:RefSeq:NP_012821.2"
                     /note="similar to Saccharomyces cerevisiae HSL1 (YKL101W);
                     ancestral locus Anc_2.479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144360.1"
                     /db_xref="GeneID:59236356"
                     /translation="MPAPARKRTINSQRSSSVAKKAARNAMLKVAGTTKVSQTQLERV
                     VQSVNDATKRLSQPESILSTSTTTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNM
                     ETGQLAAIKIVPRKNNKHAKNEPASTCSSVSHVSASSNATSTMVNGTATNSTNTGAET
                     DPINPYGIEREIVIMKLISHANVLGLYEVWENKSELYLVLEYVDGGELFDYLVSKGKL
                     CESEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNRSIKIADFGMAALEISNK
                     LLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKV
                     QSGRYQMPMSLSKEARDLISRILVVNPARRITTEEILSHPLITKYEKPPFKIRSNKTT
                     KFSMRQGKSNADLHLLNEYDRSTLELNSKEDVDERILSNLQILWHGASRELIMAKLLQ
                     PSMCEEKVFYSLLLKYKEKHRTRVEAESEALLQKNKINIIDETNETNEANETNEADET
                     LEGRRISDPSAPHLLQKSQFSIPSLKQEKSPSVSALRPTALPIFAVSSSRTFKKSGSL
                     MSMQSQRSLKSKIKITKSSSKKSMSESSSKRTLQNSSSKRSLYSLTSISKRSLNLNDY
                     VTNEISERKAEQLPPLPSIGSNNDFEDLCNQILFGDALDKILEEEEEEEYDNKTVDSA
                     SRTTNKTDTEVSSGNSSPVVTPPQEALRPAFVFGQQLSDTTTSVNNSTADLSSPPRSA
                     FKDLTNTVTNTALSRKPSFSGLKRDISQKSNLKDMLARPNQNSNYPYRSVHNVTAFSG
                     TFAREQDFSLDPRRNASQPANSKVVESLLDRFKEKSNLKSKRKSNGWSYETGSIFGAN
                     QGVEDQSSGLTKESDVEMSSFMNHNQGLESLSDFHNMDADVLAHSSTVRTKPLISLPS
                     SSLNPTMSFKNLNDYLRNPDESYVTSSRRASASRNSTTARKQSTKISQPQKSSLAVGR
                     THSKANSSTSNDFDLISDMSYALDIPTNTFMAQAVTISNHGSAERIVPDHLGHVNRNE
                     NMKNNNGNNTLATIYDDTKVNIFEDAPTDTESLDVTSSEGDSIPNVHRKAVSIETLNN
                     TNVLAPSTNVRVSLYVNNNTNSNAILPRETTEEIISKFQMPHEKFSEDAQRRVSSTNA
                     TGKGNDAIENSQSVLPMFKDVEEADSEDRSAHKDISFNGLQQKDLEPQPNRVTMLFDA
                     DEEEHRKSEEETQQRGKDTPSKTEAVKEHNGTIKTTIKTTKKIREEKIKVRPKVKVMN
                     STLNEPPAKKSWFKKLFSGLKASREDLRLVQTHKTSLSFEDAHLLTLNEFDKNAVDYF
                     LKSSSRNNVSEIVQYDCKFVKGNFKFRIKIINDGTLRTDKQTLIIIKKKSGRNTSESE
                     HAFQIFNADVARVIRRLELKTKTE"
     gene            complement(<673010..>674131)
                     /locus_tag="HG535_0D03410"
                     /db_xref="GeneID:59236357"
     mRNA            complement(<673010..>674131)
                     /locus_tag="HG535_0D03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288466.1"
                     /db_xref="GeneID:59236357"
     CDS             complement(673010..674131)
                     /locus_tag="HG535_0D03410"
                     /inference="similar to AA sequence:RefSeq:NP_013800.1"
                     /note="similar to Saccharomyces cerevisiae ADH3 (YMR083W);
                     ancestral locus Anc_2.480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144361.1"
                     /db_xref="GeneID:59236357"
                     /translation="MIRAATRLGTRPVGNYGKFIRLQSTFEIPKTQKGVIFYESGGEL
                     HYKDVPVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGHEGAGVVVAKG
                     SHVNNFEIGDLAGIKWLNSSCMTCDLCETGYESNCAKADLSGYTHDGSFQQYATADAV
                     QAAQIPKGTDLAQVAPILCAGVTVYKALKTSNARPGQWVTVSGATGGLGSLAVQYAKA
                     MGLRVVGIDGGPGKEQLFKSLGGEVFVDFTKSKNTAEEIIEATQGGPHAVINVAVSEA
                     AISMSTQYVRPTGTVVLVGLPAHAYVKSEVFSHVVKSISIKGSYVGNRADTREAIDFF
                     SRGLVKSPITVVGLSELPKVYDLMEKGAILGRYVVDTYK"
     gene            complement(<674581..>676473)
                     /locus_tag="HG535_0D03420"
                     /db_xref="GeneID:59236358"
     mRNA            complement(<674581..>676473)
                     /locus_tag="HG535_0D03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288467.1"
                     /db_xref="GeneID:59236358"
     CDS             complement(674581..676473)
                     /locus_tag="HG535_0D03420"
                     /inference="similar to AA sequence:RefSeq:NP_012822.1"
                     /note="similar to Saccharomyces cerevisiae YKL100C;
                     ancestral locus Anc_2.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144362.1"
                     /db_xref="GeneID:59236358"
                     /translation="MNQYLKLLTNQLGKLPRRVLQDSMRISSKNSGSELEHVFEQISN
                     VLENNESYLVTKVDKFSQETARLLVKLLESHFVFINYIVLTLIATLLVMYGTFASIDS
                     IPYTALPPTKLHPLFDPSDFDLEQDCEIVYADTEDKKTDLLHLDEKQAILLPLRSGAI
                     LLVLYFIVTKLELQWKLYLLKFLNFIMILMSVPASFFVYNYVANTITRHISHWISCNP
                     LKICSRVRITISDDNEEITRSGCFVQNFSYRDVLTNELGFKDTVDKLNKEDSHLKRLY
                     SREFTKPKEVKSNRQMANIYANGTTAISLILSIMLSACYFFCPNDWLVRNVVSINFAL
                     WTISQLKLKNLKSGALILFALFLYDIYFVFGTNVMVTVATNLDLPIKLSLPTNFNVAQ
                     GKFEFSMLGLGDIVLPGSFISLCYKYDIWKWHYENNDIEFHLLNWSYVGRYFITSMIS
                     YLLALGTCMFALAKYKVAQPALLYIVPFLLISTIFTAWIQGDLAQFWTFQYDVIELGE
                     NKLSTEHDDSDSNTDAKEYPVTYSDFFQSDCIENDDDDEEENYTYNDALIDYESDDDL
                     DYDSEVNEDDFEIAVPEYKPTDILRLLDDAAHSPEGEDADFVLDDDGPDLDSETDTVI
                     LDADEL"
     gene            complement(<676650..>677480)
                     /locus_tag="HG535_0D03430"
                     /db_xref="GeneID:59236359"
     mRNA            complement(<676650..>677480)
                     /locus_tag="HG535_0D03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288468.1"
                     /db_xref="GeneID:59236359"
     CDS             complement(676650..677480)
                     /locus_tag="HG535_0D03430"
                     /inference="similar to AA sequence:RefSeq:NP_012823.2"
                     /note="similar to Saccharomyces cerevisiae UTP11
                     (YKL099C); ancestral locus Anc_2.482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144363.1"
                     /db_xref="GeneID:59236359"
                     /translation="MASHRTAAIISRRIKSIVRRFNMAKLVHNVQKKQHKERSQLAGR
                     SRLGFLEKHKDYVKRAQDYHKKEKSLKILRTKAKERNPDEYFHAMHSRSTDAQGLLHA
                     SRHGSDEDASLSTDQVKLLKTQDSNYIRTLRQMELHKMTRKSNDLTFDASGSHTVFVD
                     TKEELGEFTPEKFFNTTVEMLNRRQNRLTKEQLTSNLGSENSFVPNPKAIMPKESLDK
                     KRLKKLKLVKEHLEREADLKRVQQKMDFQREVMKNGSKKKITDANGNVSFKWKKQRKR
                     "
     gene            <677637..>678566
                     /locus_tag="HG535_0D03440"
                     /db_xref="GeneID:59236360"
     mRNA            <677637..>678566
                     /locus_tag="HG535_0D03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288469.1"
                     /db_xref="GeneID:59236360"
     CDS             677637..678566
                     /locus_tag="HG535_0D03440"
                     /inference="similar to AA sequence:RefSeq:NP_012824.1"
                     /note="similar to Saccharomyces cerevisiae YKL098W;
                     ancestral locus Anc_2.483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144364.1"
                     /db_xref="GeneID:59236360"
                     /translation="MLVKALPDFGTCLSYSISARRNLVYIYKKQSGNNIDTERHSEIV
                     KNTIDRSYEGRGIVSRIMEKYPSEEDQDLLSPAGNSVSKLEIVIIPNICQYNKEEQVK
                     LVKMIKNCNSGGSRSSRIFIGMVPWAMADHERHIISMRDWLKHRFWIACLEPNETDSV
                     NLRTEPSYDIPYTEVHCSPAVRRYVLDVMVHLRMHRFVDITKGGGIQTMALNDVIVLS
                     QLISKTTFKKNFITPEHVKIACIWYFPLHIDMLKDASIDTTVQYGSRPDMIDDFLDKL
                     YKLNDEEAKKIENPLFLETLVVHDVLNKIVPPV"
     gene            <679098..>679820
                     /locus_tag="HG535_0D03450"
                     /db_xref="GeneID:59236361"
     mRNA            <679098..>679820
                     /locus_tag="HG535_0D03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288470.1"
                     /db_xref="GeneID:59236361"
     CDS             679098..679820
                     /locus_tag="HG535_0D03450"
                     /inference="similar to AA sequence:RefSeq:NP_012826.1"
                     /note="similar to Saccharomyces cerevisiae CWP2 (YKL096W-
                     A); ancestral locus Anc_2.484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144365.1"
                     /db_xref="GeneID:59236361"
                     /translation="MHFSASFQIALLSFARVITAASESFGFLGIHSGTDLQFSSVYNE
                     NGNLMIGSGENGVSGIVTDDGSVRLDGNTYITVASDGTMKEGTQAESALGFSIQNGDL
                     AYRGSEGFYAIPIGSAYLFSTARGNGSIGVLIKAVSNGQSIPDFTPNGQNGTSSSATT
                     TMAPTSSGDSTVSTWLPNYNSTAYYPDNNATVTTRTQTSINTATETCTTCPTILPTEG
                     GANCVVPGIAAGAVAAVAALLL"
     gene            <680073..>680717
                     /locus_tag="HG535_0D03460"
                     /db_xref="GeneID:59236362"
     mRNA            <680073..>680717
                     /locus_tag="HG535_0D03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288471.1"
                     /db_xref="GeneID:59236362"
     CDS             680073..680717
                     /locus_tag="HG535_0D03460"
                     /inference="similar to AA sequence:RefSeq:NP_012827.1"
                     /note="similar to Saccharomyces cerevisiae CWP1 (YKL096W);
                     ancestral locus Anc_2.485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144366.1"
                     /db_xref="GeneID:59236362"
                     /translation="MKLSIIIPASILSIVALVEADSDPFGMIAIRSGSDLQYASVFAQ
                     NSTLYFGHVANSSFSGIVTDCGQLKLSDDSYVSIANSGELQEVKGSASATDGFAIQDG
                     HLTFKSGQEIFYAIPQSPSAYLVSAQNHGNESLGVIIRAQGFSGSVVSDFYPTKNCSV
                     PTGSHTNYSNNTSPKQPSSTNPVVNVQNQAGIVDIFSSFGLGCGAIVGIVALLI"
     gene            complement(680929..681002)
                     /locus_tag="HG535_0Dtrna9V"
                     /db_xref="GeneID:59236668"
     tRNA            complement(680929..681002)
                     /locus_tag="HG535_0Dtrna9V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59236668"
     gene            <681533..>684646
                     /locus_tag="HG535_0D03470"
                     /db_xref="GeneID:59236363"
     mRNA            <681533..>684646
                     /locus_tag="HG535_0D03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288472.1"
                     /db_xref="GeneID:59236363"
     CDS             681533..684646
                     /locus_tag="HG535_0D03470"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144367.1"
                     /db_xref="GeneID:59236363"
                     /translation="MDRGSEYTNKTIRNFFKEYGIIPCYTSVGDSKANGVAERLNYTL
                     LDDCRTLLRSSNLPLHLWFYAVQFSTLMRNSLITSSVGTSSRAKAGLTGLDVSTILPF
                     GQRVMVNIPPKNKLRPRGIVGFALTPSAESHGYLIYIPSKHTVTDTTNYLIIRGDPHD
                     RTDDADAVIAPLLDQLEARQDGEFDNNMSTHSGGMEMDVSIHSGGTIHQRPVSPTPTA
                     DNLSTSSGGNDPIQTGTTDTTEVIPEYIPEGNNDVLGPDIHDDPPEHTNDDPPEHTSD
                     EIADNIEEHGSNMINEDPRINLQSANHAVTYDNTEGDDQPTQNEPTSNPINDPANDHP
                     SSAIIDSTKTPDPIPDTVSRRTINNDIDPSSAIASTVGIQASAYDDVAPITEDERTTS
                     STSTAELDPLPSEEDSPVPESTTVATPDSETPESISNVGGNDQSPEVNAKSLEERKNR
                     IFQYRNGDIPRVKPPSTKRKSNLALGEIEDRTQRKRPKRHILYVNAVHSNPTPHVKPS
                     LSYYEAIVNNDDKNDAKGYNEAYMKEYDQLIKMKTWDPNKPMNEKTIPRQQIINSMFI
                     FNTKRDGRKKCRFVARGDQQKAGTYKEDLKANTVHHYALMTSLNIALDKKMFITQLDI
                     SSAYLYAELEEDLYIRAPPHMKLKGKAFKLNKSLYGLKQSGANWYKMIGSYLTNSCNM
                     TELTGWPCVFKDENECFVCLFVDDMIVLSKDIKAANKLVKTLKKKFETKVIHDGKLDE
                     NNMATYDILGLEIEYTFGKKMTIGMENSLTEKLPHLGFDIEKDNKKFLVPGTPGEHIH
                     KDNLVVEEDDYKEKVKQMQKAIGLLSYVGYKYRFDILYYVNILAQHTLYPSEQVEKLT
                     KQLLNFVWQSKHKKLIWHANKHTKTNRITAITDASFANEEGFRSQLGHYYCLNGKVIG
                     GRSSSEKLRVISSTEAEIYAVSESVPMLQGLACLVKQIDPSSSLRSKILTDSKPTISI
                     VEDQSEVSRAFRNRFFGTRAFRLRDEARRNDLKFEYIKTEDNYADILTKPTSIAIFKK
                     LTHSWVK"
     gene            complement(<686471..>687127)
                     /locus_tag="HG535_0D03480"
                     /db_xref="GeneID:59236364"
     mRNA            complement(<686471..>687127)
                     /locus_tag="HG535_0D03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288473.1"
                     /db_xref="GeneID:59236364"
     CDS             complement(686471..687127)
                     /locus_tag="HG535_0D03480"
                     /inference="similar to AA sequence:RefSeq:NP_013794.1"
                     /note="similar to Saccharomyces cerevisiae VPS20
                     (YMR077C)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144368.1"
                     /db_xref="GeneID:59236364"
                     /translation="MGQKGSKVQITENDRAILQLKRSKDEIHKFTRKTDQLIGTERER
                     LKHMIKDNPKGYKNDRKVRFLLKRIHYQDHLLQQASEQLINLENLVSTLEFKLVEVQF
                     IKGLERGKDILSKLNQEFKNVDELVDGVHEQISYQNEIDNVLSHSIVGVDDFEDELDK
                     ELEQLDSEVNPKTSLHLPSTDNLPPLQQNEESNKIQGPSLNAEENIKAPQTEEPPLLA
                     "
     gene            complement(<687426..>689651)
                     /locus_tag="HG535_0D03490"
                     /db_xref="GeneID:59236365"
     mRNA            complement(<687426..>689651)
                     /locus_tag="HG535_0D03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288474.1"
                     /db_xref="GeneID:59236365"
     CDS             complement(687426..689651)
                     /locus_tag="HG535_0D03490"
                     /inference="similar to AA sequence:RefSeq:NP_013795.1"
                     /note="similar to Saccharomyces cerevisiae CTF18
                     (YMR078C); ancestral locus Anc_2.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144369.1"
                     /db_xref="GeneID:59236365"
                     /translation="MSDLFNFAGLTGGSTLFDTGDVIEHRAIHDDRENDHCEQRATEF
                     TSSCGKVVKLRKKKVSVAEGLDATRLGYAKSAWRNDETYGININALLDRIEAKNEAKG
                     GLSSRYQTHSKRHRSELLVEKWRPRNFLDLVGNDKTNRRILRWLRQWSPCVFNEALPR
                     GPQKKPQENTEDNSEDEELLDPLQRPQKRILLIHGPPGVGKTSVTHVVAKQAGFSVVE
                     INASDERAGTVVRDKTHNTLFNHTFNESAVCLVADEIDGSVESGFIKVLIDIVSNDAK
                     ATQKLILGSQLKVKSKKKKKSSKMLLRPIIAICNNLYAPALEKLKPHCEIISFKRPSD
                     SSLQERLERICQIENLEIAPKTLKELMDLSQGDVRSCINNLQFLSSNQEFNSEVQVGV
                     ANKLESSSKDFSTSWFRICNALFRKDPRADPKSEIKELTRQVELNGNYERLVHGCHSL
                     YLLEKYSDNGLMKPAALSDWLIFHDLMFKSLFDHNGELLRYCSITPLAFYNYFSDIAN
                     REDMRIKNSDFEFKEKQKSNLDVCRLLQHRITVNMPSRAPFISQQSLISHILPFVDYM
                     LSSDVNKCRDLKLRQSIYDLMVGVLREFQLTLQPKYHEGLETRNLLGIEPPIENIVLL
                     DEKRQKETLTKRPPIYNVLLAKSEESKARKRHRDQVTREKDKNLEIRSKKAKSGANSV
                     DFFKIQYGLGDKRQPDSKAAVNDKLNKREKKDGVRIWVKYKEGFSDAVRKNVSWKDLW
                     S"
     gene            <689933..>690999
                     /locus_tag="HG535_0D03500"
                     /db_xref="GeneID:59236366"
     mRNA            join(<689933..689941,690097..>690999)
                     /locus_tag="HG535_0D03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288475.1"
                     /db_xref="GeneID:59236366"
     CDS             join(689933..689941,690097..690999)
                     /locus_tag="HG535_0D03500"
                     /inference="similar to AA sequence:RefSeq:NP_012832.1"
                     /note="similar to Saccharomyces cerevisiae YKL091C and
                     SEC14 (YMR079W); ancestral locus Anc_2.491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144370.1"
                     /db_xref="GeneID:59236366"
                     /translation="MVTQEERKLLESYPQVCAPGSCSGCPGNTDEAQENALSQLREEL
                     TSEGYEERLDDSTLLRFLRARKFDVALAKEMFTACEKWRKEYDTDTILTDFKYEEKPL
                     VAKFYPQYYHKTDIEGRPVYIEELGSVNLTEMYKITTQERMLKNLVWEYESFVKYRLP
                     ACSRYCGNLVETSCTIMDLKGISISSAYQVLSYVREASYIGQNYYPERMGKFYLINAP
                     FGFSTAFRLFKPFLDPVTVSKIFIHGSSYKKDLLKQIPEENLPAKFGGKSEVSEADGG
                     LYLSDIGPWRDPKFIGPEGEAPQVYHV"
     gene            <691427..>694534
                     /locus_tag="HG535_0D03510"
                     /db_xref="GeneID:59236367"
     mRNA            <691427..>694534
                     /locus_tag="HG535_0D03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288476.1"
                     /db_xref="GeneID:59236367"
     CDS             691427..694534
                     /locus_tag="HG535_0D03510"
                     /inference="similar to AA sequence:RefSeq:NP_012831.1"
                     /note="similar to Saccharomyces cerevisiae BUD2 (YKL092C);
                     ancestral locus Anc_2.490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144371.1"
                     /db_xref="GeneID:59236367"
                     /translation="MGNADLLHKATERSFSSNTMELRTILSGVQTYNGTFKGQVQWCE
                     SLVEGHWRLQHLEITEHGSLRYRLDSATLTSSCIEDDTFIFENVRTKAIIEHLQSCVL
                     QLIEGNEDSLPTIKVELKAQQAQYLRVEDPSTFESLFFSLLWWSALKPEGVFSKTLLK
                     APSAPEERNPTKLLVSQLFVYGPLPQSKNIGVLQLSRPSFFSETDAEEGWFPAMGVLK
                     SNGILDLHLQSDGSLIYSFDITILTRSEIRLVDSSLNCDNFLFMGVLPKLREQLNLSS
                     ACRFILNGRTQRRSSGVVFKFPLTIDVEDWIVALKSFALAESISLIGSHDSNRLRVSN
                     RFKVSIIEGSFTRSDLMPHSPTLYVECLLWDRIWARTPIVSGSFTPFWREEFMFHEST
                     RIDKLRIEIKEKGSQKNRTDKTIGVIELSQESICDGSLSKETRLPVLSPQDKKIKIGT
                     LCIKITSSLNFVLPSVNFTTFERILSEDCHRSLANYVNDSSFAYDFKFEDFAMVLLDI
                     FQAIGKENAWLSALIDRELVDVDGSITRNTINNKTSSHIYSTLFRGNSALTKSMEKYF
                     YRIGKEYLDNSIGSILRQIVYDRISCEVDPSRIDEPDPERKRKILEKNRETLLNLVES
                     IWVTIYKTSNDLPMSIKTQMKTFRTKVELICMGENSNTIVHCVSSLLFLRFFCPVILN
                     PKLFDFVRSHLDDTPRRTLTLVSKVLLNLSIVTYFGKKEPYMVELNDFIGAHKEEVLD
                     YVDKVTQKKLDFSPKTLKLSSSLSRPKLTMNEDCLIDLPSNPYLIDRYLRETELFTAL
                     ATVATERDGDPKILQSVSIEQITKNVAHLEVSSEHKVLDIGELEFEKITNNNTEVFGS
                     DLMKYLEKENSSSPVPNEYLQQSFKDDSARMKVLEQESILLINRSEHLKQVFSDYEIP
                     AQEIKERVNHTQYLIKNSYYNKDLKVFVDGNAKFDKNEAHKRLFDLTTGRCPLLESLI
                     PDPRIEYAEGSSASSSWNSPSVKTRGFSRLKSTKIQRKLTKSSEDTKRQESTSVIKRW
                     FKRGT"
     gene            complement(<694675..>697482)
                     /locus_tag="HG535_0D03520"
                     /db_xref="GeneID:59236368"
     mRNA            complement(<694675..>697482)
                     /locus_tag="HG535_0D03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288477.1"
                     /db_xref="GeneID:59236368"
     CDS             complement(694675..697482)
                     /locus_tag="HG535_0D03520"
                     /inference="similar to AA sequence:RefSeq:NP_013797.1"
                     /note="similar to Saccharomyces cerevisiae NAM7 (YMR080C);
                     ancestral locus Anc_2.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144372.1"
                     /db_xref="GeneID:59236368"
                     /translation="MYRQGSDADSEVNEYEDEINEMMNEVDPQLNTERSLVTSEHACA
                     YCGIDSPTSVVRCYTCRKWFCNSKHGCSSSHIVNHLVLSHHNVVSLHPDSDLGDTVLE
                     CYNCGCKNVFLLGFVSAKREAVVVLLCRIPCAQTKNANWDTDQWQPLIEDRQLLSWVA
                     EEPPNEDKLKARLITPSQMSKLEAKWKSNKDATLNDIEISEEQEEIPPTLLRYQDAYE
                     YQRTYGPLIKLEADYDQQLKESQALEHISVTWSLALNNRRLASFALSTFESNELKVAV
                     GDEMLLRYSGLQHPEWEGRGYIVRLPSSFQDEFTLELRPSKVPPPIHLGTGFTAEFIW
                     KGTSYTRMQDALKKFAVDKKSVSGFLYYKILGHEIVDIDFNVPLPKEFSIPAFAQLNA
                     SQSYAVENALQKPLSLIQGPPGTGKTVTSATIVYHLSKLHKDRILVCAPSNVAVDHLA
                     LKLRNLGLKVVRVTAKSREDVESSVSDIALHNLVGRSSQGELKKLLKLKEDVGELSLR
                     DTKRFVKLVKKAESEILKKADVVCCTCVGAGDKRLDTKFSTVLIDESTQASEPECLIP
                     IVKGAKQIILVGDHQQLGPVILERKAGDAGLNQSLFERFISLGHVPIRLEVQYRMNPH
                     LSELPSNMFYEGSLQNGVTIEQRTVKNSSFPWPIHDVPMMFWANYGREEISAKGTSYL
                     NRIEAMNCEKVITRLFKDGVKPEQIGVITPYEGQRAFILQYMQMNGSLDKELYINVEV
                     ASVDAFQGREKDYTILSCVRANDQQVIGFLSDPRRLNVGLTRAKYGLVILGNPSALSR
                     NIIWNNLLLHFREKGCLVEGSLNNLQLCTVQLTRNHPKRNQKDRYAFNLGAGASEFPS
                     YQDFDTQSLMSFGQAETFNNATKELSSYLNNQLWSTENPAGRRDRANPANGSHNMHSQ
                     LHDGEELLSDELRKGLNSLHI"
     gene            complement(<697814..>698500)
                     /locus_tag="HG535_0D03530"
                     /db_xref="GeneID:59236369"
     mRNA            complement(<697814..>698500)
                     /locus_tag="HG535_0D03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288478.1"
                     /db_xref="GeneID:59236369"
     CDS             complement(697814..698500)
                     /locus_tag="HG535_0D03530"
                     /inference="similar to AA sequence:RefSeq:NP_012830.1"
                     /note="similar to Saccharomyces cerevisiae MBR1 (YKL093W)
                     and ISF1 (YMR081C); ancestral locus Anc_2.488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144373.1"
                     /db_xref="GeneID:59236369"
                     /translation="MGKEFSNEMFSLNIFERAVQDPCCDGCDHEDGRCYERSEHGDGD
                     EEHDPLEERSGGGGTKCVRNALVRHQSSPAMQTSQPARRRANSATLIRQISRQSTLDV
                     VAPAGMSIEEGQPMEFVPQRQQQQQQQTPSPTPTQQQTPSPTPTLQRTRSSCACIPTH
                     LYGLEKYVSSVLDALSTGDYQDVPESLTAAESAVSSPLSSQSSSFSKPQCDSRKKSFI
                     ETSLAKSFSQ"
     gene            <698614..>699120
                     /locus_tag="HG535_0D03540"
                     /db_xref="GeneID:59236370"
     mRNA            <698614..>699120
                     /locus_tag="HG535_0D03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288479.1"
                     /db_xref="GeneID:59236370"
     CDS             698614..699120
                     /locus_tag="HG535_0D03540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144374.1"
                     /db_xref="GeneID:59236370"
                     /translation="MYMYVYVYMLEARKNTNPMVPLVCVRKSPGDAEPSKPCFLDISP
                     VHSFRVSAVPANRAKGQSLDRYHDIRPDAVGGTTRRCNHSALWEHPAPSPGSRSQTRN
                     GFSECIEQRAAAIKAKIELFVGERAKKKRRGPDCCLVSTGRRDPAFRCRESAARRAAD
                     EKGISQNR"
     gene            complement(<699397..>700326)
                     /locus_tag="HG535_0D03550"
                     /db_xref="GeneID:59236371"
     mRNA            complement(<699397..>700326)
                     /locus_tag="HG535_0D03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288480.1"
                     /db_xref="GeneID:59236371"
     CDS             complement(699397..700326)
                     /locus_tag="HG535_0D03550"
                     /inference="similar to AA sequence:RefSeq:NP_012829.1"
                     /note="similar to Saccharomyces cerevisiae YJU3 (YKL094W);
                     ancestral locus Anc_2.487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144375.1"
                     /db_xref="GeneID:59236371"
                     /translation="MSYPYECATEVPETQYEQFDQANFAFIQWKTATETPKGRVLIVH
                     GFCEHCKIQHRLMDNLAQNGYESFTFDQRGAGLTSPGKLRGRTDEHHTFKDLDHFVEK
                     NLEQCRENNTPLVLFGHSMGGGIVLQYAAHGRFRSRVAAFSCTGPLILLHPHSRPSRL
                     VSLLSPLLAKCLPSFQIDTELDLDGITSDKRYQDFLKHDIPLSTPLIGTLRQIYDFLK
                     RGEALYENRGGHISANFIRDRPVLVMHGTDDTINDPAASKHFVETVCPAEDKTLKLYR
                     EAKHSILSLETDDVFRTVFDDYLAWLNRCCVSK"
     gene            complement(<700485..>701258)
                     /locus_tag="HG535_0D03560"
                     /db_xref="GeneID:59236372"
     mRNA            complement(<700485..>701258)
                     /locus_tag="HG535_0D03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288481.1"
                     /db_xref="GeneID:59236372"
     CDS             complement(700485..701258)
                     /locus_tag="HG535_0D03560"
                     /inference="similar to AA sequence:RefSeq:NP_012828.1"
                     /note="similar to Saccharomyces cerevisiae YJU2 (YKL095W);
                     ancestral locus Anc_2.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144376.1"
                     /db_xref="GeneID:59236372"
                     /translation="MSERKSINKYYPPDYNPLAAENAVQKAAKKLKSKNRDSITIRLM
                     TPFSMRCLKCSEYIAKSRKFNGKKELAKERYLDTIKIYRFSIKCPRCNNVICFRTDPK
                     SADYVMELGGKRNYEPATAATGADKIESVKETLERLVDAQKRAEIGNDADDKMEVLEK
                     RLMKLEREREADEELELVKRLNDVRRANESKLAHQEDEVPTDDADADLDQLAEAAFAK
                     RRSAPQPHTTAPSHQRVAKIAGLTKKKKKNPLGVTIKKR"
     gene            <702004..>704922
                     /locus_tag="HG535_0D03570"
                     /db_xref="GeneID:59236373"
     mRNA            <702004..>704922
                     /locus_tag="HG535_0D03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288482.1"
                     /db_xref="GeneID:59236373"
     CDS             702004..704922
                     /locus_tag="HG535_0D03570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144377.1"
                     /db_xref="GeneID:59236373"
                     /translation="MATNLHSGHGSNSTESSYGGNKDSPGIENYNSNLNDTHIGAASN
                     EVFRKRTSKGVAETGGEGSADGNGTVKKRRRKAIKSCAFCRKRKLRCDQQKPMCSTCK
                     ARNHKECVYNTGFENELDNSGSSCSGSGGVSKLGGAGIPCGAVAGTARTTSDGGFNDE
                     GGNGSVYRKEKSESIMESTIPLMERLNQLQKQLEDNGAIVKESVLSANSGTNIPTNST
                     EESAPIDHYRSKDSFEVSIYNQSSYGNRKTDYVTLTRSQLHENTNGNILKDYFTLQCK
                     ESGRRILYGPTSTRIFIAKGKWAMLDKFRQVWLKVKAARAKWKKETNYTMLKEMKCVE
                     QPLEKPRNFGNSDCGSDCGINSEINLKSLVCSCLPTFEKIDSLIDFFFSNDTLFEASD
                     VLDKFKVKNDFKSAFIPGKPSPNLNHERPIIALVANEKKNYYKIGVILMILATTHYQS
                     ELPTEIENFSVHLSGLSTAKALYIERVQFLVVKFHYRLKYGFTGGDGSHNMLVIDDAI
                     ASSTAIGLNRNIKILYKGQESVVGSLETLQKLWLWILFADCDISIQIGRPLRISDDEI
                     DDSVFLNNDSSRTFYDTFKRFILMTRRMLSDIHNKDKKPPLGDHCETLINFIENEFPP
                     LSEFTGKSLTTIIHLRKARLLAQTVSLLITFYCLRYLAFNEIGIGLKNGVMKASLISF
                     SLYVNILLYSFELDKKIFPERLDLNYKFVPPYLCHSFSIVHGLPFRAIIVFYSLAYNS
                     LTLFESGLMCSKKNLQTTECDLSTLRVQNESYISFLTFFKLFLETFDRLMGPHNQQFA
                     IIARRSHVFVIGAAFERVCRKVIEKVMECRTNAENNWINESKNQQPNSDYASFESFKK
                     TNELQQNIKKFQSDIDNSLNMNILDTADYITALPSMNINSDNNCNTDKSPTAQIAQAT
                     ETAQAPQPGPALSLSLSLSEQEDIAQTISDDFWQSYNVGWQEILDNAEYDNFFQELIL
                     "
     gene            <705257..>706681
                     /locus_tag="HG535_0D03580"
                     /db_xref="GeneID:59236374"
     mRNA            <705257..>706681
                     /locus_tag="HG535_0D03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288483.1"
                     /db_xref="GeneID:59236374"
     CDS             705257..706681
                     /locus_tag="HG535_0D03580"
                     /inference="similar to AA sequence:RefSeq:NP_012833.1"
                     /note="similar to Saccharomyces cerevisiae CUE2 (YKL090W);
                     ancestral locus Anc_2.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144378.1"
                     /db_xref="GeneID:59236374"
                     /translation="MDGIINNNFNTEGQINEYEEKIAELCDIFPDKSQTEIQKAFLSS
                     NKNLPATCELLLTGHETLLKESDVAGVDPQVNRKQEFTPVDELGAMFPNIDRKAITTA
                     LQSNKNSLDDTIGDLLNFDILSVEQGNEQKRLESQIKKGNRYRDVDKNDWKLTSNYLE
                     IVQQYTNVDNDTAMKSYYNNFMNMGKTIINIIWTAENDHNARQKNDSKILTRKPTTGG
                     RVQSAYGYAHEATNSFTALEKKRYLNGNDKSMQSSPYVYNPNTEETKKVSEILTENPI
                     VKCISRDFLKKALKFYNGDMKRTLSVILFIIDLNASKDTYCRVNASKDCAGYKHHTAS
                     SYPKAFKQKTPSAGTIALRCSDFQSEEHYKIGCEMIETILIAPRLDFHGFIPEDAIQI
                     LKICLKKWWNHELLERELKAQKLSISKAFNVSAVEVVTGRGIHSVGGVSVLRKRVKMF
                     LDRENYLYWEEPSYFIVTGKKPVK"
     gene            <707391..>709124
                     /locus_tag="HG535_0D03590"
                     /db_xref="GeneID:59236375"
     mRNA            <707391..>709124
                     /locus_tag="HG535_0D03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288484.1"
                     /db_xref="GeneID:59236375"
     CDS             707391..709124
                     /locus_tag="HG535_0D03590"
                     /inference="similar to AA sequence:RefSeq:NP_012834.1"
                     /note="similar to Saccharomyces cerevisiae MIF2 (YKL089W);
                     ancestral locus Anc_2.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144379.1"
                     /db_xref="GeneID:59236375"
                     /translation="MDYMLLGVQSRKTGLNVKENIKKDEYSMENIDDFFKDDDTSLIN
                     SKGNNRRSSLLSSLTKNNVLSHTEHQSPILKGLQSSNFDSSRRSTEQFHGQNSSIIQN
                     HLSIVEEDLLPVDNSQYEEIVKDAHLTPKDSKIRRDTTIDRGSIRLTPEKPLNDYLYN
                     DVPDLVDDDDEDTRDFTSLNTSENALLEDELDDDFVLESEEDRDYVEGESILNEEENS
                     NDDDDDERDDESSNDSNDTDNGDEISSQSLSHPKYTYGDAKLSTEIYDSDEESIREQA
                     REVIDTETEGRANGLRRSRRVKVAPLEYWRNEKVVYKRKSGKPVLDIDKIITYDQNDD
                     DEEEELGRGKKKRKKSVRTRPYNYIPTGKPRGRPRKNKLPDGDAFDPNTELLDDINSG
                     KVETAEWLKHGILEASVNNANDKVSKEIVAFAPNLAQSEQIKETDEERFSLEVMFDKY
                     KENFASGMLKLPVRGNKKVSDSHRTFITFYIIEGVLEVTLAGNVFLITKGSSIQIPAF
                     NQYSFRNKGNNEAKMFFVQVTLSEAESKVFMNEKEMEKQDHSLSPRGIDKASEESESE
                     GSLSSMSISEI"
     gene            complement(<709308..>712244)
                     /locus_tag="HG535_0D03600"
                     /db_xref="GeneID:59236376"
     mRNA            complement(<709308..>712244)
                     /locus_tag="HG535_0D03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288485.1"
                     /db_xref="GeneID:59236376"
     CDS             complement(709308..712244)
                     /locus_tag="HG535_0D03600"
                     /inference="similar to AA sequence:RefSeq:NP_011856.1"
                     /note="similar to Saccharomyces cerevisiae STE20
                     (YHL007C); ancestral locus Anc_2.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144380.1"
                     /db_xref="GeneID:59236376"
                     /translation="MSDENKYDSFRERDCGTLKQGDDANRPEQIIKKDGSSTEVATGE
                     SDACIELANGLDGNPGAEKASHTKDASTKPSLSTHDEVENNEQNTFELPRAPGTLNVN
                     ALNGHSEEDDRTRDLCEYRSMDPKKSPIDTPKDTTETAISASLDEPIQFTRVSSSSAL
                     SGISSYENEEHSIKNSEQTNNPAIKNEGMDSRTFTKSGEEEIEGQSADDRPPTSSDLK
                     SSAYNGMRDFSSVGDQTNSTIRASESDQHVNGTLIASTTSESIFELSSEQANTSSNKI
                     PLLPVNNLDTKQRTSSKTNTPVTTPKIPQQNASAPIVGPTQTSVAKSSPFKAFTSKSA
                     VRSPRNISPPSSSPVIQPQSRNESSKRKSSGSSRMKGVFSSFVQNIKRNSQGEKNKTP
                     NGVKISTPYNAKHLHHVGIDIKTGEYTGLPEEWERLLTSSGITKKEQQQNMQAVVDIV
                     KFYQDVTEASGEDKVFKTYNVGNAGYSIHNTPSFRTGSGSFVNKFYTPSGSSTPDLSR
                     QTPNLAQSSSIPSPQVNAYRTPPNPPSPPSSLGGPDSTEKISNEKFIPSRPAPKPPVQ
                     RSKTSTSAAHASKTTSSSITVPKDTSGSSLSLASRQASIKREEQPLPPIPQTCTQENS
                     SDINNETQDLKNVTSADKTNGHSNVLSRDASRKANVALAEKKAEERERKTKQLYAKLS
                     QICTDGDPSKIYLNLTKIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKELIINEI
                     LVMKGSKHRNIVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAVCRETL
                     AGLKFLHSKGVIHRDIKSDNILLSMEGEIKLTDFGFCAQINEVNLKRTTMVGTPYWMA
                     PEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPQLKEPDNL
                     SQELKKFLSWCLNIDPDERASATELLHDQFISEYADKNESLAPLVKLARMKKIAEKME
                     DDEADA"
     gene            complement(<712774..>717252)
                     /locus_tag="HG535_0D03610"
                     /db_xref="GeneID:59236377"
     mRNA            complement(<712774..>717252)
                     /locus_tag="HG535_0D03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288486.1"
                     /db_xref="GeneID:59236377"
     CDS             complement(712774..717252)
                     /locus_tag="HG535_0D03610"
                     /inference="similar to AA sequence:RefSeq:NP_012915.3"
                     /note="similar to Saccharomyces cerevisiae UFD4 (YKL010C);
                     ancestral locus Anc_2.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144381.1"
                     /db_xref="GeneID:59236377"
                     /translation="MSRGDENSETLGSSDYGMDDHNSGEGSEPYSYHQEEIIGMSDRD
                     EDYEDNHSGGDYYGEEGSNEEEDQGILVGADDDMDHESDVSDRRNRGHDTDRSGSTPF
                     SRVNERLFSVQNLLGNMAQGFEGESNDNEGHIGGGGTHVFGTRQGLGNLAEAFPEIIS
                     LINDGVRRGNNGERNDRFSTLVNNVLNAPEDTYIAMESLKELSQHLLMMDQLVLERML
                     PTEKLLKGIIGIISDSALNEELELQLMSCRCLYNLFEMNPDTITAAVDQGLIPNLQVK
                     LQEISYIDLAEQILETLELISRVHGKEVLRSGALTACLQYLDFFTIHAQRKAVTIVSN
                     SCCKVRTDDFEIIKEIFPTLIPIFVNGSDFLILDKILKALYGICEGLRKKPLLESLFT
                     IDVMQRLAQLASTPESSLESKVRCFDIISVLVKASCLLSKDFIENCNVVDILLNCFNS
                     YSKNSKAALHETLIYVPKPLLHAISRTAVLIFPSEKEQILSMDNAKKPDLHLNRKGFD
                     KLMKNLTPLLIEIYVNTVDFDVRRLVLIALARIATCVGISEAGPICERIIGLAGSTLA
                     QSDSLLDKEKDQIMVSSTLFVGVLSLLDILAARFSSSVLTPLKREGIFNLVKSLKRML
                     LERKNEGTITIFAQDSDIERSPTTESEEFFEEEEDDEDDEDDDDDDDDDDDDDDGDDE
                     YDMQFSTMDIPTEIKPNNIKFEVLRYMPQDFIYWKILELSDRLLTTFDVDEGVVSEEL
                     RDIEKLVEYLLHIEWKENNQQSWRELWVRIRNCIFKAGFEISSFEFISTGLAAALAAT
                     IRKFGIIGSIPRRAFLEVFRDDDAKRLVLILQSTLTRLESFRVTECGLQGSEERVASL
                     GKHVKIKLVYDEDSDIDQIGQTLSGSTIHIHCIASFKTLNEFLKHRMAQARFLSSVMP
                     SLTSTEPGSSNNNGLEEVRNWVFEFSTEQETLKLNDTIFYGLFRAYKASGKDLNTLWH
                     EPQVIKFKKVNETVAQVESLMALYDHELDDKNEILKPADDIFTLLKFLRIKELPSDIF
                     INSKLSAKLSRQLEEPLVVASGLLPHWTLQLTKRYYFLFPFDTRLFFLQCTSFGYGRL
                     IQLWRNKTGTVKDSHGDDSLQKLGRITRHKLRISRSSMFLSGLKILDKYGSSPSVLEI
                     EYQDEVGTGLGPTLEFYASVSREFTKKNLQIWRYDRYAHQDADYVATPLFPAPLDPKE
                     DNEKVLELFLHLGTFVARSMLDNRILDFNFNRVFFELTHRRCRSRNNMKFHEDLEDNL
                     FLLSLVDGHLAKSLKFLYDHRDSEVDLEQLTLFFTLPGYDIDLIENGSSIQVTNQNVE
                     NYITLVIDFVLASGIKEQLDRFIDGFSKVFPYTSLLLLDPDELVGLYGNFQEDWSSAT
                     LYATINADHGYTMDSPSIHELVSIMGSFSIQERRLFLQFLTGSPKLPIGGFKSLKPKL
                     TVVLKHPDDNLTADAYLPSVMTCANYFKLPKYSDRNMMRSRIVQAMNEGMGPFLLS"
     gene            <717642..>718355
                     /locus_tag="HG535_0D03620"
                     /db_xref="GeneID:59236378"
     mRNA            <717642..>718355
                     /locus_tag="HG535_0D03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288487.1"
                     /db_xref="GeneID:59236378"
     CDS             717642..718355
                     /locus_tag="HG535_0D03620"
                     /inference="similar to AA sequence:RefSeq:NP_012916.1"
                     /note="similar to Saccharomyces cerevisiae MRT4 (YKL009W);
                     ancestral locus Anc_2.498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144382.1"
                     /db_xref="GeneID:59236378"
                     /translation="MPRSKRSKLVTLANTEKKGRENKERIFDEVREALDTYRYVWVLH
                     LDDVRTPVLQEIRSSWAGSKLILGKRKVLEKALGSKREDEYKENLHLLAKDCAGVTGL
                     LFTDESSQTVEDYFKTYSRSDYSRPNSRAPLTFTIPAGIIYSRGGQIPLEEDVPMVHS
                     LEPTLRNKFLIPTKIKAGKITLETPFTVCEKGEKLDVRKALILKQFGIADSQFKVKVA
                     SYYDTESSDVKKVSINMEK"
     gene            complement(<718483..>718977)
                     /locus_tag="HG535_0D03630"
                     /db_xref="GeneID:59236379"
     mRNA            complement(<718483..>718977)
                     /locus_tag="HG535_0D03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288488.1"
                     /db_xref="GeneID:59236379"
     CDS             complement(718483..718977)
                     /locus_tag="HG535_0D03630"
                     /inference="similar to AA sequence:RefSeq:NP_011857.2"
                     /note="similar to Saccharomyces cerevisiae SHU1 (YHL006C);
                     ancestral locus Anc_2.499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144383.1"
                     /db_xref="GeneID:59236379"
                     /translation="MSIEYVLASLLEPKKSNEDAVQTFIFVLGDKARAHVENGKKTES
                     HLLSSINAVVKSRDAIHVLFLNRLQYLFMYLMKFEAEEDPSAVKYDRFVVYGLDALLK
                     QVDDENDKINEDQLRLSNLIFNAAFRIKRKHSLKAITFVPFDDNSDLTMTLQRLERYW
                     RHVC"
     gene            <720361..>721599
                     /locus_tag="HG535_0D03640"
                     /db_xref="GeneID:59236380"
     mRNA            <720361..>721599
                     /locus_tag="HG535_0D03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288489.1"
                     /db_xref="GeneID:59236380"
     CDS             720361..721599
                     /locus_tag="HG535_0D03640"
                     /inference="similar to AA sequence:RefSeq:NP_011859.1"
                     /note="similar to Saccharomyces cerevisiae MRP4 (YHL004W);
                     ancestral locus Anc_2.500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144384.1"
                     /db_xref="GeneID:59236380"
                     /translation="MSAIIFYRGITYSRLSARKLLGRFQSTTSRADNRIEPETVESGL
                     KANIEDPEKAPEDEVFSLRQKQFNDQVVEQLNSISQLYKDEYSTFESQLKQNLTAKEK
                     QLDEELADFLKKYSQLNKLINAEDDAQDLSHKFISAAATQNRRYPYLVPSARDKPYTP
                     QELFLRQMKHAKHTARLGANIEKVYFPHRDVHNPPTADKMSIQKLLAAGVHLGQSTSL
                     WRPSTQSFVYGEYKGIHIIDLNKTLSYLKRAAKVVEGIAERGGIILFLGTRDGQKRAL
                     EEAAKKTHGFYISTRWIPGTLTNSTEISGVWERHEVDFADRPTGRVLSPDENSSIVKP
                     DLLVVLNPTENRNALKEAMQARIPTIGIIDTDSEPSIVTYPIPGNDDSLRSVNLLLSV
                     LAKAGETGLRNRIRKVVGTE"
     gene            complement(<721844..>723097)
                     /locus_tag="HG535_0D03650"
                     /db_xref="GeneID:59236381"
     mRNA            complement(<721844..>723097)
                     /locus_tag="HG535_0D03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288490.1"
                     /db_xref="GeneID:59236381"
     CDS             complement(721844..723097)
                     /locus_tag="HG535_0D03650"
                     /inference="similar to AA sequence:RefSeq:NP_011860.1"
                     /note="similar to Saccharomyces cerevisiae LAG1 (YHL003C)
                     and LAC1 (YKL008C); ancestral locus Anc_2.501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144385.1"
                     /db_xref="GeneID:59236381"
                     /translation="MSSSGNNLRPMTPATKLSAKSRTRRTSSVGKIDLGDTVPGIGTM
                     SETRAARAASNQRMKALASASKNDMDLLQKFWLTYREMSYRHAWVTPLVVLATVYGAY
                     FSSGNRTKTNPLNMFVTISYQIGDSNMYGKGIKDLYFVFFYMIFFTFLREFLMDIAIR
                     PLTKWLNVTSPHRVKRMMEQVYAIIYYGVSGPAGLYIMYNSDLWFFETAPMYRTYPDL
                     TNSFDFKLFYLCQAAFWAQQACVLVLQLEKPRKDYKELVFHHIVTLLLIWSSYAFHFT
                     KIGLLIYITMDVSDFFLSLSKTLNYLDSPVVPPVFFTFIAVWIYLRHYINICILWSVL
                     TEFRTEGSYVLNFATQQYKCWISLPIVFVLILALQLVNIYWLLLIFRILYRLLWKGIQ
                     KDERSETESDESDDEKDDLKAEKQN"
     gene            <723913..>725289
                     /locus_tag="HG535_0D03660"
                     /db_xref="GeneID:59236382"
     mRNA            <723913..>725289
                     /locus_tag="HG535_0D03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288491.1"
                     /db_xref="GeneID:59236382"
     CDS             723913..725289
                     /locus_tag="HG535_0D03660"
                     /inference="similar to AA sequence:RefSeq:NP_011861.1"
                     /note="similar to Saccharomyces cerevisiae HSE1 (YHL002W);
                     ancestral locus Anc_2.502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144386.1"
                     /db_xref="GeneID:59236382"
                     /translation="MSIRQAILKATDAKLRADNWQYILEVCDRVSEDPEDGGEEAVEV
                     IEQRLGQKDANVVLRTLSLIISLAENCGSRLKQAIDSKKFTKLLLSLIENRSVHNEVK
                     KEIVKTVQQLSQSFNDDPSLRYMSDLLRQITKSYPMLLNDQQPSVPSKKEMTLDSKQK
                     EEKELEEALKLSLVEFENQKNTQHSPAAQQQQQDEPRQQNAARQQGQVEGLAAPALVK
                     KVRAMYDLSGTEPDELSFSKGDVIIVLEQVYRDWWRGTLRGKVGIFPLNYVMPIEEQS
                     PQELRMEIEKENKIMGQKANVDQLYFTLKSAKSGNNENLGDPTQNPAINDLYGSVTPL
                     RPEVAKMIGKYARKREDLVSLRQVLANAEVTYNQLLDRATNAYTSPIPMAQSQPFDAR
                     VQEHHSYQTQPSENGNNTLQQMQQTRQQDLYPMPQAQLPQPPQYGANYAQTHTLFQAP
                     SYTSRTEY"
     gene            <725499..>726296
                     /locus_tag="HG535_0D03670"
                     /db_xref="GeneID:59236383"
     mRNA            <725499..>726296
                     /locus_tag="HG535_0D03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288492.1"
                     /db_xref="GeneID:59236383"
     CDS             725499..726296
                     /locus_tag="HG535_0D03670"
                     /inference="similar to AA sequence:RefSeq:NP_012918.1"
                     /note="similar to Saccharomyces cerevisiae CAP1 (YKL007W);
                     ancestral locus Anc_2.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144387.1"
                     /db_xref="GeneID:59236383"
                     /translation="MSDSQFESIISQIISDTPSGEIKQVYEDLITIAGENSKETVLDA
                     IEQYNIKNLIPIEVDGKSVVLSRYNREGSKFFDPASSISFNVDHLNREGFDIQPFQST
                     QLNQVQEDLLKNLQKYAEKNFPGYLTTSIYPIPEESNKIVLSIVSMKYNPSNFWNGHW
                     RSEYIFDSNFNKLKGSIDVQVHYYEDGNVSFKSSETFDLDDITDVIKTIAVKEKEFEE
                     NLDTSFSQLNETQFKSLRRRLPITRSRVNWGKAIGTYRLGKDAAQGK"
     gene            complement(<726372..>726751)
                     /locus_tag="HG535_0D03680"
                     /db_xref="GeneID:59236384"
     mRNA            complement(join(<726372..726629,726716..>726751))
                     /locus_tag="HG535_0D03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288493.1"
                     /db_xref="GeneID:59236384"
     CDS             complement(join(726372..726629,726716..726751))
                     /locus_tag="HG535_0D03680"
                     /inference="similar to AA sequence:RefSeq:NP_012919.3"
                     /note="similar to Saccharomyces cerevisiae SFT1 (YKL006C-
                     A); ancestral locus Anc_2.504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144388.1"
                     /db_xref="GeneID:59236384"
                     /translation="MSNSRYSQLENRNDQNLDNLASKLATFRSINQDIGDQAVNDSSV
                     ANQVSNAFDSMLNNVKNSSQRLTRSMNIGNNVWKMVGLTLLLFFILYTLFKLF"
     gene            <727822..>728430
                     /locus_tag="HG535_0D03690"
                     /db_xref="GeneID:59236385"
     mRNA            join(<727822..727950,728143..>728430)
                     /locus_tag="HG535_0D03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288494.1"
                     /db_xref="GeneID:59236385"
     CDS             join(727822..727950,728143..728430)
                     /locus_tag="HG535_0D03690"
                     /inference="similar to AA sequence:RefSeq:NP_011862.1"
                     /note="similar to Saccharomyces cerevisiae RPL14B
                     (YHL001W) and RPL14A (YKL006W); ancestral locus Anc_2.505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144389.1"
                     /db_xref="GeneID:59236385"
                     /translation="MSTDSIVKASNWRLVEVGRVVLVQKGQSAGKLAAISEIIDQKKV
                     LIDGPETGVPRQAINLGQVVLTPLSFSLPRGARTSTISKKWTASGVTEKWNATSWAKK
                     IAQRERRSTLSDFERFQVMVLRKQKRYAVKKAVAKA"
     gene            complement(<728669..>730135)
                     /locus_tag="HG535_0D03700"
                     /db_xref="GeneID:59236386"
     mRNA            complement(<728669..>730135)
                     /locus_tag="HG535_0D03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288495.1"
                     /db_xref="GeneID:59236386"
     CDS             complement(728669..730135)
                     /locus_tag="HG535_0D03700"
                     /inference="similar to AA sequence:RefSeq:NP_012921.3"
                     /note="similar to Saccharomyces cerevisiae BYE1 (YKL005C);
                     ancestral locus Anc_2.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144390.1"
                     /db_xref="GeneID:59236386"
                     /translation="MSLRRSNRSNKGTNKYMEALLREEQEQQNAQDSYVTEKDVKIAN
                     DGDAEYQNEDVQENHDDDFIDDAEDTDFRGTRAKKRHRTAPNKTNIGVKTNKRIKKDT
                     GTHADKDLKLRQNAKKLFADLFAKFIIPDTVNANVYTLQAETSVDLLTEKLSRSLEEE
                     LYNACFDKELNQLNRYYAEKVRILYSNIKDPKNLTLKDHIINGKIAFANLVRMNTSEL
                     ANPDLQHFKEEIDTKSLNKLIIEPPTEKPRWIKTHKGEELVEAQDEFKPENDIIFERD
                     NIMGRGRNSEFMKVEEEKHEGGSGILEEPSEEPLLLSPKGEVHQHVSDDNITKATSQS
                     MEVIVSYPEINNEFAGAVKYLGSSKELKENPYMTALGDGRLNVEGRLSKGRVLSYLNE
                     MKSIRNFLLFSINPNKSKSPVSEENFISLHDFLIKNEKVIGIECKKKYEKNIYLIPTE
                     YIGQSIIMGSVMSSDLSKNVVEDSTKLFMLIVIKPELL"
     gene            <731234..>732484
                     /locus_tag="HG535_0D03710"
                     /db_xref="GeneID:59236387"
     mRNA            <731234..>732484
                     /locus_tag="HG535_0D03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288496.1"
                     /db_xref="GeneID:59236387"
     CDS             731234..732484
                     /locus_tag="HG535_0D03710"
                     /inference="similar to AA sequence:RefSeq:NP_012922.1"
                     /note="similar to Saccharomyces cerevisiae AUR1 (YKL004W);
                     ancestral locus Anc_2.507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144391.1"
                     /db_xref="GeneID:59236387"
                     /translation="MATAIQRFFLSDKPPYSHIADLERSFNPKVTFKKVSNYKLKASD
                     YIHFGFLGSVFLFVLYANPAPLFYKLLFYALLCVLFIIPVTSQFFFNALPIWAWLALY
                     FTSSYIPATHRPKITVKVLPAVETVLYGDNLSELLAASTNIYLDILAWIPYGLFHFGA
                     PFVVAIILFLFGPPTVLRGYAFAFGYMNLLGVIIQNLFPAAPPWYKILYGLKTAYYGM
                     HGSPGGLKRIDKLLGIDLYTSGFENSSVIFGAFPSLHSGCSTMEALFFSYCFPKLKPL
                     FIVYVCWLWWSTMYLTHHYFVDLVAGSVLSYVFFQYTRLYHLPSDTSLFSRWSYSTIE
                     KYDMNKMNPLLSESNDIENVPLSNLETDFELNSMGERSTSPSIFDGATSTSRSSATSN
                     TSLGEFQNEYVGASPRVTSKLRFD"
     gene            complement(<732963..>733352)
                     /locus_tag="HG535_0D03720"
                     /db_xref="GeneID:59236388"
     mRNA            complement(<732963..>733352)
                     /locus_tag="HG535_0D03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288497.1"
                     /db_xref="GeneID:59236388"
     CDS             complement(732963..733352)
                     /locus_tag="HG535_0D03720"
                     /inference="similar to AA sequence:RefSeq:NP_012923.3"
                     /note="similar to Saccharomyces cerevisiae MRP17
                     (YKL003C); ancestral locus Anc_2.508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144392.1"
                     /db_xref="GeneID:59236388"
                     /translation="MLYELVSIVRVVNPTSANKEAKELATTIGKLVIQNRGVVRRILP
                     MGNKLLPRILKKDQEQHFQGFHFLMLFDSSAAVQSEILRTLKNDPRVIRSSIVKVKTN
                     KQLDIASSVEKSSGYNSILEKVSKDFI"
     gene            <733649..>734446
                     /locus_tag="HG535_0D03730"
                     /db_xref="GeneID:59236389"
     mRNA            join(<733649..733708,733805..>734446)
                     /locus_tag="HG535_0D03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288498.1"
                     /db_xref="GeneID:59236389"
     CDS             join(733649..733708,733805..734446)
                     /locus_tag="HG535_0D03730"
                     /inference="similar to AA sequence:RefSeq:NP_012924.2"
                     /note="similar to Saccharomyces cerevisiae DID4 (YKL002W);
                     ancestral locus Anc_2.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144393.1"
                     /db_xref="GeneID:59236389"
                     /translation="MSVLEWFFGKSLTPQERLKKNQRALERTQRELDREKRKLEAQEK
                     KLIADIKKSAKNGQVNAAKVQAKDLVRTKNYVKKFENMRTQLQAISLRIQAVRSSDQM
                     SRSMREATVLLGGMNRSMNIPQLQRIAMEFEKQSDLMDQRQEFMDESIDNVMGDELED
                     DEEAEEIVNKVLDEIGVDLNAQLQSTPQNLVSDGQLQESRERVAQPLGASGEVTSSNP
                     DDELQARLDSLKRQT"
     gene            complement(<734535..>735143)
                     /locus_tag="HG535_0D03740"
                     /db_xref="GeneID:59236390"
     mRNA            complement(<734535..>735143)
                     /locus_tag="HG535_0D03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288499.1"
                     /db_xref="GeneID:59236390"
     CDS             complement(734535..735143)
                     /locus_tag="HG535_0D03740"
                     /inference="similar to AA sequence:RefSeq:NP_012925.3"
                     /note="similar to Saccharomyces cerevisiae MET14
                     (YKL001C); ancestral locus Anc_2.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144394.1"
                     /db_xref="GeneID:59236390"
                     /translation="MATNITWHHNLTYKERQNLRKQDGCTIWLTGLSASGKSTIACAL
                     EQLLLQNNIAAYRLDGDNVRFGLNKDLGFSEKDRNENIRRISEVSKLFADSCTISITS
                     FISPYRTDREKARELHKESGLKFIEVFVDVPLEVAEQRDPKGLYKKAREGVIKEFTGI
                     SAPYEAPENPEIHMRTDLKSIEECAAEIFAFLSREKIIPGSD"
     gene            complement(<736190..>738286)
                     /locus_tag="HG535_0D03750"
                     /db_xref="GeneID:59236391"
     mRNA            complement(<736190..>738286)
                     /locus_tag="HG535_0D03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288500.1"
                     /db_xref="GeneID:59236391"
     CDS             complement(736190..738286)
                     /locus_tag="HG535_0D03750"
                     /inference="similar to AA sequence:RefSeq:NP_012926.1"
                     /note="similar to Saccharomyces cerevisiae VPS1 (YKR001C);
                     ancestral locus Anc_2.511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144395.1"
                     /db_xref="GeneID:59236391"
                     /translation="MDEHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSS
                     VLENIVGRDFLPRGTGIVTRRPLVLQLINRRVKKNDHSADSTTKQLIDLNIEDSNKDK
                     PENNQGQSEDNSQEWGEFLHLPGKKFFNFDEIRQEIVRETDKVTGANAGISSVPINLR
                     IYSPYVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDL
                     ANSDGLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQ
                     KDIERKKTIRQALEDERKYFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIK
                     AKIEATLKKYQSELYNLGPETMDSASSVVLSMITDFSNEYAGILDGEARELSSQELSG
                     GARISFVFHEVFKNGVDALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTDAFEVLVKQQ
                     IKRFEEPSLRLVNLVFDELVRMLKQIISQPKYARYPALREAISNQFVEYLKEAIIPTN
                     DFVVDIVNAEQTYINTAHPDLLKGSQAMTMVEEKLHPRQPAVDPKTGKALANQPPVKP
                     LQAEEKSGFFGGFFSTKNKKKLAALESPPPVLKASGQMTERETMETEVIKLLISSYFC
                     IVKRTIADIIPKALMLKLIVKSRTDIQKVLLEKLYGNQDIEDLTKENDITIQRRKECK
                     KMVEILRHASDIVSSV"
     gene            <738874..>740646
                     /locus_tag="HG535_0D03760"
                     /db_xref="GeneID:59236392"
     mRNA            <738874..>740646
                     /locus_tag="HG535_0D03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288501.1"
                     /db_xref="GeneID:59236392"
     CDS             738874..740646
                     /locus_tag="HG535_0D03760"
                     /inference="similar to AA sequence:RefSeq:NP_012927.3"
                     /note="similar to Saccharomyces cerevisiae PAP1 (YKR002W);
                     ancestral locus Anc_2.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144396.1"
                     /db_xref="GeneID:59236392"
                     /translation="MNYQKIYGITGPVSTAGSTAAENRLNDELIQELKREGSFETEQE
                     TENRVKVLKILQELAQEFVFRVSKKKNMSDGMARDAGGKIFTFGSYRLGVHGPGSDID
                     TLVVVPKHVTRDDFFMVFDELLRARPELEEIAPVPDAFVPIIKIKFSGISIDLICARL
                     DIAQVSQSLTLADKNLLRNLDEKDLRALNGTRVTDEILELVPKPIVFRIALRAIKLWA
                     QRRAVYANVFGFPGGVAWAMLVARICQLYPNANSAVILNRFFKILSEWKWPQPVVLKP
                     IEDGPLQVRVWNPKIYAQDRSHRMPVITPAYPSMCATHNITDSTRKVILEEFERGIRI
                     TTDIFSSKKKWVDLFEKHNFFYKYKFYLTAMAATRGNDEQHLKWSGMVESKVRLLVLK
                     LEALSGIKSAHPFTKPFEAVYCYSTNEDCKHILDSFGTHKTEEELRNFKRVTDENKGD
                     EEIEKQSKVYITTMYIGLDVNVEDKKEKIDIHVPCNEFFNLCRNFNEEYQDSEVYSLV
                     IKYVKLHDLPDDVYEEGEERPVKKKSKRKKMDKISNGSKRTKSETSNTKETCNNSDSA
                     ETNGSGTTQNGSVTASTATEVTKA"
     gene            <740922..>742253
                     /locus_tag="HG535_0D03770"
                     /db_xref="GeneID:59236393"
     mRNA            <740922..>742253
                     /locus_tag="HG535_0D03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288502.1"
                     /db_xref="GeneID:59236393"
     CDS             740922..742253
                     /locus_tag="HG535_0D03770"
                     /inference="similar to AA sequence:RefSeq:NP_011863.1"
                     /note="similar to Saccharomyces cerevisiae OSH7 (YHR001W)
                     and OSH6 (YKR003W); ancestral locus Anc_2.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144397.1"
                     /db_xref="GeneID:59236393"
                     /translation="MALGKLKAKSLQSSSSSVLTKDGATGSHEEVLDTDDVDENDESG
                     QNILLNIISQLKPGCDLSRITLPTFILEKKSMLERITNQLQFPDIVMDAHREHDDLQR
                     FVKVVKWYLAGWHIAPKAVKKPLNPVLGEHFTCYWDLPNKQQAFYIAEQTSHHPPESA
                     YFYMIPESSIRVDGVCIPKSRFLGNSTAAMMAGLTVLQFLDIMDSKNKPEKYTLSQPN
                     MYARGILFGKMRIELGDHMIIKGPKFQVDVEFKTKGFISGTYDAISGTIKDYEGKEYY
                     EISGKWNDVMYIKDLRDKCFKKTILFDTSKATVSKPKVRPLSEQGEYESRRLWKKVTD
                     ALAMRDHEVATEEKFKIENHQRELAKKRLEDGVEFHSKLFKRAGPHEDLDLDYYLYKK
                     IPGGNNHEEQIKSILEIAPILPGQKFTEKFQIPAYKKQEIQEKVLTQNSKS"
     gene            complement(<742377..>743561)
                     /locus_tag="HG535_0D03780"
                     /db_xref="GeneID:59236394"
     mRNA            complement(<742377..>743561)
                     /locus_tag="HG535_0D03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288503.1"
                     /db_xref="GeneID:59236394"
     CDS             complement(742377..743561)
                     /locus_tag="HG535_0D03780"
                     /inference="similar to AA sequence:RefSeq:NP_012929.4"
                     /note="similar to Saccharomyces cerevisiae ECM9 (YKR004C);
                     ancestral locus Anc_2.514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144398.1"
                     /db_xref="GeneID:59236394"
                     /translation="MLQLCQELYKILIANSAQGKFRLTFAPDQAGITERYFSVNEDQH
                     IEIVCFKKTYISIFEECHNYFFTNGYKNSKCKRNGLTMFQQITNEEPPLYQAPLDMNT
                     YVATIGLLLTTPENKTAINLYLDSVLYKLNDFSGLTNYKAAILQEEATLVGRLLTSSN
                     NKLNKSSSLWCLYRKLYLLLRDAAGTIDYITIFVCSASRHFSNYYCWETVRWFYDVVP
                     TELAKMELFSATKIFCLQNTRDSSSWSALAYMICQKKAKIDFNWHDSIRLQNSLKCGL
                     NFRQIPPGFDVDIEGVACDIAHSINTLTIQDWPPFLCLLSALNALPKNGTLSFLTSWK
                     EEVQAFETVCGPVTFKRRNPIVPINVSNDLMLFRKSKNVGFKKRFLDCLPSQSCKTDS
                     NC"
     gene            complement(<745543..>746331)
                     /locus_tag="HG535_0D03790"
                     /db_xref="GeneID:59236395"
     mRNA            complement(<745543..>746331)
                     /locus_tag="HG535_0D03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288504.1"
                     /db_xref="GeneID:59236395"
     CDS             complement(745543..746331)
                     /locus_tag="HG535_0D03790"
                     /inference="similar to AA sequence:RefSeq:NP_012931.4"
                     /note="similar to Saccharomyces cerevisiae MRPL13
                     (YKR006C); ancestral locus Anc_2.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144399.1"
                     /db_xref="GeneID:59236395"
                     /translation="MMILSAGGCAVAFRTAEKQMQRYAVGALHSTSKQSDFFSWFRKK
                     KEQEADSLVATQDTKELIKDIESGKKSKISNREKLDLRPENFIGDDSAKIERKARQAL
                     LMDVPFNVWLNGSKVANDQQLKSIAIESFNAASQDLTISSVDEAPYSADFTDLVTKFN
                     FTKLLQARTGYLIPDNKLTILNSPSQFVEFYCTEIISGKSSKFKESEPHAINLSTRHS
                     PPNVYIAPDIDAKSQKKRFGKIMYEAQSLEAEHTKKSIELIKRI"
     gene            <746574..>747071
                     /locus_tag="HG535_0D03800"
                     /db_xref="GeneID:59236396"
     mRNA            <746574..>747071
                     /locus_tag="HG535_0D03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288505.1"
                     /db_xref="GeneID:59236396"
     CDS             746574..747071
                     /locus_tag="HG535_0D03800"
                     /inference="similar to AA sequence:RefSeq:NP_012932.1"
                     /note="similar to Saccharomyces cerevisiae MEH1 (YKR007W);
                     ancestral locus Anc_2.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144400.1"
                     /db_xref="GeneID:59236396"
                     /translation="MGIVLSCCQDNDSEENEALLAGQQNGFGDDSAEDYNARQLQTKL
                     HEEQMRARDEALKEIVSNTNDKLIDISMISNSGIVIQGTDLKKGQGEMECISQERPRS
                     DADELILEGVGTGAMKYTVLDAEKVLSAEMRQQLKALHNAIFESLDEQLQEEIPSDLV
                     VSLSK"
     gene            <747315..>748991
                     /locus_tag="HG535_0D03810"
                     /db_xref="GeneID:59236397"
     mRNA            <747315..>748991
                     /locus_tag="HG535_0D03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288506.1"
                     /db_xref="GeneID:59236397"
     CDS             747315..748991
                     /locus_tag="HG535_0D03810"
                     /inference="similar to AA sequence:RefSeq:NP_012933.4"
                     /note="similar to Saccharomyces cerevisiae RSC4 (YKR008W);
                     ancestral locus Anc_2.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144401.1"
                     /db_xref="GeneID:59236397"
                     /translation="MPPKKRKLVEEEEEKPVTKYAAGKQPRNGVLPEVVYNHPMYPES
                     ELHQEMWTIPKFNLFISFTLNYLIESYKAMFKDFIKLPSRKFHPQYYYKIQQPISINE
                     IKSRDYEFPDGPHTFLLDIELLAKNCISYNEPDSLIVKNSLQVVQYIEYEVLKAKNVT
                     RNYLVSDDVKYRLLTYLKRVINATDKNIEEEMGVVHSNTDDVMKIAEPFMQLVDRDEL
                     PDYYEVIHRPTALGLIRQNLEVGYYSKIYDFIVDTQATFQNALVFNDLDTLIYQDAKK
                     LLGYFNHLMQHKFFPELQDASERGETKLEYDKIEYEQYLADGGNENTNELLEDDDLTD
                     YDFNHIEGLGNGYNRTILSEDYLLGPNATESQSKKPMLSTPIEEPPKILKYNIIKSMQ
                     KELISQEHTIEKVPYDMIDQVSIFSSKSLYHQATNPGPGAKPSCNQNWVAYTFNGAQM
                     NQNENMYSFNLQPVQTFLTLTAKIRHAGLESSLMVNSENIKSLKVSTDAMKQEDGQQL
                     EQNEEKEVIKNDSERFDIRLNEGLNYIVFKCQNSDKEKIEFMKFWVNVLP"
     gene            <749376..>750611
                     /locus_tag="HG535_0D03820"
                     /db_xref="GeneID:59236398"
     mRNA            <749376..>750611
                     /locus_tag="HG535_0D03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288507.1"
                     /db_xref="GeneID:59236398"
     CDS             749376..750611
                     /locus_tag="HG535_0D03820"
                     /note="ancestral locus Anc_2.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144402.1"
                     /db_xref="GeneID:59236398"
                     /translation="MQFSIIFRRYLHGKYLRVVLLLLVISVTTIFCSFKIGDTSLLVP
                     KGNSYSEKGKNSVKTSAEPTSNSKLRTGQDIILTLARNSELEDMKDSIISFERSFNSK
                     FHYDWWFMNDEEFDQEFKSVVKSLVSGDVKFIKIPKEYWSYPEHIDQKKAASSRNEYE
                     KKKVMYGKSESYRFMCRFNSGMFYKLPELEGVDYYWRIEPAVRFDCDITYDVFQYMRE
                     NDKQYAFSMALQEDIRTIPSLWDVTKEFFKDNPELIAPGNSIDFVTDDRGVSYNLCHF
                     WSNFEIASLEFFRESGYDEYFKFLDERGGFFYERWGDAPVHTIAVSVLLPAEKIHFVG
                     NTGYFHNPNQDCPRNSELRSSLKCRCDPSTDFTWHKWSCVNKFFEIHNYVRPDSLDNI
                     KKYYPTIYETIDLHESKDT"
     gene            <750970..>751275
                     /locus_tag="HG535_0D03830"
                     /db_xref="GeneID:59236399"
     mRNA            join(<750970..750978,751057..>751275)
                     /locus_tag="HG535_0D03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288508.1"
                     /db_xref="GeneID:59236399"
     CDS             join(750970..750978,751057..751275)
                     /locus_tag="HG535_0D03830"
                     /inference="similar to AA sequence:RefSeq:NP_011864.1"
                     /note="similar to Saccharomyces cerevisiae QCR10 (YHR001W-
                     A); ancestral locus Anc_2.520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144403.1"
                     /db_xref="GeneID:59236399"
                     /translation="MVSYISQLTSKSAGRFNFKGMAAIAPDLFLWGGAWAASLMVFTE
                     GWPRFQSTLYEKIPYFGQHWVDNTPAEDKPN"
     gene            complement(<751526..>754237)
                     /locus_tag="HG535_0D03840"
                     /db_xref="GeneID:59236400"
     mRNA            complement(<751526..>754237)
                     /locus_tag="HG535_0D03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288509.1"
                     /db_xref="GeneID:59236400"
     CDS             complement(751526..754237)
                     /locus_tag="HG535_0D03840"
                     /inference="similar to AA sequence:RefSeq:NP_012934.1"
                     /note="similar to Saccharomyces cerevisiae FOX2 (YKR009C);
                     ancestral locus Anc_2.521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144404.1"
                     /db_xref="GeneID:59236400"
                     /translation="MVSEKLLFKDKVVIITGSGGGLGKAYALEYAKRGAKVIVNDLGG
                     TLGGGGSSSRAADVVVEEIKKNGGIAVANYDSVNVHGDKIVQAAIDNFGRVDILVNNA
                     GILRDVSFAKMTENEFNAVVDVHLNGAYKLCKAAWPYMLDQKFGKIINTASPAGLYGN
                     YGQANYSAAKLGLVGMAETLAKEGFRHNIQVNAIAPLARSRMTENVLPPHILKQLGPE
                     KIVPLVLYLTHESTNVTNSIFELAGGFYGQLRWERSSGQIFNPNPKFFTPEAILNKWK
                     AVTDFKDKSFNEVQHPIQLSDYNDLIVKAKKLPVENDQGKKKIQSLRNKVVVITGAGG
                     GLGRSHAQWFARYGAKLVINDIRNPTDVVAELNEMFGAGTAVADTHDIVSQAFQVIET
                     ALKSFGRVDVLVNNAGILRDRSFKKMTDQEWFDVLKVHLTATFAMSKAAWPVFVKQKS
                     GYIINTTSTSGIYGNFGQANYAAAKAAILGFSKTIALEGFKRGIRVNVIAPHAETAMT
                     KTIFTQRELINHFDASQVSPFVVLLASGELQTLCGAKGVNGQLFEVGGGWCGQTRWQR
                     SKGFVAVDDPVEPELLRANWSEVTNFKGDTFNPSSTEDSSMAILQSVQNAQMGTKSKD
                     IFKYTSKDCILYNLGLGASSKELKYVYENDPNFQVLPSFVVIPFMSNISPLKMDRLVD
                     NFNYSMLLHGEQYFKLYECPLPTQGSLKTIAEPLQVSDKGGKAAVIIGGFKTYDSKTN
                     KLLAYNEGTFFIRGAREAKNRKPIKGERAKFATKVFKAPANRPPDFETEVKTDEDQAA
                     LYRLSGDYNPLHIDPKVAKSVKFPRPILHGLCTLGVSAKALLEHFGAYDELKVRFTNV
                     VFPGDKLKIRAWKEDNGTVIFQTVDVNRNVTVLDFAAVKLVGSGARL"
     gene            complement(<754620..>756239)
                     /locus_tag="HG535_0D03850"
                     /db_xref="GeneID:59236401"
     mRNA            complement(<754620..>756239)
                     /locus_tag="HG535_0D03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288510.1"
                     /db_xref="GeneID:59236401"
     CDS             complement(754620..756239)
                     /locus_tag="HG535_0D03850"
                     /inference="similar to AA sequence:RefSeq:NP_009847.4"
                     /note="similar to Saccharomyces cerevisiae APM3 (YBR288C);
                     ancestral locus Anc_2.522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144405.1"
                     /db_xref="GeneID:59236401"
                     /translation="MFISFYIADTKNALIFQYLLSSSSPLFSHLLTKIQNVCPELISE
                     HHDEERDESIMGQDSLKYTSSIHSSLGKDLEVYKYHSVTNNINYFCLTSLSKGQASIE
                     PLLFLENMDRILLEYFEKERLTVSKLINNHDRLSMIFYMCVDSGEPAVGRLHENMIKR
                     MVPMRSDLSKIINSTAHSFQKAVRQPALQNQRLFEHSATKGSLLFEQGSGSSTNDAFE
                     NEVVPWRTGNLKYKDNEIYVDVLETMHLVYSQRQKKRRRSYRGKNETGAEIKMVCGSI
                     CGQINFRSHISENPTIELDLNLAGNYLGVPSLHESVETSSEPGKPVDKLRFIPPDGKF
                     CLMEYNIDLDMLQARNAVYKSGSIGMVSVDFQDGLGSKHDEFEIIINISNSTKVTDIK
                     DLRIDVEVTPEVMPRNNTTDERSNKNKNQEVDDPNPDFSEHKIKVLRNTHGRFENDVV
                     PGKGTWIFQKDTAVGALPVLRGCVENVWNSAIYVKVKRVSVSYNYAGELASGIQVNAI
                     NITSGVRNLKSLKLFKGVKYTTASGDFVIRG"
     gene            <756421..>759438
                     /locus_tag="HG535_0D03860"
                     /db_xref="GeneID:59236402"
     mRNA            <756421..>759438
                     /locus_tag="HG535_0D03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288511.1"
                     /db_xref="GeneID:59236402"
     CDS             756421..759438
                     /locus_tag="HG535_0D03860"
                     /inference="similar to AA sequence:RefSeq:NP_009848.4"
                     /note="similar to Saccharomyces cerevisiae SNF5 (YBR289W);
                     ancestral locus Anc_2.523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144406.1"
                     /db_xref="GeneID:59236402"
                     /translation="MSASDANGRNNVSSNSPRGVGQGQANPFSKIGTPSFSISQIPAQ
                     ILQNLTPAQIQMIQQRHQHILMTRMQQQQQQQQQQQQQQQQQQQQQQQQQAQQQQTQQ
                     QQQQQQQAQQQQAQQQQAQQQQAQQQQAQQQQAQQQQAQQQQAQQQQAQQQQAQQQQA
                     QQQQAQQQQAQQQQQQLGQTQSPHQLTGQKGPIQQSQKSMVVPSQTQAQEHNQSSTPG
                     GMQQSLHLQQSPSSHPVASQQYQSQKEFKSSGMQNGEEEGASRLVNPQNTLPTQSMGN
                     SGTQSAPINLPPQIARLPLPTQQGVLDFLKQQALARNNPAVVTAVTLAQQQLQLQIQQ
                     QQEQAQISQQKKTYAQQGQKGQHAQSTPVHQVQLQEQARQVQQGQTSEIQGNLGQANA
                     GTVKKNIQFSQQKRQQHISIQQERSSHLNAYPNKDASMQVYPSNATAQSPSMEAAINS
                     MQLPPMPKLNLPKYQTINYDMPERNVPSSTFWSSQKRDTDTLLYEQIIQRDKANKFDL
                     ARENNGCEPFSIYGFSNKEYLGKLWHTLKYYQELKSTRMKSITNTSQNIPAASVWGKG
                     YSGYGNGVTNTVTQVIPESRVDDRPHVYQNKLQVYRQAMSEKSEDLVPIRLEFDHERD
                     KFFLRDTLLWNKNDSLVKIEEFVDDMMRDYRYAPSHREQFAENLTNSMKEQISEYQPN
                     PYLELNQERIGGDDMRINIKLDIVVGHNQLIDQFEWDISNSENCPEEFAEGMCQELCL
                     PGEFVTAIAHSIREQVYLYHKSLALLGYNFDGSVVEDDDIRSRMLPLITVDDVYRTPS
                     DAKVYTPNLLQISIAELERLDRDKDRDTRRKRRQGRSSRRGVILAGNVNNGAITNIGS
                     SALGNGASSTTNVPSASGIIEVSLPDIADIPRTFRTPVPTTTQPGGIDLGPPVGSYQL
                     ETATENVARPPRSPEAMPLCHIVDHVPGKFLLISINLKDKINRNLTDKREVGDEKTFI
                     SSLSSQPEASNYRRSETEHRVPANSNEAVIENE"
     gene            <759751..>760680
                     /locus_tag="HG535_0D03870"
                     /db_xref="GeneID:59236403"
     mRNA            <759751..>760680
                     /locus_tag="HG535_0D03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288512.1"
                     /db_xref="GeneID:59236403"
     CDS             759751..760680
                     /locus_tag="HG535_0D03870"
                     /inference="similar to AA sequence:RefSeq:NP_009849.1"
                     /note="similar to Saccharomyces cerevisiae BSD2 (YBR290W);
                     ancestral locus Anc_2.524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144407.1"
                     /db_xref="GeneID:59236403"
                     /translation="MIEGNLASDQQQVGSSTAAREIHEGQPSPNVMVTEAADDVAPEL
                     RTDEQNQEEASSSSGLGANSFSVNLLRRIKVAGKLFNILDRIYKKNNQQASHLQLGAN
                     FDGVFSNLSAKPDCQTNSSGSEQDHPPTYDEAAVDMAPSYYGVDDYSGLYNNEICIEG
                     LPVGNLANLIWNIVVSSSFQFIGFLITYILHTSHAAKQGSRFGLGITFLGYAYSMIPN
                     NVTSKVGKDKALDRVELQNPNEYDDLSPSSRPAKSGGYTSNLSSGLKQEKRELPALAV
                     VIGLLGGFIILKSIYDYVKVKKMEHKYQSQDPS"
     gene            complement(<760780..>761676)
                     /locus_tag="HG535_0D03880"
                     /db_xref="GeneID:59236404"
     mRNA            complement(<760780..>761676)
                     /locus_tag="HG535_0D03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288513.1"
                     /db_xref="GeneID:59236404"
     CDS             complement(760780..761676)
                     /locus_tag="HG535_0D03880"
                     /inference="similar to AA sequence:RefSeq:NP_009850.1"
                     /note="similar to Saccharomyces cerevisiae CTP1 (YBR291C);
                     ancestral locus Anc_2.525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144408.1"
                     /db_xref="GeneID:59236404"
                     /translation="MSSQPKKQVDPLKSFLAGSLAGAVEASITYPFEFAKTRLQLLDK
                     ASKSSRNPLVLIYNTAKTQSIASIYVGCPAFIVGNTAKAGVRFLGFDAIKNVLRDPQT
                     GELSGPRGIIAGLGAGLLESVVAVTPFEAIKTALIDDKQSLKPKYHNNGLGIARNYAS
                     LVRDKGLSGLYNGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSPKDKPLSSGLTFA
                     VGAFSGVITVYATMPIDTVKTRMQSLNASQYSSTLNCFATIFKQEGLKTFWKGATPRL
                     GRLILSGGIVFTIYEKVLLVLG"
     gene            <762440..>763504
                     /locus_tag="HG535_0D03890"
                     /db_xref="GeneID:59236405"
     mRNA            <762440..>763504
                     /locus_tag="HG535_0D03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288514.1"
                     /db_xref="GeneID:59236405"
     CDS             762440..763504
                     /locus_tag="HG535_0D03890"
                     /inference="similar to AA sequence:RefSeq:NP_011865.1"
                     /note="similar to Saccharomyces cerevisiae LEU5 (YHR002W);
                     ancestral locus Anc_2.526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144409.1"
                     /db_xref="GeneID:59236405"
                     /translation="MANEIETTQADINAKKQQIVTINKGSLDYVIRSGIAGGISGSCA
                     KTLIAPLDRIKILFQTSNPHYTKYAGSLVGLVEAAKHIWINDGIRGFYQGHSVTLIRI
                     FPYAAVKFVAYEQIRSFLIPSRDYELHWRRLMSGSLAGLCSVFLTYPLDLIRVRLAYV
                     TDHNRVKLTKIIRTIWSEPASVTLSSKPYVPQWFGHWCNFYRGYIPTVFGMIPYAGVS
                     FFAHDLLHDLLRLPSLAPHAVLKLSDEEEELRNHKKQRIPLKTWAELFSGGLAGMASQ
                     TAAYPFEIIRRRLQVSTLAPRNMYEHKFQSIGDITRIIYQERGWRGFFVGLSIGYIKV
                     VPMVACSFFVYERMKWHLGI"
     gene            complement(<763635..>764948)
                     /locus_tag="HG535_0D03900"
                     /db_xref="GeneID:59236406"
     mRNA            complement(<763635..>764948)
                     /locus_tag="HG535_0D03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288515.1"
                     /db_xref="GeneID:59236406"
     CDS             complement(763635..764948)
                     /locus_tag="HG535_0D03900"
                     /inference="similar to AA sequence:RefSeq:NP_011866.1"
                     /note="similar to Saccharomyces cerevisiae YHR003C and
                     YKL027W; ancestral locus Anc_2.527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144410.1"
                     /db_xref="GeneID:59236406"
                     /translation="MSKDAWKIIAVTALCSVAITKCIDIAWKLRSSKPPKVNTGIDKA
                     SKDKEYDDELFREQLARNYAFLGEEGMEKLKEQYIVVVGAGGVGSWVVTMLVRSGCFH
                     IRVIDFDQVSLSSLNRHSCANLSDVGTPKVNCLKEHLLKIAPWCEIEAINELWTIENA
                     ERLIYGGGKPTMVVDCIDNLNTKVDLLKYVYDQKLQVISSMGASTKSDPTRINIGDIT
                     ATEEDPLARSVRRRLKLKGVHTGIPVAFSAEKPDPRKAKLLPLPDEEYEKGKVGELSA
                     LKDFRVRILPVLGTMPGIFGLTIATWILAKVSGYPMDPIEGKNRMKLYDGLFQTLAGQ
                     MTRIGIKDQRVPVALSDVSYVLEEIFRGKSPISGYSTKLTLSKWDPSKPVSLQNVVIL
                     TKEERQKHEDRVLNGGEKLEDVYPKHILDRIDAKFQEERYYSQFR"
     gene            complement(<765220..>766644)
                     /locus_tag="HG535_0D03910"
                     /db_xref="GeneID:59236407"
     mRNA            complement(<765220..>766644)
                     /locus_tag="HG535_0D03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288516.1"
                     /db_xref="GeneID:59236407"
     CDS             complement(765220..766644)
                     /locus_tag="HG535_0D03910"
                     /inference="similar to AA sequence:RefSeq:NP_012897.3"
                     /note="similar to Saccharomyces cerevisiae TFA1 (YKL028W);
                     ancestral locus Anc_2.528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144411.1"
                     /db_xref="GeneID:59236407"
                     /translation="MDRPIDEIVKNLLKFVVRGFYGGSYVLLLDAILFHSVLAEEDLK
                     QLLGINKTDLGPLVARLRSDGLMSTHKQREYPPNSKSVERIYFYIKFPHAIDAIKWKV
                     HQVVQRLKDDLDKNSAPNGYMCEICSTKYSQLEAVQLLNYDRTEFVCSLCDHPLVEDD
                     SGKKNKEKQDRLNRLMDQVQPIIDYLKKIDDSRIDENTFETALARLIPPQNQSRAAYT
                     YNPKKGSTMFRPGDSSLTAGVDGTLLGNDSSRRAGANSQATLHVNITTANDEIAQRVL
                     QERQAEEKRKQNAVPEWHKQSTIGKSALGRLDEDEEFDPRTTAQANMSLEETAIDGVN
                     GDGKGVDEFYPKHRPLTEKEIEERENERTLNEYYASLAKKQKELKDDEEDDDDDDDEP
                     GDYDDVPLKDDDDDDDDDDDDDDLEDVAEKNDQEGEQNIKQEEPKVNGINGISGTTDS
                     NTNRRTSDDNDDDDEEMDIEFEDV"
     gene            <767908..>769872
                     /locus_tag="HG535_0D03920"
                     /db_xref="GeneID:59236408"
     mRNA            <767908..>769872
                     /locus_tag="HG535_0D03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288517.1"
                     /db_xref="GeneID:59236408"
     CDS             767908..769872
                     /locus_tag="HG535_0D03920"
                     /inference="similar to AA sequence:RefSeq:NP_012896.1"
                     /note="similar to Saccharomyces cerevisiae MAE1 (YKL029C);
                     ancestral locus Anc_2.529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144412.1"
                     /db_xref="GeneID:59236408"
                     /translation="MLASKTASSVTRRALLIRQTCRLYTSKSRSNFATTTRDTTFNQA
                     NFDESQVQKTPVGSKAKQLFESGKPKLTRLSVDGPIECPLQSFQLLNSPLFNKGSAFT
                     QEEREAFNLDALLPPQVNTLDEQVERAYKQLCYLKTPLAKNDFMTSMRVQNKVLYFAL
                     VRRHIRELVPIIYTPTEGDAIAAYSHRFRKPEGVFLDITEPESVERRLSVYGSDKDVD
                     YIVVSDSEGILGIGDQGIGGIRIAISKLALMTLCAGIHPGRVMPVCLDVGTNNKKLAR
                     DELYMGNRFARVRGKQYDELVDKFIKAVKKRFPNAVLHFEDFGVKNARRILDRYRNEL
                     SCFNDDIQGTGAVVMASLIAALKHTNRDLNDTKVIVYGAGSAGLGIADQIVNHMITHG
                     LTKEEARSKIYLMDRRGLILSSLQQTSTNAQHVYAKDDKEWEGCNTKSLLDVVSKVQP
                     TCLIGCSTQAGAFNKSIVQEMYKHNPRPIIFPLSNPTRLHEAVPEDLMQWTDFNALVA
                     TGSPFPPVNGYRISENNNCFSFPGIGLGAVLSRATVISDKMISAAVDQLASLSPLEEG
                     NSKPGLLPPLEVIQDTSSKVAAAVILQALNEGVARIEDEEVPGLPGKKVQVPRDFDKC
                     LTWVRNQMWEPIYRPMIKVNHDPSIHTHQI"
     gene            complement(<769942..>771192)
                     /locus_tag="HG535_0D03930"
                     /db_xref="GeneID:59236409"
     mRNA            complement(<769942..>771192)
                     /locus_tag="HG535_0D03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288518.1"
                     /db_xref="GeneID:59236409"
     CDS             complement(769942..771192)
                     /locus_tag="HG535_0D03930"
                     /inference="similar to AA sequence:RefSeq:NP_011867.1"
                     /note="similar to Saccharomyces cerevisiae NEM1 (YHR004C);
                     ancestral locus Anc_2.530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144413.1"
                     /db_xref="GeneID:59236409"
                     /translation="MNALSYISSNLQSSNQQDDSGDYSEVQNEEAGCSSAADGGGEGE
                     GSSAKQQVGIRTRIRLVVWSIVLFCPHYLILKPTQFLWFLVTSPLMLIEYGVKSKLHK
                     NRNKGGGQESSGALAATKSEVSSTLAKISENDEDDLSGGGELYLQRDFVKGSLLQTTA
                     TPARNSKANGGNLSATGHAHARSSGRSDTSSGNVLGTKKMGRFLFPKKLIPKSVLNAQ
                     RRKILVMDLDETLIHSASRNTSHSNSSQGHMVEVRFAVSGVSTLYYVHKRPYCDLFLS
                     KVSKWYDLVVFTASMKEYADPVIDWLESSIPGNFTKRLYRNNCILRDGVGYIKDLSIL
                     CGNSNQMAVANLNGGGLGEIILVDNSPVSYALNVDNAIQVEGWISDPSDTDLLTLLPF
                     LEALRYTTDVRDILALKNGEQAFS"
     gene            <771415..>772275
                     /locus_tag="HG535_0D03940"
                     /db_xref="GeneID:59236410"
     mRNA            <771415..>772275
                     /locus_tag="HG535_0D03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288519.1"
                     /db_xref="GeneID:59236410"
     CDS             771415..772275
                     /locus_tag="HG535_0D03940"
                     /inference="similar to AA sequence:RefSeq:NP_013785.1"
                     /note="similar to Saccharomyces cerevisiae NAT4 (YMR069W);
                     ancestral locus Anc_2.532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144414.1"
                     /db_xref="GeneID:59236410"
                     /translation="MCPPRPTRRNVTEPLFNTATQPQPVPLATSSSLTGTAPPSEEEK
                     TISPSMQINTQRFLELIHAEFPDQLATPRADTLHRRTFRIDHATPDNGCPSSATLPKL
                     LHLLATNLGQKYDACNARLYHNSTPWQQNKLHEMNTSGLAYVVYSSNDEPQMFLSFLI
                     CEECDIRKQHDQHQVLYLYEIQIHAAYQRMGLGRTLLHHLRRLVPSINSNLQLSVYCI
                     ELTVFGDNHNAIRLYKSVGGKLTFGSPKIEFEVENENQRVTRTTAAARNARSSRCRFV
                     IPLYFTFYIT"
     gene            <773505..>774407
                     /locus_tag="HG535_0D03950"
                     /db_xref="GeneID:59236411"
     mRNA            <773505..>774407
                     /locus_tag="HG535_0D03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288520.1"
                     /db_xref="GeneID:59236411"
     CDS             773505..774407
                     /locus_tag="HG535_0D03950"
                     /inference="similar to AA sequence:RefSeq:NP_013786.1"
                     /note="similar to Saccharomyces cerevisiae MOT3 (YMR070W);
                     ancestral locus Anc_2.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144415.1"
                     /db_xref="GeneID:59236411"
                     /translation="MMMMNWNHEQQQQQHFPIHQPMLSAQQQQQQQQQQQQQQQQPAQ
                     PSAPPPPQTQEGAFFFPQQHPPQQLPSQRHQALPSYQYFLSQTRSSPQNRSSSTEGPQ
                     QQQQQQQQQQQQQHPKLQPFLPGLSQARNTSVINTQTNTIVDNTATTVRTNPTDENSQ
                     SKNSSVDSSTTSSKFLNIKSDNRATSVDEESLIHKCHLCEKSFKRKSWLKRHLLSHSP
                     RRHFQCPWCLSKHKRKDNLLQHMKLKHTDYVLRELKRNDISFSPPSDTTNENIRTLLC
                     EGRLNKDEVKKVLNLLIDKHNDET"
     gene            complement(<774488..>774991)
                     /locus_tag="HG535_0D03960"
                     /db_xref="GeneID:59236412"
     mRNA            complement(<774488..>774991)
                     /locus_tag="HG535_0D03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288521.1"
                     /db_xref="GeneID:59236412"
     CDS             complement(774488..774991)
                     /locus_tag="HG535_0D03960"
                     /inference="similar to AA sequence:RefSeq:NP_013787.1"
                     /note="similar to Saccharomyces cerevisiae TVP18
                     (YMR071C); ancestral locus Anc_2.534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144416.1"
                     /db_xref="GeneID:59236412"
                     /translation="MAVNIRQFINVGGIISDLKSFNFSLYGQWFGYINIILCLALGIA
                     NLFHVSAVIAFGIVSIVQGLIILFIEIPFLLKICPLSNNFIEFIKKFETNGYRCLFYI
                     GMSVIQWCSIILQATSLIVVAVGLTISAISYGIAFSKHQEFQNTKILKNPQDDDFPHE
                     AIVREML"
     gene            <775285..>777309
                     /locus_tag="HG535_0D03970"
                     /db_xref="GeneID:59236413"
     mRNA            <775285..>777309
                     /locus_tag="HG535_0D03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288522.1"
                     /db_xref="GeneID:59236413"
     CDS             775285..777309
                     /locus_tag="HG535_0D03970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144417.1"
                     /db_xref="GeneID:59236413"
                     /translation="MNNREDLMIDVSTNCNIRDTEMASQAKLPSNEITSLSRKFQLST
                     FIYDLQHGLSFSNALTRLQTMKALMEQVVSEAIENNIDSEEDIFEDASSTIDEGDEPI
                     GIVPVTEPKKIPTYNNVIIPQDKDPMINTGSNNDHDDEHEHNNISCQHHHTETDTSYD
                     HLTVISQAEKTDHQFLRLRIGEINALDINSKQKATMVQKLMMGNYNIEPPSFKDGVRP
                     EQNPSEVQDTYLDALSSVNSDDWRPEYYKPGVYGCPHYQRACKLQCNICHSWHTCRFC
                     HDEKQNENSASYHPLQRNETKWIMCMRCQNVQRPSRNCEKCNEEFALYYCDKCVLYDN
                     DEAKDIYHCDKCGICRLGLGLGIDFFHCDGCQACLSIELLNNHKCIERATMSNCPICG
                     EYMFTSVKPVVYMSPCGHAIHQHCFDEYTKHSYKCPHCQVTVLNMDAQFRVLDKDIEE
                     QPLPEPYCNWICIVSCNDCKGRSKCPYHILGLKCGHCLSYNTVQLKLIKPGNKDDEDV
                     DPAALEQFNHSMNRSLSENLLNDHFQTEDISPLINMDNFVMSNIDHYMNSYFKEKPGK
                     LRESDNVNDFINTNGLFKSQTKARYSNEIMASTSMQRVSSLTEKFKQFISGNATTTSI
                     DSAISLQHTTERSIGEIFQVWRRDAAQFRGQDLSKDDSPTMPKIPDSEGS"
     gene            <777830..>779972
                     /locus_tag="HG535_0D03980"
                     /db_xref="GeneID:59236414"
     mRNA            join(<777830..777839,778762..>779972)
                     /locus_tag="HG535_0D03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288523.1"
                     /db_xref="GeneID:59236414"
     CDS             join(777830..777839,778762..779972)
                     /locus_tag="HG535_0D03980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144418.1"
                     /db_xref="GeneID:59236414"
                     /translation="MGAWISHDHPLQFQQLDHTDNQFHSPPQQQSLNQFQPQAFQPPY
                     HQQFQQQFGGQGSQQQFNQIRQQPQQPQQQHHQHQSQQQHQSQQQRQSQQQPQHTLSN
                     QQSQQQQAQYSQAGLPHQPNNSIPQLPQDFSYIQGNSGVQTINQQQLSELMYNSFLSH
                     LAQKQVSTALTSALGTASHINPATAAAAAGNTFLNQPTQRYFHNNVSNSATMMDATHP
                     AMMQPSQEVQVQAPQPVAKKMSSTQSRIEKRKQLKKQGPKRPSSAYFLFSMSIRNDLL
                     QQFPEAKVPELSKLASAKWKELTDDQKKPYYEEFRVNWGKYRVLRDEYEKTLPPKRPS
                     GPFIQFTQEVRPIVVKENPDKNLIEVTKMIGERWRGLDPEKKAEYTETYKRRLKEWES
                     CYPEETSEKTSKKK"
     gene            complement(<780310..>780939)
                     /locus_tag="HG535_0D03990"
                     /db_xref="GeneID:59236415"
     mRNA            complement(<780310..>780939)
                     /locus_tag="HG535_0D03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288524.1"
                     /db_xref="GeneID:59236415"
     CDS             complement(780310..780939)
                     /locus_tag="HG535_0D03990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144419.1"
                     /db_xref="GeneID:59236415"
                     /translation="MNFLRTPISRNQEDSNDTFKRPHIPITKESAANASRSLNIPHVR
                     FQDTSAVPIQAGCTTLKGGGYRKKVSLKPGHSALDWHALVTKKRSKGLVTRVDKLLGE
                     DVKTLEQLNSPHSLTQLKNGVPPYLIKPPLRINAEILRKHNTQEDCWSVINGRVYSMT
                     DYFDFHPGGVDILFKHCAGRDGTAAFNKYHRWVSVDKLLEISLVGIWIN"
     gene            complement(<781235..>783268)
                     /locus_tag="HG535_0D04000"
                     /db_xref="GeneID:59236416"
     mRNA            complement(<781235..>783268)
                     /locus_tag="HG535_0D04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288525.1"
                     /db_xref="GeneID:59236416"
     CDS             complement(781235..783268)
                     /locus_tag="HG535_0D04000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144420.1"
                     /db_xref="GeneID:59236416"
                     /translation="MANLHIFDPVTDEEIVTATSLLKDLHGDGKLSFSQVDRLDPPKK
                     DAIKYLDIERYGGGPLPYVPRRVYAYYYVNNKMPLYKAVVNVSEKFVISSKITPEGTV
                     GPLQPDGVAAIEKAILDHPIVQAEIAKLKLDKHTYSHPSLGKLKYTVICEPWMYGTDS
                     IHDKIPMIQAYMYLAVDHSESNHYSIPLKFSPVFEYLSHKFVRMDYLPSGADERFITE
                     TLPLSKIPAIVEYHPDLVEDYQPREGLKPLIISQPEGPSFNVDGSKITWQGWEFRVCS
                     NVREGFAIYDVHFKGRSLFYRASLVEMTVPYLDSRPPFHRKQAFDLGDCGFGNTANSL
                     ALGCHCLGVIKYLDTRRSDMEGNPVLIPSTICMHEQDYGLLFLHKNYRTDNSVVTRRR
                     EFVIQTIATVANYEYIINMIFDQAGAITVQVRATGILSTMPNDLNNVTDFGTIVAPGV
                     TAAFHQHLLSFRFDTRVDGDKNSVVYDDIVPMEEDLPHNKYNVGGYQKRSFVEKSGSV
                     DQSPFTNRTYKVINENSINPVTLKPVGYKFEMPAKQMILASPKSYNVKRAHYATKQFW
                     VTKYGEDQLYPAGEFTNQSQRDNGLVDWADGTDSVRNTDTVVWATLALTHPPVTEQFP
                     VMTSDFMQFLVTPASFFTQNPALDVPLASNNFNKSVYFEESVNKSASCCKSNL"
     gene            complement(<783604..>784068)
                     /locus_tag="HG535_0D04010"
                     /db_xref="GeneID:59236417"
     mRNA            complement(<783604..>784068)
                     /locus_tag="HG535_0D04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288526.1"
                     /db_xref="GeneID:59236417"
     CDS             complement(783604..784068)
                     /locus_tag="HG535_0D04010"
                     /inference="similar to AA sequence:RefSeq:NP_013790.1"
                     /note="similar to Saccharomyces cerevisiae YMR074C;
                     ancestral locus Anc_2.537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144421.1"
                     /db_xref="GeneID:59236417"
                     /translation="MDPELQALREARLAELKRSSGGPGPGDRDGSGSSNGAARDEPGA
                     GAIGSLIAGHLQPQALERLTRVSLVRPDRAKAVEQYLVQLLRQGTVTHKITEDEIVQI
                     LHGVAREQNKKNETKIIFNRRELVGNDELFSFSTKNSKANDDTDDDEDDFFD"
     gene            <784649..>786778
                     /locus_tag="HG535_0D04020"
                     /db_xref="GeneID:59236418"
     mRNA            <784649..>786778
                     /locus_tag="HG535_0D04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288527.1"
                     /db_xref="GeneID:59236418"
     CDS             784649..786778
                     /locus_tag="HG535_0D04020"
                     /inference="similar to AA sequence:RefSeq:NP_013791.1"
                     /note="similar to Saccharomyces cerevisiae RCO1 (YMR075W);
                     ancestral locus Anc_2.538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144422.1"
                     /db_xref="GeneID:59236418"
                     /translation="MEHSSRSSAPLESGGNPETSLNSLMPAPTSADDAQVSSKTVPKN
                     GKNGRKAVESISSDKPNSQVKRPRRTTSQYVDYNLKKRRIIPPDDYSKRGKPSSVTAS
                     NSEGDSDIFEEDQKSIIDLDENGTPQMNEPKHIIDAKNGATGVFLSQGPSEKIKKEYL
                     WNYKKNSSGSLTNNINNNKNSNSEMIIQPDWNFQDKLLENELYKSKLRTVKSESMTKL
                     SSLREQLRAKDIHENERDKLIDNVNRTEQESNDCNHSSRHSTTHIKIKATISKESKSK
                     LFGQNSIANLPPNSNCTKPNNSRLTNPAEEIENDDFCSSCSQTGSFLCCDTCPRSFHF
                     LCLNPPLNANNLPEGDWSCPQCTFKLKYSSQTQIKKVEKDFIQNKLPTKGKLFGKLIF
                     QLGATNPRQFKLPHAIRDYFVNINTGSRDQYQDEKEKDPLTEKQLFGTPYGQSITKLD
                     AYNPDSHFDPETGELLLCYKCGKSKMGTWDNPNDSRLITRCDYCRTPWHLDCIPEVPR
                     ASLKNLGTNWKCPLHAPTDKLMHKQRRMTKNQKFIEPFQTCGFKNNGDIDVDLVEISA
                     PGSRQMIESAKNIGNFPPVPILKESSIKLDFMDKIYRAKKVRRDNELKCQEHLIDRLI
                     VSSSLVAMENNHSNLAELISFIYFTLNKDAHAKKLWDFKELCHVAEQELEKVEISSGE
                     IKQLIILKKLLESKPKEELIRFFNLEP"
     gene            complement(<786900..>790781)
                     /locus_tag="HG535_0D04030"
                     /db_xref="GeneID:59236419"
     mRNA            complement(<786900..>790781)
                     /locus_tag="HG535_0D04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288528.1"
                     /db_xref="GeneID:59236419"
     CDS             complement(786900..790781)
                     /locus_tag="HG535_0D04030"
                     /inference="similar to AA sequence:RefSeq:NP_013793.1"
                     /note="similar to Saccharomyces cerevisiae PDS5 (YMR076C);
                     ancestral locus Anc_2.539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144423.1"
                     /db_xref="GeneID:59236419"
                     /translation="MAKTTFRFNKPIISTSDSFIATDELLSRLAALHEELSTTVQGEV
                     ELSSLDAYRLALVSKKLLRHKDLGVRSFVACCLSDVLRLYAPDAPYTEPQLTDIFKLI
                     LAQFEKLGDPENGYYIQQTYLITRLLEYRSIVLLTDLPSSGRLLEELFQIFYDDTKVF
                     GQKLFKVIGGILGEVISEFDSVPLPVLKMIFNKFLTYNPGKVPEGLGVVSNCGYEVSI
                     ILCDSYSSRMSRHLTKYYSEILYQITGENAVSAYDSKPSAFRTVEKLHKLVIRLWENV
                     PDLVSAVIGFIYHELLSDNETLRKQATKLIGSLLSVNSSINFVTTHSDTFKAWLSKIA
                     DVSVEVRQQWVESVPEVLSVRDDVSQEISKGLTKTLIDSEYKIRKSSVLVLSDVSVQR
                     IWMSITNATFFSCLLQLTREKNREVRELCILTVAQFYTESLEKIARTNQNADVWEVVD
                     TTPRVLFELYYINDQHINEQVDHAIFKYLLPFELDNEKRVKKILNMLSNFDKKAFASF
                     FAFNKRQLQISLALSKYVEFCDELNAKKDSEDDTDTANRFRKTVDWLASGLADKQKGT
                     AALEVLKLLNDKRVFYLIKTCIANDVPYSSLVNSMKELIIKIQDPALFRKNNVRNVSN
                     IIPKEIAHELEVLLYRSSPFIYNVSNISVFLDVGSHYSSDEITLKRKLLDNIAEVNPS
                     LFKEQIKTLKDTVEKHDVIDSNKDVLSVDETLKTLYKISKVMKDHLELDDTILHINLK
                     KLALKGNPLEAKYATKLIALLPSAQQKLKEVKSCLLPLNLQKDNNISSHIIVLAEIMK
                     YAPEILAEDSTDIVGYLIKEVLLKNQVVGDSKNQPKWLENFVLNDIRYSALSSKLFTL
                     KLFTNKLRSIAFEIPNDELSRAFTEKTMKLFSYLIASGGELISEQNKEYFPTPANYQT
                     KLRCCTGLQVLKLARVPILGDFINPTDIVKLINLVEDESLPVRKEFLDQLKHYISYEL
                     ISIKFLPLIFFTAYEPDAVLKSSTKTWINYTFTKPSFKKNTFFERALPRLIHAVAHHP
                     DIVEGLASKDDTYLNSLTTAIDYLLFYFDSVATQENFSLLYYLAERVKNYKDAVSNEQ
                     DFEDNDDQETQSTTVANGDELETACLRMYIIGELAQMILLSLKERQGWQHSTYPGKLN
                     LPADLFMPFSSVQEAQASFRTHLPDKFAGKLRLNIKAKVGRVLTASQTQRQKAQKRLL
                     ANEYHENEKKKRRVVKEPKESSAIANGDDQSYISPSRAEGKRGALPIVKKNLRVRKEI
                     DYKDADDDIDSSEEGQVAYDENNKNDDGGIE"
     gene            complement(<791210..>793036)
                     /locus_tag="HG535_0D04040"
                     /db_xref="GeneID:59236420"
     mRNA            complement(<791210..>793036)
                     /locus_tag="HG535_0D04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288529.1"
                     /db_xref="GeneID:59236420"
     CDS             complement(791210..793036)
                     /locus_tag="HG535_0D04040"
                     /inference="similar to AA sequence:RefSeq:NP_011855.1"
                     /note="similar to Saccharomyces cerevisiae YHL008C;
                     ancestral locus Anc_2.540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144424.1"
                     /db_xref="GeneID:59236420"
                     /translation="MVVDDAYYITPHEAALAAVATSMKKARLQFNTLVVNAILGGILF
                     SSGSILCVAIHSENPGIEENNPGILNMMSGIAFGIGLFYVVIMGADLFNSNILFFSVG
                     VLRRAVSVFDLLVSWTVCLFANLGGSLLVSYVFCHLSGVSSQPLWKTGSRALVEGKAS
                     FSFIETMLKAIVGNFLVCLAIYLQLLAKPIHVKFMVLVAPIFTFVACGFTHTVADMTL
                     SFIGMLNGADVSVGKYIWKLLIPAVIGNIIGGFSFSLVVPFYLHLVVVERDRKRLSLP
                     EYEARDEQPELNFDSRVVRITPHENRAEEEDAEEAEESEGDNLDGLSEKRATDDSFSN
                     QEDENIDHANFQGSYASLPEESAPRAYTASDVPSNLLTRFSTLKSNYSGHSLISTRSR
                     KRPILRSPQGVFPVRGMGEPLAREKTIENPYSVSARSSIDGFDSVEAKKIQIPRSLPI
                     KRSQTEVPPASRAVDDRSDEVHEAGSYSAIDDRPGAKLERAITRLVERKPRERKSTAE
                     LPRTTQDTFPFNRPAANSRTYSERPSSRNSSLFRTMSQQFIPRRHSENINDFNKELKQ
                     AGVSQKAAASSNSVAGIANYSPMDFPTPITAPLRKHNSHSTP"
     gene            complement(<793560..>796688)
                     /locus_tag="HG535_0D04050"
                     /db_xref="GeneID:59236421"
     mRNA            complement(<793560..>796688)
                     /locus_tag="HG535_0D04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288530.1"
                     /db_xref="GeneID:59236421"
     CDS             complement(793560..796688)
                     /locus_tag="HG535_0D04050"
                     /inference="similar to AA sequence:RefSeq:NP_012892.1"
                     /note="similar to Saccharomyces cerevisiae YKL033W;
                     ancestral locus Anc_2.541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144425.1"
                     /db_xref="GeneID:59236421"
                     /translation="MTDESLIFQELRPLCVELSRIAFQPQKVFNPNSTALLNALSRLD
                     TKLALYQNEVFSQSLADYLFVPIASLLKQERLGDQHTELVLLILSHMLRLSWREIGTF
                     PKELSQQLLTLINFLIAPNAKIMTLNKRSTSYRSSSAAVLLEYFRSLKNQVYVHEFFS
                     SVNSYNLSGLGHGITILLEILESSIPDPQVQLSALETLFLLYQGILKDGEILSFVLPG
                     NVSTFSKLLSKPGLTVNYKVVIRTLEIFGTLLALVYDDFSLMVHDNRPTNIQGIVNKQ
                     VHNQDQDSAKSNMITIDKATDFKRHRDSSWLRATSGQIKIALKSFVHKMTKRNNRNIM
                     TALADFLSHLLMRCSISLSNCEHLVLSALIELRMDPKYQLPKHHKCLVDIIREKISRI
                     NHIIQFEDVNGFKSLLFAIKVLNQCSFKYEDLMIPDLSMQVTEIIEQSSAMNGHHKIL
                     EQSSNVFMSEAFDKSLVKSANTPSPIFSCFSNEIEEYLGDLLIVLGSISADRNRLSEL
                     IETILTEDATVSLYRKTASLWLSTWLLKGMKEDAETSAQELLVFKEVQERDVTGCYSI
                     LEYCDSLAQEVVLASEGKALNRETETALRTILFSIEAVSGILKKDFECELIDHIYTVI
                     ENLASSSPTIRQSAQSSALSIAQNIYGGSVREMVLDNIDYLTESVSVRLNSGLTERVS
                     TVLGVICKIAGYQIIESFKDIFESIFKLIDHYHGYDEMCLQFFQLFEVIVLEMKKRYY
                     SQNDAQFKVTSDSTMRGSYEPWGMTSLQDLMSLLDEENIGKAEPENTALFDDDNTPKN
                     FEELFNSKVREIDSDDEDQEEEDDANGNAQQSFGGNEKIEWISPIPLASYRILLQIFN
                     YGDRLLTHRSRQLRIQILITLKLIVPMLATQYDSLLPQIAQSWDVMVACSIDHDLAVV
                     KYSCDCLQEMTRCSQDFITKRFLDLWGRWQEKSALLKELHPGRWSSIQNNSNKSLTLY
                     KTKFPPVAYKALLSMCNVLLEGISVAGLMLTDSTLKEMIYGCLQVLPAKTVSNQSFVA
                     ADVVYAITHDLV"
     gene            <796966..>798699
                     /locus_tag="HG535_0D04060"
                     /db_xref="GeneID:59236422"
     mRNA            <796966..>798699
                     /locus_tag="HG535_0D04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288531.1"
                     /db_xref="GeneID:59236422"
     CDS             796966..798699
                     /locus_tag="HG535_0D04060"
                     /inference="similar to AA sequence:RefSeq:NP_011853.1"
                     /note="similar to Saccharomyces cerevisiae YHL010C;
                     ancestral locus Anc_2.542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144426.1"
                     /db_xref="GeneID:59236422"
                     /translation="MEAIYRIQVDFLNTKQVNRAYNSFIAEERHTTDTSVSEALEERT
                     ECKEGFNQDNKQDWRIGELVIERQAEMKQNMDTQDKDLLISSYLGHGTVRLFRLNEAH
                     DLASFDKDLKIVPGDDTMVCILFVPTYFTVHDLLHFYIGDDIISKQISTFRILRNKKD
                     ELGYNYMVLIKFRDPVLAKNFKEEFNGKKFSKVDPETCHVVSIKEVVFKKSLFERLET
                     EKIPYLLTDPFTTIEGDIAPLKEVELPTCPVCLERMDSDTTGLITIPCQHTFHCSCLD
                     KWKNSQCPVCRYSTLRLSRNSAIRQTGETNGCSTCQCHENLWICLICGNIGCGRYNSK
                     HAIQHYEATSHCFAMDMRTQRVWDYAGDNYVHRLVQNEVDGKLVEVQADGLARQGNSH
                     NGIETNKDGEMASNFMRNKEYHLEYVQVLISQLESQREYYEMKLGQSRKVENQLEEQE
                     IVPVRKQFEQLKVTMKNSRSEWEQERATLKKEVDEDSLVIRGLQENLNHAATQRASLS
                     SEINNLKKSNSELKEQVQDLMFYLQTQEKFKDADESVREGTIVIPAALDPPSNSAKNS
                     RKKKVKKKKKT"
     gene            <799220..>800182
                     /locus_tag="HG535_0D04070"
                     /db_xref="GeneID:59236423"
     mRNA            <799220..>800182
                     /locus_tag="HG535_0D04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288532.1"
                     /db_xref="GeneID:59236423"
     CDS             799220..800182
                     /locus_tag="HG535_0D04070"
                     /inference="similar to AA sequence:RefSeq:NP_011852.1"
                     /note="similar to Saccharomyces cerevisiae PRS3 (YHL011C);
                     ancestral locus Anc_2.543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144427.1"
                     /db_xref="GeneID:59236423"
                     /translation="MATNSIKLLAPDVHRGLAELVSKRLGVQLTDTVLKRDPTGEVSF
                     SIGESVRDQDIFIITQIGSGIVNDRVLELLIMINASKTASARRVTAIIPNFPYARQDR
                     KDKSRAPITAKLMADMLTTAGCDHVITMDLHASQIQGFFDVPVDNLYAEPSVVRYIKE
                     NVNYKESIIISPDAGGAKRAATLADRLDLNFALIHKERARANEVSRMVLVGDVTDKIC
                     IIVDDMADTCGTLAKAAEILLENQAKSVIAIVTHGVLSGKAIQNINNSKLDRVVCTNT
                     VPFEEKMKDCPKLDVIDISSVLAESIRRLHNGESISYLFKHYPL"
     gene            complement(<800354..>801025)
                     /locus_tag="HG535_0D04080"
                     /db_xref="GeneID:59236424"
     mRNA            complement(<800354..>801025)
                     /locus_tag="HG535_0D04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288533.1"
                     /db_xref="GeneID:59236424"
     CDS             complement(800354..801025)
                     /locus_tag="HG535_0D04080"
                     /inference="similar to AA sequence:RefSeq:NP_012891.4"
                     /note="similar to Saccharomyces cerevisiae YKL033W-A;
                     ancestral locus Anc_2.544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144428.1"
                     /db_xref="GeneID:59236424"
                     /translation="MDGLLLNTEDIYTLSLNEILATYGKGPLTWDVKIHLQGLPGEEA
                     GQKVIDTYDLPISYEEYNRLNHDIQARMWGQCKFLPGAVELIKYLNSEKIPIALCTSS
                     AKIKYQLKTKHLQENFQLFDTIVTGDDPRIPKGRGKPFPNIWQLGLKELIEKFGTAIE
                     PQECLVFEDGIPGVKSGLAFGANVIWVPHPGAYEYLGDTKMLLGNNGELLKSLELLNK
                     SKYGL"
     gene            <801717..>803050
                     /locus_tag="HG535_0D04090"
                     /db_xref="GeneID:59236425"
     mRNA            join(<801717..801983,802652..>803050)
                     /locus_tag="HG535_0D04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288534.1"
                     /db_xref="GeneID:59236425"
     CDS             join(801717..801983,802652..803050)
                     /locus_tag="HG535_0D04090"
                     /inference="similar to AA sequence:RefSeq:NP_010669.1"
                     /note="similar to Saccharomyces cerevisiae YRA1 (YDR381W);
                     ancestral locus Anc_5.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144429.1"
                     /db_xref="GeneID:59236425"
                     /translation="MSANLDKSLDEIIGSGRKAVRARVNKRALGPGPRRAPKQVRRPI
                     VGDSRRAKFSADGTATRMARLLDASREAKVNVEGLPRDIKQDAVKEFFSSQIGGVQRV
                     LLSYNERGQSTGMANVTFKNGEMAKKAVAKFNGAPIDGGRSKLKLNLIIDPNQQPVRS
                     LSDRIRAVPQKNNRQSNIPQKKAPNKKAALVEKQKVPRAKPEKKSLEDLDKEMADYFE
                     EKK"
     gene            complement(<803356..>803760)
                     /locus_tag="HG535_0D04100"
                     /db_xref="GeneID:59236426"
     mRNA            complement(join(<803356..803659,803741..>803760))
                     /locus_tag="HG535_0D04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288535.1"
                     /db_xref="GeneID:59236426"
     CDS             complement(join(803356..803659,803741..803760))
                     /locus_tag="HG535_0D04100"
                     /inference="similar to AA sequence:RefSeq:NP_219495.2"
                     /note="similar to Saccharomyces cerevisiae YDR381C-A;
                     ancestral locus Anc_5.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144430.1"
                     /db_xref="GeneID:59236426"
                     /translation="MSAKHVGKNILYASILAVISVTVVKGIIRSKKEARYTPPALARG
                     KNDSEQSKEYYDNLADVKPGFPLPKDNPEDQSTRKSQFEGSGMSVLSRKRGDRLGFID
                     RRSEK"
     gene            <804229..>805233
                     /locus_tag="HG535_0D04110"
                     /db_xref="GeneID:59236427"
     mRNA            <804229..>805233
                     /locus_tag="HG535_0D04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288536.1"
                     /db_xref="GeneID:59236427"
     CDS             804229..805233
                     /locus_tag="HG535_0D04110"
                     /note="ancestral locus Anc_5.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144431.1"
                     /db_xref="GeneID:59236427"
                     /translation="MSTEDRASQQNVGEIVHALSGAGAGVLSLSVTYPLLTISTKLQS
                     EDKNKDAQIEQKKSAKEIIKSIYAKDGLLGYYAGLESAVYGIAVTNFVYYYFYELAAN
                     SIKRVRANNQLNTLQSMATGAVAGSITAIVSNPIWIANTRMTVTKSQESTLSTIIKII
                     QKDGPMTLFNGLKPALILVLNPVIQYTVFEQLKNIILALQKKKNQKEVLSPLWAFVLG
                     ALGKLIATGATYPYLTLKTRLHLAGHDNVNKKSAEAGQRSEEKVTMISEALKIIKKDG
                     VSGFYSGISYKLVQSILNAAFLFFFKEGLVMWSVRLISEMRSVISMKNKMLKIQAVKK
                     "
     gene            complement(<805314..>806207)
                     /locus_tag="HG535_0D04120"
                     /db_xref="GeneID:59236428"
     mRNA            complement(<805314..>806207)
                     /locus_tag="HG535_0D04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288537.1"
                     /db_xref="GeneID:59236428"
     CDS             complement(805314..806207)
                     /locus_tag="HG535_0D04120"
                     /inference="similar to AA sequence:RefSeq:NP_014773.4"
                     /note="similar to Saccharomyces cerevisiae ORT1 (YOR130C);
                     ancestral locus Anc_5.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144432.1"
                     /db_xref="GeneID:59236428"
                     /translation="MEDSIIIAEQRDRGLQSKALRDIINGSIAGAIGKTIEYPFDTIK
                     VRLQTQDSKLFPTTWSCIQYTYKNEGIMRGFFQGIGSPVFGASLENAVLFFSYNQCAA
                     LLEKHTEFSQLQQIITSGAFAGSCASLVLTPVELIKCKLQVSNLQNAAKGETRPTQII
                     PTIKAVLKERGLLGLWQGQSGTFLRESFGGCAWFATYELLKEYLKSTHKDGSDVYTWE
                     LLASGASAGLTYNASIFPVDTLKSMMQTEQIGLIDCAKKIFAKSGISGFYRGLGITLA
                     RAVPANAAVFYTYESLSKMSF"
     gene            <806876..>807211
                     /locus_tag="HG535_0D04130"
                     /db_xref="GeneID:59236429"
     mRNA            <806876..>807211
                     /locus_tag="HG535_0D04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288538.1"
                     /db_xref="GeneID:59236429"
     CDS             806876..807211
                     /locus_tag="HG535_0D04130"
                     /inference="similar to AA sequence:RefSeq:NP_010670.3"
                     /note="similar to Saccharomyces cerevisiae RPP2B
                     (YDR382W); ancestral locus Anc_5.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144433.1"
                     /db_xref="GeneID:59236429"
                     /translation="MKYLAAYLLLTQGGKESPSAADIKSVIESIGVEADDARINELLS
                     SLQGKGSLDEIIAEGQQKFASVPAGGAASAGAAAGGAAAGGDAAAEEEAAEEEKEESD
                     DDMGFGLFD"
     gene            complement(<807333..>808043)
                     /locus_tag="HG535_0D04140"
                     /db_xref="GeneID:59236430"
     mRNA            complement(<807333..>808043)
                     /locus_tag="HG535_0D04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288539.1"
                     /db_xref="GeneID:59236430"
     CDS             complement(807333..808043)
                     /locus_tag="HG535_0D04140"
                     /inference="similar to AA sequence:RefSeq:NP_010671.4"
                     /note="similar to Saccharomyces cerevisiae NKP1 (YDR383C);
                     ancestral locus Anc_5.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144434.1"
                     /db_xref="GeneID:59236430"
                     /translation="MYKEIADFVSHSAGLHSVEPIDDLQEQIPNACLQALRAQVDLKR
                     HELYKLSKQDAICKQVVDFESDWRREQLNLISDLIGDIPRYSIGTELRGDDDDSNDPG
                     LSLEKLMQDIGNLPRIGIASSNSIADNQERDVRILNEYSNLRKELVNKCHAIAFGNTK
                     IEETENKLNKIRHLLESIEEKLDPTENITDFFARYDGEIRLNLEEFTFLLEDAIKRSD
                     TSPLTQANLKEMMKRVSI"
     gene            808189..808260
                     /locus_tag="HG535_0Dtrna4D"
                     /db_xref="GeneID:59236654"
     tRNA            808189..808260
                     /locus_tag="HG535_0Dtrna4D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:59236654"
     gene            complement(<808462..>809298)
                     /locus_tag="HG535_0D04150"
                     /db_xref="GeneID:59236431"
     mRNA            complement(<808462..>809298)
                     /locus_tag="HG535_0D04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288540.1"
                     /db_xref="GeneID:59236431"
     CDS             complement(808462..809298)
                     /locus_tag="HG535_0D04150"
                     /inference="similar to AA sequence:RefSeq:NP_010672.1"
                     /note="similar to Saccharomyces cerevisiae ATO3 (YDR384C);
                     ancestral locus Anc_5.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144435.1"
                     /db_xref="GeneID:59236431"
                     /translation="MTSGSSESISQGSEKDGIRALHGDNVSRGAEGTRPQERVVRSIS
                     AEGEYVTIGDQTFRRSEFVNIFASDLDEETYRRRPKSKKLANPIPLGLASFSFCCLTL
                     SLCNARVRGVTNNNLLISAFMFFGGAIELFAGLLCFCTGDTYAMTVFSSFGGFWICWG
                     CINIEQFGVARAYADDPEMLSSIQGFFLAGWTVFTFLVMICSMKSTWGLFLLLFFLDL
                     TFLMLCIGTFISNVNVLMAGGYFGILSSCCGWYSLYCAIASPSNSYVPLVAYPMPDAG
                     LV"
     gene            complement(<810064..>810702)
                     /locus_tag="HG535_0D04160"
                     /db_xref="GeneID:59236432"
     mRNA            complement(<810064..>810702)
                     /locus_tag="HG535_0D04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288541.1"
                     /db_xref="GeneID:59236432"
     CDS             complement(810064..810702)
                     /locus_tag="HG535_0D04160"
                     /inference="similar to AA sequence:RefSeq:NP_014774.1"
                     /note="similar to Saccharomyces cerevisiae YOR131C;
                     ancestral locus Anc_5.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144436.1"
                     /db_xref="GeneID:59236432"
                     /translation="MTKILPTSFKGIRAVVFDMDGTLCLPQPWMFPAMRESVGLTDKS
                     MDILTFIEKAPSSLEREQALQRIEAVEAKAMREMIPQPGLVPLMKYLSLKNLSKNVLT
                     RNLLPPVTHLITSYIPIEYRHFDHIITREFKPPKPSPEPLLHIAGLLSLAPDQIMMVG
                     DSYDDMKSGRQAGCVTVLLRNPANSPMLDHGEHSSLIDVAVDDLSEIISLID"
     gene            <810985..>812664
                     /locus_tag="HG535_0D04170"
                     /db_xref="GeneID:59236433"
     mRNA            <810985..>812664
                     /locus_tag="HG535_0D04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288542.1"
                     /db_xref="GeneID:59236433"
     CDS             810985..812664
                     /locus_tag="HG535_0D04170"
                     /inference="similar to AA sequence:RefSeq:NP_014775.3"
                     /note="similar to Saccharomyces cerevisiae VPS17
                     (YOR132W); ancestral locus Anc_5.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144437.1"
                     /db_xref="GeneID:59236433"
                     /translation="MTSVVAYDPNEDDDDMIDNNPFARSILENQPSIGETPPQEENES
                     EERRENSHNEAEQEQQVLRDASLDPNDDNQQEEEESFRILPERRPSKYTLLVKIKGME
                     RIGSTSNKKENPTLIMDVQTNLPTFRKQNHKNIRKTPDEFQQLFKYLNGAIQESFIPS
                     VPRSFTNYGINSNEDYEKTIKNFQEWFNRICEDPLILRNEEVAFFIESDFNTYSPINK
                     SKLPATGLKRKTLKQLAPPYDETVELAEFRPLVKSIYWRCQDIDSKLSKVSRSKKILS
                     QEENSFGQGFVNMDDQGQSHLYKKFGKILIAVGDIDSVIATLDIATLHDALEWIVKDS
                     YVVKEALTNRHLIMRELMQAQQILRTRQDQARKLRAKRDINPLKVDEALRHLKTSTMD
                     EQLLTNKLKRVTMNMLIERQTWLEWYENKMSNSIKEYALRKIEYERKKLTLLERIRSD
                     VRRADTNGGLSRLGREGRVSGNDAMTTDIISQSVDGDDWTGEARRRSTSQMDKLAHTE
                     FDKALTIEAGAATFSETQSSSPFDTNETARASESTSLDARSAATMLGLPTF"
     gene            <813054..>815582
                     /locus_tag="HG535_0D04180"
                     /db_xref="GeneID:59236434"
     mRNA            <813054..>815582
                     /locus_tag="HG535_0D04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288543.1"
                     /db_xref="GeneID:59236434"
     CDS             813054..815582
                     /locus_tag="HG535_0D04180"
                     /inference="similar to AA sequence:RefSeq:NP_010673.1"
                     /note="similar to Saccharomyces cerevisiae EFT2 (YDR385W)
                     and EFT1 (YOR133W); ancestral locus Anc_5.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144438.1"
                     /db_xref="GeneID:59236434"
                     /translation="MVAFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQKAG
                     IISAAKAGEARFMDTRKDEQERGITIKSTAISLFAEINDEDVKDIKQKSDGNSFLINL
                     IDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQALGERIKPVVVINKV
                     DRALLELQVTKEDLYQSFSRTVESVNVIISTYADEVLGDVQVYPSQGTVAFGSGLHGW
                     AFTIRQFANRYGKKFGVDKSKMMERLWGDSYFNPKTKKWTNKETDASGKPLERAFNMF
                     VLDPIFRLFAAIMNFKKDEIPVLLEKLEINLKGDEKELEGKALLKVVMKKFLPAADAL
                     LEMIVMHLPSPVTAQNYRAEQLYEGPSDDPFCLAIKKCDPNADLMLYVSKMVPTSDKG
                     RFYAFGRVFAGTVKSGQKVRIQGPNYVPGKKDDLFLKAIQRVVLMMGSRTEPIDDCPA
                     GNIVGLVGVDQFLLKTGTLTTNEAAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGL
                     KRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLENDHAGIPLKISPPVVAYRET
                     VEGESSQVALSKSPNKHNRIYLKAEPIDEEVSLAIENGKINPRDDFKARARIMADEFN
                     WDVTDARKIWCFGPDGNGPNLVVDQTKAVQYLHEIKDSVVAAFQWATKEGPIFGEQMR
                     SVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAV
                     GGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVF
                     DHWATLGSDPLDPTTKAGEIVLAARKRHGMKEEVPGWQEYYDKL"
     gene            <815835..>817700
                     /locus_tag="HG535_0D04190"
                     /db_xref="GeneID:59236435"
     mRNA            <815835..>817700
                     /locus_tag="HG535_0D04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288544.1"
                     /db_xref="GeneID:59236435"
     CDS             815835..817700
                     /locus_tag="HG535_0D04190"
                     /inference="similar to AA sequence:RefSeq:NP_010674.3"
                     /note="similar to Saccharomyces cerevisiae MUS81
                     (YDR386W); ancestral locus Anc_5.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144439.1"
                     /db_xref="GeneID:59236435"
                     /translation="MSLPSNLKNLYAEWLQELIVELNPRQEQLNLTYEKARRHLLETE
                     GIIFYPKDLKKIKGIGETIMKRLEKKLMQHCQEIGAEFPQPRPAVESSSLGKRTTTIL
                     RSKSFNGGFDEPEEQQLPKKKKVSYIPRKRSGGYGILLALLEHRAILKGISRDDVIKT
                     AQKYCDSSMDPNFMTKELRGAWSAIHSLKKHDLVLEGGRPRKYSLTEAGVTMATTLKS
                     AADITFPFENQTSAGHQCESETSCADITADFCALFESDSNKRREALLDNESTSLMDMT
                     FHNSIVAESKEEDIPRNDDTMTTSSPKLTSNRHKTVNRDHILKRKFNGVSYELWLQGS
                     YEVYPIIDHREIKSHGNRDFFSIALETKGIKCGMRQLALGDILWVAKHKKSGSECIIN
                     TIIERKRLDDLAFSIRDNRFMEQKSRLDKSGCRNKYYLIEETMSKALEGMNEALKTAL
                     WLILVYYRFSMIRTSNSDETVDRLHALHTVIVKEYSKKKLIVIYPTSLRNQDDYLKVL
                     EQFRDEFEKFPDIECCHSFQCFQEILGKGELSTIRELTIQILMYVKGVSIEKAVAIQT
                     LFPTLNHLLVAYRNCRTDEEAKLLMFHKLGEAPGAKKITKSLSEKLAGVFGSFTS"
     gene            complement(<817789..>819438)
                     /locus_tag="HG535_0D04200"
                     /db_xref="GeneID:59236436"
     mRNA            complement(<817789..>819438)
                     /locus_tag="HG535_0D04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288545.1"
                     /db_xref="GeneID:59236436"
     CDS             complement(817789..819438)
                     /locus_tag="HG535_0D04200"
                     /inference="similar to AA sequence:RefSeq:NP_010675.3"
                     /note="similar to Saccharomyces cerevisiae YDR387C;
                     ancestral locus Anc_5.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144440.1"
                     /db_xref="GeneID:59236436"
                     /translation="MEQRREANVRSSYEVDEVYSDLYSTLSQVTSTTANDIEQLLFSF
                     TWRTCFILLGATVGGLLFGYDTGVISGVLLSLKPQDISRSVITNFDKEIITSITCVGS
                     FFGSALAIPMADKYGRKMTLAYCCIVFVLAALLMATSMTLTFLVFGRFIVGIAVGIAA
                     QCVPVYMSEISPSNARGTILTLNSLAITGGQLISYIISFFFSSIDQSWRYLFGLSAIP
                     ALLFICLLDFIPESPRWLISFGSLTKAHESIKIIYPKATPRQIALKLKRLIIDINKMR
                     RYQDVEEPLLRRSSCFFFRYNHSSNSLQLLEEPPTDPSNSEVFILPKNAGQRSTRRRI
                     HRMEPRAKRALTVGCVLMFFQQITGFNAFMYYATIIFANLKVENPLIPAMAVAFTNFI
                     FTFVALKLVDSVGRRSTLLCTVFIMIIGLLLSSVGFARTDTRLIITSLLIFVAAYASG
                     MGAIPWSTVELLPLNRRSFGSGCISCVNWLTNAIVSMSYLSIMNRVGNEHTMMIFVFF
                     AVLNWIFVYFFFPEVKGLSLEEIGKVFENGIDVHYVYRNYH"
     gene            <819910..>821337
                     /locus_tag="HG535_0D04210"
                     /db_xref="GeneID:59236437"
     mRNA            <819910..>821337
                     /locus_tag="HG535_0D04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288546.1"
                     /db_xref="GeneID:59236437"
     CDS             819910..821337
                     /locus_tag="HG535_0D04210"
                     /inference="similar to AA sequence:RefSeq:NP_010676.1"
                     /note="similar to Saccharomyces cerevisiae RVS167
                     (YDR388W); ancestral locus Anc_5.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144441.1"
                     /db_xref="GeneID:59236437"
                     /translation="MSFKGFTRAVARAPQSFRHKFNMGEQIEDPVYEDAERRFKELEI
                     EVKKLSDESKRYSGAVNGMLSHQIGFAKAMEEIFKPISGKMSDPNAAVPEDNPEGIEA
                     CEQYKAIVAELQEALKPDLALIDEKIMAPCQELLKTIGYIRKMSTKRNHKKLDLDRHY
                     NTYKKQETKAKPQPKDEERLYKAQAEMEVAQQEYDYYNDMLKNQLPLLFTLEAQFVQP
                     LFVSFYFMQLNIFYTLYNRFQEMKIPYFDLNSDIVETFHFKRGNVEEQCDSLTITNFK
                     VGYSKAKLEMTRKKYGAGGAPGMQSPTSPGTPGAPSGYDPVTGQPIYQSSQPGYGSPA
                     AAGYAGSPAGYAGAVPGYAGAAVTSPGAYGAQSPQPAGYGATMTPTAYPGSFQSPDAA
                     AAPPAYTTGVPMQTPVQPQPTPAVETVTALYDYQAQAAGDLSFPAGAVIEVVQRTADP
                     NEWWTGRYNGQEGVFPGNYVQVHKQ"
     gene            <822106..>824091
                     /locus_tag="HG535_0D04220"
                     /db_xref="GeneID:59236438"
     mRNA            <822106..>824091
                     /locus_tag="HG535_0D04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288547.1"
                     /db_xref="GeneID:59236438"
     CDS             822106..824091
                     /locus_tag="HG535_0D04220"
                     /inference="similar to AA sequence:RefSeq:NP_010677.1"
                     /note="similar to Saccharomyces cerevisiae SAC7 (YDR389W)
                     and BAG7 (YOR134W); ancestral locus Anc_5.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144442.1"
                     /db_xref="GeneID:59236438"
                     /translation="MTNSNPIVTVSPAKSPISALWKQWSNNPKSASSESLGLPSINQS
                     KAGSDSKKSVYSDVNSQALSKNTMSALSSSPQPSDDYKNYRDNFLSNRHGFTGRVFGV
                     SLSESLSIASAEVIVQSELVSFGRIPVVVAKCGAYLKKYGLETSGIFRIAGNSKRVKE
                     LQYIFSSPPDYGAKFSSWDSYTVHDVASLLRRYLNNLKEPLIPLDLYEDFRKPLKDKP
                     RIIKYMTSQPVMNPGQSGNNANTIKSNKDAQQAVVPVDDRENDGDEELEDDSKTLAEE
                     ENKKKQRHKKRLIRDIRAAIKDYETLFISISNDAKQLTIYLLDLLSLFSRQSQFNLMS
                     ARNLAAIFQPSILSHPQHDMDPREYELSRVVTEFLIEYSYKLLPHLLKLAKSEQEIAK
                     IESQKKSKTSAKEEQLKERVNADVVKTAKVVIANEEKEELTTAIPSSKPINILPPKKI
                     DISQATGISFSADKKYEMSPKKQQLQLPRHGRPHSKSFGSVVTPPDVIASSKRRSKLF
                     PWLHKPGILSDNGGDLTATEEEGEEGYFDERESDGFAQSPGSSFSNSAPRQVYLPIPN
                     MDRSLSWNSITSPSRRPMSTIFSGSRNNSVEAFEGLSSARRARSSSGNEQSNLGTSSN
                     PMADGQEESTEERHSRSRRSESWFRRLRSRSRSKTRS"
     gene            complement(<824279..>826180)
                     /locus_tag="HG535_0D04230"
                     /db_xref="GeneID:59236439"
     mRNA            complement(<824279..>826180)
                     /locus_tag="HG535_0D04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288548.1"
                     /db_xref="GeneID:59236439"
     CDS             complement(824279..826180)
                     /locus_tag="HG535_0D04230"
                     /inference="similar to AA sequence:RefSeq:NP_010678.3"
                     /note="similar to Saccharomyces cerevisiae UBA2 (YDR390C);
                     ancestral locus Anc_5.472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144443.1"
                     /db_xref="GeneID:59236439"
                     /translation="MARESNLIKIVGKSNYEKLRSFKCLIVGAGGIGCELLKDCILME
                     FGEIHIVDLDTIDLSNLNRQFLFRQRDIKRPKSTVAVNAVQYFNNSKLVPYQGNVMDN
                     AQFPLNWFKQFDIIFNGLDNLAARRYVNKMSQFLSTPLIESGTSGFDGYIQPIIPGKT
                     ECFDCTKKETQKTFPVCTIRSTPSQSIHCIAWAKNFLFGQLFTFDNDSENDNGNDWGT
                     DDQAEIERIKQETGELSALKNIITAQDESRIEQILKKLFVDDIEKLLQIENLWKTRTK
                     PVPLSILIIEKALHNNSGAHLNENSLWTIEEQVNKFIQSIKSLMLRLKKEKIDIEFHK
                     DDKDTLEFVATAANIRSFIFNIPMKTLFDIKQIAGNIIPAIATTNAIIAGLSTLTSLR
                     VLNLLCYAATKSATDLNMAFTAKASNLSQDRYISNPKLAPSNPYCPVSSRVNRGIIQI
                     TEMGLSTISLYQLTNLLREKYIFPEEVSILDTSDNRLLYDFDFDDLEGKKLTDLSLGE
                     GSVLLFSDEEGDGTDLKFKKPIEFYFEIASGPLENEILLPQIESSYITARRSLHDETS
                     EQDLREPQDKSKEDQTIILDEDEETAPENKRLKRPLPEESADEVTEEIRKKNKISEPP
                     AEDNVIELD"
     gene            <828462..>829568
                     /locus_tag="HG535_0D04240"
                     /db_xref="GeneID:59236440"
     mRNA            <828462..>829568
                     /locus_tag="HG535_0D04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288549.1"
                     /db_xref="GeneID:59236440"
     CDS             828462..829568
                     /locus_tag="HG535_0D04240"
                     /inference="similar to AA sequence:RefSeq:NP_014779.1"
                     /note="similar to Saccharomyces cerevisiae IDH2 (YOR136W);
                     ancestral locus Anc_5.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144444.1"
                     /db_xref="GeneID:59236440"
                     /translation="MFRSQVCRRTFGRLLATKQPTIGRYTGKPNPATGRYTVSFIEGD
                     GVGPEISKSVKEIFSAAKVPVDWEVCEVKPLLVNGVTTIPEPAVKSINKNLIALKGPL
                     ATPIGKGHRSMNLTLRKTFGLFANVRPARSVEGFKTTYSDVDLVLIRENTEGEYAGIE
                     HVIVPGVVQSIKLITREASERVIRYAYEYCRAVGRPRLVVVHKSTIQRLADGLFVTVA
                     KEMASEFPDIKLETELIDNTVLNVVSNPGQYTDAVSVCPNLYGDILSDLNSGLSAGSL
                     GLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNEYADRIEK
                     AVLSTIAAGPETRTGDLAGSASTSSFTAAVIGKL"
     gene            complement(<829772..>831439)
                     /locus_tag="HG535_0D04250"
                     /db_xref="GeneID:59236441"
     mRNA            complement(<829772..>831439)
                     /locus_tag="HG535_0D04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288550.1"
                     /db_xref="GeneID:59236441"
     CDS             complement(829772..831439)
                     /locus_tag="HG535_0D04250"
                     /inference="similar to AA sequence:RefSeq:NP_014780.3"
                     /note="similar to Saccharomyces cerevisiae SIA1 (YOR137C);
                     ancestral locus Anc_5.474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144445.1"
                     /db_xref="GeneID:59236441"
                     /translation="MRLRRKRSIRSLNRTLVFTIVFAVFFFRAQLIFHIANIIFHPQT
                     SEYQGGLIDDIQFIKCYRWFRQCQSLIRPLSSADRNLAAWARVSKNLSEETSYAIESG
                     VLYDTYVYVHRWKKSSNSQPMTDLAISKDPLTVPLRVLSEVQKLIQSRDSSAFHKHIY
                     QQEPSIWERFSPWNHKSKGEIHLLGEDWQYKGGGIWCKYESRNDPLVDIEVYLGAGFV
                     ESRPQWKEVISEYFRPYVKSNKYIPLSITKKVKSLSEPEVEPFDDSLRLKLPMTHDRS
                     FKILQITDVHFRCSDDGTILLNEFQTVNFIINILDREVPDLVVITGDFLDGLKSFDYQ
                     ACILKLVQPMIRKGISYAFSFGEADYSLYATETQITAFISRLPFCMNKWSSLNNHMAI
                     DIKLNSGSDIVLYVLDSFKSVEPFFIERERLSLPKYSLAFRSLPIKEYRPEGSFPLIG
                     QYNERFALESSLKIDSNLGDILKRFKIMAMSCGYEHNNDCCLKSNDEIWLCYGGSSGV
                     GLGKMFDMPANVRVFNIDDDKGEITSWKRNFISVDSVYDYQYIRSVQ"
     gene            complement(<831844..>833697)
                     /locus_tag="HG535_0D04260"
                     /db_xref="GeneID:59236442"
     mRNA            complement(<831844..>833697)
                     /locus_tag="HG535_0D04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288551.1"
                     /db_xref="GeneID:59236442"
     CDS             complement(831844..833697)
                     /locus_tag="HG535_0D04260"
                     /inference="similar to AA sequence:RefSeq:NP_014781.1"
                     /note="similar to Saccharomyces cerevisiae RUP1 (YOR138C);
                     ancestral locus Anc_5.475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144446.1"
                     /db_xref="GeneID:59236442"
                     /translation="MERAVQSLMDMGIPEDVAKNALNKAGGNIEAAASYIFSNELPDE
                     INQPIRENVKDSSFIGKGEHVELASSANGFNKGDLSNIIATTRTEQIIDTDSDDSDVQ
                     FESSPPNTSDDKLSIHKFEIDDSTIVLPLPPNFLFENYFALFSLFVVNYLPQYLFRPD
                     FKDLNYDKNWFKGISVNKPLLKLDFNEEQELIPTAKSEDSNIMQPELLWQLQKFGSIV
                     NSTISDRAFVRSKMFAIALDSQIQRKLGEAEHLYEILPAFIKSLAIDLEMCPDFDTNE
                     IKNLFISSAFHTPSVDESTKQTWLSLFHFLPEEYDSNLYRMFNALLHPDESINLEINH
                     ENDSEAEKNENSLDVIAPILTIVFDEMDESTEHVNLTEGVEVPLKFYPQLYTKKCKDE
                     LIRPILEKRKQAQLLSRSILQDITNLKSFQGKDILKFLNSTIDYLQLDNKDSDLINQL
                     LLLKDEILSRKTTRTNEYKHLAQQLQTEWNLSHPEISLVNTAKDRGLIDEPYILTLAA
                     ISPYNYFSRDRSGTWHYVHCNMAGSDFKVRTCSSELEVQDSIKQCTKQASESPLMFIY
                     CKEHFIPQIDQVNRALEMNEGCLNFAKLDQLELNKSHQKHQHEEYAHDYSA"
     gene            <834274..>834606
                     /locus_tag="HG535_0D04270"
                     /db_xref="GeneID:59236443"
     mRNA            <834274..>834606
                     /locus_tag="HG535_0D04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288552.1"
                     /db_xref="GeneID:59236443"
     CDS             834274..834606
                     /locus_tag="HG535_0D04270"
                     /inference="similar to AA sequence:RefSeq:NP_014616.1"
                     /note="similar to Saccharomyces cerevisiae MIM1 (YOL026C);
                     ancestral locus Anc_7.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144447.1"
                     /db_xref="GeneID:59236443"
                     /translation="MDNELLQDIPHQVLETLEAGTVREPKNDDVDVHSSGFNVNGILS
                     FTGSCMINLILPFFNGLMLGFGELLAHEICWRKNIFNRLTNKGYRVYPQTRITRERER
                     NSSAGKFL"
     gene            complement(<834645..>835082)
                     /locus_tag="HG535_0D04280"
                     /db_xref="GeneID:59236444"
     mRNA            complement(<834645..>835082)
                     /locus_tag="HG535_0D04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288553.1"
                     /db_xref="GeneID:59236444"
     CDS             complement(834645..835082)
                     /locus_tag="HG535_0D04280"
                     /inference="similar to AA sequence:RefSeq:NP_012280.1"
                     /note="similar to Saccharomyces cerevisiae RPR2 (YIR015W);
                     ancestral locus Anc_7.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144448.1"
                     /db_xref="GeneID:59236444"
                     /translation="MAKIKQRRTLAVNEDGTILSDPPKSIGNAENFQRMNYLYQLSMW
                     QTAANRQDTDQGLSRMYIKNMDLVSKKTKSSLLPYVKRTFCKKCHRVLVPKRTVQMTL
                     KQASDGKDILVWECRCGYIKKFPIGTNRSYRTFYDKPENLLHM"
     gene            complement(<835100..>835900)
                     /locus_tag="HG535_0D04290"
                     /db_xref="GeneID:59236445"
     mRNA            complement(<835100..>835900)
                     /locus_tag="HG535_0D04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288554.1"
                     /db_xref="GeneID:59236445"
     CDS             complement(835100..835900)
                     /locus_tag="HG535_0D04290"
                     /inference="similar to AA sequence:RefSeq:NP_012279.4"
                     /note="similar to Saccharomyces cerevisiae YIR014W;
                     ancestral locus Anc_7.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144449.1"
                     /db_xref="GeneID:59236445"
                     /translation="MSRLVVYMPEDMINSSASDNVRNKLLFTGELAMACYACVYLRYV
                     RDGSLMLAVFALILISLSDFIKSLMLAYLKRNQWSAGNSGPANEAEVDDDSDVSVILD
                     DAAIKAILLRALKYFQIIILTQTIYSFSYHFCLKLDEKFCQNRFGFTTLLLLGELDCS
                     ERGKWFVWFLDVLIILFELIIVTNSLRSDSRNKSLSITQLQVQKHGILSILLLNLWSE
                     DLAVDGGLDLCIVPRPHAGNPNYGSTSDGQTIEEEDTVSGDEMGGLLP"
     gene            <836140..>838047
                     /locus_tag="HG535_0D04300"
                     /db_xref="GeneID:59236446"
     mRNA            <836140..>838047
                     /locus_tag="HG535_0D04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288555.1"
                     /db_xref="GeneID:59236446"
     CDS             836140..838047
                     /locus_tag="HG535_0D04300"
                     /inference="similar to AA sequence:RefSeq:NP_014615.1"
                     /note="similar to Saccharomyces cerevisiae MDM38
                     (YOL027C); ancestral locus Anc_7.116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144450.1"
                     /db_xref="GeneID:59236446"
                     /translation="MFRYNTSEAAVRTAFSTVSKKQLGFRLASKKTSPWAASIVASSM
                     IHRRYVTLSNERQEPSISDVESIPRAKAGKNASSPLSSPSVKSGVAKAANASASNTSN
                     ASSAANAPNTPNAASSSAVPPSSAASSSPAPNVSKPKKTKEPLMQRIKHEIKHYVNGT
                     KLLGFEIKVSTKLLFKFVQGYELTRREINQLKRTMGDIFRLVPFSAFLIIPFAELLLP
                     VALKIFPNLLPSTYESGKDKQAKRNKLIEIRKKTSDFLHDTLEESSLLSYNSIESTEK
                     KKTFLNFFKKLYSPKDGKANVFTHEEILTVAKMFKNDTVLDNLSRPQLVAMSKFMSIT
                     PFGNDNMLRYQIRHSLKKIMGDDKVIDYEGINSLSTDEIYLACVSRGVKAYGVPTEEL
                     KENLKVWLDLRLRQKVPSVLLVLSSTYTFGGLEKRHEMNQKAYSPIAEEKEKKNRYDE
                     LMDVYYDGILQVLSSIPDPVYNVAKLDVSESKSPAAPTPPATVASEHSDSGPVASANE
                     VLKSLKEAGKEPNDFAEAAEEAQQATKAAEKQPSVAVKTSEPAKEEQTEEVEKQHEEE
                     EPISRTDENEFKLNVLKEQEALIKKEQEEAKERTSALPISDDITLDEDDKSQPPIPTD
                     QAPETKVIKKE"
     gene            <838492..>840102
                     /locus_tag="HG535_0D04310"
                     /db_xref="GeneID:59236447"
     mRNA            <838492..>840102
                     /locus_tag="HG535_0D04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288556.1"
                     /db_xref="GeneID:59236447"
     CDS             838492..840102
                     /locus_tag="HG535_0D04310"
                     /inference="similar to AA sequence:RefSeq:NP_012283.1"
                     /note="similar to Saccharomyces cerevisiae YAP5 (YIR018W)
                     and YAP7 (YOL028C); ancestral locus Anc_7.115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144451.1"
                     /db_xref="GeneID:59236447"
                     /translation="MKARSEPLFNKYAKLVPKNPIETELAMSKVHLSKNWKIPPRLKP
                     GRRPDPRSDVKNTLGNETEPNGKESNGFEYASQEKRKIQNRDAQRAYRERRANRIDEL
                     EGTVETLQNMVKSWRKKCKATQEELLQSNKIIYNLRKENKQLKDNVEQLELKTASKAL
                     TKTPRRVKKTSISPAQSSDSNESNTCSNDSMLFLNPVLQNVIKNFKPMKAVTLKKRKI
                     STLSQPSLFEDSATTPVSYNRSSSLSRSSEITVSPDGKCGFCSDSTTCVCKELEKEAQ
                     EVKLKDGCNGNIATCFRCSSKVETLEKLKGNCDVSRESGVICPSSPLITHSKKKRLKL
                     NDASCIDKPPSVSSHKLVGHADESEEKKKDDDSLNIFEISDRSRPNTLSSESSPDSRD
                     NSLAVSIVRAARDASGLIKNDEVTRTQIGKTCRGLEPGSCVQCRADPQSAIFCKTVCT
                     RDKEQKLNGSQSNPVQRPSEVIPISDAYQRVRKYMKLKNMCEDQVGPSTLPVSLHKVA
                     SDLRISDREVERRSVDDAIKELDKNAME"
     gene            complement(<840269..>841687)
                     /locus_tag="HG535_0D04320"
                     /db_xref="GeneID:59236448"
     mRNA            complement(<840269..>841687)
                     /locus_tag="HG535_0D04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288557.1"
                     /db_xref="GeneID:59236448"
     CDS             complement(840269..841687)
                     /locus_tag="HG535_0D04320"
                     /inference="similar to AA sequence:RefSeq:NP_014612.1"
                     /note="similar to Saccharomyces cerevisiae GAS5 (YOL030W);
                     ancestral locus Anc_7.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144452.1"
                     /db_xref="GeneID:59236448"
                     /translation="MVSFASFVGLLFLVGFARCANDTNSSAINITGNAFFNSATGERF
                     YIRGVDYQPGGSSNLTDPLASPTICRRDIPVFQELGINTIRVYTVDNSLDHQECMEML
                     QHAGIYLILDVNTPDSSISRSNPNCSYNTDYLQSIFATVDAFANYDNVLGFFAGNEVI
                     NQVNNTYTAPYVKSVVRDMKRYIRTRGYRRIPVGYSAADISSNRQLVAEYFNCGDDAD
                     ARIDMFGVNDYSWCGRSSFQVSGYSTKMQIYQDYSVPIFLSEFGCNEVPSSRPFTEIG
                     SIYSSRMSSVFSGGLVYEYSNEDNRYGLVQIESETEVTRLPDFYNLKYEYGNTSNPSG
                     GGGYSTSNDHSSCPDYDAGTWEANNTIPEMPSAASAYFRSGAGAAQGTGFLTQDSCYN
                     DASDNDDDSSSSSSSSSSSSSSSSSTSSAASSSGISSSSATPSSSSSSSRESSSSSRG
                     SAAVLETPLFFQIICEMFNMMF"
     gene            complement(841973..842045)
                     /locus_tag="HG535_0Dtrna5T"
                     /db_xref="GeneID:59236659"
     tRNA            complement(841973..842045)
                     /locus_tag="HG535_0Dtrna5T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:59236659"
     gene            <842882..>843781
                     /locus_tag="HG535_0D04330"
                     /db_xref="GeneID:59236449"
     mRNA            <842882..>843781
                     /locus_tag="HG535_0D04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288558.1"
                     /db_xref="GeneID:59236449"
     CDS             842882..843781
                     /locus_tag="HG535_0D04330"
                     /inference="similar to AA sequence:RefSeq:NP_014115.1"
                     /note="similar to Saccharomyces cerevisiae MRPL10
                     (YNL284C); ancestral locus Anc_3.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144453.1"
                     /db_xref="GeneID:59236449"
                     /translation="MIGLFLNNTLNPCGLGGNFFSFRNVRLLSMLGTLRPSEGAVKKY
                     RRVGRGPSSSKGKTSGRGQKGQKARGKVKSWFEGGQTPLYKLFPKIGFTNANARPLKE
                     LSLEKIQWFHSVGRLTLKEGEVLDMKKMRDVGLVTGSIKHGIKILGNGKTSYNLPIKI
                     EASKATSESLKAIESAGGDFTARYYNRLGLRAHLSPNWFLNKRGRIPLQARPTRRKDI
                     EYYSDESRKGYLVKESHDLLQQIDEAKRSGASNIARKAGKRSALRAQLDDITKDISYS
                     SSTPFNIDSNIMTMEDFKQLKSK"
     gene            complement(<843858..>844988)
                     /locus_tag="HG535_0D04340"
                     /db_xref="GeneID:59236450"
     mRNA            complement(<843858..>844988)
                     /locus_tag="HG535_0D04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288559.1"
                     /db_xref="GeneID:59236450"
     CDS             complement(843858..844988)
                     /locus_tag="HG535_0D04340"
                     /inference="similar to AA sequence:RefSeq:NP_014534.1"
                     /note="similar to Saccharomyces cerevisiae YOL107W;
                     ancestral locus Anc_3.76"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144454.1"
                     /db_xref="GeneID:59236450"
                     /translation="MLIFNCGVNECKTCLQILHSPTLFSHISFTTQQPERTESVIIMH
                     WNSRFIEINTSKSLLNIRDVPGATQFLTLSYTIFSTTLYVLRRSTYNKLEKSDDNLEF
                     SSIVSPILQLIPATLLKYPYSIVLSNLIDVKIWKAIANLVFLLIGGSHIERSWNSSKE
                     LLKFVLIIGSLTNMLTVTITATLSLFFPAIDLNSPLDGNYTMIIGFPIILKQLYPETT
                     IFRLKNLGYFSKNFRFKLLPIFIMFILTFSQLFVFHHFAQLLSIWITFFSSWTYLRFY
                     QVLQINFENTGDCLLGDASDTFQLIYFFPDLIKPVLRPIFDFTYNILSVRLKIVRSFE
                     IDDIDRGNSVAEHRGAKKITNTTEERRKQLALQILQERMVEP"
     gene            complement(845002..845073)
                     /locus_tag="HG535_0Dtrna6R"
                     /db_xref="GeneID:59236664"
     tRNA            complement(845002..845073)
                     /locus_tag="HG535_0Dtrna6R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:59236664"
     gene            <846608..>847066
                     /locus_tag="HG535_0D04350"
                     /db_xref="GeneID:59236451"
     mRNA            <846608..>847066
                     /locus_tag="HG535_0D04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288560.1"
                     /db_xref="GeneID:59236451"
     CDS             846608..847066
                     /locus_tag="HG535_0D04350"
                     /inference="similar to AA sequence:RefSeq:NP_014533.1"
                     /note="similar to Saccharomyces cerevisiae INO4 (YOL108C);
                     ancestral locus Anc_3.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144455.1"
                     /db_xref="GeneID:59236451"
                     /translation="MNPKAVENGVACAKVVTENEGKAKKRKPRAKKMNNLSLDEVRKN
                     HVVSEKRRRELVRAIYDDLVNIVPDLRPNENRSEMVIYLKTMNYLKWIYRRNRHLRSQ
                     LLQNYSSDSNKKIPEHLIWEFCNESDLREEQKSSPQLQDVHMIDKLPSSN"
     gene            complement(847138..847211)
                     /locus_tag="HG535_0Dtrna3N"
                     /db_xref="GeneID:59236653"
     tRNA            complement(847138..847211)
                     /locus_tag="HG535_0Dtrna3N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:59236653"
     gene            <848946..>849545
                     /locus_tag="HG535_0D04360"
                     /db_xref="GeneID:59236452"
     mRNA            <848946..>849545
                     /locus_tag="HG535_0D04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288561.1"
                     /db_xref="GeneID:59236452"
     CDS             848946..849545
                     /locus_tag="HG535_0D04360"
                     /inference="similar to AA sequence:RefSeq:NP_012282.3"
                     /note="similar to Saccharomyces cerevisiae MET28
                     (YIR017C); ancestral locus Anc_7.122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144456.1"
                     /db_xref="GeneID:59236452"
                     /translation="MTKGKKNNNESDESNISSLKVSQDLQNLISSNSELGSRLLSLLL
                     VSSGNGKEIIDAINNGDIAKIQNLDIDLNLKVPEMRNEENNNDKNKTDNLGITRLEPN
                     EVKKSGNAEDNAITNHVDKRRRNTEASARFRIRKKLREQEKLNRIQELNAKINGLYKN
                     IDRLLEENRHWKAKLEELNERKSKELLERIKSGNAASPL"
     gene            complement(<849628..>852396)
                     /locus_tag="HG535_0D04370"
                     /db_xref="GeneID:59236453"
     mRNA            complement(<849628..>852396)
                     /locus_tag="HG535_0D04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288562.1"
                     /db_xref="GeneID:59236453"
     CDS             complement(849628..852396)
                     /locus_tag="HG535_0D04370"
                     /inference="similar to AA sequence:RefSeq:NP_014606.1"
                     /note="similar to Saccharomyces cerevisiae YOL036W and
                     YIR016W; ancestral locus Anc_7.121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144457.1"
                     /db_xref="GeneID:59236453"
                     /translation="MSTLYGARDMRTHPDGSPTSVVLPGGTVAALSHLQDIKEEEDIE
                     LTKLDSNGSCLSKNKGSPNSSLSSGGRHQLESTTISSHSVSIQNDKLSIIAGKAGSID
                     DLSLLPPLPNTIENVISTHPSLTVRDDLDNEISSRKIDISISNDDNNDSIGNGDGSNK
                     FNESHNNNNNNNNNNNNDNNNHNNKNNQLHIDRVNDQPHSIIDTDSIQPGSLKQQLRD
                     PENFLSTIEHDNDIMKGLGAPFDLSKALEIPTSFKTTPGTMGNNPLGGNIKNQEISVN
                     TTSTDASNSVGVGFGIGNFNSTTHSSNNNSDSSTSIIATPKTNSSKRKGSNVLLSSDT
                     HNALSQGSSPIDLSQFHDSKINGLRSNSNSNPTSFQYFLPSFNAGLDATSLESSTNEN
                     FNPFSSKISNDKRSNKKFSTNNSSSSSFSNASVSDELLYKIPPPKLQRPSCSRSRSNS
                     NSNLVSSTLSLDGLNHESSVTSTNTATNSFFPRDSNKNIKKLPLLRRASTALLRKTSM
                     KNNGTSNFDKDFQRSRSASTTPILPNSSFFDADSVKRTPPLNKQKYCSSLMEKDDSID
                     YFPKCLSDAEEDDLHYVTQLNDSYRPPSRNPSIRSRMRKGISRIMSSGGSVKRAVSSS
                     SLKTDMLAQNEDRIGKGIGNGNGQSNDSEMNMRMTQVTALSSPLETFSIENRISPKKK
                     DALVLMGESCSNSSSTKRSSPIDVRSKDPITNVTPISTSTMMSPVASAVMQINDSLDK
                     NDDASSTGHIELTNEQFNSSTDNEIHGLREKCSTKKLQMGKNDDEYDVTVDLDKLTKS
                     IPVITVTDKINSRSCVSIQQQSNISLDAVYMGRGKKIHKQFFSGTEIGSKNGSDKPEM
                     MTLKEYVGILMKQQQVEDERLALLERNFTESGWCSKDDIRSIKQKRIIISKRWAERIS
                     FYQSKLDY"
     gene            complement(<852929..>853732)
                     /locus_tag="HG535_0D04380"
                     /db_xref="GeneID:59236454"
     mRNA            complement(<852929..>853732)
                     /locus_tag="HG535_0D04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288563.1"
                     /db_xref="GeneID:59236454"
     CDS             complement(852929..853732)
                     /locus_tag="HG535_0D04380"
                     /inference="similar to AA sequence:RefSeq:NP_014604.1"
                     /note="similar to Saccharomyces cerevisiae PRE6 (YOL038W);
                     ancestral locus Anc_7.120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144458.1"
                     /db_xref="GeneID:59236454"
                     /translation="MSGYDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGKQCVVL
                     GCERRSTLKLQDTRITPSKISRIDNHVVLSFSGLNADSRILIEKARVEAQSHRLTLED
                     PVTIEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDSTPKLYQTEPSGIYSAWT
                     AQTIGRNSKTVREFLEKNYNRDDPPASVNDCVKLTIKSLLEVVQTGAKNIEITVVEPD
                     SKIATLSSQEIGKFVEEIEREKQQSQEEHEKKKKSASTPAAPTPATAAL"
     gene            <855456..>857993
                     /locus_tag="HG535_0D04390"
                     /db_xref="GeneID:59236455"
     mRNA            <855456..>857993
                     /locus_tag="HG535_0D04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288564.1"
                     /db_xref="GeneID:59236455"
     CDS             855456..857993
                     /locus_tag="HG535_0D04390"
                     /inference="similar to AA sequence:RefSeq:NP_014783.4"
                     /note="similar to Saccharomyces cerevisiae SFL1 (YOR140W);
                     ancestral locus Anc_5.476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144459.1"
                     /db_xref="GeneID:59236455"
                     /translation="MVQQQRSEDSAAGVHGTGSGRRASILCGNNPQANTGAATSQPQG
                     QGQGQGQGQTPGSSSSSSNAGHGPLQNTVFIHKLYNILEDDDLKDLIWWSSSGLSFLI
                     RPTEQFSRALATYFKHTNIASFVRQLNMYGFHKVSNDHNKDVQTSTTTSSAQQPPPPP
                     PSAHGGPQVDSDGIKIWEFRHSTGLFKKGDIEGLKFIKRRSSRNITPLSVRKNSNPNS
                     AFAGGMADDDRERENESLRISRPPSQPSQIQLQQQQQQLQQQQQQQQQYHQQLQQWQR
                     SQFMSNPDLEVPAQAQQQPALPRSHSQISHQQSAVTPANGPAFSTYPSTDSFFSQRYH
                     QHNFDTKYSELSQNFNDLRYDYSNLQMKHEEKLESLRNLSFDMTKLLDFLASFISLHN
                     NSSVTYRELISIHIDEKKLSNDSQKKLKNNEIELNNLEQELIKFKASLISRSQKNPDF
                     VRQQQQSQQPLQPQPLHKQQPQPQPQPQPQPQPHPQSHASTNSISIPTAPNLAPNVFV
                     VPAPPGTTVNPPQPAGPPFLATDNFAASGMMMMNPFESNGHQTSAKRNMSILMDPLSS
                     APPINAMIPPHLTSSPVRQPYYTSHTPGSQIVRNPSPLMNSTKAPKFENSNNSETSNN
                     LSSATTIKRNTRLSVKDGTFVMKPSKSNATTVAANGKRNSVQSDGSSRSNSVVSLANE
                     NFISNASNTELTGSKDSATLGLPFKTFYSHNNSINEPNSSANSNNESTVLQNYNQKTT
                     SESNNNSHQNRQSPSNAFSQKNYKAAEPENNNSMSELFHKRELTSTVNDVNIDAQVNI
                     VSPIPTRSINADIGSSRGSSGVYSLLNKEGSAASTNEEENSAKRVKL"
     gene            complement(<858125..>860707)
                     /locus_tag="HG535_0D04400"
                     /db_xref="GeneID:59236456"
     mRNA            complement(<858125..>860707)
                     /locus_tag="HG535_0D04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288565.1"
                     /db_xref="GeneID:59236456"
     CDS             complement(858125..860707)
                     /locus_tag="HG535_0D04400"
                     /inference="similar to AA sequence:RefSeq:NP_014784.1"
                     /note="similar to Saccharomyces cerevisiae ARP8 (YOR141C);
                     ancestral locus Anc_5.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144460.1"
                     /db_xref="GeneID:59236456"
                     /translation="MSQETRESSIVYEDPIDIPLEEEDDDEEDEEDEQIGHSEDEEDG
                     GGDDDDDDDDEDDEDDDDDGDNQGSEILRSSTATPISRPNTVSETGDTDGNDGDMEDG
                     KRSPSSSQDRVNKFAKLDPTKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKQIGIEK
                     IEANTLPPTGLFQPVLLINQKNYSSDYLKKDEQVFALRERKTIRNNAQVSTVNNTPDV
                     TDLKNSQTEANDIINNPDEDIDLSDANTTIVIHPGSKFLKIGFAKDETPTVIPCCTAI
                     PKSELADKEKSPKAPKISKEQSEKFENEKLEIQQSFRDRMRYYKRKMQPNSREQVLSY
                     NKASKPQIIDSKGDPQRINWILDGDKRYYGDEAIKCSLEKFVIRYPFHNGGSFNISSP
                     YYASLQDLLSDVIKLLEHAFSMEKFNLTPSQFSQYKVVLVIPDLFEKSHVELFIRTLL
                     TEMQFQAVAIIQESLATCYGAGLSSSTCIVNIGATQTSIACIDEGTVLENSLVNLNYG
                     GDDITKLFAIFLMQSAFPYKDWDITSPHGWLLAEQLKKDFVTFQDANVTVQLYNFNNR
                     VPKAPLEKYELKVFDEVMLAPLAIFYPEIISTLHSTTKMNEQKNKILQAQLPISKDIF
                     TECVNDWRSYSQNDCLNGTLYCGNNNDVDVITKILDLPTKIEDFQNEAPMNPDMRKNY
                     TPLEKAIVQSITNASIPLDIAKMSTFYSNILVVGGGSNIPALDFILTDRINIWRPRLL
                     SLTTFPNFYKKVLKQAKDMRATVKSGKAEEEEEEMKLKVDSMIKEELQKYWDSIEAQN
                     GNEHLLPVNVLPPPRDMDPSMLIWKGASVLAQIKLVEELYLTSTDWDIHGSRILQYKC
                     LFTY"
     gene            <861442..>861921
                     /locus_tag="HG535_0D04410"
                     /db_xref="GeneID:59236457"
     mRNA            <861442..>861921
                     /locus_tag="HG535_0D04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288566.1"
                     /db_xref="GeneID:59236457"
     CDS             861442..861921
                     /locus_tag="HG535_0D04410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144461.1"
                     /db_xref="GeneID:59236457"
                     /translation="MSIMGHFLVIEQAHNSHLQDYVDVGGFGYSGENVLTAIVAGLMK
                     YQIVQKAATITANNAANDTCAHFYLTNMKVLKVEVHRFLNGCHLIRCRNHVLNNLFKT
                     TDKPLKIYKNIGRVLINLTKLAKLLTKLPFYERHSSKRVATDTRHNRGTMVVHLEAV"
     gene            <863515..>864501
                     /locus_tag="HG535_0D04430"
                     /db_xref="GeneID:59236458"
     mRNA            <863515..>864501
                     /locus_tag="HG535_0D04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288567.1"
                     /db_xref="GeneID:59236458"
     CDS             863515..864501
                     /locus_tag="HG535_0D04430"
                     /inference="similar to AA sequence:RefSeq:NP_014785.3"
                     /note="similar to Saccharomyces cerevisiae LSC1 (YOR142W);
                     ancestral locus Anc_5.478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144462.1"
                     /db_xref="GeneID:59236458"
                     /translation="MLRTSAVRGRPLCRLFSREATPNDKTIKNLLLNRDTKVIIQGFT
                     GKQATFHAKISQEYGTNIVGGTNPKKAGQTHLGQPVFATVKDAMKETGATASGIFVPP
                     PIAASAIREAIEAEVPLAVCITEGIPQHDMLYVAEMLKSQDKTRLVGPNCPGIISPVN
                     RVRIGIQPTKIFQPGKIGIVSKSGTLTYEAVQQTTLAGLGQTMVIGIGGDAFPGTDFI
                     DTLKLFMEDPTTEGIIMLGEIGGKAEIEAAEYLKEFNFSRSNPLPVASFIAGTVAGQM
                     KGVRMGHSGAIVEGSGTDAESKKKALREVGVAVVESPGHLGKALLDEFAKLK"
     gene            complement(864724..864794)
                     /locus_tag="HG535_0Dtrna6G"
                     /db_xref="GeneID:59236662"
     tRNA            complement(864724..864794)
                     /locus_tag="HG535_0Dtrna6G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGG"
                     /db_xref="GeneID:59236662"
     gene            complement(<865476..>866465)
                     /locus_tag="HG535_0D04440"
                     /db_xref="GeneID:59236459"
     mRNA            complement(<865476..>866465)
                     /locus_tag="HG535_0D04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288568.1"
                     /db_xref="GeneID:59236459"
     CDS             complement(865476..866465)
                     /locus_tag="HG535_0D04440"
                     /inference="similar to AA sequence:RefSeq:NP_014786.1"
                     /note="similar to Saccharomyces cerevisiae THI80
                     (YOR143C); ancestral locus Anc_5.479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144463.1"
                     /db_xref="GeneID:59236459"
                     /translation="MLNKVSNTSGALNTSIRMAEWCIENEDRIDVSATQSKYSRTVNL
                     EDYVNPPKSEKAALLILNQAIGTPNLFLKLWNKYPLRVCADGGANRLYELFEKNEDAR
                     SKYLPDYIIGDFDSLKPHVGEYYQKSGVPLIKQETQYSTDFSKCLCLIALHIYSGSFR
                     DKIVNQQTIEAYSGIHDLYDAMLKDSNIIIPKSIRLLAIGAIDGRFDQTIHSITQLYQ
                     LSVKESLFNLCYLSATDLIFLISPGGVLIEYSKKFRDECIGCCGLLPLGGPTEIYETR
                     GLKWDVGNWYTSIASGKVSSSNRFSGIDKCFVDCKEGIVMNIEVFTDKLYNYI"
     gene            <866606..>867598
                     /locus_tag="HG535_0D04450"
                     /db_xref="GeneID:59236460"
     mRNA            <866606..>867598
                     /locus_tag="HG535_0D04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288569.1"
                     /db_xref="GeneID:59236460"
     CDS             866606..867598
                     /locus_tag="HG535_0D04450"
                     /inference="similar to AA sequence:RefSeq:NP_010680.1"
                     /note="similar to Saccharomyces cerevisiae SPT3 (YDR392W);
                     ancestral locus Anc_5.480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144464.1"
                     /db_xref="GeneID:59236460"
                     /translation="MDKHKYRLEIQQMMFVSGETNEAPVETTSLIEDIVRGQVIEILL
                     QSTKTAQMRNSKSILPEDVIFLIRHDKAKVNRLRTYLSWKDLRKNAKDQDAAAAAGSG
                     SGPGGIEDDEKKAGPEKDEKEGGNVMKVKKSQIKLPWELQFMFNEQPLEKNEDDDELD
                     EDEREANMATLKRLKTADDRTRNMTKEEYVHWSDCRQASFTFRKAKRFKEWSGISQLT
                     DSKPHDDVIDILGFLTFEIVCSLTETALRIKKQGQILQLQKNKSQKSAPDLKLEITNI
                     HRKKRLFDGPDNVANPLKRKHVEEAWRILQTIDMKHRALTNFRGGKLNSRPVIM"
     gene            complement(<867658..>869973)
                     /locus_tag="HG535_0D04460"
                     /db_xref="GeneID:59236461"
     mRNA            complement(<867658..>869973)
                     /locus_tag="HG535_0D04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288570.1"
                     /db_xref="GeneID:59236461"
     CDS             complement(867658..869973)
                     /locus_tag="HG535_0D04460"
                     /inference="similar to AA sequence:RefSeq:NP_014787.3"
                     /note="similar to Saccharomyces cerevisiae ELG1 (YOR144C);
                     ancestral locus Anc_5.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144465.1"
                     /db_xref="GeneID:59236461"
                     /translation="MSHAVSLTELLDGNSKKKKLERLIVNPDEPLISGDELHSDNSGL
                     QDEDIDASSMVISEDILPPVKKTSSQTLAEKEPQSVQDFLMSRKNKRKVEPIDDLDNT
                     VIISSDIEETSQDGVFVDNVEFYEKSSSKQMPSKVSYPANFKTTRLKDLFKDLKQAPS
                     KPIELNSATVTRTLDRDGISKKKRKTCSKPTSIEAPFPSKQLIEPDNDNIKYRKLHIS
                     CKKRNLTDQSTSNFESFEYELLTAKENKQHNKMFTKISTNNEKHASLWTRLMKPKSIN
                     DVLLDKSLKSNVSAWISQAFMKLKRPTTRHKLLKRQRVEDKTPLDDFIVNDETDEDAT
                     GIREFVPIMILFGEGIGKNTLIEVIMKQLGGHVYEIDTSSNRSKKNIFDSLKEFSTSH
                     YVKGKGAKGVILFDDVDVLFKEHDKFFWQAVERVLLGSRRPILLLCRDLNYIPYSIVR
                     LAADEGALFHAKKVSSQTVIRFLQRYCQRLGLDISVPILELLVNSNNNDIRKCLMELQ
                     FICTFPGGFSAQSDEKRDFDPGDLNKAALYADSISSCNILLTKTEWMSSIAQHDDLTL
                     MSPQVVAKYNNFSEDQEKLRNDYLIDYRLHLLNKINHRMLPFELNIAKEINSTLKKIY
                     PLFEVRHLNTQKSFNNICRAAISYLSTRIDFQQQGTEVQARRTRNSKKYQEILDSFDG
                     KYAQTSTEENIKHDFAVSVSKNIKEQVYPFAYEIAKSDALSKEKNKQVFLDASKGVAK
                     DQYDELVYKLLAHGAMKPIWFKGNPKLVIDN"
     gene            complement(<870177..>870995)
                     /locus_tag="HG535_0D04470"
                     /db_xref="GeneID:59236462"
     mRNA            complement(<870177..>870995)
                     /locus_tag="HG535_0D04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288571.1"
                     /db_xref="GeneID:59236462"
     CDS             complement(870177..870995)
                     /locus_tag="HG535_0D04470"
                     /inference="similar to AA sequence:RefSeq:NP_014788.1"
                     /note="similar to Saccharomyces cerevisiae PNO1 (YOR145C);
                     ancestral locus Anc_5.482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144466.1"
                     /db_xref="GeneID:59236462"
                     /translation="MVAPTALKMDNEPVSVGKIAGGSSRIIGIDNTEHIDDEDDDEVL
                     VGQDEAVEVTARSSNDKEVSEKAGVVLDEEGKPRFASAKDSNESKVKLEGRKVPVPPH
                     RMTPLRNNWTKIYPPLVDHLKLQVRMNLKTRSVELRTNPKHTTDPGALQKGADFIKAF
                     TLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENAT
                     RTRIVLADTKIHILGGFTHIRMAREAVVSLILGSPPGKVYGNLRTVASRLKERY"
     gene            <871482..>873368
                     /locus_tag="HG535_0D04480"
                     /db_xref="GeneID:59236463"
     mRNA            <871482..>873368
                     /locus_tag="HG535_0D04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288572.1"
                     /db_xref="GeneID:59236463"
     CDS             871482..873368
                     /locus_tag="HG535_0D04480"
                     /inference="similar to AA sequence:RefSeq:NP_014790.4"
                     /note="similar to Saccharomyces cerevisiae MDM32
                     (YOR147W); ancestral locus Anc_5.483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144467.1"
                     /db_xref="GeneID:59236463"
                     /translation="MQRLLWQGLAKTVRTSAVRCSTNGSFTGHRFALNRSRWRDTAML
                     LNYRTFHEGASLQTKRGKNPENVFSNSTDYLHIQNILLQKNQARMDKKKLLSEASNFY
                     ERFRVNTKWLLIRGDRPFSATEIGTMFSWLLISQILWIILGTTTFISILLLILNTVFA
                     KEMVGKCVGKLLNTFLDDVDVSFKDALVPEWKKGCIRFNQVQLKTCAGDLKNEIYDDD
                     DDDDDDDDDDDDDEASSSVKPTLTFDLKFHQIELTLSLKKWMFGHGLIKDISVFGMSG
                     NATINYSYTADSPENTKLFVDWFSNKEYHLGRVQINDSCIKVYDKQLGMHYRVSIYNM
                     LMPQLRFGYMLTDFFNSAVVTGSINHSLFTIHKRQHKLAYLDDLEQDLTPWKRITRLR
                     LDSINAKDMGLTKSNTFNWIEDGNLEIVADIMLPHEEDGVKQNEDTNKYVVLDLKFKF
                     KDLKAAFPDVAPRLSTGETIISLNELKPLITYINTQNSLFRSVMNIENASSAWNYPYT
                     SITKPKSYPNVTIIPSSVQWPEDEDGSTAMNQEIIKFHDQPVNTNNEIVLRCRIVKNV
                     QELKNMVMFQETGIYDTLSMELYVDLIRMVEEWEYKKKSDWMKLWGTTIASQLLLFGF
                     GAMV"
     gene            complement(<873512..>874177)
                     /locus_tag="HG535_0D04490"
                     /db_xref="GeneID:59236464"
     mRNA            complement(<873512..>874177)
                     /locus_tag="HG535_0D04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288573.1"
                     /db_xref="GeneID:59236464"
     CDS             complement(873512..874177)
                     /locus_tag="HG535_0D04490"
                     /inference="similar to AA sequence:RefSeq:NP_014791.1"
                     /note="similar to Saccharomyces cerevisiae SPP2 (YOR148C);
                     ancestral locus Anc_5.484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144468.1"
                     /db_xref="GeneID:59236464"
                     /translation="MSGFSINLKSKGKKSLRVKKKGSTQSANVFGIQNVGKQSNITKL
                     THVDEFVEKEIEEQPKLTIKPEGSLRYSLSRSDDTETHNEELKFGLTKNCTSATKDDT
                     SNSRSIIKNSEEQLQRREMELLGLAPEMTQEEEYENVPVEEFGDALLRGMGWDGRYDD
                     DEARAFKEPHQKKLHLPNVSRPDYAGIGAEVEPSGGKLKNSQRDQTYLPIIKIKKDTK
                     KRA"
     gene            <874361..>875728
                     /locus_tag="HG535_0D04500"
                     /db_xref="GeneID:59236465"
     mRNA            <874361..>875728
                     /locus_tag="HG535_0D04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288574.1"
                     /db_xref="GeneID:59236465"
     CDS             874361..875728
                     /locus_tag="HG535_0D04500"
                     /inference="similar to AA sequence:RefSeq:NP_010681.1"
                     /note="similar to Saccharomyces cerevisiae SHE9 (YDR393W);
                     ancestral locus Anc_5.485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144469.1"
                     /db_xref="GeneID:59236465"
                     /translation="MLLRCRLRPLVINHKCPCLSVIRLASYRSFSKTTLVLEASDPKG
                     ARSTTKEHQKSLGNIAEPYWRAFTSRMQQYKSAVARIKHQFSIHAKKAQDSIREANQK
                     LAEQERNRMDTRLNYDKDIETSRRIVDLPSQREVHRRQWSRKLEFYLDSLQETVLTAT
                     KALNDVTGYTSIQKLRKSIDLMEHNLEQNRTYLKSLKARYATAIEQRTESQRELNELL
                     QRKSSWSPADLERFTKLYKDDAMNLKRERDLKEEVRIKDSEQEELINDLYHAILTRYH
                     EEQIWSDKIRRTSTWGTFILMGVNIVLFLVFQLLLEPWKRRRLTKSFEDKVKRALDQY
                     SIEQTQKFEELSSNLKESGNLEQSKTKEKDSERTVTFEENASLENSSHHSEVLPGVKV
                     TTHHFPAEDMSFSRIYHWLVNFATKLKPSTVLRLDSVFSLSSIELYLYSALLLFLGAL
                     SGSIL"
     gene            <875990..>877270
                     /locus_tag="HG535_0D04510"
                     /db_xref="GeneID:59236466"
     mRNA            <875990..>877270
                     /locus_tag="HG535_0D04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288575.1"
                     /db_xref="GeneID:59236466"
     CDS             875990..877270
                     /locus_tag="HG535_0D04510"
                     /inference="similar to AA sequence:RefSeq:NP_010682.3"
                     /note="similar to Saccharomyces cerevisiae RPT3 (YDR394W);
                     ancestral locus Anc_5.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144470.1"
                     /db_xref="GeneID:59236466"
                     /translation="MEELGIQSAGETLVEEKNSIKSYGALISQLSNNNVSNTNNTSSD
                     IYLKLKRLEKEYELLTLQGEYIKDEQRHLKRELLRAQEEVKRIQSVPLVIGQFLEPID
                     QNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISIMG
                     QNEKPDVTYADVGGLDMQKQEIREAVELPLTQADLYQQIGIDPPRGVLLYGPPGTGKT
                     MLVKAVANSTKASFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSIIFIDEVDSIA
                     TKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDR
                     KIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRA
                     VRKNRYVILQSDLEEAYASQVKTDSDVDKFDFYK"
     gene            complement(<877395..>878936)
                     /locus_tag="HG535_0D04520"
                     /db_xref="GeneID:59236467"
     mRNA            complement(<877395..>878936)
                     /locus_tag="HG535_0D04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288576.1"
                     /db_xref="GeneID:59236467"
     CDS             complement(877395..878936)
                     /locus_tag="HG535_0D04520"
                     /inference="similar to AA sequence:RefSeq:NP_014792.4"
                     /note="similar to Saccharomyces cerevisiae SMP3 (YOR149C);
                     ancestral locus Anc_5.487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144471.1"
                     /db_xref="GeneID:59236467"
                     /translation="MTSISNRFILFSIGLWFAVQPSYLHPDEHFQSLEILCDKFYNYK
                     GFVPWEFESKHAARSFIPLYIFYGPLLCGLRPLLKWHLIEQPLTILRIIRIQNYLVYT
                     IVCHFALKAINVKHGNRSAAELFVISSYITWSYQSHSFSNSIETILLLAVLALFTKFV
                     ERKSGEHENQYKKSFLLGTLITLGTFNRITFAGFILLPFVSLFLRFYCGQWRSFFVLI
                     ISIITCSVTFVCFDTAIYQSSSYVVAPINNLLYNLDESNLALHGIHPRITHMFVNLPQ
                     IVGPGIILLPNAFRSFSKVCENQAALSVLSGMTFLSLFKHQELRFLTPLAPLLFSCFI
                     PRSPFKRLKWEYIFRAWFLFNLIAGLIMGVLHQGGILRAINDFHKNESPINVHIWWKT
                     YSPPAWMYRNKNLTVSAMNTVNGVESIDEIPFHVVNNHVIDLRGSNLELLIKSLIHFE
                     NAGASVTLIAPNSMRVLLNSMQDTTNFRLERLAEWKLHLDLDHIDFSNPSSLALGLAS
                     YNVSS"
     gene            <879209..>882064
                     /locus_tag="HG535_0D04530"
                     /db_xref="GeneID:59236468"
     mRNA            <879209..>882064
                     /locus_tag="HG535_0D04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288577.1"
                     /db_xref="GeneID:59236468"
     CDS             879209..882064
                     /locus_tag="HG535_0D04530"
                     /inference="similar to AA sequence:RefSeq:NP_010683.3"
                     /note="similar to Saccharomyces cerevisiae SXM1 (YDR395W);
                     ancestral locus Anc_5.488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144472.1"
                     /db_xref="GeneID:59236468"
                     /translation="MNEQDEREILQCIEHTMVADAKVIKLAEQQLFEFQKQSGFATFL
                     LRVVSNTDIPLNIRLSSAIYLKNKIQRSWNAIKREDGIKADEQQIIKENLIQALVSNS
                     QNNHLRPHLTESIRRILNTNCEWDLTSAIVELLSSGKQDYVYSGLLILFEVCIVHRWD
                     MSDSRQTIDDVISLVLPIVEGIASQLVSQNDYRSNELLYLILKCFKYACLNNFPQYFN
                     NTDKLSAWIQMHLFLCSKPLPAEVLQLDPADRSLDKRVKVNKWAFGNLNRFIHKFSRP
                     TKSISEEFVSYVLANLIPSILEDYFKIIQSWSDQSLWLSQASLHFLIQFLEKCMVMDQ
                     IYPLLEPHLGTILESVIFPCLCASSQSVELLEDDPEEYTRRYFDMNKEGSTADVASSD
                     FIFVVGHKRDSQLSKILPFVNNIFLSYSTNENDIYCAYKQEGAMRIISTLFAFIDPSA
                     DLEGIFSHYIISFLTQTKYPFLTARALETIAIYGNPFEDMGTLSKLFELTYTHFLNSN
                     ILPIQIEAADALKTLVVSNPNIHSHISSQVPGIMEKLLKLSKEFQIDIISEVMEVFVE
                     RFSDELTAFGEDLADNLVDQFLTLGRSMVESSGGTYSTGDQDQEIQVSALLQTMTTMV
                     MSMTKVPLIDKFLPVVKFTIVNAQITFLSELVDLMDSLALSSQTLYNQFTPAVWEMFH
                     DVLDSFQTYAMDYFETYLVFFQTVVTHGFPKDQTFLQPFLEILSVKMESEIDYDVEGV
                     LDILVLYALSMRDTPLFDRALKASSNDELEIDDARIVKTFLANLFVKPIETLQTCENE
                     GATLSMLTKWFSCKFSSVFAIKLQILAIIALFKLPELPSCVKGFTNQFSDKLITLTEQ
                     LPEAIRKRDAISKGDDFIQEALEVGPNGEDDEYFDEYEDDLNETVLDQINAFQEIHNF
                     FSQLQAQNPSKYQQIVGSLTDVKRHSLNVILEFVSQN"
     misc_feature    complement(join(882749..882756,882821..882857))
                     /note="Short protein (HG535_0D04540, QLG72745.1) was
                     converted to a misc_feature."
     gene            <883297..>885222
                     /locus_tag="HG535_0D04550"
                     /db_xref="GeneID:59236469"
     mRNA            <883297..>885222
                     /locus_tag="HG535_0D04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288578.1"
                     /db_xref="GeneID:59236469"
     CDS             883297..885222
                     /locus_tag="HG535_0D04550"
                     /inference="similar to AA sequence:RefSeq:NP_010686.1"
                     /note="similar to Saccharomyces cerevisiae UTP5 (YDR398W);
                     ancestral locus Anc_5.490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144473.1"
                     /db_xref="GeneID:59236469"
                     /translation="MSTIESPVVLSKFDNDGRSLCSVSVALNKQRVGVEAVHGGETLN
                     TNFLYLEDSSLRVGSMRWSQISSTDTLCVFLGLNNGEIWIYSPAANEVVYKMSTGNSY
                     EIKDMKISSGGTILWCIDSDDFFYKFDLTNFTLKDHFKIETCSQLSKLCLLPKDSSKI
                     LVASFTIFLVDVESRKVSQTYPGHVSPVTHLSTLNDDYFLSGAINDRFLNIYDIKSSM
                     TKSVLVLQSNLKEVSIYNDESVAATTEDGDVEVFSDPLVSANTANNKRRGNNKSKQSN
                     KKLHVQETPTKVLPVINVSIKKDILTICWLQNAIIPHFEQLKWQDLPLNYTLEVSSDK
                     SGIAGKHSRSLYGTELSASKNYVEGNAKITSGDNFKHVNDAIKQWELEVTEQERSNDQ
                     DSDSNLNESLADKLEAASISHVQIGKKKNSTATTVGTVTVVLSQALQANDHSLLETVL
                     NNRDERVIKDTIFRLKPPLAVILLERLAERIARQTHRQGVLNVWVKWCLIIHGGYLVT
                     IPNLMSSLSSLHSTLKRRSDLLPRLLSLESRLEYALDRLSSDSLHEDEDNLEELLEEE
                     FEEDVEYNEELDDAGLIEDGEEDEQFEDDEDEESDNDDSEERKVNGTRSDGLSKNEVD
                     VESINSDEAGYSDVEMQ"
     gene            complement(<885299..>886183)
                     /locus_tag="HG535_0D04560"
                     /db_xref="GeneID:59236470"
     mRNA            complement(<885299..>886183)
                     /locus_tag="HG535_0D04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288579.1"
                     /db_xref="GeneID:59236470"
     CDS             complement(885299..886183)
                     /locus_tag="HG535_0D04560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144474.1"
                     /db_xref="GeneID:59236470"
                     /translation="MSLASKGIKMAEVSKFKRLSNHVSIPSIGLGVYQVDNKTAERVV
                     YQALKVGYRHFDSAQLYRNEAGVSNGIEKWLDDVPNSKRQDVFYTTKIADVSHGYEKT
                     KKSLEKSLKTAAGLDYIDLVLVHSPQSNTEKRLSTWKALQEFVESGRVKSIGVSNYGV
                     RHLKELLEWEGLKTRPVINQVEINPWLLRKDLVDFCHHNDIQVEAYSPLTRGRKLGDA
                     TVKRLAEKYKKDPGQILLRWSLQLQFIVIPKTVHQDRLISNFDVYDFEITDDDMALLT
                     HPDDYGVIAGWDPVKYQG"
     gene            <887326..>887964
                     /locus_tag="HG535_0D04570"
                     /db_xref="GeneID:59236471"
     mRNA            <887326..>887964
                     /locus_tag="HG535_0D04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288580.1"
                     /db_xref="GeneID:59236471"
     CDS             887326..887964
                     /locus_tag="HG535_0D04570"
                     /inference="similar to AA sequence:RefSeq:NP_010687.3"
                     /note="similar to Saccharomyces cerevisiae HPT1 (YDR399W);
                     ancestral locus Anc_5.491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144475.1"
                     /db_xref="GeneID:59236471"
                     /translation="MSDDKEYISYNNVHQLCQISAERIKNFKPDLIIAIGGGGFIPAR
                     ILRTFLKEPNSRTIRIFAIILSLYEQTGSSGEESIGTKVQRTQWIDYEQCKLDLVGKN
                     VLIVDEVDDTRTTLHYALSELEKDAEEQAKAKGIDLEKNPESKTTFAIFVLHDKLKPK
                     KADLPPEIINDNNRYFAAKQVPDKWFAYPWESKDIVYHTKRAMEQGNDVFLP"
     gene            <888193..>889209
                     /locus_tag="HG535_0D04580"
                     /db_xref="GeneID:59236472"
     mRNA            <888193..>889209
                     /locus_tag="HG535_0D04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288581.1"
                     /db_xref="GeneID:59236472"
     CDS             888193..889209
                     /locus_tag="HG535_0D04580"
                     /inference="similar to AA sequence:RefSeq:NP_010688.4"
                     /note="similar to Saccharomyces cerevisiae URH1 (YDR400W);
                     ancestral locus Anc_5.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144476.1"
                     /db_xref="GeneID:59236472"
                     /translation="MTIGKIPIWLDCDPGHDDAIALLLACFNPAFDLLGVSACHGNAP
                     QSNTSYNTRSLITAFGEQKRVPVYAGAIKPWVREPKYAPDIHGASGLDGTTLLPVPEC
                     ELHTGSYLDAMEEAIMEHQGEISLVSTGSLTSVATVFKERPHLIKMIKYISIMGGGIG
                     IGNTNMNMSAEFNICIDPQAASFIFGHKVLKDKCILLPLNITHKAIATADILHKIQGN
                     DGNKLRQLFFELFQFFAHSYKDAQGFDLGPPVHDPLALIPLLEFYKWEPSSRVQFSYK
                     RFDLQVVEDLDSADVGKLCVLKEYSPEDSQGSIVGFDLNFDFFWDQVYEALYLAEKSS
                     TIEV"
     gene            complement(<889275..>890792)
                     /locus_tag="HG535_0D04590"
                     /db_xref="GeneID:59236473"
     mRNA            complement(<889275..>890792)
                     /locus_tag="HG535_0D04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288582.1"
                     /db_xref="GeneID:59236473"
     CDS             complement(889275..890792)
                     /locus_tag="HG535_0D04590"
                     /inference="similar to AA sequence:RefSeq:NP_010690.1"
                     /note="similar to Saccharomyces cerevisiae DIT2 (YDR402C);
                     ancestral locus Anc_5.493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144477.1"
                     /db_xref="GeneID:59236473"
                     /translation="MVSPFLFESKMMQIILVVLLILFFYLAFRIVVPPLNFPRTIPTI
                     PFYVIFLPSIFDIDQVDLFNLYLKEPLKKYGAAKIFFGSRWNIVVSKPEYLAQIFKDE
                     ETFAKSGNQKKIPYSVIAAYTGDNIISAHGEVWKTYRSIMANGLQQFDETPFYHNAKL
                     FCDILQKKIGDKDEALIPISADIQRLCLDNISQVTLGFDFGGLREEYNPLLEHLVNIK
                     KQIFHPFFLTFPFFDSFPIPARKKAFKEVEYFRQELVSHIQQQLIKNFKFEQTTFVSS
                     DLVRAFNNQTINYKQLTDNLVILLVAGHENPQLLLTTSLYFLGKYKDTWQHKIRNEIE
                     NVSEPKTLGELPLLNSFLYEATRMLPPLNTIINRRTSRSCRLGSDIIIPQNTYVGYNN
                     FGAAHEAKSWGTEADKFHPERWGDDMASISKKWKSAKSTHAMSAFHGGRRACLGEKLG
                     MAEMRITIAEMLRNFEWSLSPHWKEKMTPAGPLSPFKLELKLKRLEFGLSKKETT"
     gene            <891596..>893203
                     /locus_tag="HG535_0D04600"
                     /db_xref="GeneID:59236474"
     mRNA            <891596..>893203
                     /locus_tag="HG535_0D04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288583.1"
                     /db_xref="GeneID:59236474"
     CDS             891596..893203
                     /locus_tag="HG535_0D04600"
                     /inference="similar to AA sequence:RefSeq:NP_010691.1"
                     /note="similar to Saccharomyces cerevisiae DIT1 (YDR403W);
                     ancestral locus Anc_5.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144478.1"
                     /db_xref="GeneID:59236474"
                     /translation="MTITEKYTPAAQSSIKCNGTYLDSKGDIAIPHDLKDLSTYSKFL
                     ALYTRDRQSSAYKSIEEKQDFNVKSQWTSFIQLISEFEPVKASVSDSITEYHIPSDIA
                     DKYTGGLSIPIKISEYCKESEHQVRGCVTTIENENEFNDWFIFHILDQARLGLSEKKV
                     CETGKPYHEIFSDYFEKKLKNTIKDDKWDAQGREYFTKRVKYFTDRYTTIECVLPAFP
                     CKSSNIDKVVDESPDKGEELALKRLIKATIEVGKIYPPGMKIWIISDGHVFSDCIGVD
                     DDVVNSYTVKLHQLYEKIAVPGVDAIGFCGLNDLFFNGAAASSFNPQMIEDIVVDHFT
                     GSKICALSDVSRAILMKGCDTDDGRLRKQISIDGHPRLNLYRGFSRFMSEDLALLPNF
                     QAASKKSFKKIVSKIAFNMIKRNDAYSNLVELVFPHHMRLSIHAHTNSGPKFGVKVIS
                     MEQCMIVKSLNSGQEPKFEDLLHIPTPWHNCVALLDNNQYVLTKSKIVKEAILNGTYE
                     GEWQNTCLDTGEGGFYVIKKRKEMNDF"
     gene            complement(<894002..>894517)
                     /locus_tag="HG535_0D04610"
                     /db_xref="GeneID:59236475"
     mRNA            complement(<894002..>894517)
                     /locus_tag="HG535_0D04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288584.1"
                     /db_xref="GeneID:59236475"
     CDS             complement(894002..894517)
                     /locus_tag="HG535_0D04610"
                     /inference="similar to AA sequence:RefSeq:NP_010692.3"
                     /note="similar to Saccharomyces cerevisiae RPB7 (YDR404C);
                     ancestral locus Anc_5.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144479.1"
                     /db_xref="GeneID:59236475"
                     /translation="MFFIKDLSLNITLHPSFFGPRMKDYLKTKLLQEVEGSCTGKFGY
                     ILCVLDYESIEIERGRILPTDGSAEFTVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQ
                     VGPMKVFVTKHLMPQDLVFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
                     GSIKEDYLGAI"
     gene            <894777..>895253
                     /locus_tag="HG535_0D04620"
                     /db_xref="GeneID:59236476"
     mRNA            <894777..>895253
                     /locus_tag="HG535_0D04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288585.1"
                     /db_xref="GeneID:59236476"
     CDS             894777..895253
                     /locus_tag="HG535_0D04620"
                     /inference="similar to AA sequence:RefSeq:NP_014793.1"
                     /note="similar to Saccharomyces cerevisiae MRPL23
                     (YOR150W); ancestral locus Anc_5.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144480.1"
                     /db_xref="GeneID:59236476"
                     /translation="MSQKLGHTGIAFARLWHHVDLARDKRTLGRLASAIAITLIGKHK
                     PVYHQSQDCGDYVVVSNCQALRVTGKKFEQKTYWSHSSKPGQLKLRTMEKVVADKGYG
                     EILKKAVSGMLPKNRLRKSRLERLKVFDGGEHPYKQNITAFAYEQPQVEAIMAKKQ"
     gene            complement(<895494..>899165)
                     /locus_tag="HG535_0D04630"
                     /db_xref="GeneID:59236477"
     mRNA            complement(<895494..>899165)
                     /locus_tag="HG535_0D04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288586.1"
                     /db_xref="GeneID:59236477"
     CDS             complement(895494..899165)
                     /locus_tag="HG535_0D04630"
                     /inference="similar to AA sequence:RefSeq:NP_014794.3"
                     /note="similar to Saccharomyces cerevisiae RPB2 (YOR151C);
                     ancestral locus Anc_5.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144481.1"
                     /db_xref="GeneID:59236477"
                     /translation="MSASVDDEYYNEDSYGYEDENSPITAEDSWAVISAFFREKGLVS
                     QQLDSFNQFVDYTLQDIISEDSTLILEQLAQHTTEADNVSRKYEIGFGKIYVTKPMVN
                     ESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAVDVPGRELKYELIAEESEDDNE
                     SGKVFIGRMPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSA
                     GNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGNSARTIKATLPYIK
                     QDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIG
                     RRGTALGIKKEKRIQYARDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRK
                     DQDDRDHFGKKRLDLAGPLLAQLFKTLFRKLTKDIFRYMQRTVEEAKDFNMKLAINAK
                     TITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLA
                     KPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLE
                     DYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMVRDIREKELK
                     IFTDAGRVYRPLFIVEDDETLGHKELKVRKGHISKLMATEYQDIEGGFEDSEDYTWSS
                     LLNEGLVEYIDAEEEETILISMQPEDLEPIQKTPEFDEEDDLAKRIRATQHATTFTHC
                     EIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYP
                     QKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFR
                     SYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDIIIGKT
                     TPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLITTNQDGLKFVKVRVRTTKV
                     PQIGDKFASRHGQKGTIGITYGREDMPFTSEGIVPDLIINPHAIPSRMTVAHLIECLL
                     SKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGP
                     TYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFL
                     KERLMEASDAFRVHICGICGLMSVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQ
                     ELMAMNITPRLYTDRSRDF"
     gene            <899650..>900372
                     /locus_tag="HG535_0D04640"
                     /db_xref="GeneID:59236478"
     mRNA            <899650..>900372
                     /locus_tag="HG535_0D04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288587.1"
                     /db_xref="GeneID:59236478"
     CDS             899650..900372
                     /locus_tag="HG535_0D04640"
                     /inference="similar to AA sequence:RefSeq:NP_010693.3"
                     /note="similar to Saccharomyces cerevisiae MRP20
                     (YDR405W); ancestral locus Anc_5.498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144482.1"
                     /db_xref="GeneID:59236478"
                     /translation="MLAINTLASLISSKGLLGLRSLATVAGTNVAASTKTRVSDTILS
                     RSREDIAKGTAHFRLGGKKLYFPKARVILLRPNAKHTPYQAKFIVPKSFNKLDLRDYL
                     FHLYGLRAMNITTQLLHGRYARVNLGTPRYREPQIKKMTIDMAEPFIWPEEPKKEENN
                     AWNDYLVKNLQKYREDRLRLGSDEFKPGTAFDGAVGPFKQVAQPFIPKFLGKRIENKK
                     TRYQAKLTRMRQLSKLDKFVNL"
     gene            complement(<900505..>901278)
                     /locus_tag="HG535_0D04650"
                     /db_xref="GeneID:59236479"
     mRNA            complement(<900505..>901278)
                     /locus_tag="HG535_0D04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288588.1"
                     /db_xref="GeneID:59236479"
     CDS             complement(900505..901278)
                     /locus_tag="HG535_0D04650"
                     /inference="similar to AA sequence:RefSeq:NP_014795.1"
                     /note="similar to Saccharomyces cerevisiae YOR152C;
                     ancestral locus Anc_5.499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144483.1"
                     /db_xref="GeneID:59236479"
                     /translation="MLLLSPFIHLVSLVIPLILTLEVLNMVCLTTKSTDNAASKSGRK
                     GSSSSIPTISSSDVNVRTLIYMLKYWTLYVMLFGMLSNLTWTLLSVLPFGSLGFLCLN
                     GFVTLELVYQFIEFIESQDGKVFFLFNKFNDSNVTWWQWVNYATTYDENNVASNFVFG
                     KLTQFVISLANRSPFSRTDYLDRGFNIMELYLRQFTHTIIMQREAYGQQQQQRQARQP
                     RDHEQDTSANVGRKSTASRFSEGYDMLDDILQESRQRKN"
     gene            <902088..>902576
                     /locus_tag="HG535_0D04660"
                     /db_xref="GeneID:59236480"
     mRNA            <902088..>902576
                     /locus_tag="HG535_0D04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288589.1"
                     /db_xref="GeneID:59236480"
     CDS             902088..902576
                     /locus_tag="HG535_0D04660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144484.1"
                     /db_xref="GeneID:59236480"
                     /translation="MLAEEPRKPVFHSVRGPAALRGSADHLSAAAPLTHSPLRKVSSA
                     ELTPLNSLEPLLLRRSLLNDGACSNARFRGAYRIPCHQSDVRRGHEATAAHGGKTQKS
                     KSKVPSRHGTHRKESTDREAEHTNAVILIPLGVVTHDTDPKTKHFLLSKARILILQSS
                     FH"
     gene            <903080..>907567
                     /locus_tag="HG535_0D04670"
                     /db_xref="GeneID:59236481"
     mRNA            <903080..>907567
                     /locus_tag="HG535_0D04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288590.1"
                     /db_xref="GeneID:59236481"
     CDS             903080..907567
                     /locus_tag="HG535_0D04670"
                     /inference="similar to AA sequence:RefSeq:NP_014796.3"
                     /note="similar to Saccharomyces cerevisiae PDR5 (YOR153W)
                     and PDR15 (YDR406W); ancestral locus Anc_5.500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144485.1"
                     /db_xref="GeneID:59236481"
                     /translation="MTSEAPKEDSSSSSVQSERVSYNGFDEKTQDEIHQLAETFSHQS
                     LAKVASSIAAEGVNPVFDGETDANYSAKLDPTSDDFSSADWVKNMSRLVQSDPEYFKP
                     YELDCCWKNLSASGDSADVAYQTTVSNLPTKLISTAYRQLRPAKETDTFQILKPMDGL
                     VKAGELLVVLGRPGSGCSTLLKTISSNSHGFKVSKDSVISYKGLSPLDISKHFRGEVV
                     YNAEADIHLPHLTVYQTLLTVARLKTPSNRIPGISREAWANHVTEVAMATYGLSHTRN
                     TKVGNELVRGVSGGERKRVSIAEVTICGSKFQCWDNATRGLDSATAYEFIRALKTQAT
                     IQNTAATIAIYQCSQDAYDLFDKVCVLDAGYQIFFGPSNEAKKYFQDMGYYCPERQTT
                     ADFLTAVTSPQERIINQEFIEKGIHVPQTPKEMSDHWLKSENYKKLLRDIDANLSEND
                     EESKTAVREAHIAKQSKRARPSSPYTVSYMMQVKYLIIRNFWRIRNSSGVTLFQVIGN
                     SAMALILGSMFYKIMKVPDTDTFYYRGASMFFAVLFNAFSSLLEIFSLFEARPITEKH
                     RTYSLYHPSADAFASVLSEVPSKILTSVCFNIIFYFLVNFRRNGGRFFFYFLINNVAT
                     FTMSHLFRCVGSLCNSFTESMVPASMLLLAFVMFTGFAVPETKMLGWSKWIWYINPLA
                     YLFESLMVNEFHGRDFECSTFIPSGSGYQSATGTERVCSAVGAVAGNDFVNGDAFLST
                     SYNYVNNHKWRGFGVGMAFLIFFFFVYLVLCEYNQGAKQKGEMLVFPHSIVRKYKKEQ
                     KLNTPRNSDDIEKTAGNDSISTTDKQLLQDSSDSSSDSNGVGLSKSEAIFHWRDLCYD
                     VQIKKETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDSLAERITMGVITGDVFIDG
                     EPRDSSFPRSIGYCQQQDLHLKTATVRESLIFSAHLRQPASVSVEDKNKYVDEVIKIL
                     EMEKYADAVVGVAGEGLNVEQRKRLTIGVELVAKPKLLVFLDEPTSGLDSQTAWSICQ
                     LMKKLADHGQAILCTIHQPSAILMQEFDRLLFLQRGGKTVYFGELGEGCQTMIDYFES
                     HGSHKCPPDANPAEWMLEVVGAAPGSHANQDYNEVWRNSEEYRAVQAELDWMERELPN
                     KVKNTTDDDDKHSQYATSLWKQTCYVCIRLFQQYWRSPDYIWPKFIMTVFNNLFIGFT
                     FFKADRSLQGLQNQMLSVFMFTVIFNTLLQQYLPSFVEQRDLYEARERPSRTFSWKAF
                     ITSQIVVEVPWNFLAGTLAYLIYYYAVGFYSNASMAGQLHERGALFWLYSTAFYVWIG
                     SMGSMCIALVPVKEAAANLASLLFTISLSFCGVMATASAMPRFWIFMYRVSPLTYVID
                     GLLSTGIANVNIECADYELVHFDPASGQTCSEYMQPFIQSRGTGYLTNPSATSDCSFC
                     SVSHTNDYLSGVGSSYHHRWRNYGIFIAYIVFDYAATVFLYWYMREPKSAKKAKKDKK
                     E"
     gene            complement(<907718..>909052)
                     /locus_tag="HG535_0D04680"
                     /db_xref="GeneID:59236482"
     mRNA            complement(<907718..>909052)
                     /locus_tag="HG535_0D04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288591.1"
                     /db_xref="GeneID:59236482"
     CDS             complement(907718..909052)
                     /locus_tag="HG535_0D04680"
                     /inference="similar to AA sequence:RefSeq:NP_014798.3"
                     /note="similar to Saccharomyces cerevisiae ISN1 (YOR155C);
                     ancestral locus Anc_5.501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144486.1"
                     /db_xref="GeneID:59236482"
                     /translation="MSSRYRVEYHLKSHRKDGFVDWIKGLLATPFVLHAVSHDMDDLT
                     TTQRVRSQYAEIFDDISSLVSNKIEFDSRNGQLNESVDDNEKYELMGKSRLNQLVPTI
                     GKFFTELPLEKAFLWEDAERGISERRMVAPSFNDVRRILNTAQIFYFTDQRRKYSRNT
                     LKLVTFDGDVTLYEDGGNLDYTNPVISYILKLLESDIKVGIVTAAGYDEAAQYDQRLR
                     GLIVAIHDSSVLTLEQKHSLTIMGGESNYLFRYFEGEEPDDYGFQSISHEEWFLPSMK
                     AWEEEDMTQTLDFAEKTLRNLRERLHLPAEATIIRKKRAVGIIPGERFDPVTQRQASV
                     KLAREQLEEVVLTLQATLESFLPARNIQFSCFDGGSDVWCDIGGKDLGLRILQNFYSP
                     DDPIKPCETLHIGDQFAPIGSANDFKARLAGCTIWIASPAETVTNLHRLLIE"
     gene            <909642..>911318
                     /locus_tag="HG535_0D04690"
                     /db_xref="GeneID:59236483"
     mRNA            <909642..>911318
                     /locus_tag="HG535_0D04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288592.1"
                     /db_xref="GeneID:59236483"
     CDS             909642..911318
                     /locus_tag="HG535_0D04690"
                     /inference="similar to AA sequence:RefSeq:NP_014804.3"
                     /note="similar to Saccharomyces cerevisiae PNS1 (YOR161C);
                     ancestral locus Anc_5.502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144487.1"
                     /db_xref="GeneID:59236483"
                     /translation="MSDEKYQRPSKPPPSYSTGGDSNMGQTSEMSGSGQAAYYQHEPN
                     TGQQPQGGQGAQQPGQPQFRQDQYYNLNSKSDGAPIESFAEAFPTENDNKPKFNDWPF
                     TVFFILTVCAFIVISSITLRAWAQTYSSNGAGIYSDYNTGTMNTNSAILLVFAAVIAL
                     VIAFCGFVLCRMFPKFFIYCGMIVNIVAGLGTAVMYLSLRYWSAGIVFLVFTAITALC
                     YWGMRSRIPLSVAILKTVIDAMKKCPQTMFVSFVGTLFATGFSVLFSLVLVATYIKYD
                     PKSSNEGCQVSGGGCSNSKLIGILVLVFFCGFYISEVIRNVIHCTVSGVFGCWYYMSK
                     SDQGMPRWPAFGSLKRSLTYSFGSICFGSLVVSLIETLRTVINIIRQSVTANGNGGIA
                     AQIGFMILGWLIGFLKWLASYFNHYAYCFIALYGKPYLRAAKETWYMLREKGIDALIN
                     DNLINIALGLYSMFASYLTALFAFLFLRFTNPSYNSTGGFNAPLIAFSFLLALQITNI
                     ANETIRSGTATFFVALGNDPEVFHASYPDRFDEIFKAYPDVLKKLSHHNV"
     gene            complement(<911539..>914454)
                     /locus_tag="HG535_0D04700"
                     /db_xref="GeneID:59236484"
     mRNA            complement(<911539..>914454)
                     /locus_tag="HG535_0D04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288593.1"
                     /db_xref="GeneID:59236484"
     CDS             complement(911539..914454)
                     /locus_tag="HG535_0D04700"
                     /inference="similar to AA sequence:RefSeq:NP_014803.1"
                     /note="similar to Saccharomyces cerevisiae MTR10
                     (YOR160W); ancestral locus Anc_5.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144488.1"
                     /db_xref="GeneID:59236484"
                     /translation="MTGLMMSYNLSNLKSSLLCISSTATQEKKNEALHYLEQFQKSPQ
                     AWPICYEVLMTIDPTELELQIFSAQTLRNKVTYDLSQLDGGLAQLKDSLLKFLLIHNQ
                     NVVLTQLNVALARLAIQYLEWKNPIMEIISTLNPYPSKLLRFLRILPEETLDIGSTPL
                     TEDEFNSRTHELINTIAEDVLKFLISCIDILQSQEHTNTDITLENIMRCLGSWSFEFP
                     VDQLLTVKPLIALIFESLLRGVDSEPGVFDAAIDCLSVILRESRDAPNEQLVLSLLQD
                     LISLQTKLLPSLLSFQSEDEDEQDEELMEGLTRLFVEAGEAWCVFISKSPEVYQPIVS
                     ILLMLTCKNTDLDLVAYSFPFWFNLKQNLVLPRYKNSRELYIPTFINLINGIIKHLQY
                     PSDGFSTKEAEDKFKDFRYHMGDVLKDCAAVVGTSNALSQPLTKIKEGLNINGSWQQL
                     EAPLFSLRTMAQEISHIENAQLPQILNIVCNLPEHPKLRYASTLVLGRYTEWTAKHPE
                     LLEMQLQYIFDGFSHGNGNSEIMTASAHALMFFCTDCSELLSTHIEQLIDFYFKVEAV
                     MDIESQFELCQGLSAVINKQPNDIVASVLQKLLDDNLSRISDLIPKWKSSPSSFSLQI
                     ADKIDLIYALFEELRPRFEIPQQGSEPLVPQIEYIWNTLNSLLVNFGAMTEPIIVERS
                     SKLLRRFFDNFHLFCEPILAPVAELLAQGYAATGLGSYLWCSGSIIVVFGDDESLPVP
                     SHLKGAVWQFATTQCKTFIEAFNKIDLTHLNDYYELIMDFFTMVTDLVMFYPREFILS
                     GQQLGEVVDVALKSLIRLENFDAYMLILRSLDDIISWGFKTPPISTVSLVEVPDDWRV
                     QIMREVIVARGAQLISCLFIALVTNLHMNAHSEAVTCIVKCLKLAFEANNNDPKICIQ
                     WICQSVDQLDQVTTKEKDNLSGNIMNGLNREDSRKMREGIKAFIEWYLRKNVNPRCY"
     gene            <914654..>914935
                     /locus_tag="HG535_0D04710"
                     /db_xref="GeneID:59236485"
     mRNA            <914654..>914935
                     /locus_tag="HG535_0D04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288594.1"
                     /db_xref="GeneID:59236485"
     CDS             914654..914935
                     /locus_tag="HG535_0D04710"
                     /inference="similar to AA sequence:RefSeq:NP_014802.3"
                     /note="similar to Saccharomyces cerevisiae SME1 (YOR159C);
                     ancestral locus Anc_5.504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144489.1"
                     /db_xref="GeneID:59236485"
                     /translation="MSSKSRSVIPPINCIFNHLQQQTIVTFWLFEQIGIRIRGKISGF
                     DEFMNVVIDEALEIPVDYKTGTENIENARSLGRILLKGDNITLITTVDE"
     gene            complement(<915024..>915944)
                     /locus_tag="HG535_0D04720"
                     /db_xref="GeneID:59236486"
     mRNA            complement(<915024..>915944)
                     /locus_tag="HG535_0D04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288595.1"
                     /db_xref="GeneID:59236486"
     CDS             complement(915024..915944)
                     /locus_tag="HG535_0D04720"
                     /inference="similar to AA sequence:RefSeq:NP_014801.1"
                     /note="similar to Saccharomyces cerevisiae PET123
                     (YOR158W); ancestral locus Anc_5.505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144490.1"
                     /db_xref="GeneID:59236486"
                     /translation="MGKGAAKHGFKSGVLPITRSILKKPTVLQESIVAKAKAPKPKGI
                     DGVGYAEGVKHPKGSHREPSPVKFIDVEDLIAKTSAPPSSIRSVVSPQQEKKLRMAEL
                     RRKFLSEAFRNEESRLLKLEQTMKQRAQALQEEKSNELALLNESRSSDLTIPTLESII
                     KEPLMRQRTPEEKEVLAMKRKYNREMIQFKSNERKLEKLLELYHVSSEFIVTEEQLLE
                     KIDEAFNNEGSDVLRTKLSLGTSRIRARNENKLGDALFGTIGDGEHVGLPTVKEYLNG
                     EMKKFAEEVESRSIEALNQRKENNDNILQI"
     gene            complement(<916131..>919934)
                     /locus_tag="HG535_0D04730"
                     /db_xref="GeneID:59236487"
     mRNA            complement(<916131..>919934)
                     /locus_tag="HG535_0D04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288596.1"
                     /db_xref="GeneID:59236487"
     CDS             complement(916131..919934)
                     /locus_tag="HG535_0D04730"
                     /inference="similar to AA sequence:RefSeq:NP_010695.1"
                     /note="similar to Saccharomyces cerevisiae TRS120
                     (YDR407C); ancestral locus Anc_5.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144491.1"
                     /db_xref="GeneID:59236487"
                     /translation="MVMEPADNHSSFVEPSRIRVLVVPVGKWRRKEFVDAVNRLKQYS
                     EIRLLDITPIDSSLFTPQGFPQGRLFFKFLTVGINDSMDLFLYDFEPFRKTFVVIGLV
                     NDDSDAQHNIKILKEKYATVISHNMIYTTKTKGSGCSNVFYSPGMIEGLETIACDIGK
                     NFLLALNHYYSSYKHMTLRSPGAIGGNSVLKTSLTVRASASTISFSAGNVASKRLSSM
                     EVTTNNIKRSASLKISKTLTPSENRNQQRSQGRQLKILGNFQLLSGRYKDALQSFTEA
                     VASLHKIKDYLWLGSALDGVAICFLMLSYLNMPFQIPQIVNVLCPTQTINGTTDMSSP
                     RNSVNFTPLGSPRASSSSAVSMAVVDAQNVNLPLLVKAISEKVLYYYEMTLSDITDYA
                     PQVVYSELLLKTLTFMVSFSNNTELSPDVLKSITEGKLPLHDKERHASIEPFFSKPEI
                     YYFANKIFELQLKEMSIESQTRIYIVLAEIYGSLGFMRKKSFVLRLLMVALMSNSSQM
                     CWNLDYKSLFSEILILYGVDPYCSSNVLPFSNSTKPTWLILQKRCLQLCLTVANKVGD
                     NESAARFAVLLIKKYTHLLNRSEQQSLFEDFLKPLVEGGHIKEYMDPFMLREIKLIRL
                     ENGTYSAENDGIPVESKLTQSDKSNAPASQIDTHEVFNPFKEVKPTKDSDQATPNEMR
                     NIFLEKDKGVITCVVQNPFKFEISIDEVQFNSSTLKFCALGKNNISAKTPFIVSPESI
                     RMINLPMEIRSSTNHKWHTLSSLKFSVIGLPLQEFKIVPSENKSQNLQQDHKRYNTEK
                     IEMKILPDQPELQFIQTKNMPDNSFMIMHGTKKRLFITFRNKSLSCSIDYLHFSHTTN
                     VEKSMKPNYWKKLPLDDIYAMDKQLEWLKNSSVKIINAPSKIIPNETVTVELEVDAVS
                     VPFQYNGFDLWIDYGMISGDKQCIYLKKLLLPFKVTLKRSIEIPNVELVPLNELPAPS
                     VKSVDWINYIMEQRRMDKAFKVQDFILLLVDVRNSWLQGIIAEMEYGDFKGKSHLIEG
                     SHTTRVIIPIKKLHPNETQFKNKPIPRLFQGRQYLSSGLNVEQENEMREKFWSREHVL
                     SHLICNWKLSADTCINGTVDFSQFLDKFDSRMVAVLYHPTSFCRISVVIDKNKVAVGE
                     QIEAKISVTPTTAATLDPHSRTKTKAKKNNVMKKANSNDLTMNIIIFDRSASKVLSKS
                     NRRILYNGTLTQHISASEHTQANIELLPIEKGNYEITACISEPRDDELTIVQSQFEPV
                     PFIVT"
     gene            <920226..>921011
                     /locus_tag="HG535_0D04740"
                     /db_xref="GeneID:59236488"
     mRNA            <920226..>921011
                     /locus_tag="HG535_0D04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288597.1"
                     /db_xref="GeneID:59236488"
     CDS             920226..921011
                     /locus_tag="HG535_0D04740"
                     /inference="similar to AA sequence:RefSeq:NP_014800.3"
                     /note="similar to Saccharomyces cerevisiae PUP1 (YOR157C);
                     ancestral locus Anc_5.507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144492.1"
                     /db_xref="GeneID:59236488"
                     /translation="MAGLSFENYQRNNFLSSTSNKQPKATSTGTTIVGVKYNNGVVIA
                     ADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAVTQLIGSNLELHSLYAGRE
                     PRVVSALQMLKQHLFKYQGHIGAYLIVAGIDPTGAHLFSIHAHGSTDVGFYQSLGSGS
                     LAAMAVLESNWRQDLSKDEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRN
                     YLTPNVREAKQQSYRFARGTTAVLKESIVKVCEVEEETVDIVG"
     gene            complement(<921084..>921824)
                     /locus_tag="HG535_0D04750"
                     /db_xref="GeneID:59236489"
     mRNA            complement(<921084..>921824)
                     /locus_tag="HG535_0D04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288598.1"
                     /db_xref="GeneID:59236489"
     CDS             complement(921084..921824)
                     /locus_tag="HG535_0D04750"
                     /inference="similar to AA sequence:RefSeq:NP_010696.3"
                     /note="similar to Saccharomyces cerevisiae ADE8 (YDR408C);
                     ancestral locus Anc_5.508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144493.1"
                     /db_xref="GeneID:59236489"
                     /translation="MFSNYMLKSTTLQYTRLLLFVFRFSLVSIMGGKALRISVLISGS
                     GSNLQALIDAEAKKELGNAKIVSVISSSKKAFGLTRATKANIPTRVHSLFPYTRDISK
                     DDREKRADARVEFEKDLAEVVLGDEPDLVVCAGWLLILGAEFLRRTKRVPIINLHPAL
                     PGAFDGTTHAIEMAWQKAQDTKKPLVAGCMVHYVIEEVDRGEPIVIKELEIVPGKETL
                     EEYEERVHDTEHSAIVEATRKVILQKSN"
     gene            <922413..>924863
                     /locus_tag="HG535_0D04760"
                     /db_xref="GeneID:59236490"
     mRNA            <922413..>924863
                     /locus_tag="HG535_0D04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288599.1"
                     /db_xref="GeneID:59236490"
     CDS             922413..924863
                     /locus_tag="HG535_0D04760"
                     /inference="similar to AA sequence:RefSeq:NP_010697.3"
                     /note="similar to Saccharomyces cerevisiae SIZ1 (YDR409W)
                     and NFI1 (YOR156C); ancestral locus Anc_5.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144494.1"
                     /db_xref="GeneID:59236490"
                     /translation="MSTAGLSMSVGSGGGLHHEIQEAIAQMELLKVPELKAVCRSIEL
                     PITGRKSILQDRIRAYLKNSCSIGRIDPWRPKTIKILIEKSKAGQVLPKYEMVWQTIR
                     SGAFNHPVATGQLPVSSLQEDGTLTVGNQVDYNATNTVRPSDVYVGPTRPSMSVEPRK
                     TYIHFKESPFYKMRKLIPETAQKINVTNVRGVCSCKFKFTKAEWNLLQGNKKFKVYLF
                     CAAASPSAEAGNVPIQFPHPNEIRFNDTQVKDNVRGLKNKVGTAKPADLTPYLRPPPA
                     QNVLEIVYAFTKNEFFTYCYIVEEVLPEELLQEVLKHPKIIKHATLQYIKQTLREEED
                     DDLVTTSTVMSLQCPVSFTRMKYPAKSIMCKHLQCFDALWYIYSQMQIPTWQCPVCQI
                     EINLKDLAVCEYVDEILKNSEEDVEQVELSSDGSWTPVVEETTAKPNDRQQSNTMVKT
                     ENDYDDYDNVPLSKQNAKEIGASASNQPVVISLDSDLEDEDDIEQNDTPNSDKTQENN
                     RSAAVRLSSDADHPGLYMDSSSTPSEATLDPRAHTAETPTAMRTESDRTESNTSYFNR
                     EIPNSLDKTPLNNSISDNDTSLPDASTSSPAPSTIIRGLFTPAYQPASSVGHPYNGVN
                     DSHGSPTIRSNGTSSTMTTVGTPDLNKREHSRRTSQVVSNSLLGLTGNSVVAPSLPVM
                     NCALQDAEGTANNGEGNGIIPQLPPLPVTQAIEIAAHGARKNINGRSNLATHGSNLHA
                     RTKKPVVSPFIPKKPYLNMLPQKRNISNASSRSILSPESPASIHNNQGADNNNTTSQP
                     IESSSEPRDSSVIDLTSD"
     gene            complement(<924940..>925680)
                     /locus_tag="HG535_0D04770"
                     /db_xref="GeneID:59236491"
     mRNA            complement(<924940..>925680)
                     /locus_tag="HG535_0D04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288600.1"
                     /db_xref="GeneID:59236491"
     CDS             complement(924940..925680)
                     /locus_tag="HG535_0D04770"
                     /inference="similar to AA sequence:RefSeq:NP_010698.1"
                     /note="similar to Saccharomyces cerevisiae STE14
                     (YDR410C); ancestral locus Anc_5.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144495.1"
                     /db_xref="GeneID:59236491"
                     /translation="MSRVTNSMDKSSADVNRYADISNNPLHTVTFTSFALGTVLGLFL
                     GLIKVVKMKNLNAYIVFLCFFHFMEYFITAKYNPLKVNQDSFLLNNGSVYILCHLIAT
                     LEYVIEYIFYPNIKVTGHSKFRFSIIVAGYLCISAGQAIRSLAMSTAGKSFSHVLQTK
                     KKKDHTLIQSGVYQWFRHPSYFGFFWWALGTQMILLNPVSFTLFAVVLWKFFHDRIKT
                     EEIYLIKFFGDDYIKFKTCVPVRIPFIE"
     gene            complement(<925888..>926682)
                     /locus_tag="HG535_0D04780"
                     /db_xref="GeneID:59236492"
     mRNA            complement(<925888..>926682)
                     /locus_tag="HG535_0D04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288601.1"
                     /db_xref="GeneID:59236492"
     CDS             complement(925888..926682)
                     /locus_tag="HG535_0D04780"
                     /inference="similar to AA sequence:RefSeq:NP_013671.1"
                     /note="similar to Saccharomyces cerevisiae VPS71
                     (YML041C); ancestral locus Anc_5.511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144496.1"
                     /db_xref="GeneID:59236492"
                     /translation="MSERTKQSSTTGEMLVEEIDKRTYDPNVYFTSHDPASLSRSRSR
                     VSKPNASSRSTKRINYSLADLENKLFNQQREPNNESSNPGHNDTNLNMLDKFTQKEVL
                     QSKKRCLELDMENQKDIVEVPSLLSTITGVDRNKIEVSSGSNGTGVIRHKNKIEVPKN
                     IHLSYRSTKPPVPKRKNTNRIVALKKTLSSRRTLQSYLETLDQVNRSIIYHNVSNKKF
                     LKVLPVITICSVCGGYDSISSCVHCGSKICSLRCFNLHNETRCIHR"
     gene            complement(<927964..>929970)
                     /locus_tag="HG535_0D04790"
                     /db_xref="GeneID:59236493"
     mRNA            complement(<927964..>929970)
                     /locus_tag="HG535_0D04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288602.1"
                     /db_xref="GeneID:59236493"
     CDS             complement(927964..929970)
                     /locus_tag="HG535_0D04790"
                     /inference="similar to AA sequence:RefSeq:NP_013670.1"
                     /note="similar to Saccharomyces cerevisiae CAT2 (YML042W);
                     ancestral locus Anc_5.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144497.1"
                     /db_xref="GeneID:59236493"
                     /translation="MKVCSKRSVLAGVKNSLSSLRRMSSLQRFPFETQNGEHYWAAKD
                     NRSYQSARAGFKGATFAHQADLPSLVVPELNQTMAKYLESIKPFCKDASEYYKQELLV
                     RDFLGNMGPVLHQRLVKFSEGKRNWMSEFWDNQSYLEYNDPVVPYVSYFYTHQRLPKS
                     HKRIDADPLLKATAIIVTASRFIEALKDQSLPQELIKGTPFCMNSFELMFNSCRLPGN
                     AEDNRDTSIFYSIYENNFIIVSFKGNYYKVLTHNESDGTPLNPREIWEQLYFIVSGLN
                     SQLQSDTNAGIGLLTSLPRDQWRKVHHELAKNPLSKDSLSTIHKASYLLALDLDDQPI
                     SLEEKSRNAWHGDGINRFFDKFVQFFVCGNGSSGFLGEHSKMDGTPTCFLNHYICKEI
                     SNLAPTEFIDNVFNRQKSSVLPAKDVTHLPFLITPFIKGWIEKANELFAETMDEHDLR
                     VWHYNRYGKNFIKKQGMSPDAFIQQIIQLAVYRYLGKQLPTYEAASTRKFFKGRTETG
                     RSVSIPSAKFVSTWEDPSATISEKIDVLKKSAKYHSDYLKAAAAGNGIDRHFFGMKNM
                     LQNSDETPKLFQDPLFNYSSTWLISTSQLSSEFFSGYGWSQVNDNGFGLAYMLNNEWL
                     HINIVNKPMKSGLSVNSMHYYLCEAADEIADTLISSAEPLKSKL"
     gene            complement(<930603..>931418)
                     /locus_tag="HG535_0D04800"
                     /db_xref="GeneID:59236494"
     mRNA            complement(<930603..>931418)
                     /locus_tag="HG535_0D04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288603.1"
                     /db_xref="GeneID:59236494"
     CDS             complement(930603..931418)
                     /locus_tag="HG535_0D04800"
                     /inference="similar to AA sequence:RefSeq:NP_010699.1"
                     /note="similar to Saccharomyces cerevisiae DFM1 (YDR411C);
                     ancestral locus Anc_5.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144498.1"
                     /db_xref="GeneID:59236494"
                     /translation="MNKNIHTGRDSGYARSELSSMLNKIPIVTRWVIGAIILQTIVIR
                     LEILPAEKTYYHFALSAKKLQIWRPVTACFLLPPSSAMALMDLYTIYSRSADLERRRN
                     TLDYLFYMWFCISALAALAAAFFGLRSYVNLETSFKFFLSYTWSVDNANARVVYFGLF
                     PILAKYIPIMELFLAFLFNENFIAPLMGLMVAYVFQCLDTTSLGPIYGSIRHIHGYGF
                     SPTGHFGMPKIVKNIFATRNNSFRQPGAPTAASARSARPVRHEFPGKGRRLGD"
     gene            <931707..>932381
                     /locus_tag="HG535_0D04810"
                     /db_xref="GeneID:59236495"
     mRNA            <931707..>932381
                     /locus_tag="HG535_0D04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288604.1"
                     /db_xref="GeneID:59236495"
     CDS             931707..932381
                     /locus_tag="HG535_0D04810"
                     /inference="similar to AA sequence:RefSeq:NP_010700.3"
                     /note="similar to Saccharomyces cerevisiae YDR412W;
                     ancestral locus Anc_5.514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144499.1"
                     /db_xref="GeneID:59236495"
                     /translation="MSLRTNRQILSRGKNYANKQLKKFGTDEVTFDKDQRLDYLTGFH
                     KRKIQRQKKAQDFNKEQDRLAKIEQRKNIRAERRQQLDEKLRNFKEGLDLDSDHDEQE
                     VQVGEDEEEWKGFDSDNGSETEKVKPILKTLYSDSTSVSVETLEPNDNFEYLAEVNNV
                     KLDKSREILDQSITRASKYAKFLGIKDADEKTKQKQKKKKFRYLTKNERKANQYKANG
                     NKRRRQ"
     gene            complement(<932384..>933544)
                     /locus_tag="HG535_0D04820"
                     /db_xref="GeneID:59236496"
     mRNA            complement(<932384..>933544)
                     /locus_tag="HG535_0D04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288605.1"
                     /db_xref="GeneID:59236496"
     CDS             complement(932384..933544)
                     /locus_tag="HG535_0D04820"
                     /inference="similar to AA sequence:RefSeq:NP_010702.4"
                     /note="similar to Saccharomyces cerevisiae ERD1 (YDR414C);
                     ancestral locus Anc_5.515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144500.1"
                     /db_xref="GeneID:59236496"
                     /translation="MMKMKKKWKHENSIHLLLLDWRLANKRRQRGSMDGEKVSGELPK
                     GWSLQIPPAERVNVLLLIAIWLWHWILVIMYSRKIDISSVLQTRRPDELKVPLAHSQL
                     IRFSRAFGIKLSKMIVPLIIISVAFQSFDKETSSFIYSAISFLPLLQFVVILGFIWKD
                     SVIIRYCTERLLLIEPTPRVLRNMYILLSDTLTSFGKPLVDFSLYLTALCLPQDSIWT
                     HFDLLISLLPLIVRVTQCIREFYLTKDRSLIFNTIKYCSSIPIITYVWYSRVQPEKYD
                     YMKHGWFLCLNSCYTFFWDIKMDWKFQSFFKIRAINKKHETMMFPRYFYYMGTLFNLL
                     VKFWWIWTINGQRHEIFFANEQQYFEILRRSIWIIFKLESEFIIITKNNDEK"
     gene            <934320..>935495
                     /locus_tag="HG535_0D04830"
                     /db_xref="GeneID:59236497"
     mRNA            <934320..>935495
                     /locus_tag="HG535_0D04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288606.1"
                     /db_xref="GeneID:59236497"
     CDS             934320..935495
                     /locus_tag="HG535_0D04830"
                     /inference="similar to AA sequence:RefSeq:NP_010864.3"
                     /note="similar to Saccharomyces cerevisiae RML2 (YEL050C);
                     ancestral locus Anc_5.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144501.1"
                     /db_xref="GeneID:59236497"
                     /translation="MLLLTTVRNQLSIYFRGSSLVAASSALGSGKRWLSSATQPEVKG
                     SKMEMNSTYVSAQMLKIVPDNTDVATLEKQDELVKRRRKLSKEITQMKKLKPISPGLR
                     WYMSPIYPYLHKGRPIYSLTIAKRGKGGRNNSGKITVRHRGGGHKRRIRIVDFHRMAS
                     GKQIVERIEYDPGRTSHIALLKHTVTGSLSYIVACDGLREGDTVESFRNGIPQDLLDE
                     MGGKVDPAILSVRTAQRGNCLPISMIPVGSIIHNVGITPVGPGKFCRAAGTYARVLSK
                     IPEKKKAIIRLQSGEHRYVSLESCATIGIVSNIDHQNRSLGKAGRSRWLGIRPTVRGV
                     AMNKCDHPHGGGRGKSKSKKLSMSPWGQLAKGYKTRRGKNQNKMKVKDRPRGKIARL"
     gene            complement(<935585..>936715)
                     /locus_tag="HG535_0D04840"
                     /db_xref="GeneID:59236498"
     mRNA            complement(<935585..>936715)
                     /locus_tag="HG535_0D04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288607.1"
                     /db_xref="GeneID:59236498"
     CDS             complement(935585..936715)
                     /locus_tag="HG535_0D04840"
                     /inference="similar to AA sequence:RefSeq:NP_010703.1"
                     /note="similar to Saccharomyces cerevisiae YDR415C;
                     ancestral locus Anc_5.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144502.1"
                     /db_xref="GeneID:59236498"
                     /translation="MLCSIFIAVILGLLTTVTALFNDPLKVLDVGEDKPLVVRESEKL
                     ALRRRGVRFIDISKHGTLPWGKKYTKFDEIPVYNYPNQLTNGKEFQELASFINGKELY
                     DNLAKFTSFFTRYYKSQHGYDSAKWLSSRINETVAGLSENAVLVEHHYHEGWMQFSIS
                     VRVIGIETPENIIMIGSHQDSMNLLFPSWIAAPGADDNGSGTVTVLEALRVYSVILRK
                     GYQPKNSVEFHFFSAEEGGLLGSFDVFSKYREAGKSVVAMLQQDMTGYVPDMKDEHVS
                     IVTDFTSEALNDFLKIVIDTYLLIPFKESTCGYACSDHGSAIKNGFPASFVLESVHAK
                     TNKYIHTTMDTIDRLNFDHMKEHVKLVLGFIIELDNWKVERK"
     gene            complement(<936841..>937668)
                     /locus_tag="HG535_0D04850"
                     /db_xref="GeneID:59236499"
     mRNA            complement(<936841..>937668)
                     /locus_tag="HG535_0D04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288608.1"
                     /db_xref="GeneID:59236499"
     CDS             complement(936841..937668)
                     /locus_tag="HG535_0D04850"
                     /inference="similar to AA sequence:RefSeq:NP_010863.1"
                     /note="similar to Saccharomyces cerevisiae VMA8 (YEL051W);
                     ancestral locus Anc_5.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144503.1"
                     /db_xref="GeneID:59236499"
                     /translation="MSGTREQVFPTRMTLGLMKTKLKGANQGYSLLKRKSEALTKRFR
                     DITKRIDDAKQKMGRVMQTAAFSLAEVSYATGENIGYQVQESVYNARFKVKARQENVS
                     GVYLPQFEAYIDSSINDFKLTGLGRGGQQVQRAKEIYSKAVETLVELASLQTAFIILD
                     EVIKVTNRRVNAIEHVIIPRTENTIAYINSELDELDREEFYRLKKVQEKKQIETARID
                     EEMKQAKLAEQNGNNDTDLGDEKLSSEQNSETQGVAATPKGSPSADLIQEQEDDVIF"
     gene            <937969..>940410
                     /locus_tag="HG535_0D04860"
                     /db_xref="GeneID:59236500"
     mRNA            <937969..>940410
                     /locus_tag="HG535_0D04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288609.1"
                     /db_xref="GeneID:59236500"
     CDS             937969..940410
                     /locus_tag="HG535_0D04860"
                     /inference="similar to AA sequence:RefSeq:NP_010704.1"
                     /note="similar to Saccharomyces cerevisiae SYF1 (YDR416W);
                     ancestral locus Anc_5.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144504.1"
                     /db_xref="GeneID:59236500"
                     /translation="MEEYITDSDDIAFEYELQSTPNNKVTWKRYLDSWKSQYNKKKSV
                     NHIVWLYERFCLQFTRDLEAWEEYIKWVLDSDMFEYHAITNLFKRCLANFSHKCDRIC
                     LMFLKFAIAEYDLSVIRVALDESLSKISRDSHAKVWGLLLPFICQTMLPLSRIEHVPN
                     EGQYEELLEVVHRCLFKNRTEIESHAQGDMWSAELLVRYLEVCPKDKIPETLIYLSST
                     GVNEVVVSSFDRYIGKNENISPDINLQYQIYTSYLKALKQLRQFNEYKEFSAKVQTIF
                     PHQKFTLIVELVRFYIKEARLKDAENLLKSSLADTLTVRDFAAIYDFHIDYEKACAEV
                     ILQELDTPGVELRKDLWEPILISHMNNLETLTKERELKLNDLKLRQNSNVVNTWLERA
                     SLFHANNEKCDVFAQAILQIDPSKIITPGSFGELWCRYAALYWEAGQYENAREVWDRG
                     LRVPYVHMEDLEKIWDCWVNHELELGPHGMEKAIKLLETALEVPENPDLQLEKYKKGK
                     KKMPSQIIVFSSLCLWNLLLDLVESFCDRNPEEVGKVINIYEQVIMLKVATPLIFINY
                     AHFLQKYKSTEAGFQVYERAIATFPPETQFEIWNMYLAEGMDKNAPLSTEHIRDLFDQ
                     ALETLLPNKIDCKAIFILYSDFEEKNGFANRSVEILFQGCKCTEDIESRLSLWKICLS
                     KAKSLLGEGGSRKLYEECIQSMPNSKIIGIVIDFAETETRLNEIDRAREIFRYGAQLL
                     PPQKNINLWGSWDEFELQHGDKETYKEMLKLKKNLENEMLVDTESESKFEGNVAFVSA
                     SNSKAVNPEEIELDL"
     gene            complement(<940447..>941970)
                     /locus_tag="HG535_0D04870"
                     /db_xref="GeneID:59236501"
     mRNA            complement(<940447..>941970)
                     /locus_tag="HG535_0D04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288610.1"
                     /db_xref="GeneID:59236501"
     CDS             complement(940447..941970)
                     /locus_tag="HG535_0D04870"
                     /inference="similar to AA sequence:RefSeq:NP_010862.1"
                     /note="similar to Saccharomyces cerevisiae AFG1 (YEL052W);
                     ancestral locus Anc_5.520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144505.1"
                     /db_xref="GeneID:59236501"
                     /translation="MIYVAQVVRSGRLQWVCFRKFRVSVQQFNRGCSDVVHLPAAHSA
                     VTPLQEYERLVKLKKLRDDPYQRSIIKSLGSLYDSLVEYKPAEIVSPDALDQVGWKSG
                     FLGKLLGVNKFSYSDEISEKIPKGIYLYGDVGCGKTMLMDLFYSTVPSHLTKKRIHFH
                     QFMQYVHRRSHEIMIEQNLDVLGKAKGREIDSIPFLAAEIANTARLLCFDEFQVTDVA
                     DAMILRRLISTLLSKNHGVVLFATSNRPPDELYINGVQRKSFIPCIELIKRRTEVIFL
                     NSPTDYRKIPRPSLSVYYYPENELKYDSEKCKKARESHIRQWYDYFAQDENTIEVDHD
                     IINDFTLTIWGREFNVPKCTAPRVAQFTFKQLCERPLAAGDYLALAQNFKAFIVTDIP
                     YLSVYVRDEIRRFITFLDAVYDNGGKLATTGAADFTSLFVEPEEIKSNYELIVRPKNE
                     SIEEHDESDDDLVKNHGFSKEIAKKAQIFALDEERFAFARALSRLTQMSSTDWVERR"
     gene            <942500..>944812
                     /locus_tag="HG535_0D04880"
                     /db_xref="GeneID:59236502"
     mRNA            <942500..>944812
                     /locus_tag="HG535_0D04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288611.1"
                     /db_xref="GeneID:59236502"
     CDS             942500..944812
                     /locus_tag="HG535_0D04880"
                     /inference="similar to AA sequence:RefSeq:NP_010861.3"
                     /note="similar to Saccharomyces cerevisiae MAK10
                     (YEL053C); ancestral locus Anc_5.521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144506.1"
                     /db_xref="GeneID:59236502"
                     /translation="MVLEQGLRKLHVEEQRGPQLFSDNTVTADDLIDITETLKRMRLA
                     LQPDSIIKEPSFDLFEGTHSLEVNNKKLDTSLITLSQEETEYDCNTAHGESQVEKLGF
                     VTGIVDQLCRYLICWLNDYQLLPTTILSCRYLEYLLIESANIDDMVYLKTGDLLYDQV
                     LCSAIYGISYFAKFVERLMKNGGVCPEEDLNFNSMGLDFLSYVCEPSKINKSLKVSLE
                     HLSAYGDTANHLVHLLKLIECLVCMEECLTKYSAGTAHLDKLMAEALYLQNKNDSETF
                     ILPLGCFSMGIQKRLSNQSPPKSLVIPSKNYDGFIVMATDLKLILSVNEAKTVMELMQ
                     FTKFFNKATQRHVISRAVFFAFIIRHDETVLGRYTFSQFAQLHPLEFSLASTEISKKL
                     PEEAVPVLEDITNVLFDWYQNAAQNTSRYRQGYNRQLLLWDALQVQMENIELEFESKM
                     MADRANEPFSDDSMLPFTSWIFAMKVTAMIEFVLKGFDLDVYKPFESYVMFWYSYYLS
                     YQLESCLEKIHKFVDSRINKIVSLNKKIKKLKAGEKKEKLRAQYRFLMDTEMAQLQTN
                     KKFLTFLLMECTIIRSLSLSQVLQFAILKSFNVIDNKSTTKCQFTSNELLYELRMKVF
                     SSIGVPEVVPYNMIESTLNDFMISEPMFALKLKKTMECIQKETQNASIAVDNVIKCIA
                     SDKDGEVLYSATRLVKPQATDYFQRLKTSAKAIQLNSKVINAKLENKQTKNDPKSLFT
                     MRLKSCENASSFFPLLELVDTRRQKSKSKK"
     gene            <945627..>946124
                     /locus_tag="HG535_0D04890"
                     /db_xref="GeneID:59236503"
     mRNA            <945627..>946124
                     /locus_tag="HG535_0D04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288612.1"
                     /db_xref="GeneID:59236503"
     CDS             945627..946124
                     /locus_tag="HG535_0D04890"
                     /inference="similar to AA sequence:RefSeq:NP_010706.3"
                     /note="similar to Saccharomyces cerevisiae RPL12B
                     (YDR418W) and RPL12A (YEL054C); ancestral locus Anc_5.522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144507.1"
                     /db_xref="GeneID:59236503"
                     /translation="MPPKFDPNEVKFLYLRAVGGEVGASAALAPKIGPLGLSPKKVGE
                     DIAKATKDFKGIKVTVQLKIQNRQATASVVPAASSLVITALKEAPRDRKKDKNVKHSG
                     NIQLDDIIEIARQMREKSFGKNLASVTKEILGTAQSVGCRVDFKNPHDIIDAINAGEV
                     EIPEK"
     gene            <946975..>948927
                     /locus_tag="HG535_0D04900"
                     /db_xref="GeneID:59236504"
     mRNA            <946975..>948927
                     /locus_tag="HG535_0D04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288613.1"
                     /db_xref="GeneID:59236504"
     CDS             946975..948927
                     /locus_tag="HG535_0D04900"
                     /inference="similar to AA sequence:RefSeq:NP_010707.3"
                     /note="similar to Saccharomyces cerevisiae RAD30
                     (YDR419W); ancestral locus Anc_5.523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144508.1"
                     /db_xref="GeneID:59236504"
                     /translation="MSKFKWSDLIKLNSKEEAYISPLAVLSHIDANAFFAQVEEVRCG
                     YTKDAPVVCVQWNSIIAVSYAARKYGISRMDTIQQALKKSDKIIPIHTAVFRKGEDFW
                     QYHDGCGSWMEDKDKQLPNELYKVSLDPYRRESRKIFKIFTQFCDLAEKASVDEVFLD
                     LGRLCFQKLMFSKELIPHQKNAEDLERIREIFINGQYQLDAYLPQIPDSLRKIKFEGD
                     VYNPNAIPLIDDWDDVLLALGSQLTQLIREQIEKSLGYTTSCGVAKTKTVCKLASNFK
                     KPNAQTVILNRCTETFLDCGKFEITSFWSLGGLLGKELIDALNAPNSGSIKFIREKWS
                     SSPNDLKQYIEVQLSSKDANHKSTVIERSKIGSLAEKLFALVRGDYWSPLTPQTMVKS
                     MMSNKNMNGDSCKTLVDCISWLEVFSGELSSRLHELEQEYDKTVIPRTVTVLVRTKSG
                     LTHSKSGPLTKTGSKIDSQCLLKVGSKLIMELGTKFGKEVQYYPLQNINMSVSHFEVF
                     SSKKSIVDMFGNQAQILESDDPATRSVSPAIVDPGRQPCLSSEVKFECQPCRLTFATE
                     KHLQEHRDYHVAMRLSENINGADENSQNISIGEKRLLLTKRTPSTPVQSHSIKRIKTK
                     GPKGIKQTKKSKPESSNGIMKYFSKQ"
     gene            949962..950043
                     /locus_tag="HG535_0Dtrna9S"
                     /db_xref="GeneID:59236667"
     tRNA            949962..950043
                     /locus_tag="HG535_0Dtrna9S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:59236667"
     gene            <950477..>955306
                     /locus_tag="HG535_0D04910"
                     /db_xref="GeneID:59236505"
     mRNA            <950477..>955306
                     /locus_tag="HG535_0D04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288614.1"
                     /db_xref="GeneID:59236505"
     CDS             950477..955306
                     /locus_tag="HG535_0D04910"
                     /inference="similar to AA sequence:RefSeq:NP_010708.1"
                     /note="similar to Saccharomyces cerevisiae HKR1 (YDR420W);
                     ancestral locus Anc_5.524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144509.1"
                     /db_xref="GeneID:59236505"
                     /translation="MQQVQVIIRRLCIICVFILAVRAQSNTERESNTVGSTLSNYDAS
                     ESTLPSISRSFMPLAGSSAGATSTTSTEATSTTSTEGTSTTNTEGISTTNAQATSTTS
                     TESTLTTSRAGTLTSSAGAGVAISTDAVLTASAEATPTTSAESSAITSAESSATTSAE
                     SSATTSAESTPTTSAEATSTTSTQALSTTSAESSATTSAESSATTSAESSVTTSAEST
                     PTTSAEATSTTSTQALSTTSAESSVTTSTESSVTTSAESIPSTNTEGTSTTNAQATST
                     ISAESIPTTSRAGTLTSSAGVGEATSTDAVPTPNAQALSTTSAEATSSSADDSFTTST
                     KAINANSVFTTSRVPTPTTSTDAVFTTSTDAVFTTITDAVFTTSTDAVFTSRPNPEFT
                     TTDADYRRQTEPSTTSRRSTRDSASLYTDEVESAIISVGTSTGSRIDSRSREPAAYFG
                     SATTAATFFSDSSPASQIYTELPTSSSAATTNFESTSDSNAPVSYESVAAQEGSSLLR
                     STSSLTDLPHGSSLPYGEATDLETATTSDTQGTSNISPPTTYMVSTAFSPTFQSSGIS
                     SMSYVTASSFSTEPNVETSDPQDSTDQYRTILSGSSESTSQIVSSLDTESSITAQDVR
                     PYSSSERSRSVETSEASTHFSFTTDIYSAASRVDGSTRTDQSSSSSLLSNIESSDGYR
                     NTMRVSATTAPTGGSSAARGVSTSINQETLLTSSGAAQNSAIERPSALSTSSRIVFTT
                     SSEIPINSFSRSATRAPIVTTTNMISNGASTEQLILNSDISSSDTFYSSDILSPGASF
                     SSMGRQQLSSRSTIVEDQSRSLQSTAVSRVTGSSSSYSSITRIQSSSQSSGSGQLIQT
                     TSGTSDQSRSLDILQSLLSHGISASVHSGASHFASYFSTQVITPNSNAVSNSAIHSRP
                     SSSASASTGQTNRDQRSEQSFSSQTKSSSRDVNSEFISINPTPVKTSKSHKSTTTSNM
                     SIDTARPLPSGTRGTQLTSDGSSPIYIGSRDQTRVTELPTWLPKSIVMQSSLQTTFTS
                     TFNPSVTETLPRLIAPPTEVVPDPDSVVVTIGFKYSLNYEFLVGNPLASAQIFQFLPS
                     VLSFPFQFQMEQDEVVIGNVLLSSTNNKVITTVLSPSDKSSRLKIREVRQSVNVSQVK
                     VRQIVPMLISGHNYLVSLAEVYFPNIYVSDLAQYVSRNDSQLYNNTVPSLFSLASLID
                     PSIPITGLVNSDVSPSRSTRTRVTGTWQTGPVISGGGSFGGNASPSLNHRIKIRLAIF
                     LTCLVIGPLAWILLFMYFHKLLYGRYRAGGKMCDDQENPLQEGAVLVQDNTSEHSLPS
                     AFATPIFDEKNGSLERQYDSNDTLQVPDDLIITGENTVYSTSHGLEYFVDSEGNFYYS
                     GTNEHFTSDENGTTKDEEFEETENTEDIDDYLYIEDQERSIITADENSYNVGSLELDE
                     DGDYVVEDINISEKNFSAGTNNSNTIESYNNSNLYQLAKASPHYERNHHNTDSNTPGF
                     TGSNSDSGHHLSTESNQAPLYVNGSGESYNQDTKDLARLAVSVDDIDEFLYNDDDDGD
                     DPLDIEIDDIDDGGVADIHVDELDELDEEIYKRLSKIANQKSQNNVFHKGPFFAGRS"
     gene            <955880..>958441
                     /locus_tag="HG535_0D04920"
                     /db_xref="GeneID:59236506"
     mRNA            <955880..>958441
                     /locus_tag="HG535_0D04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288615.1"
                     /db_xref="GeneID:59236506"
     CDS             955880..958441
                     /locus_tag="HG535_0D04920"
                     /inference="similar to AA sequence:RefSeq:NP_010709.1"
                     /note="similar to Saccharomyces cerevisiae ARO80
                     (YDR421W); ancestral locus Anc_5.525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144510.1"
                     /db_xref="GeneID:59236506"
                     /translation="MGKLSSKRHGELTKEGTAKWRRSYKACLNCRTKKVKCDMGPVGN
                     PHGPPCLRCRRERKKCEFPPSKHRVDIGQEVSDMCGIPTASAVKKCGYESSTHSKEVS
                     DSGTSALDSKWKIEVYSMQNALEFLAKAAGSVAHSEGPDINSELNSSSMQNALSKIVK
                     SFSIDQESSAPPECAHNTQSSARAAPFSFEGLGNMQPQLFTKLTDIEFIGDDRVISEM
                     EAIKLIDAFFLRMHPFFPHIPLQLQEPEELVRYPLLLCAILTVSSRYQSFRELKLFEG
                     SSGDRALDIHEKLWAYSQRLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHSKWQDY
                     ANDSESSDSSRRDTRDIGTIKETKGLIGLESIRRSDRMAWMLTGSAVRLAQDMGFIET
                     NCKIFIATHIAETQTAMQVNQRPILAESLNDIKFEENDEAEDIQSLYFNHILENDKSR
                     KRWLKFVQEMRLYEIPEGSRIWKEVETEFLNDEYILFHAASNVNENLYFKGQKTTPLP
                     SQLKFTKSQKAKIELLKIISIGNETIYCDKGNLQLFIKDPRANLVILKILSPLIENWY
                     KNYNDLLSPATNNPNYHALMVDGESLICDYSYCQLYIYSLALQVDVRENPFKLKEIAK
                     SAKYVEIAYSAAKEILVSAERLRSFGLARFLPVRWVARIVRAIAFIIKCYLTLTGNKT
                     NTIGNPVANTILRLTVIPIEETLPLVETAAEILNETSPDELHLGKRYSTIISYLCSEM
                     RTNNFKNKNREQEYRAENETSNLPPRRTEQHEQTDTIAESRDTNHLPQHTTAPDMSQH
                     DAPLQPMNSLPNEIMDWFFTSEDIGLDFVDPWTEMIEQKYMEKSHFHQQDSPAAG"
     gene            <959521..>961656
                     /locus_tag="HG535_0D04930"
                     /db_xref="GeneID:59236507"
     mRNA            <959521..>961656
                     /locus_tag="HG535_0D04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288616.1"
                     /db_xref="GeneID:59236507"
     CDS             959521..961656
                     /locus_tag="HG535_0D04930"
                     /inference="similar to AA sequence:RefSeq:NP_013708.1"
                     /note="similar to Saccharomyces cerevisiae GIS4 (YML006C);
                     ancestral locus Anc_5.526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144511.1"
                     /db_xref="GeneID:59236507"
                     /translation="MQKSVRVDDYFDNDDGGVWSWYLMNIRSGNFEEVSKNRLKATLL
                     KRFLNERFDPSNNQHHRPNTKILFISIPDKVHRDRILLENFLRDYFHLERLEHIQITR
                     LTHGKIYNHENHYILIDTMNNFEDPRFLKLVNTRWPQCDIAAKELTNSNNKSSTYSPN
                     NINNSHNKTNNKRGRSNHNEDPRSYGTVSERTDSSKSLPTSQPYSSGMQNGIGSASGD
                     NMQLQQRVEVKSVLSESVNENDDTLSTRFFNDEQGHETGSEEAHKAEEDQDYQDDYGE
                     SIVLDFPHTIVRKQFTKMNLYSPAQSENVSFNSYEDNLKDAGSESASEDESEITSYPG
                     QPLTLTVTRQEDGLTNGSQSSQEGQNHDSVSELSSVSRSLHSLGSTTSLDEDDNIDVD
                     SDSSDYSVLSILPSISISDSLGHFRLVLQLSLVQNPETKEIFTAIRQSNNEPTVANVE
                     DDWLLYDSNFSMDNLQMLTLQDFLDSNRSFPKIIFYSMIVVSDDEDESTQPKSPQPLL
                     STNNAFDPSQHTLLRDSLNNDHVSDIESDLSLSNEPKGFYPASDRDETDNDYEYDDAS
                     LSEKSDPRMFAPTRIQSNATAHRSIRTVNSIGDWAFLHSHNDVHPSGKMNLSNDSQPT
                     EQNVHFNKDANGLHLSAVNTSSKGGLSKVNTVASMGAVERSKSTPLPVILKSLSIDNE
                     GKRWKSRMEAFRKKRSHRSNNGEKNCAIM"
     gene            complement(<961736..>963958)
                     /locus_tag="HG535_0D04940"
                     /db_xref="GeneID:59236508"
     mRNA            complement(<961736..>963958)
                     /locus_tag="HG535_0D04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288617.1"
                     /db_xref="GeneID:59236508"
     CDS             complement(961736..963958)
                     /locus_tag="HG535_0D04940"
                     /inference="similar to AA sequence:RefSeq:NP_010710.4"
                     /note="similar to Saccharomyces cerevisiae SIP1 (YDR422C);
                     ancestral locus Anc_5.527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144512.1"
                     /db_xref="GeneID:59236508"
                     /translation="MGNTPASQQGSGSEGPTADLSHKYARLQELEKGRQHSITSQLFP
                     SRKTRHSAVETASRNRKHTLSGPSVFKTNYSMAHSQDNLSGSTESIRDDMAGLTLKKS
                     NDHNAETPSFLSPGPSASTVQPTREDALSVGDLGGHLIPADSVSRSNPDFSSSHRPSV
                     VALMNSLRKDGDTSVISSKATTRSPSMDIYGALSLKSQSNGADKSMDFENILDDGYLQ
                     SEDIVLNQSLLQNVLKKDMKRKRSINNGHDSKKSNITTNTSHEARLKVSSTSFSYESL
                     ESGALPELKKPKSLSTDEGVLPSFHSTSVRNENQDRSPSFPHPHLGITDFDRIDSFEK
                     KSVEHREGAESLPHSFSSNSFSESERVNVILKFRDQIDNNASKVALISADILSALNYQ
                     PSSISGGLPLQYDNHDGCWIVPDLKLPPGIYKLQFLVDGFVRHSNFLPSATDSVGSIV
                     NWFEVLPGYETIEPYREQIDFVTCNGNENNDNIPPHADKAVNDNDNIDESYSGKSTDR
                     TSQHTLIAQPVPARVARPVLAGRHTSSYFKQDRTGTPYSDYKGISRTSSAVRKSPPGH
                     QTVSSFDLLTALQPKKYEYSSEIPELFKAGNMLGQSDENTLQQPTAPPLYELSSTTSN
                     ILDCDQDTLFAKLQQGGLLDAETAEQEFLEQYVVPDLPIYLNSTYLNKIFSEFQNNSY
                     NGVADGINHIIPHVNLNHLLTSSIRDEMISVGCTTRYEGKFITQVIYAPCYYASHPTE
                     "
     gene            complement(<964370..>966208)
                     /locus_tag="HG535_0D04950"
                     /db_xref="GeneID:59236509"
     mRNA            complement(<964370..>966208)
                     /locus_tag="HG535_0D04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288618.1"
                     /db_xref="GeneID:59236509"
     CDS             complement(964370..966208)
                     /locus_tag="HG535_0D04950"
                     /inference="similar to AA sequence:RefSeq:NP_013707.1"
                     /note="similar to Saccharomyces cerevisiae YAP1 (YML007W)
                     and CAD1 (YDR423C); ancestral locus Anc_5.528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144513.1"
                     /db_xref="GeneID:59236509"
                     /translation="MSTTTAKRPLDLGSASADSSESAGSNEHESHEYLEQENESEEPR
                     RKGGNPGRKLLDDEAKNKRTAQNRAAQRAFRERKERKMKELEDKVHSLEQVNQQSAVE
                     TEFLRSQLMTLMGELKRYRPVSTNDSQVLAYLSKNDGSRLQGLKDEDGNVNKKMDFTF
                     AFPWKDKSDRSESRSRDQVPSPGSSSSNSASQTLSKRKMSETTPDTLTNSIGANNNNS
                     NYSHINNSVNNNNTPSSTTTTSGWMDNVFYSDDAQRLPSFPNNAGTATPGTTLSVTDP
                     LGQDSVLFSNHFNFEDEFDEQVSKFCSKMNEACGTKECPIPKQAPKASPMVLSNTWDA
                     NISPGDDVSGAGSGVGISHENESSNDDNVKNNDSKSTDNRYKLPQDSFDLGSEGNVSK
                     YNAPANASSAPSAPSALSAPSAPSLSTSISSSSISNERPLNILNNDSINNFIIGNDNE
                     SVERRTSNNEQRQQHQQEQQHKQKNGIFPFLDTSLAFPNESEQNLIFRDNQDSSLLAE
                     LLEETAENNDFETNLINEEPIEFPFKQNANDVDNVVPARDGKLLKCSEVWDRITSHPK
                     YASIDIDVLCVELMAKAKCSERGVVVQAEHVQKALDKQAAVDKDFF"
     gene            <967297..>968415
                     /locus_tag="HG535_0D04960"
                     /db_xref="GeneID:59236510"
     mRNA            <967297..>968415
                     /locus_tag="HG535_0D04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288619.1"
                     /db_xref="GeneID:59236510"
     CDS             967297..968415
                     /locus_tag="HG535_0D04960"
                     /inference="similar to AA sequence:RefSeq:NP_013706.1"
                     /note="similar to Saccharomyces cerevisiae ERG6 (YML008C);
                     ancestral locus Anc_5.529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144514.1"
                     /db_xref="GeneID:59236510"
                     /translation="MSETELRQRQAQFTKELHGDDIGSKSGFKAFISKNKSAQKSAVD
                     KYLKHWDGKVDKETEDKRLEDYNEGTHSYYNVVTDFYEYGWGSSFHFSRYYKGENFAA
                     ACARHEHYLAYQAEIKKGDLVLDVGCGVGGPAREIARFTGCNVIGLNNNDYQIAKAKW
                     YAKKFGLADKLDFVKGDFMKMEFDANTFDKVYAIEATCHAPKLEQVYSEIYKVLKPGG
                     TFAVYEWVMTDKYDENNPEHRKIAYEIELGDGIPKMFTKKVAQDALKNVGFDVLVEDD
                     LAAKDDEIPWYYPLTGEWKYVQNLGDLATFLRTSYLGRKFTSTMVAAMEKVGVAPEGS
                     SKVTNALEEAAVGLVAGGRAKLFTPMMLFVAKKPLDTK"
     gene            <969089..>970828
                     /locus_tag="HG535_0D04970"
                     /db_xref="GeneID:59236511"
     mRNA            <969089..>970828
                     /locus_tag="HG535_0D04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288620.1"
                     /db_xref="GeneID:59236511"
     CDS             969089..970828
                     /locus_tag="HG535_0D04970"
                     /note="ancestral locus Anc_5.530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144515.1"
                     /db_xref="GeneID:59236511"
                     /translation="MTTNSSDNKHIDRPWLRDIPFNSSELRDRLIDQPWKEITLFKSQ
                     KEHTDGAAEGSGASGASDFSAEESDSKNEDKGLRYHISGGSATSKGSRGLGKYWAIIT
                     TGAGLFSDGYINNSISTVSTCLSTIYGAQYTESRAIQNVSSIAFAGTVIGQLTFGYLA
                     DYYSRKMAMLTGTSLLILFSILCAGAWGVGTTGTQAGGLFAAITAYRFFLGIAIGSEY
                     SSSSPAAAEASNMLPSGKRNRYFCWFTNMMIDLGFVVSAFVPLVLLWICGERHLTPVW
                     RITIGLGAIPPISLFFLRLRYRESDAFKATRFRKVMPYWRIIKFYWLRLACVSIIWFL
                     YDFSAYAFGTYSSIIIGIVLGDDASLVQTFGWNVVFNLFYMPGAFSGAISADWFGPRT
                     TLTVGLILQAALGFIMAGALEHLRKHIAGFVVVYGIFMTLGEFSAGDNIGLLASKVFA
                     VPVRGQLYGIAAAVGKVGAFVGSYVFPSIIRNAGGFDTTSGLQAPYWVASSLCIFSAL
                     VAYLFLPAVDQDASAEEDRRFLEFLKSTGFDLSELGDDGASASVDYSFESSTGSESLI
                     VKENVEEKNIELN"
     gene            complement(<971043..>971450)
                     /locus_tag="HG535_0D04980"
                     /db_xref="GeneID:59236512"
     mRNA            complement(join(<971043..971273,971339..971361,
                     971429..>971450))
                     /locus_tag="HG535_0D04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288621.1"
                     /db_xref="GeneID:59236512"
     CDS             complement(join(971043..971273,971339..971361,
                     971429..971450))
                     /locus_tag="HG535_0D04980"
                     /inference="similar to AA sequence:RefSeq:NP_010712.1"
                     /note="similar to Saccharomyces cerevisiae DYN2 (YDR424C);
                     ancestral locus Anc_5.532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144516.1"
                     /db_xref="GeneID:59236512"
                     /translation="MSSINSKPILKASDISDELKDDIFAISLEATNKFELERDIAGSI
                     KKQLDLKYDTTWHVIVGKNFGSYVTHEKGHFVYFYIGPLAYLVFKTA"
     gene            <971627..>973489
                     /locus_tag="HG535_0D04990"
                     /db_xref="GeneID:59236513"
     mRNA            <971627..>973489
                     /locus_tag="HG535_0D04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288622.1"
                     /db_xref="GeneID:59236513"
     CDS             971627..973489
                     /locus_tag="HG535_0D04990"
                     /inference="similar to AA sequence:RefSeq:NP_010713.1"
                     /note="similar to Saccharomyces cerevisiae SNX41
                     (YDR425W); ancestral locus Anc_5.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144517.1"
                     /db_xref="GeneID:59236513"
                     /translation="MNIFGESEEEDNNPFAGTNHLYASGIAAVADGEDDFIPKGATIY
                     DEINKDNDEGEDIETGSPVDSPINSFTQNTMKHDLKEQEKGMNSFENAAPTTSTKFEP
                     YVSLTMSMAIGSNGQNSAETPDINITEAGDYKDPWGKHAIGYVIQFQGKEVVRRYSEF
                     DTLRQALIRLLPTVIIPPIPSKHPLIKYFLNPLAAENDSKIIDKRKRMLTSFLNNCYA
                     VEEIRNQVVFTKFLNPEYSWPNVLKSPPIAILPVNNLLAPPLNPTKPSPLHLLLPVTK
                     SLSRLDPLAHNGSTLELEKQFAHLEARLKKFRLHLDPSHKIIKQHRLHFHNLGSLFAE
                     LGAYYNAFSLQANVISNEDTVKAIKMLSNAIEKIGHGFDVNYVCSEILIENLLNSLEE
                     PIGEILHFLEDAQRVITFRKLKRLQFQIIEQTIQKRELRIKNLKEAQFQMKRLQEALQ
                     RNAQESPTIAEAIKHIEKKMSLSPTDDVPKQLQESELRPQEEQPRIEEISGEAPPDRD
                     QISISNRRTTTRKKNRRSGELEPHLLTEHERQQEIQKLFKEIEKLNECFKLINKDMED
                     VNKSTLQTLRMLEDYINRKMGIMIKSFTKFVINWLTECLKAWKNARLIVNNIET"
     gene            <973667..>974914
                     /locus_tag="HG535_0D05000"
                     /db_xref="GeneID:59236514"
     mRNA            <973667..>974914
                     /locus_tag="HG535_0D05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288623.1"
                     /db_xref="GeneID:59236514"
     CDS             973667..974914
                     /locus_tag="HG535_0D05000"
                     /inference="similar to AA sequence:RefSeq:NP_010715.3"
                     /note="similar to Saccharomyces cerevisiae RPN9 (YDR427W);
                     ancestral locus Anc_5.534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144518.1"
                     /db_xref="GeneID:59236514"
                     /translation="MKHYSNIYRLRQSIAPFNTLMSGAHQIDTVLSTLRVEADPELES
                     LFYEFEDLYEQKLWHQLTQRLSVFFEDPRSTPLRLRVYDNFVTRFYDKINQLSVVEFL
                     LLSLKDNDDFDESLKFLMDLKESFKKIDEKTQRNNGLKNHDFGCLLIDIEIARIYLFK
                     GELVKSRDSLDDLEKVLDMEDSVPLKITNAFYSTNAEYYGLKKDFNSFYYTSLLNLST
                     MTTPEQQGRDEQEMKELAYKLSIAALLGDKIYNFGEILNHPIMNSIVADPQYKWLFDL
                     LNALTSGDFTKFDKLIGVQIPKVPILAENESFLRQKICLVTLVESVFTKDIRALSFED
                     IASATHLPKDNVEHLVMRAISLNLIKGSIDQVNELVTVTWVQPRIINSEQISRMRDKL
                     VDWNEEVAKLGEKIDAHGKSIWV"
     gene            complement(<974948..>975706)
                     /locus_tag="HG535_0D05010"
                     /db_xref="GeneID:59236515"
     mRNA            complement(<974948..>975706)
                     /locus_tag="HG535_0D05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288624.1"
                     /db_xref="GeneID:59236515"
     CDS             complement(974948..975706)
                     /locus_tag="HG535_0D05010"
                     /inference="similar to AA sequence:RefSeq:NP_010716.3"
                     /note="similar to Saccharomyces cerevisiae YDR428C;
                     ancestral locus Anc_5.535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144519.1"
                     /db_xref="GeneID:59236515"
                     /translation="MTKNIDRLYDRSVSFYEPVKNRSPNAIVFIHGGAWIDEKNTPND
                     FEFLCGAMLNMSDNDLDYAMYGITYRLSPTVKHPTHICDVIENLYRLIKDKGIKKLQL
                     VGHSVGATLAWQVATATATNELCSSSEKLIYVQSCLTGLYLIDGIFSISELLDEYPEY
                     IYFVSQAFQNNGKEFEELSYSIKRLPCWISYIHLLHSYKDELLTLRQPRYMADLLQEN
                     AIPYISYFSDMGLHNEVYENPKLARYLLDNLKFT"
     gene            complement(<975911..>976756)
                     /locus_tag="HG535_0D05020"
                     /db_xref="GeneID:59236516"
     mRNA            complement(<975911..>976756)
                     /locus_tag="HG535_0D05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288625.1"
                     /db_xref="GeneID:59236516"
     CDS             complement(975911..976756)
                     /locus_tag="HG535_0D05020"
                     /inference="similar to AA sequence:RefSeq:NP_010717.1"
                     /note="similar to Saccharomyces cerevisiae TIF35
                     (YDR429C); ancestral locus Anc_5.536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144520.1"
                     /db_xref="GeneID:59236516"
                     /translation="MSDVLQPEVIENSDGSKSVISYRIEDGQKYKITQKIKEIKVTEK
                     VHRSVALRRQWVKYGQEKGSPAGPNHSTTQVGEEVQLRLSRNWRQMEQEETQKSKITS
                     ETVISCRLCGGAHYTMNCPFKSILNDIAALEDPAAAAADGSGEGPGAPEATPIPADAS
                     ATAGGEGGSRYVPPSRRAGAKDPSSDAYRDARERDDMSTLKITQLNENADENTLKEEL
                     LFPFGPIPKVVVVRNRETGKSRGLAFVTFVSEEVAEKALHFLDGRGFMNLILRVEWSK
                     PKTKE"
     gene            <977038..>977250
                     /locus_tag="HG535_0D05030"
                     /db_xref="GeneID:59236517"
     mRNA            <977038..>977250
                     /locus_tag="HG535_0D05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288626.1"
                     /db_xref="GeneID:59236517"
     CDS             977038..977250
                     /locus_tag="HG535_0D05030"
                     /inference="similar to AA sequence:RefSeq:NP_013705.1"
                     /note="similar to Saccharomyces cerevisiae MRPL39
                     (YML009C); ancestral locus Anc_5.537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144521.1"
                     /db_xref="GeneID:59236517"
                     /translation="MAKAKSKNTIIKLISTAATGFSRHITVSRGAPLVTQVRYDPVAQ
                     RHVLFKEAKKRKVAEKKPLDFLRTSK"
     gene            complement(<977430..>980621)
                     /locus_tag="HG535_0D05040"
                     /db_xref="GeneID:59236518"
     mRNA            complement(<977430..>980621)
                     /locus_tag="HG535_0D05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288627.1"
                     /db_xref="GeneID:59236518"
     CDS             complement(977430..980621)
                     /locus_tag="HG535_0D05040"
                     /inference="similar to AA sequence:RefSeq:NP_013703.1"
                     /note="similar to Saccharomyces cerevisiae SPT5 (YML010W);
                     ancestral locus Anc_5.538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144522.1"
                     /db_xref="GeneID:59236518"
                     /translation="MNEEEIGRHREGEVQERPSSVLEGTGGDAATKEVEIDPQTQKRA
                     DQSKHDSPAVESETPSEGISADSEKKQESMSPEVEDTQNQEQGGVHGQQSSDSSKVND
                     DDSKKRPWEEDAEEGNEEVYAAKKIEEEGETNGGNEDEDDEDDEDDEDEDEENGVERH
                     SKKRRQERNRFLDIEAEVSDDDEDEEDEEESELVREGFITRGDDEDESSEAQREDRLH
                     RQLDQDLNKSSEEDAQKLAKELRERYGRSSSKQYRAAAQDGYVPQRFLLPSVDTATIW
                     GVRCRPGKEKELVRKLLKKKFNLDRAMGNKKLKILSIFQRDNYTGRIYMEAPKQSVVE
                     KFCNGVPDIYISQKLLIPVQELPLLLKPNKSDDVTLKEGSYVRIKRGIYKGDLAVVDQ
                     ISENNLEVMLKMVPRLDYGKFDEIDPVTNQRKARRPTYAQRPPPQLFNPTMALRLDQA
                     NLYKRDDHHFTYKNDDYVDGYLFKSFRIQHIEGKNIQPTVEELARFGSKEGAVDLTTI
                     SQTIKKAQAARVTFQAGDRVEVLNGEQRGSKGIVVKTASDVATVRVPEFPKPLEFLMS
                     SLRKIFEPGDHVTVISGEHQGDAGLVLTVKQGQVTFMSNQTREEVTITANNLAKSLDS
                     TPTSSEYSLHDIVELSAKNAACIIQAGHDIFKVIDESGKVSTITKGSILGKINTSRSR
                     VATVDTSGNEIKIGDTVVEKVGARREGQVLYIQSQQVFVMSKKIVENAGVFLVNPLNV
                     EAVASRDNVLNNKLDLNKINPDLMSKMGPPSKVAIQQPQQLRMGRDLALGKTVRIRTA
                     GYKGQLGIVKDVNGDNAIVELHSKNKHITIDKHRLTYYNREGGDGLTYDELVNRRGKL
                     PQGRIGPSYVSAPRHMAAGGNGPAAIGAQGRPLSGGMTPGWSSFDGGKTPAATAQAAG
                     GASAWGGSSQWGGASTWGGQGAGNASSWGGTSTWGGQGSGATSTWGGNSAWGNKSSWG
                     GASTWASGGEANGASSTWGGRGDKSAYGGTSTWGGNNNTNNGGSSSWGNSGAAQQGHN
                     STWGGAQQETGNKSAWGDQGNRSSYGNGSTWGA"
     gene            <980895..>981416
                     /locus_tag="HG535_0D05050"
                     /db_xref="GeneID:59236519"
     mRNA            <980895..>981416
                     /locus_tag="HG535_0D05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288628.1"
                     /db_xref="GeneID:59236519"
     CDS             980895..981416
                     /locus_tag="HG535_0D05050"
                     /inference="similar to AA sequence:RefSeq:NP_013702.1"
                     /note="similar to Saccharomyces cerevisiae RAD33
                     (YML011C); ancestral locus Anc_5.539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144523.1"
                     /db_xref="GeneID:59236519"
                     /translation="MDLNYKKVEAFMKVKIPQEIEDEILAVYANCSMEHDMTIKELDF
                     YFSELQLSKELRKMVSPSELSILDTDIIDFERLLQCTYHLLIFMDNEEIIDEMWRLLI
                     HASGRDVSFPQVLLKNHVLSLKDVQKMSNSVGAESSDGIIEMVSCATSGKRVYITYLD
                     FAYILGKLGYLRF"
     gene            complement(<981432..>982073)
                     /locus_tag="HG535_0D05060"
                     /db_xref="GeneID:59236520"
     mRNA            complement(<981432..>982073)
                     /locus_tag="HG535_0D05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288629.1"
                     /db_xref="GeneID:59236520"
     CDS             complement(981432..982073)
                     /locus_tag="HG535_0D05060"
                     /inference="similar to AA sequence:RefSeq:NP_013701.1"
                     /note="similar to Saccharomyces cerevisiae ERV25
                     (YML012W); ancestral locus Anc_5.540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144524.1"
                     /db_xref="GeneID:59236520"
                     /translation="MQKAIYGLVYLVLSCFVQSVNALRYEISASEKPEPICIRDFVSE
                     GQLVVVDVTSDGHVGDGQVLSLYIYDSIGNEYRRKRDFADEVRVVFTAPSTTSFDICL
                     ENVAQFKGRSMSRSVELDIESGSQARDWNKISASEKLKPIEVELRKIEELADEIVEEL
                     QYLKNREERLRDTNESTNRRVRNFSVIVIIVLISLGLWQVNYLRNYFKAKHII"
     gene            complement(<982289..>985258)
                     /locus_tag="HG535_0D05070"
                     /db_xref="GeneID:59236521"
     mRNA            complement(<982289..>985258)
                     /locus_tag="HG535_0D05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288630.1"
                     /db_xref="GeneID:59236521"
     CDS             complement(982289..985258)
                     /locus_tag="HG535_0D05070"
                     /inference="similar to AA sequence:RefSeq:NP_010718.1"
                     /note="similar to Saccharomyces cerevisiae CYM1 (YDR430C);
                     ancestral locus Anc_5.541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144525.1"
                     /db_xref="GeneID:59236521"
                     /translation="MLRFQRFYSSYAQKKVLRKYPVGGIIHGFEVKRTMAVPEFKLTA
                     VGLVHSQTGAEHLHIDRDDKNNSFSIAFKTNPPDATGVPHILEHTTLCGSQKYPVRDP
                     FFKMLNRSLSNFMNAMTGPDYTLFPFSTTNMTDFKNLRDVYIDSTLNPLLKSEDFYQE
                     GWRLEHENVMDSKSDIVFKGVVYNEMKGQISNANYYFWVAYQNSIYPSLNDSGGNPKK
                     ITDLYYHELVDFHKTNYHPSNAKTFTYGNFPLDSTLKSLNNAFAGYGKRIKNQTVLLP
                     VELSVPIDVNTEGELDTMLPPDRQLKTSMTWICGSPHDIYETFLLKVLGNLLMDGHSS
                     VFFQRLIESGVGLDFSVNSGFESATAANFLTIGVQGVRDLDQFRTIVIETFQELQATP
                     FDRKKIDAIIQQLELSKKDQKSDFGLQLLYSILPNWSNGVDPFETLQFDDILTRFREE
                     LEQHGDKLFQDLLEKYIIGKPSFNFSMEGDADFSKKLEIEESERLKTKIKSLNEDDRK
                     AIYDRGLYLQKKQNSVEDLSSLPSLKLTDIPRVGDTYELDPLAENITCRITDTNGITY
                     LRAKRLLNDSIPLKLYPYLPLFADSLTSLGTSTQDYSDIEDDMKLHTGGVSTHIEVTA
                     DPVTCEPRLSLRFDGWSLNSKTDHIFDIWKKLLIETDFKKHSEKIKILIRSLVSSNTA
                     SVAESGHSFARGFAAAHISQTKAICENLSGIQQVQFIANLSGMLEDEPAFQEHIVNKL
                     VELKKHLIGSQGLEFFITTDSTVCANETCEKAQRFMRTLPVATNKGGISTTAFPLLSE
                     NGTINNTLIDFPFQVSYAAASLHGVSYTHEDGAPLQVLANLLTFKYLHREIREKGGAY
                     GGGAAYSALEGLFNFYSYRDPRPLAALDTFDKSVSFVLNDTNWNNSDLNEAKLTIFQQ
                     IDAPVSRKSEGSMFFYSGVTDKMRQTRREQLLDVSVPDIHRVSELYLLNKKPVRAIIG
                     PNINDKYPPSSWAIKKM"
     gene            <985647..>986846
                     /locus_tag="HG535_0D05080"
                     /db_xref="GeneID:59236522"
     mRNA            <985647..>986846
                     /locus_tag="HG535_0D05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288631.1"
                     /db_xref="GeneID:59236522"
     CDS             985647..986846
                     /locus_tag="HG535_0D05080"
                     /inference="similar to AA sequence:RefSeq:NP_010720.3"
                     /note="similar to Saccharomyces cerevisiae NPL3 (YDR432W);
                     ancestral locus Anc_5.542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144526.1"
                     /db_xref="GeneID:59236522"
                     /translation="MSESYEQPPVAPEEYEAPAAEPVEQTGAPEEEEQVPPPQPEHDE
                     MERQHEPMSHHEPMDHHMDDRYHQPGPQPYYPPPPQLEGELSTTRLFVRPFPFDVQDS
                     ELNEIFTPFGPMKEVKILNGFAFVEFEEADSASRAIEEVNGKTFANQPLEVMFSKLPP
                     KRYRIMLRNLPEGCSWQELKDLARENSLETTFSSVNTRDFDGTGALEFPTEEVLVEAL
                     EKLNNIEFRGSVITVERDDNPPPIRRSNRGGFRGRGGFRGGFGGRGGYGFRGGYGGPR
                     GGFGGPRGGFGGPRGGYGGPRGGFGGPRGDYGGPRGGFGGPRGGYGGPRGDYGGPRGG
                     FGGPRGGFGGPRGGYGGPRGGFGGPRGGYGAPRGDYGAPRGDYGAPRDSYRSRDAPPR
                     ERSPTRQ"
     gene            complement(<987547..>989367)
                     /locus_tag="HG535_0D05090"
                     /db_xref="GeneID:59236523"
     mRNA            complement(<987547..>989367)
                     /locus_tag="HG535_0D05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288632.1"
                     /db_xref="GeneID:59236523"
     CDS             complement(987547..989367)
                     /locus_tag="HG535_0D05090"
                     /inference="similar to AA sequence:RefSeq:NP_013699.1"
                     /note="similar to Saccharomyces cerevisiae UBX2 (YML013W);
                     ancestral locus Anc_5.543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144527.1"
                     /db_xref="GeneID:59236523"
                     /translation="MPLIIHEGQEFNLSHEEQDQLNQFQMITTFPDADLPLIIRLLQN
                     HGWKLERAMSSYYDNDWKASLEAENSQPAIPERPSTPNVNVSIGEQNQDLSPFLISDM
                     NLVPSLPIVKPIPANYLETYSIVGLNKRKNESWKIMQESSPLLVILMFIPKVLGKLGI
                     GIISLLWGIITFGFRSNVGNENMVSKVPSLPSGNNMRMEEILPQIADENAMGPLLDIL
                     CTKMTFNDALKECQEEFKFLLVILIGNISLLESDERDKNSQLFLSKIISEQNVLSLLK
                     SHAQDLVIYAGCVEELEPWLVAKQLKVRYTPECLLVGNVLNSSGSINGVTRLSVLSRL
                     RLTSAKRFYKSLKLSIERYNAELLVSRNEQHELRMAREIRSKQDAAYEESLRQQKVKD
                     EMRRKENEEIVAKQNNELELERKRKWKETAKHLFWLRACVNLLDEKMPISGTKEDTAT
                     LQARTSQGLRMILNFKSNTTLYTIYVTLGCFLYLSETKLDSEQWKSKIRNKIKELSKD
                     MSVQCFTSQDIIPEFSDMQEMKKLIEQELSNVPEVFTGQTYVDFDFELVSPFPRHEIP
                     ANSTVTIKDVNQLWPKGSVLIEDVVTEDSGGDSGSEEDDA"
     gene            complement(<989660..>990472)
                     /locus_tag="HG535_0D05100"
                     /db_xref="GeneID:59236524"
     mRNA            complement(<989660..>990472)
                     /locus_tag="HG535_0D05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288633.1"
                     /db_xref="GeneID:59236524"
     CDS             complement(989660..990472)
                     /locus_tag="HG535_0D05100"
                     /inference="similar to AA sequence:RefSeq:NP_013698.1"
                     /note="similar to Saccharomyces cerevisiae TRM9 (YML014W);
                     ancestral locus Anc_5.544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144528.1"
                     /db_xref="GeneID:59236524"
                     /translation="MAEIKEEEYVHKVYNEIADHFSETRYKPWPIVIGFLNKRSVGSI
                     GIDVGCGNGKYLKINPNVFIIGSDRSSGLIQCAHSIDKSHNVMVADGMHLPHKDNSFD
                     FAISIAVIHHWSTRERRVSAIAHILSKLKAGGEALIYCWALEQGNSRRGYHEGMEQDI
                     LVPWVLQEKKTKMALKERKRDKAIKPDLTGVPPNERAKFMANWKKEQDRKRSEQQLDP
                     QNIESDTQEKNTKYRYYHLYREGELEEDCLLAGGTVLDKGYEKDNWYVVVAK"
     gene            <991035..>992594
                     /locus_tag="HG535_0D05110"
                     /db_xref="GeneID:59236525"
     mRNA            <991035..>992594
                     /locus_tag="HG535_0D05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288634.1"
                     /db_xref="GeneID:59236525"
     CDS             991035..992594
                     /locus_tag="HG535_0D05110"
                     /inference="similar to AA sequence:RefSeq:NP_010722.3"
                     /note="similar to Saccharomyces cerevisiae GPI17
                     (YDR434W); ancestral locus Anc_5.545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144529.1"
                     /db_xref="GeneID:59236525"
                     /translation="MPICNNNLRLLVGLCFVGLYLLVGVPLWYNLTAVYRAPLPVEYI
                     RSLHEQKFHDVHMVIPVYIKSIVYRFPDVHEAVQVQVNHLLNSRYQFVPWSLQVLPHS
                     EMKGPESENHVISLVLDDFVGYSISYSSKETTVFFDDRSVISNDVPFFVAQTIIEHTF
                     TLELEQLSSDFSRKHETTAISYNPNIHLSVSLLTGDGYPISWEIDSALKEYFTPLRKL
                     LSPLVNFTVDTGITYYNDLNLHILNESQSVTEQDISHAIDLSELSSMNYFEEPVSLNL
                     AIIFPSELTAPSGLQFINNNSTPEDYGNNWKSYVVPQWGVFVINKYPLQRDSKLTGSF
                     LVPIMYQFANDLFQLLGLAKNSGDITHPGVTIDSFKRWTTLRNINKAEETLWSLVKLA
                     NSFEQMSIPHEVLTNTTAALDLRLDIIDLLNDPKKGGDLLWNQALALSNQLVKLSETA
                     FFHSEMVQQNFFPQEHKIAVYLPLLGPSSVVIFFGFIKLMKERNQNAKAENEKEDKDS
                     QKSEPSNSTEK"
     gene            <992856..>993902
                     /locus_tag="HG535_0D05120"
                     /db_xref="GeneID:59236526"
     mRNA            <992856..>993902
                     /locus_tag="HG535_0D05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288635.1"
                     /db_xref="GeneID:59236526"
     CDS             992856..993902
                     /locus_tag="HG535_0D05120"
                     /inference="similar to AA sequence:RefSeq:NP_013697.1"
                     /note="similar to Saccharomyces cerevisiae TAF11
                     (YML015C); ancestral locus Anc_5.546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144530.1"
                     /db_xref="GeneID:59236526"
                     /translation="MADPEGPLDIIPRTNYSPLLTMANYNSIKQMIDQVLNEDQEYVS
                     WKLKSLRTGGTMNSHMEDLSGNAQSNDPSNSEHLVYQAQNKRRHPNRISKSRPDRINE
                     VPKTSRFPRDFYLESIEKIPLPRELDQDEKFKLLVTNLDDEQTNRFEVFHRTSLNKTQ
                     VKKLAGLVINQSVTENIRVFLQAIGKMYACEMIELALDVRQKWFVSLMMVEFDRRKVV
                     GKKLKKYLKKLTLSVEPENKVDEDCEDSVNESECDSYFDDDEAEMKRIRKGNVLLGGK
                     VNTPEGRLGLIEHYNELVKEFNRIDVSVEKYANSPVLPEHIREAWRLYQLQSDKLPSS
                     KWRSQGEGNGQMFR"
     gene            complement(<993911..>994876)
                     /locus_tag="HG535_0D05130"
                     /db_xref="GeneID:59236527"
     mRNA            complement(<993911..>994876)
                     /locus_tag="HG535_0D05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288636.1"
                     /db_xref="GeneID:59236527"
     CDS             complement(993911..994876)
                     /locus_tag="HG535_0D05130"
                     /inference="similar to AA sequence:RefSeq:NP_010723.1"
                     /note="similar to Saccharomyces cerevisiae PPM1 (YDR435C);
                     ancestral locus Anc_5.547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144531.1"
                     /db_xref="GeneID:59236527"
                     /translation="MEKVVQQTDYDALSCRLAAISKGYLPSVAFQVQRCNYHGYKEMH
                     MEYLHSLKSVSRRIHSKIFRAMQNSFPVMNYGTYLRTVSIDIQINDFLKSHSKFQNVQ
                     IINLGCGSDLRMIPIIKNFTNVTYIDIDYKDSIEMKRKILDQNRALKKALESDDDGET
                     NRYKLISCDLNDEAQTVRTLSESTSSDSPTIVISECVLCYMDDHASKQLISVVLDIYK
                     TGIWISYDPIGGSKFSDRFGIIMQSNLRESRHLEMPTLMIYNSKETYSSRFANCNVEI
                     KDMWDIFENDIPKEEISRLKSLQFLDEVEELKIMQTHYVLLKASW"
     gene            <995596..>997722
                     /locus_tag="HG535_0D05140"
                     /db_xref="GeneID:59236528"
     mRNA            <995596..>997722
                     /locus_tag="HG535_0D05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288637.1"
                     /db_xref="GeneID:59236528"
     CDS             995596..997722
                     /locus_tag="HG535_0D05140"
                     /inference="similar to AA sequence:RefSeq:NP_010724.1"
                     /note="similar to Saccharomyces cerevisiae PPZ2 (YDR436W)
                     and PPZ1 (YML016C); ancestral locus Anc_5.548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144532.1"
                     /db_xref="GeneID:59236528"
                     /translation="MGNTGSKSAKSTKSTKSSKVKNGSKSSDGDSSASPAFTRTDTSQ
                     SVRSTRSMRSLRSRRSETNSLNSRINSKEEAGSSTVDNASEANTETPRRDGLHHRHSE
                     SDFLHQPNTLADNNHLRPSTPTSSRAQSKRSSFANTDLPPSMIQMAPKSPILKNKVYN
                     NTNAANYNENALTDEDDDDDYDDSSSKKKNKNGGSNRSRDSISKHSTSKSQLDSVRHN
                     ISSRPSSVRSGSSSKIRRRSDNFDGHEMSPNQHIMTRTNSHASSIQTRKSSGSAGTTA
                     YSTPLNSPGIIRRTDQQDDFIDGQDDYFGSANINVGNHTDGQEVDEVNSENDVMGEKH
                     HHLKLPDVKNLSRRESLNEYPSNIPDIVVDDSSPSANDQRQSGPKKKRIIKPINIDET
                     IQKLLDAGYAGKRTKNVCLKNSEISQICQLAREMFLSQPSLLELSPPVKIVGDVHGQY
                     GDLLRLFTKCGFPPSANFLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHEC
                     ANVTRVYGFYDECKRRCNIKTWKLFVDTFNTLPLAAIVAGKIFCVHGGLSPVLNSMDE
                     IRHVSRPTDVPDFGLINDLLWSDPTDSPNEWEDNERGVSYCYNKVAINKFLNKFGFDL
                     VCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMSVSEGLLCSFELLDPLDG
                     AALKQVMKKGRQERKVANQQQMQDTQ"
     gene            <998093..>998509
                     /locus_tag="HG535_0D05150"
                     /db_xref="GeneID:59236529"
     mRNA            <998093..>998509
                     /locus_tag="HG535_0D05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288638.1"
                     /db_xref="GeneID:59236529"
     CDS             998093..998509
                     /locus_tag="HG535_0D05150"
                     /inference="similar to AA sequence:RefSeq:NP_010725.3"
                     /note="similar to Saccharomyces cerevisiae GPI19
                     (YDR437W); ancestral locus Anc_5.549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144533.1"
                     /db_xref="GeneID:59236529"
                     /translation="MTEDYSEEYEWFAYYITVTSILVFIIVWSLLPNESAIGQLHNGL
                     FKAILEILPQRNWVIYSQAFILMGMLYTYFGILMYNEDVLTPSLDDLRTITDSKGKVA
                     IADSEKKLIDEYVFKETSAIIDIPIMDVCRILYGDK"
     gene            complement(<998662..>1000353)
                     /locus_tag="HG535_0D05160"
                     /db_xref="GeneID:59236530"
     mRNA            complement(<998662..>1000353)
                     /locus_tag="HG535_0D05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288639.1"
                     /db_xref="GeneID:59236530"
     CDS             complement(998662..1000353)
                     /locus_tag="HG535_0D05160"
                     /inference="similar to AA sequence:RefSeq:NP_013695.2"
                     /note="similar to Saccharomyces cerevisiae PSP2 (YML017W);
                     ancestral locus Anc_5.550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144534.1"
                     /db_xref="GeneID:59236530"
                     /translation="MVHSRDIILTSDYNPMVMELCIMRTGSNNAGAIKKMSLEEFLGD
                     DTLGDSVWNEDEINLDAISNTTNIDFLKTKSGPDNTESGPNGHSGNRMHNESAFDFHH
                     RGGFGRENDGGSGDSFAMQGPPYIVKFSLLPPRFSDADIHDLFHEKFTKFVKFKLFWE
                     LNKNPSIDVVKSGSIFDQNFRKTTKVGFVELYTGRDMDKILKYWSTPLLKIHNIKVEP
                     AEFNDFKEYRTKVELLTDPNDDAGKPYIMARKKSNPFGAAKPVDTQSKILAIEDTVGK
                     LHIEDTRTLRRLSGGETTNGPTSLKSGKVQILKKPKEVSKEAQPSPPPLRYVDVMEKQ
                     SGEEQKKKTSPTATTALPSTGDIDVKCSEQTSASLQHNTLILDDNIELQNGGNETGQT
                     SNFSDSEGGYSSGPSHRTYGDQRPQRGGRGGGYSRGNSNKRGGGGTGGGNRGGNGPHQ
                     SRYNNKYDSANENENYQPRTYNNHRANQSHDQNQNFNKHSQGQNQSQQNQGFNQEEKR
                     YSMFKPASGFLWENGKNNDGQNHSRGGFNNNNNHRGSRRGGFNNRGRHNNGFTPA"
     gene            <1001325..>1002530
                     /locus_tag="HG535_0D05170"
                     /db_xref="GeneID:59236531"
     mRNA            <1001325..>1002530
                     /locus_tag="HG535_0D05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288640.1"
                     /db_xref="GeneID:59236531"
     CDS             1001325..1002530
                     /locus_tag="HG535_0D05170"
                     /inference="similar to AA sequence:RefSeq:NP_010726.3"
                     /note="similar to Saccharomyces cerevisiae THI74 (YDR438W)
                     and YML018C; ancestral locus Anc_5.551"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144535.1"
                     /db_xref="GeneID:59236531"
                     /translation="MMIRKLGKRWTLGLVMLALVIVLWVLSSFLLNLIFQDNSYKKPF
                     FITYINTASFVFYLIPTGRKMVKNYIQTGHFHAHDELVLEEEGAAQDVVESEQDPDTS
                     ITVHSPLIPKDSNVDHDGSRLSLPETMKLSAEFCVLWFTANFVTNASLAYTSVASQTI
                     LSSTSSFFTLFVGALCHTETLNRVNIVGSIVSFLGILLVTRSDALQSHIHIKPFPGSS
                     TFDDNDDTSADAMKTLLGNVLALLGAFFYGIYSTLLKHRIKDESRVNMKIFFGFVGLF
                     TLIFVWPTLLLLHYTGWESFEWPSTPRIITVVTVNCLITFISDFCWANAMLLTSPLTV
                     TVGLSITIPFAMFGDFMLKNKPMTLLYFLGAMLILGSFFIINKHSEEETLDHLLEDTN
                     SSATGELTV"
     gene            complement(<1002685..>1003653)
                     /locus_tag="HG535_0D05180"
                     /db_xref="GeneID:59236532"
     mRNA            complement(<1002685..>1003653)
                     /locus_tag="HG535_0D05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288641.1"
                     /db_xref="GeneID:59236532"
     CDS             complement(1002685..1003653)
                     /locus_tag="HG535_0D05180"
                     /inference="similar to AA sequence:RefSeq:NP_013693.1"
                     /note="similar to Saccharomyces cerevisiae OST6 (YML019W);
                     ancestral locus Anc_5.552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144536.1"
                     /db_xref="GeneID:59236532"
                     /translation="MKFLRILYLLVLLFAGQSKAVLEAADALQLKDFSGVITVTEDNY
                     EELSRGVPNYFMALFITTSRPVKEGVRCVICDDFEPILRKVAVTISKQAPHAQILFLK
                     ADVAFNKLLVKDLKISSIPHMLIFPPPVDDKFQWKSSSFYQYELKEERIRDALHFGDF
                     LAKILKVFIKVDQKFEYQEFFSYFIACIVIFSIFKRVVLPKIPNKPKFFSMLVSLLIL
                     LLSITGLKFTQINSVPFIARDPKGNIMYFSGGTGWQFGIEILSVSAMYIVMGVLFCMM
                     LYIHSFSMNDRLRWVLSAVCSCLLFYLCSYYVSCFDIKSPGYPYKF"
     gene            <1003852..>1004628
                     /locus_tag="HG535_0D05190"
                     /db_xref="GeneID:59236533"
     mRNA            <1003852..>1004628
                     /locus_tag="HG535_0D05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288642.1"
                     /db_xref="GeneID:59236533"
     CDS             1003852..1004628
                     /locus_tag="HG535_0D05190"
                     /inference="similar to AA sequence:RefSeq:NP_010727.1"
                     /note="similar to Saccharomyces cerevisiae LRS4 (YDR439W);
                     ancestral locus Anc_5.553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144537.1"
                     /db_xref="GeneID:59236533"
                     /translation="MTTLVQLLANYYKSVVESERIYYENVIRKSVTSDTSDKELREPS
                     PRMLQEMLLLQRQIGQLTVEIQVLRKENDTLKELQKTQRALMESKLNNCKKTIEKLKK
                     NGKDELSEQRNSNLQERDRANFHLLSPLNVRTLDGVSTQNHYANSNGRPTSLRHVITN
                     KQQTLFDGDDSRENLSADRLEDVAFVNSLKNRGELAKIVLPSDGLSVNDDSVAKSTST
                     SLQSLSGRQLGNKKKRLARKRIKTGDSESDDEDVIKHPLV"
     gene            complement(<1004808..>1006739)
                     /locus_tag="HG535_0D05200"
                     /db_xref="GeneID:59236534"
     mRNA            complement(<1004808..>1006739)
                     /locus_tag="HG535_0D05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288643.1"
                     /db_xref="GeneID:59236534"
     CDS             complement(1004808..1006739)
                     /locus_tag="HG535_0D05200"
                     /inference="similar to AA sequence:RefSeq:NP_013692.1"
                     /note="similar to Saccharomyces cerevisiae YML020W;
                     ancestral locus Anc_5.554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144538.1"
                     /db_xref="GeneID:59236534"
                     /translation="MISTPSSSHASLRSAGSDRKSTGVDLKEAPHKTSRSWSVWGGDK
                     AEVNLKRPKTSEESASHSKSSGLETSSVCNIEPSHKSAMTQASVKSYEKNGKVISSAS
                     GNMVPQEADQMGPSEHQNIRKEDPTTEGEDKSNKRTWFFWNRVSNNQKNGTTSEVEQI
                     ATSSKNDSQMTNTFIPYSETDAILIKGKSATEITEQENIQVNENPHPNIVVPSFDVLP
                     HQTTWTSISSCINKWANSWSIISEKRLKQKCLYRRDPQESLLKLSNDNSHPIKVLIVG
                     VHGFFPTKMIRPFIGEPTGTSIKFISEAEKVLTEYFNKNETKVQISKIALEREGEVMD
                     RVDFFFEVMKSWAKEINQADFVYFVAHSQGCPVTILLLARLIDCGIVNLDTAMFSNEE
                     LVPQCKNKKIISILAMAGINNGPFYGADQTLFVRAYQTIEKESLRELFQFQKFDSILS
                     RQLIRSIRIIIRSGVKISFIGSINDQLVPLYSSMCLFAHHPNIFRATFIDIESRTPKF
                     IKRLVNIAGTLINLGYDDHGIIKEISGALAGTLTGGGHSTVYNEAQVYEIGLKFALET
                     TDCIADTPVEFKPFKLDQLGANPFHLPWCMRGLLYETGRRFDDDETHQLFSEFEEWEP
                     ETKQLKDVKYRLNGLKSKL"
     gene            <1007052..>1008089
                     /locus_tag="HG535_0D05210"
                     /db_xref="GeneID:59236535"
     mRNA            <1007052..>1008089
                     /locus_tag="HG535_0D05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288644.1"
                     /db_xref="GeneID:59236535"
     CDS             1007052..1008089
                     /locus_tag="HG535_0D05210"
                     /inference="similar to AA sequence:RefSeq:NP_013691.1"
                     /note="similar to Saccharomyces cerevisiae UNG1 (YML021C);
                     ancestral locus Anc_5.555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144539.1"
                     /db_xref="GeneID:59236535"
                     /translation="MTVELKRRQTSIAEFFGPKSKKSKKLENEESANTSTTDASDEVS
                     TVKSIEQIQTTQKKESESETLEGCEDYMTVRELFQKSLSSMLAQLLALEIETIEPGWF
                     SHMKEEFRKPYFVKLKQFVNTEKKNHTVFPPPRAVYSWTRLTPFDKVKVVIIGQDPYH
                     NFSQAHGLAFSVKSPTPAPPSLKNIYKELKSNYSDFSIDNNYGDLTPWSMQGVLLLNT
                     ALTVRAHNANSHSKKGWEVFTKRVVELLISDRKKNNHSLVFLLWGNNAIKLVESLLSP
                     QELAQNKNLKVFKSVHPSPLSASRGFFGSNHFKQTNDWLYHERHEKMIDWSVVPGSHL
                     KEVFEANTKVS"
     gene            <1008306..>1009994
                     /locus_tag="HG535_0D05220"
                     /db_xref="GeneID:59236536"
     mRNA            <1008306..>1009994
                     /locus_tag="HG535_0D05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288645.1"
                     /db_xref="GeneID:59236536"
     CDS             1008306..1009994
                     /locus_tag="HG535_0D05220"
                     /inference="similar to AA sequence:RefSeq:NP_010728.1"
                     /note="similar to Saccharomyces cerevisiae DOT1 (YDR440W);
                     ancestral locus Anc_5.556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144540.1"
                     /db_xref="GeneID:59236536"
                     /translation="MEDEFPSLFSSPKDESASSFSSDKEQDYGVLKLQFTGETTNGQV
                     KTAKRRSKGLEKLLEEASIYTPRYESSLPRGFLRDRHKKSTESKDPSYAKTGDEPVAK
                     KSRAKLTTMKKQLHTKKRAGITIRNVIPKTTRPLPEDHRGQVEKDDPSSNQSHAFENS
                     LKPTKFYFVECEGPPLKLRYDLFDVPFLQTHAKFQGSPTPSTILTAKSSQRNVNSYTI
                     MLKSVLFLDYEEEYHVDSGSSSMKFDSMSEIGKIIEYTAIIYVPKPYSNLILENILPH
                     LYEAFNTSNCKLFIEKVQDYNEFIQTIPREEILEHLTQARFIPRCFIHDLLHIVYSRS
                     ILPSFRKLKEYEAFSSYVYGELLPSFLSDVYSKCELEPNHVFMDLGSGVGNCVVQAAL
                     EYGCKLSFGCEIMPNASELTEEQHKELAERCKLFGLKLHPVEFSLRQSFVDNSRVDAL
                     IPQCDVLLINNFLFDAKLNKKVEEVIKSLKTGTKIISLKNLRGQGYAINFFNLDSILN
                     RLKVERFDLKQGSVSWTHNGGEYYISTVLPDVDESLFDPSEGKRNTRRPQRYTR"
     gene            complement(<1010368..>1010931)
                     /locus_tag="HG535_0D05230"
                     /db_xref="GeneID:59236537"
     mRNA            complement(<1010368..>1010931)
                     /locus_tag="HG535_0D05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288646.1"
                     /db_xref="GeneID:59236537"
     CDS             complement(1010368..1010931)
                     /locus_tag="HG535_0D05230"
                     /inference="similar to AA sequence:RefSeq:NP_010729.3"
                     /note="similar to Saccharomyces cerevisiae APT2 (YDR441C)
                     and APT1 (YML022W); ancestral locus Anc_5.557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144541.1"
                     /db_xref="GeneID:59236537"
                     /translation="MSIEAYAQELKAALHQYPNFPQKGILFEDFLPIFRKPDLFQKLI
                     DALVIHLKETFAENNIDFIVGLESRGFLFGPSLALALGVGFIPIRKPGKLPGELVTAA
                     YTKEYGDDSMEMQKEAIPANSNVVIVDDIIATGGSASAAGSLVKQVKANILEYCFILE
                     LDFLKGKQKLDAPVFTLLSGQQEALKH"
     gene            <1011154..>1012722
                     /locus_tag="HG535_0D05240"
                     /db_xref="GeneID:59236538"
     mRNA            <1011154..>1012722
                     /locus_tag="HG535_0D05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288647.1"
                     /db_xref="GeneID:59236538"
     CDS             1011154..1012722
                     /locus_tag="HG535_0D05240"
                     /inference="similar to AA sequence:RefSeq:NP_013689.1"
                     /note="similar to Saccharomyces cerevisiae NSE5 (YML023C);
                     ancestral locus Anc_5.558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144542.1"
                     /db_xref="GeneID:59236538"
                     /translation="MSYSTSLTYAKGRNGHNQDLHYFVDLNHTHQSSFEIPHSICLLD
                     HYDHLILFFECQMGTGGAFVVPLFDIIVILMTLATISDHHKEQILRNNDPYNATRSSL
                     GKRALKLLRFYIKTLKDFDHTEKRLYDLELLRCQFFIVIDQLFVNTSLKNPYASYISC
                     LEQKSGVLGTEFITSTIGKRANFLNTILWTFSNSLQDDRALYTSIHEVWMPIQDIMLD
                     LIELRHDYYIRNEIDKGDGRLEIFKALARSPLARFLTSMDSSRQFSRRFCGYIFIMCD
                     YKSNLKATEELQIYPVHRGEESFSPTFVSRVRYTRDYKLQKSFLMQRRFLKICFRLYL
                     DIPAGFELSSPSFNLEDLVEEISKNLAEFNDIKQFEAFFFANYRQSLHMMPYIAQTTL
                     IRIFSGFIDRSQKKSISLPKVNLVDILNNADSFLTQCISLFQEGFFMLWDIESKNSFI
                     LDNMKADTCLIVLLNRMQYLNGKSTLIDSKYYDEFVSSINKNDSERRDIINRHFLGEE
                     VSDFHSVITQLLDI"
     gene            complement(<1012762..>1016814)
                     /locus_tag="HG535_0D05250"
                     /db_xref="GeneID:59236539"
     mRNA            complement(<1012762..>1016814)
                     /locus_tag="HG535_0D05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288648.1"
                     /db_xref="GeneID:59236539"
     CDS             complement(1012762..1016814)
                     /locus_tag="HG535_0D05250"
                     /inference="similar to AA sequence:RefSeq:NP_010731.3"
                     /note="similar to Saccharomyces cerevisiae SSN2 (YDR443C);
                     ancestral locus Anc_5.559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144543.1"
                     /db_xref="GeneID:59236539"
                     /translation="MVTDSSIYRLEDLLSSFYRVEKVEKINYHQYVPKKQDDQWSIQM
                     ELLIRKQNPRNLVALLSRELWLFSINEREIPSLPKATGSTNNTATPDKSGHFTADYSK
                     PNLPPHYALFLKALRRMIYINITARSHNRLVPYGNACISLGYSCSNQILQIEPHLFED
                     GNLAVTVCSKPMGLVRLSVDKIEESFLRQHALYLAPSGIRMYMYSDKKEQCLVPPPKN
                     SEILLMTLYISHGINLCHKKNIQWAKFIPHLGHLNGHTPNVATYMDPPTDMRTIVWPV
                     DLCFAQKATNCPENSKNDLSCNHLSGAFDIIDDFMQLKQTSAYRTPNSSGGAAVNTVG
                     TNPLSSGGAYTDQFQHYYRNTTGSAPSTTYAAVNVGGKGSPQDLSPAYTTLDKPLSGL
                     SDHFGNGAFLTTPNINEHDFNERRNLINDLDISPVKPDIANNKVSTKTLSVHSLEATP
                     QTSENSQGLVGSTRENELFGEDDDGDDEDLFGEQDGSSGSLPKPKDMSLDKNLSDEIT
                     EDMFGMSDDDDSNKCISPRRDLYHVGDNDESQQGFPAKGSRLKRKYLDIPMEEMTLSN
                     SPLYMDPGAPLPIETPKDRRKSVFAPLTFNPIIENNVDNKYKNGGKFSFSPLLNEESL
                     KFDVSTADLSSSEEESDSSDDFADFVARPSAEPNMQEFQYGNYQAMQIIPDSVPPEGS
                     KSDLVSPNLSVVNEPTKDSSNAIWRIPPTDLSQNEPLISSTGETVLQNADLMEPSAAE
                     QTSHERKQIISDGTSSFDLAENEATNSGVNPSGDSLIPETSSSLPFLLRHMPLSSIPC
                     TFSSVNPTIVVSEKDQTILALLAEQIVFDYQILDSMAKYEITNLGLKTCSDGLVSHVM
                     KQVFTEFTRLHGGDLISKFYSINQPSVYVKKHHETVTLNADSQPFNKYLNSKPANGIK
                     NIRFLLLTTAFHEDCLSFVSTLCQTYIGYEFGFCELLKLANEDAQGLVCLKDLEKGKL
                     LLLAAQIVTYCSTNKNAGKDVPVMIMLPIDSNTLEEVVTKVTLFNIIRSEVTAKIPSA
                     QIFLKLMPIDFIRNPLTSVDSYSDLCMSIYNILPPKSIKFASVAHKLPEKVVFRTQQQ
                     NNGSPGVHYDALIHLAYARSVDKAWVFAAFSDSRGNENMVKAWYVGTSKNKFDDACNE
                     IWSLALKMSSKKYGKTCLILTRLNGVLPDDELMNWRRLSGRTLHLAVVCVDDNTKVSF
                     FDEEKIYPTFKPLLNDDSLCKEMSAKDLDDFEIRDIVQDVHAVVFCHPFPLTNSQHRC
                     AIKSGALIQFGNELGDSILRKFEVNLLNCPHSDSTSLLETILEEFRNLGALSSWFGVS
                     NGETAHIPWHVLAVKKLLGTLVHTKVKVSE"
     gene            complement(<1017169..>1017648)
                     /locus_tag="HG535_0D05260"
                     /db_xref="GeneID:59236540"
     mRNA            complement(<1017169..>1017648)
                     /locus_tag="HG535_0D05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288649.1"
                     /db_xref="GeneID:59236540"
     CDS             complement(1017169..1017648)
                     /locus_tag="HG535_0D05260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144544.1"
                     /db_xref="GeneID:59236540"
                     /translation="MSDFYKLCPFVRKNEPFPFTNLKGKVVLIVNVASKCGFTPQYEG
                     LQELYKKYREQGLVVLAFPCNQFGAQEPGTDDQISDFCKINFGVTFPVLQKIDVNGSD
                     ASPVYEFLKSRKPGLLGFKGVKWNFEKFLVDRNGKVVSRFTCFTVPSMIEPAILELL"
     gene            <1018811..>1020766
                     /locus_tag="HG535_0D05270"
                     /db_xref="GeneID:59236541"
     mRNA            <1018811..>1020766
                     /locus_tag="HG535_0D05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288650.1"
                     /db_xref="GeneID:59236541"
     CDS             1018811..1020766
                     /locus_tag="HG535_0D05270"
                     /inference="similar to AA sequence:RefSeq:NP_010732.1"
                     /note="similar to Saccharomyces cerevisiae YDR444W;
                     ancestral locus Anc_5.560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144545.1"
                     /db_xref="GeneID:59236541"
                     /translation="MKPWTIESKTVEGSLIYDDIESLGIGSLCRYKVIVEKGEIEGAE
                     NEELTKLFLRVKNKESPLLRPVYLTGPYACYVDVRPYNYDEDHTFDKNEPIQFTSDLR
                     PDEHFKADLWLNENSRMEDGRYSWTIDVISQVSVSSVPKVEYQLKIGTTKAATKHIKK
                     VTKSFKGVVVERWDTRKLWNLPPKFPHKPVHLVILTHGIFANVGCDMLYMKDKIEEKA
                     FTLPEEINPNVVVRGCMDNMGKSARGIRYLGIRVAKYILRTLDELNEDYKVDKLSVIG
                     HSLGGPVQAMAIHYISVKRPDVFDPATGVKPINFIACASPFLGVVGDFPLYVSLALDV
                     GALGLTGRDLTLRHTPLISTDGIVADKDERPLHKFILEALPQSPALEVFQKFVHRTVY
                     ANVLHDGIVPLRTAALLYLDWGSLAKVHDIRKKQSLAASDGLNTPIDASSSDDLKSDE
                     KHNAIGEIPIEGMEKKAALQWIMPQVLNKGKKFSKYERTQTRDFDSDSSESDNGSNIK
                     KRLSDNSNFNPPPEASTFMAAISVIVSPVPTQEYLKNPAIRTDAIVHDKVYHPNELPP
                     PHYNDRPFIKKVIYLNESNNRCQERIARAWQEKMSWRKVLVDLKPDSHNNICVRRRFT
                     NLFGNVAVKNLVDSHFGEEACRKYAAL"
     gene            complement(1021233..1021305)
                     /locus_tag="HG535_0Dtrna10K"
                     /db_xref="GeneID:59236650"
     tRNA            complement(1021233..1021305)
                     /locus_tag="HG535_0Dtrna10K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59236650"
     gene            <1021521..>1022459
                     /locus_tag="HG535_0D05280"
                     /db_xref="GeneID:59236542"
     mRNA            <1021521..>1022459
                     /locus_tag="HG535_0D05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288651.1"
                     /db_xref="GeneID:59236542"
     CDS             1021521..1022459
                     /locus_tag="HG535_0D05280"
                     /inference="similar to AA sequence:RefSeq:NP_010734.1"
                     /note="similar to Saccharomyces cerevisiae ECM11
                     (YDR446W); ancestral locus Anc_5.561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144546.1"
                     /db_xref="GeneID:59236542"
                     /translation="MTLIKAEENPETRLKSSVSTDSTIFFGNSKAREPDSPKRICGAK
                     DSRPALVNKSLNVASPKKDSTINLKKPKPEDSLLSAVNGLSSPARQRNLEMCIPSAPR
                     IKSEFEATKMVLQETIGSPKGKLIKSSSNINFSRSSPVASGPGINSLPSSIKKKKLKS
                     TTDKFKKISSTELFGNLDKGILPFTNYQHALDAPGEYFPITRFLYELHTSDEDSQKKN
                     DLFADIEQDKERKFCQKTSQYSLSKWIEEGQNLMNRQTNLIGELVRERIELSHKFRVI
                     TTIINQRAEALNGRGDILDEKLNKIKSLGKEILNII"
     gene            complement(<1022658..>1023357)
                     /locus_tag="HG535_0D05290"
                     /db_xref="GeneID:59236543"
     mRNA            complement(join(<1022658..1023065,1023355..>1023357))
                     /locus_tag="HG535_0D05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288652.1"
                     /db_xref="GeneID:59236543"
     CDS             complement(join(1022658..1023065,1023355..1023357))
                     /locus_tag="HG535_0D05290"
                     /inference="similar to AA sequence:RefSeq:NP_010735.3"
                     /note="similar to Saccharomyces cerevisiae RPS17B
                     (YDR447C) and RPS17A (YML024W); ancestral locus Anc_5.562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144547.1"
                     /db_xref="GeneID:59236543"
                     /translation="MGRVRTKTVKRASKALIERYYPKLTLDFQTNKKLCDEIATIQSK
                     RLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSALDLSHSKGVLNV
                     DNQTADLVKNLGLKLPLSVTSVSAQRERRFRRRV"
     gene            <1024089..>1025393
                     /locus_tag="HG535_0D05300"
                     /db_xref="GeneID:59236544"
     mRNA            <1024089..>1025393
                     /locus_tag="HG535_0D05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288653.1"
                     /db_xref="GeneID:59236544"
     CDS             1024089..1025393
                     /locus_tag="HG535_0D05300"
                     /inference="similar to AA sequence:RefSeq:NP_010736.3"
                     /note="similar to Saccharomyces cerevisiae ADA2 (YDR448W);
                     ancestral locus Anc_5.563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144548.1"
                     /db_xref="GeneID:59236544"
                     /translation="MSNKFHCDVCSADCTNRVRISCVECSEYDLCVPCFSQGLYNGGH
                     RPYHDYRIIETNSFPILCVEWGADEELALIKGSQTLGLGNWQDIADHIGNRDKEEVAK
                     HYLDYYISSPYYPIPDITNNIDVSQEDFLEQRRQTIEKFREKPLQPLRKPMASVPSCH
                     EIQGFMPGRLEFETEFENEAEGPVKDMVFEPDDQPLDIELKLAILDIYNSRLTTRAEK
                     KRVLFENNLLDYRRLQGIDKRRNKETKDLHNKIKPFATIMTAIDFEEFSRDILEELRC
                     RSRIHQLQEWRSNGITTLEAGLKYERDKQLRIAALERFGTSTYTQANGIDGRHRTSSA
                     HRSNADYSQNHNEVSGRKKVMTISDIQHGSDFGLLSPDEQQLCTQLKILPKPYLAIKE
                     LLFRELLRSDGSLKKKSCRDLLNIEPIKANKIYEFFESQNWI"
     gene            complement(<1025430..>1026767)
                     /locus_tag="HG535_0D05310"
                     /db_xref="GeneID:59236545"
     mRNA            complement(<1025430..>1026767)
                     /locus_tag="HG535_0D05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288654.1"
                     /db_xref="GeneID:59236545"
     CDS             complement(1025430..1026767)
                     /locus_tag="HG535_0D05310"
                     /inference="similar to AA sequence:RefSeq:NP_010737.1"
                     /note="similar to Saccharomyces cerevisiae UTP6 (YDR449C);
                     ancestral locus Anc_5.564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144549.1"
                     /db_xref="GeneID:59236545"
                     /translation="MSSKTRYYLEQCIPEVNDLVDLGLFTKKEVSLIMKKRTDFEHRL
                     NSRGSSINDYIKYINYENSVESLRKKRVKRVLQNSKKNTISDWSVQQRIAYIYQRGCN
                     KFPNELKFWAMYLKYLKTRGNQTSYKKIQKVYNELLRLHPTNVEVWISCAKYEYEVHA
                     NFKSCRLLFQNALRFNPQAFKLWYEYIKFELSFITKLINRRKVMGLLSEREQELDMLK
                     QTSTESSEENGSKNEDATVYIPTAGDVMKDKLNQLPEADMNMLGNDETNPALRGDIAL
                     TIFDMCMKTLGDYYINKYKGYYDISDSVTLKELKLETTSTLFEKSMELISLFDNFKDL
                     HRDYLINHVLEYWKNEHENILLKDDLPELNDGIIFLDITLNIRYMQVESLDVDQLQLS
                     VKKYFAYKSKLDESSIKKVKEKYSEFIRDRFITKMSSENNESYHLLETITKKL"
     gene            <1027069..>1027959
                     /locus_tag="HG535_0D05320"
                     /db_xref="GeneID:59236546"
     mRNA            join(<1027069..1027095,1027177..>1027959)
                     /locus_tag="HG535_0D05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288655.1"
                     /db_xref="GeneID:59236546"
     CDS             join(1027069..1027095,1027177..1027959)
                     /locus_tag="HG535_0D05320"
                     /inference="similar to AA sequence:RefSeq:NP_013687.1"
                     /note="similar to Saccharomyces cerevisiae YML6 (YML025C);
                     ancestral locus Anc_5.565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144550.1"
                     /db_xref="GeneID:59236546"
                     /translation="MFSKCRLTRLFKTIRRQSTLAAESVSLPNAATPPRFTLATVRSF
                     PSLEPLTFAPVPINVLAAPLRRDILWRAVVYENDNKRVGSSNPPGRSENGYSRRKLLP
                     QKGTGRARAGDANSPTRHNGARALARNAPNDYTTALPYKIYSQAVLNALSHQYKSGNL
                     FIIGGGNELAKTNELDLNELDLVPNPNAEADHGDIVFARFLKEYNLENKRLLFITSDL
                     REGLMKHTDAFKDKVDIVQQEFVDVNDLLKAQRIFIELESLEFLAVTHSPE"
     gene            <1028722..>1029486
                     /locus_tag="HG535_0D05330"
                     /db_xref="GeneID:59236547"
     mRNA            join(<1028722..1028768,1029093..>1029486)
                     /locus_tag="HG535_0D05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288656.1"
                     /db_xref="GeneID:59236547"
     CDS             join(1028722..1028768,1029093..1029486)
                     /locus_tag="HG535_0D05330"
                     /inference="similar to AA sequence:RefSeq:NP_010738.1"
                     /note="similar to Saccharomyces cerevisiae RPS18A
                     (YDR450W) and RPS18B (YML026C); ancestral locus Anc_5.566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144551.1"
                     /db_xref="GeneID:59236547"
                     /translation="MSLVVQEQGSFQHILRLLNTNVDGNIKVVYALTTIKGVGRRYAN
                     LVCKKADVNLYKRAGELTQEELERIVQIMQNPTQYKIPAWFLNRQRDVNDGKDYHTLA
                     NGVESKLRDDLERLKKIRAHRGVRHFWGLRVRGQHTKTTGRRRT"
     gene            complement(<1029844..>1031034)
                     /locus_tag="HG535_0D05340"
                     /db_xref="GeneID:59236548"
     mRNA            complement(<1029844..>1031034)
                     /locus_tag="HG535_0D05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288657.1"
                     /db_xref="GeneID:59236548"
     CDS             complement(1029844..1031034)
                     /locus_tag="HG535_0D05340"
                     /inference="similar to AA sequence:RefSeq:NP_010739.3"
                     /note="similar to Saccharomyces cerevisiae YHP1 (YDR451C)
                     and YOX1 (YML027W); ancestral locus Anc_5.567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144552.1"
                     /db_xref="GeneID:59236548"
                     /translation="MKFVKRSHIFIHSNIKLNKQLRRSVCFDIWAYLIMTTSGKPLLP
                     SLQSIFHTEGPMPEPCSSLLNSMRPRFYSDNGVIRLPPLEGGVQRPKSVDSGLRHTMV
                     SQPANTETKVEPSTPLSKTKSATSSLGASSSLGKRCDVLTPLSAARAIITPSANDKKR
                     AFAFITHSQETFPKKEPKIDNAPLARRKRRRTSTQELRILQAEFDLCPAPDKRKRQEL
                     ADRCNMSVKAIQIWFQNRRQASKKQKNSASKSTAASAETKEMSEMIIEDNLHMTPLAN
                     KIINTLETGNCRDSTVDDLSVVLPEEKISPTKSINKYTPTKLSPSSKRGQALTFHLTS
                     DKKLLTPIKTPSNTRVNRLINGTPGSVSPFPRKYSITQNNSKPILEHKKIPLRELNTN
                     TLVH"
     gene            <1031796..>1033814
                     /locus_tag="HG535_0D05350"
                     /db_xref="GeneID:59236549"
     mRNA            <1031796..>1033814
                     /locus_tag="HG535_0D05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288658.1"
                     /db_xref="GeneID:59236549"
     CDS             1031796..1033814
                     /locus_tag="HG535_0D05350"
                     /inference="similar to AA sequence:RefSeq:NP_010740.3"
                     /note="similar to Saccharomyces cerevisiae PPN1 (YDR452W);
                     ancestral locus Anc_5.568"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144553.1"
                     /db_xref="GeneID:59236549"
                     /translation="MVINVSTKEALIAPRQGGKHHRGLAVRYVVVLSCLIAAFYYLLG
                     TVRVRDDEDAVFEILSGEEGWHVGSEGERERLAQLGLTPRAPVILRDSQTGKEKKLHG
                     RFLHITDIHPDSHYREGSSIDKQCHRDKPEDKKDRAPRFGRACAGCDGSVDLMDYTLK
                     WIKENVRDEIDFVIWTGDNVRHDNDRQIPRTEFEILDMNEVLAQKMHSLFCDHESNNP
                     RDFDAMVVPSLGNNDVFPHNLFAMGPTLQTREYYRIWNTFVPQEQQRIFDRSASFVTE
                     VIPGKLAVISINTLFLFKSNPLVDNCDSKKQPGYQLLVWLGNILQEMRERGIKVWLSG
                     HVPAIPKNYADSCYDKFTLWTYEYRDIIIGSLYGHMNMDHFIPADGKKSWKIINEREQ
                     LNGASLYKSYSDNEADAEVADDDDDFFLDHAMCASETHLLGAKPVQKESYMNSVKNVF
                     YQKIFDKFEDQEAYQTGKRKRKNLRKKRKSMEKLCERYSIVQIAGSVIPTFNPGFRIW
                     EYNLTGIDNDDQLLRAQSWDKFYQNLERIMDNDVRIDEDYSIVEITGKRSKNDKTLPA
                     KKPKNLPLGPAHVAQLFSPTKFIQYFADLSEIDKQYKDLLKQGKNASEAADFAFKYKV
                     EYTSQDEPYALGGLLVKDYISLASKLVSDKKLWKKFLERAFISSGYKD"
     gene            complement(<1033930..>1034520)
                     /locus_tag="HG535_0D05360"
                     /db_xref="GeneID:59236550"
     mRNA            complement(<1033930..>1034520)
                     /locus_tag="HG535_0D05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288659.1"
                     /db_xref="GeneID:59236550"
     CDS             complement(1033930..1034520)
                     /locus_tag="HG535_0D05360"
                     /inference="similar to AA sequence:RefSeq:NP_010741.1"
                     /note="similar to Saccharomyces cerevisiae TSA2 (YDR453C)
                     and TSA1 (YML028W); ancestral locus Anc_5.569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144554.1"
                     /db_xref="GeneID:59236550"
                     /translation="MVAQVQKPAPTFKKTAVIDGVFDEVSLEKYKGKYVVLAFIPLAF
                     TFVCPTEIIAFSEAAKKFTDIGAQILFASTDSEYSLLAWTNVARKDGGLGSVDIPLVA
                     DTNHSLSRDYGVLIEEEGIALRGLFLIDPAGIVRHITINDLPVGRNVEEALRLVEAFQ
                     WTDKNGTVLPCNWTPGAATIKPSVDESKEYFSTANK"
     gene            complement(<1034853..>1037531)
                     /locus_tag="HG535_0D05370"
                     /db_xref="GeneID:59236551"
     mRNA            complement(<1034853..>1037531)
                     /locus_tag="HG535_0D05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288660.1"
                     /db_xref="GeneID:59236551"
     CDS             complement(1034853..1037531)
                     /locus_tag="HG535_0D05370"
                     /inference="similar to AA sequence:RefSeq:NP_013683.1"
                     /note="similar to Saccharomyces cerevisiae USA1 (YML029W);
                     ancestral locus Anc_5.570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144555.1"
                     /db_xref="GeneID:59236551"
                     /translation="MICHKLLLGRVLQLRGKSDIKRHGIRGTLRYLSNPNLPDHLHSR
                     MLLHKDGMMECLALAPLKVIVWSSDKGLIRTNIVISAHPRTAIGRLVEYIYSQLSEEL
                     KAMDQSGNSSYTDRGDLGSVSDYCIYYRSKKEQPVDITLQDLESSGNISFIRLLFDKR
                     GTHTEEPINSQYEINANFKTTNLLININALSVDKIMSQMELNVPMGLTVKGLKEIAMK
                     VLYEYEEGSNSKNLCLVKNNHSIADILAFIVKGDQSPVYLNDSNAELYDDLTLTKILG
                     CDFAPQKQSYFTVMFKVTHAHLPAECLDNSITIEFISDSTLSVNKMSVTTETSVEEVK
                     EFICSAYTHSLRLSTNDIKLIYKGQLIHTLDFAGQPSKITDYINGTDGAKIHVHINQE
                     YNEPGPGFWSELFNGADRFEFLPQRNLESQPMMPSFSSQSRVTLTPMSPPETQLPLME
                     VSDQAGFQFSTESSLSLLQGDEPYFKCLVDGKDEVFVPAHVLEPAAITLEIDDSKMSL
                     SSLDYTIENGIIKLSPKLISRLESKFDMEIMRKAIIGEDFDNLTNQNIMTAHQMQQGN
                     RITFFTRILPVLLLVFRTLYLIGNNSIVPFFFILELSTFLSWKYTALIAILFLLRTIW
                     STREIWEIWSDHFSLSEIDDESYIKIKEHITSKSLSQDFFKECISSDSVIDIFMSSTL
                     RDSREHLYEAYNIEHANESNGVASLKALLENVSNRDIEKGPIDEFMISCLCLYETTRY
                     TMPETYQNSMRRIFVMVKRDLTKQTNPEQLPLHKKMLRGFRIAIERFRQSQVSIIVLE
                     HVVPDPRQDTLIASIVKNIVLFFLIILPPIKNKVDTILEERARAHEHINEDEKDEELH
                     SEDDILLISEQPSVTTGLQLHDQEAHDHLQEQPTAR"
     gene            complement(<1037825..>1038310)
                     /locus_tag="HG535_0D05380"
                     /db_xref="GeneID:59236552"
     mRNA            complement(<1037825..>1038310)
                     /locus_tag="HG535_0D05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288661.1"
                     /db_xref="GeneID:59236552"
     CDS             complement(1037825..1038310)
                     /locus_tag="HG535_0D05380"
                     /inference="similar to AA sequence:RefSeq:NP_013682.1"
                     /note="similar to Saccharomyces cerevisiae YML030W;
                     ancestral locus Anc_5.571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144556.1"
                     /db_xref="GeneID:59236552"
                     /translation="MSRMPSSFDVKDADLTEMPFGERIVYHCKQQPLVPVGCLLTTAA
                     VVLAVKNVRSGNKAKAQIYFRWRVGFQAATLVALVAGSYLYGTSVKEKQAKEDQMREK
                     AKKREQLWIQELERRDQETKYRKKRAEMARVRTKNDEEAVARLQKELKELEFQIRGET
                     D"
     gene            complement(<1040083..>1040643)
                     /locus_tag="HG535_0D05390"
                     /db_xref="GeneID:59236553"
     mRNA            complement(<1040083..>1040643)
                     /locus_tag="HG535_0D05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288662.1"
                     /db_xref="GeneID:59236553"
     CDS             complement(1040083..1040643)
                     /locus_tag="HG535_0D05390"
                     /inference="similar to AA sequence:RefSeq:NP_010742.1"
                     /note="similar to Saccharomyces cerevisiae GUK1 (YDR454C);
                     ancestral locus Anc_5.572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144557.1"
                     /db_xref="GeneID:59236553"
                     /translation="MTRPIVLSGPSGSGKSTLLKRLFAEFPNKFGFSVSSTTRSPRPG
                     EIDGKDYDFITVDRFKEMIKNKEFVEWAQFSGNYYGTTVKSVKKVADAGKICILDIEM
                     QGMKAVKFETDLNARFLFVAPPSMENLEKRLRGRGTETEESIAKRLETAKAEMEYAKT
                     GAHDKILVNDDLNKAYEELKAFIFSE"
     gene            <1041264..>1043150
                     /locus_tag="HG535_0D05400"
                     /db_xref="GeneID:59236554"
     mRNA            <1041264..>1043150
                     /locus_tag="HG535_0D05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288663.1"
                     /db_xref="GeneID:59236554"
     CDS             1041264..1043150
                     /locus_tag="HG535_0D05400"
                     /inference="similar to AA sequence:RefSeq:NP_010744.3"
                     /note="similar to Saccharomyces cerevisiae NHX1 (YDR456W);
                     ancestral locus Anc_5.573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144558.1"
                     /db_xref="GeneID:59236554"
                     /translation="MLSKFLLSVLLKLVWCAAKVTSDVQDDDDERLPMPVAPGKDDPL
                     NGDGGDHVDPVAEEMFFSWALCILLFLLISALWSSYYLSQRRIRAVHETVLSIFYGMV
                     VGLIIRMSPGHYIQDAVTFNSSYFFNFLLPPIILNSGYELNQVNFFNNMFSILTFAIP
                     GTFISAVVLGIIIFIWTSLGLESVNISFLDALSVGATLSATDPVTILSIFNAYQVDPK
                     LYTIIFGESLLNDAISIVMFETCQKLLGSPAKLSSLFEGIGLFLMTFTVSLLIGLLIG
                     ILVALILKHTHIRRYAQIESCIVLLIAYESYFFSNGCHMSGIVSLLFCGITLKHYAYY
                     NMSRRTQITIKYIFQLLARLSENFIFIYLGLELFTQVELVYKPVLIIITAGSICVARW
                     CSVFPLSNFINWVYKVRTVRSIRNSGTEAFAIPDEIPYNYQVMTFWAGLRGAVGVGLA
                     MGLQGEFKFTLLATVLVVVVLTVIIFGGTTAGMLEILNIKTGCFDENDLSDDEFDIEA
                     PKASPIPEAAGRTNREPYSDNTLHTESSLMVPSDSGVGVVPDAPLLADNSMLGNSLDP
                     ENARISLDKQGLRDAFGNIFRSDSQWFHNFDEQVLKPVFLDSSTQSVRDSGRDSPSLG
                     NKRP"
     gene            complement(<1043225..>1045060)
                     /locus_tag="HG535_0D05410"
                     /db_xref="GeneID:59236555"
     mRNA            complement(<1043225..>1045060)
                     /locus_tag="HG535_0D05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288664.1"
                     /db_xref="GeneID:59236555"
     CDS             complement(1043225..1045060)
                     /locus_tag="HG535_0D05410"
                     /inference="similar to AA sequence:RefSeq:NP_013681.1"
                     /note="similar to Saccharomyces cerevisiae NDC1 (YML031W);
                     ancestral locus Anc_5.574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144559.1"
                     /db_xref="GeneID:59236555"
                     /translation="MLNAPVALSSRYSYHTIFTDICKTRFNHLATRLLLITTLSEALV
                     LTILSRGYSSSFELLIIFPLRLSLLYLANLSIIICRKNYLHVQYRGYANLVKSTIAQL
                     FCLRFVIYELIHCFCSLCISVTFSDFFGFSGFTSPCHEFMKCYRVLICIMIPTLYTLQ
                     HCIFDLDRLSFSFETHFNPPQQYISSSLKRIFTKSGIMTVLLTVCSPFVFFSVSSEWA
                     IGFKDYLKLTVLTFCIFFNIEYVNVAFSAHMSIGCLHKGKPISSLSSTPMESLITGLS
                     SNRLFTKLTAFQELSYRATSTDLSLRLPIYHTRYRNSHVWPEILKECLMTMQETNESV
                     TNYLNALERSLRSQKNSNYKVRDAMGTDRDELFGNEASVSQSSSNPMQDRLPGAPPGL
                     PDDVRHKITLKDDNVLLKRNLDSKRGRSTNPLDDNIQMAHYYNEPFMTHDTTLTTLLG
                     TLITNFKNSISLFFFPSGAQPQDQTQQLSIIDAWCISKRRQAEKLVPLPVCHAECIVS
                     LMGLLINALEEDPKGGVVSSVGEVLKCLERSVGALGRFADWNPDMVKHPTETQATPDA
                     ITILYDLSVSSFLEIVIKYNALLNDLYLDDDVVKLSRWVLDMCGQ"
     gene            <1045336..>1046673
                     /locus_tag="HG535_0D05420"
                     /db_xref="GeneID:59236556"
     mRNA            <1045336..>1046673
                     /locus_tag="HG535_0D05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288665.1"
                     /db_xref="GeneID:59236556"
     CDS             1045336..1046673
                     /locus_tag="HG535_0D05420"
                     /inference="similar to AA sequence:RefSeq:NP_013680.2"
                     /note="similar to Saccharomyces cerevisiae RAD52
                     (YML032C); ancestral locus Anc_5.575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144560.1"
                     /db_xref="GeneID:59236556"
                     /translation="MEGKKSIAGHSTEDIQLKLDKKLGPEYISKRVGYGSSRVAYIEG
                     WRVINLANQIFGYDGWSTEVKSVTIDFLDERQGKFCIGCTAIVRVTLSVGGYREDIGY
                     GTVENERRKSAAFERAKKSAVTDALKRSLRGFGNALGNCLYDKDFLSRIDKVKFDPPD
                     FDEGNLFRPSDEITDSSRSNTVDTSEVRQNKRRQITKVGNSIKTTTAIGNEAQPTEEI
                     QINRNDSQPGNKVDTDHMDVDTVTKQEPDELLDDSLMFSDDFQDDDIINMERKDQPRP
                     VEKKAPHVNDTSTPENAMEPITFVTARAASSLQNKIPVTHESVFDPKYQAQSIKHTVD
                     QTTSKHVPTTVFKEKGINDSRDTLYEKFAPKGKEIGLASPTLTSDAKEVAPGSSTPSA
                     SPPSVPSPAFPRFAPPTTAYTNGSASISTVLKPARREVGRPKLGPVYQRRANP"
     gene            <1047082..>1056870
                     /locus_tag="HG535_0D05430"
                     /db_xref="GeneID:59236557"
     mRNA            <1047082..>1056870
                     /locus_tag="HG535_0D05430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288666.1"
                     /db_xref="GeneID:59236557"
     CDS             1047082..1056870
                     /locus_tag="HG535_0D05430"
                     /inference="similar to AA sequence:RefSeq:NP_010745.3"
                     /note="similar to Saccharomyces cerevisiae TOM1 (YDR457W);
                     ancestral locus Anc_5.576"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144561.1"
                     /db_xref="GeneID:59236557"
                     /translation="MVKLSRFEKLQKEQNASTFKPLLDELVECDEPTFVEKLNHIQEW
                     DRSRDDLFVWTPVLNRIDEILSRVVNNYSYASSDFKKNPVKLIEMSRKDEELSINLMK
                     FTTRLLCNTENRYIYSSMDVMNSFLNCPNFRIKLYAVKILAIIGERYIISRERIDSEN
                     ILGNPFLKKKVLKLALALPSSTIDDNGDHFSLADLFFDKKKYPLKWTKLKYTYYTAST
                     SHPSKKNGSSTGVQHPKDTNCQMSSMKKIFFSREDLQSHSLQQLYDKGMEVLPSENWF
                     DFSVKVNIAKAFSDNSFDSIELRNLILRTKFNAIAATNTIYHPPQVSSKLFEVDPYAF
                     NSLTDFISLSETKLPKELRLDSIFALECVSLKHVWCSDIVRNLGGNMSHGLLFQILRF
                     IGKILREESSEVDEEYNVRLFYLISNLADVKALHDSLLAAGLIPSLLDIISARQSPYR
                     RTMASATHLLEAVISDGESSAEFINNDGFTILIDLITEEVNFALENPDYGSPPKYSVV
                     YYSVSFRQLAYIRSLLKLVLKLLKTDSGDRIRNLMDSPILHSLRNILENRPVFGYTLI
                     TYVLDILQRVINSEPTIYPILVEAGLIPYIIEHFSELLGPYSELLSILPDVISALCLN
                     SEGLKKVKEKNMIRFLFDAVTDLNYAKVLYWKEESVDLGASMDELARHYPELKPLILD
                     CFSDIVRELPRRICFNQSFLYLSLNGGDFFYRGKDEEVELTEENGKELSFWDVQKSTP
                     IVDCFADVFYGMTLENSALGKLPENITVKDLFSIIVMDKPPFDYTSSQALLNFTDVLQ
                     LFDEQHKNYAFPEVIIMLAENLCDVEQFLTSSNDESFLLKASLGRDNSDVEDTVSKLS
                     KLSALIYIVTDVYINLTSLSPKRVLQILDYFDKNGFELIKNLRLLFQKCALEEMYLIS
                     QMPDEAIDQTLPHPGGHSPPVQIHVKKPSKREQMDNYTSAKFKNSFQIRAILNKLQSC
                     SSMIFRCLLRLSRVKDLDLEDCDRALEVHISDEVTKQVISMLRAVELKNHMPYFLVVF
                     NFNTYIFTFPKTTITGAGMLQTIPAFLFYQNGGYKVYFEAIKYLFTNMSTFENLAAIE
                     EVDYVKNSEDVLTLSCLLNALSFFNKSMQIDTMENIQSMEVFYPYMDNDYNLTKALML
                     VVKILALGLVMDLNKMNLLFCSQSRTVPYAVFKHILTMLKNIFSGKNEGEEEVYELRW
                     DLIPPSHRKIQLLKACGISEEVARGFIEETDDEMPSEKPNLFSETEWEKYQYLTKGDT
                     WQLHPVLMEAQYEQMYTNDDLNSMRNEYFQTGLSQKVFDVLPFYPKLVNAFAKTLLQM
                     FNIHGERSENFAAQVLDKITKTNLENGATLSSFIHLFGIFLNEKYVYENSHSLIDSFL
                     EYLQNSLNPRFINCPWFSKALYVYEIILAKSEVPLMEPYPPGLCVHYRMPAIAPIYRI
                     APDTRKNFFDVLIRVGDITNFYSALATCRILLFYARDDVYAAEVSRSGILSKLLKVIG
                     VYQKSEKINYLESSFLLLARRTFETTDIVSSLIRFELNKSFTTRVMGEPKPRERDLGG
                     VIDEKPHVVMRNPKMFVDVLCEDARFQNFNEDGKIVDYDLIRSSQTGAAERDEPGERS
                     KNSLTVQNRTGIIHLLLSQLMAASKKDWVSEPPSTEEGPSGSKQEKIEPARNPVCAYM
                     IFLMKVLIELISSYKQSKFEFLTFDRRNAYTESPKPRTTALNFFFYQLLDRSTDSEQS
                     KPEAKRREVMSMLSRSVIVGFVSTVQDENNKKSDLRATDPDMTFIRKFAIETVIRALR
                     NTASNPKMLEGNVSKLDTWFKVISSMVFLQAPCLRLILDSNKVDADQYQICKLMIEMN
                     VPSAITECIALLDLNYPFCKKLFNSAVDPLNAINSVRLSYAGMFKVESNDDEVEVDDD
                     SDKEDPSDMFRNSALGMYDVADIEEDDDGDDESLIGDDEDIAFVDGEDGGFEVVFSDD
                     NDEENDPSSDGSHSSNENMEYDSASESATDESVSSVHTSVEGREESDSQNEGYYFEDD
                     DEDVEIIDVNAEEYDSDLEIDLSDYNLEDSDWESGLSELSASDEEGEGSIIAENNVFG
                     RSNGSRRRWMTNEGMEIIEGESDEEGGSGLFQGIEHVFHSESQPLYRVQDGRSHGRHH
                     HRSFRNHEHPPLGLPSLSLLNGPRRQQSNLINPLGPSGLEEIENGISEQLNSPTSLRN
                     RPEHAHFGGVLVSGEFFDDRSPDGIILKSTVMRWKDIFDMFYDTKTYAIYIIPTIVAK
                     LYQPSLQLNMEQKRKTAEKEKEAQTKQQKAVKVTSSVPSEALETAASAISSDAQNDSS
                     REHHDPVYVNIEGSEVDIGGTDIDAEFLNALPDDMRAEVFAQHVRERRAEALHSDIHS
                     REIDSDFLDAIPENLREEILDYETAESRFSNIVHAMHDHVDDDEDMDSEHEDDNDADA
                     TTGSSNPGDESEKKKSARIYFSPLVDRAGTAALMKSTFIAQPYVQREVYHELFFRLCS
                     SKQNRSDIINMLLIILTEGVVDQSSLEKVYNLISCRAQGQNRLPGHAMQRQLPVECTP
                     LVVANQAIEILQNLIDSDNRLKYFFLTEHENLMVTKTPAKNKKDIFSKNLKWPIKYLF
                     ALLDSKIITDETVLMDLLTRILQVCTKPIQVIAKNTDSPTNSKKKFSSPHFDRKDLEK
                     IVSIIKLDSCNTRVFQQTLNIIHNLAPLKDSMRIFTEELISSAIETMASLISDLEKLT
                     TMGSQATSGAEINSELVQKFTVPSSDQAKLLKVLIAVDYLYTHKNKLKSDEVGQLMEV
                     YNKMELNKIWEPLSKCLFEFESRKGLNTSATVLLPLIEALMVVFKHSKTSQAKFATLR
                     YEDGKNVDLSTIPSENLFFYFTEVHKKLLNQMIRTNPKLMSGPFSLLVKNPKVLDFDN
                     KRYFFTARLVTESRDRSTLAITVRREQVFLDSYRALFFKSNEDIKKSKLEITFKGESG
                     VDAGGLTREWYQVLSRQIFNPDYALFLPVASDKTTFRPNRTSGINPEHLSFFKFVGMI
                     IGKAIRDQCYLDCHFSREVYKNILGRPVALKDMESLDLDYYKSLVWILENDITDVIEE
                     TFSVEADDYGEHKIIELAENGSEIAVTEENKQDYVKRIVEYKLQTSVKEQMANFLQGF
                     YALIPVELISIFDEQELELLISGLPDIDVDDWKNNTTYVNYTSNCKQISYFWRAVRSF
                     DLEERAKLLQFVTGTSKVPLNGFKELTGVSGVCKFSIHRDYGHAERLPTSHTCFNQLN
                     LPSYNSYETLRGSLLLAVNEGHEGFGIA"
     gene            complement(<1057546..>1060125)
                     /locus_tag="HG535_0D05440"
                     /db_xref="GeneID:59236558"
     mRNA            complement(<1057546..>1060125)
                     /locus_tag="HG535_0D05440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288667.1"
                     /db_xref="GeneID:59236558"
     CDS             complement(1057546..1060125)
                     /locus_tag="HG535_0D05440"
                     /inference="similar to AA sequence:RefSeq:NP_010746.1"
                     /note="similar to Saccharomyces cerevisiae YDR458C and
                     SRC1 (YML034W); ancestral locus Anc_5.577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144562.1"
                     /db_xref="GeneID:59236558"
                     /translation="MDTEYLGRGFDPNSIKVAQLRRILVENKVDFASHAKKAELVQLF
                     EEQVKPKVPKLRKKYENLLPSDKGIVKVGSKDKSKGKSNRSKLKKKSKARKSKLKVED
                     GERNEENGSMTPTGEDIQSSKQSSVDATVKSEKESDVEITPFSEVNEMQMGSGRRGSE
                     LKTENRDADEHMGEDNDLKIDEDKEESRDVAMESTVSETATPVKDEMTGDNGESKTRK
                     RRRRIGDGENTPITNKVARKSPQKSPHRSLIIDKFESSSSDSSFNNGSKVNISNAGPI
                     ITHEESTPEKFVSEGSDFSYRRKTVSPDLSKLKISAAFAEQLKSAVQKTASNTPSRSE
                     SEQEYGSRPYSSIRVSRHKASSPVQSDELFAPIAASSEDDETQSSSQETIKSINVEKA
                     TSEAATDDIPSARQMPDIQSPKLPTKQDVEDSEARVEKMQDFLNDVIDSPVVEVADAR
                     LSTFLKSFCKIFVKFMFFILIAVSISYGLWYRQQRIYVGYCGNETSLSKDAECGPVLT
                     TMDRYLRDYKPQCLPCPDNAICYPKFSIKCKPEYTIQKNPWSLHGLLPLSDRCIKDSK
                     REKLISEVVQKSLEILRAKNAQVSCGECQNEVESGISEKELYEIFNESRAPWVSDHEF
                     DELWVQAISDLQKEPEITWRQVSIILGSNQSQRVSILTDNITTSTQLPKAEFASIGNS
                     SCSTATDDFQGEEGYLRETTQPQEARFLRSTSKKYISLRCKFEREIYQTYYRFRLIIW
                     GVGFLLILVKTVNYKLRKYYMEKEKMEQLTRRVVIRLKEAKKDSAGNDVISFLSTVQL
                     RDVLLADITDLNYKNILWQKVVKRLEHNNTNIKTNLVEIHGEIMKCWEWIGPLSDSSD
                     REK"
     gene            <1060397..>1062814
                     /locus_tag="HG535_0D05450"
                     /db_xref="GeneID:59236559"
     mRNA            <1060397..>1062814
                     /locus_tag="HG535_0D05450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288668.1"
                     /db_xref="GeneID:59236559"
     CDS             1060397..1062814
                     /locus_tag="HG535_0D05450"
                     /inference="similar to AA sequence:RefSeq:NP_013677.1"
                     /note="similar to Saccharomyces cerevisiae AMD1 (YML035C);
                     ancestral locus Anc_5.578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144563.1"
                     /db_xref="GeneID:59236559"
                     /translation="MSSNNSEMEINETSKELSEFSLEPTPSFDVPDPNSSGMFRETDV
                     RREDGQLDPLELTNTEEAREAQDEVEEMTSANFSYHESRKLHENGSKQVALNDNSSPS
                     SFVAQPPWRKVLSENDHEESSEPIIRNRTLSFGAQRSLPDIPGGSSTWKKSKKFVGGE
                     DTNYKMGMLADESGQQFLEEPSPELIGLYANVAECRKLRTKYQDISLQRNDQNPKNKP
                     DWVVYPAPPKPTYDSETKTVIKVDNKPDWQIFDFSACEIPPEDQDWDFTTNAEDCFVV
                     HKSKNADELITAVPSLREYYLDLEKLISISSDGPAKSFAFRRLQYLEARWNLYTLLNE
                     FQETSVSKRNPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKHKLRHCKDENVIFRDGK
                     VLTLDEVFKSLNLSGYDLSIDTLDMHAHKDTFHRFDKFNLKYNPIGESRLREIFLKTD
                     NYIKGSYLAEITKQVLSDLENSKYQNCEYRISVYGRSIDEWDKLASWVIDNKVFSHNV
                     RWLIQIPRLYDVYKKTGIVKNFNEVTINIFKPLFEVTKNPRSHPKLHVFLQRVIGFDS
                     VDDESKVDRRFHRKYPIPSLWESSQNPPYSYYLYYLYSSLVSLNQWRAKRGFNTLVLR
                     PHCGEAGDPEHLVSAYLLAQSISHGILLRKVPFVQYLYYLDQVGIAMSPLSNNALFLT
                     YDKNPFPRYFKRGLNVSLSTDDPLQFSYTREPLIEEYSVAAQIYKLSNVDMCELARNS
                     VLQSGWEAQIKAHWLGNDFEKEGVEGNDVGKTNVPNIRANYRWDTLSTELELVDHFAK
                     FKGVVIE"
     gene            <1063176..>1064144
                     /locus_tag="HG535_0D05460"
                     /db_xref="GeneID:59236560"
     mRNA            <1063176..>1064144
                     /locus_tag="HG535_0D05460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288669.1"
                     /db_xref="GeneID:59236560"
     CDS             1063176..1064144
                     /locus_tag="HG535_0D05460"
                     /inference="similar to AA sequence:RefSeq:NP_010748.3"
                     /note="similar to Saccharomyces cerevisiae TFB3 (YDR460W);
                     ancestral locus Anc_5.580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144564.1"
                     /db_xref="GeneID:59236560"
                     /translation="MNHAVDDYYENKDMCPICKTDRYLSPDVKFLVNPECYHKICESC
                     VDRIFSLGPAQCPYKGCDKILRKNKFKTQIFDDVGVEKEVDIRKRVFNVFNKKLGDFD
                     ENLEEFNKYLEEVEDIIYNLDNGIDVNKTEEKLRSYEELNKQLIMANIERSKQDLENF
                     EQRQQFEKEMRLKKRMLERQIEDEERMNKDWAKKEIVNRLSNADDAEDVIEGVKNTVK
                     LKKSSARRKLEELNRVMKSNPYLAANNSGPRKDAVPFTPFNGDRDASKRFTINDALYE
                     DPFIKDLQERKEFIASGFRVDYVYNRVLTEAFMGLGCVLAEELQTS"
     gene            complement(<1064130..>1064743)
                     /locus_tag="HG535_0D05470"
                     /db_xref="GeneID:59236561"
     mRNA            complement(join(<1064130..1064219,1064297..>1064743))
                     /locus_tag="HG535_0D05470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288670.1"
                     /db_xref="GeneID:59236561"
     CDS             complement(join(1064130..1064219,1064297..1064743))
                     /locus_tag="HG535_0D05470"
                     /inference="similar to AA sequence:RefSeq:NP_013676.2"
                     /note="similar to Saccharomyces cerevisiae CGI121
                     (YML036W); ancestral locus Anc_5.581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144565.1"
                     /db_xref="GeneID:59236561"
                     /translation="MIVSRFPQFPHYEISIALYEDVTNVEELRAKANSSLPFALINAS
                     LVFSVEQLYSAVYRVLIEHTYNKIQTASFSSECLLRLSASTKVSESQKFGLKYPSNRI
                     ICVNIEETTDDSIERPDETIFELVKGKSAVLEDENLSKKCDADTLRKIYKLDQTFQPE
                     RPDEFSRALVNAIQLRGL"
     gene            <1064954..>1066246
                     /locus_tag="HG535_0D05480"
                     /db_xref="GeneID:59236562"
     mRNA            <1064954..>1066246
                     /locus_tag="HG535_0D05480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288671.1"
                     /db_xref="GeneID:59236562"
     CDS             1064954..1066246
                     /locus_tag="HG535_0D05480"
                     /inference="similar to AA sequence:RefSeq:NP_013675.1"
                     /note="similar to Saccharomyces cerevisiae YML037C;
                     ancestral locus Anc_5.582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144566.1"
                     /db_xref="GeneID:59236562"
                     /translation="MDITEVGAPQEDHLLDHEISSLNHLIDDLLPMQIMTNHIVNNEK
                     VLYEILDEVPNGRKSMNKLFYSNYVPKKGDVVLNSYPSARLQTLSTTIANEWLNAERQ
                     SISQMNSSTLQIEEPILFSWREKSQGTKDSRGSVDGVDEINKETPTVRQITNHVLFKK
                     ASAQIKKLSSEIRMIEPTENGLAGDRDREIHRPKILTWANPDFHVDPLQTFVATKLPK
                     SPKNEPKPEKRNSTKRRSLFGFWSGRRKKDKEKLTDTKERGSHGDKQLVSSTSNADID
                     DLSAEGQSDKKTRATELESAGSTQHSGNKNLEFELDVLVYKNKNEEQEEPGEQLEQGK
                     KEEKCDQRERCSKSFESDRTNEIDRPNVNSEDDHEFGDFEQASELLDQESISRTNDHA
                     DYPSFTAATHMPSLQDHTDSPVSMDSFVLLQPKKKAVK"
     gene            complement(<1066394..>1066597)
                     /locus_tag="HG535_0D05490"
                     /db_xref="GeneID:59236563"
     mRNA            complement(<1066394..>1066597)
                     /locus_tag="HG535_0D05490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288672.1"
                     /db_xref="GeneID:59236563"
     CDS             complement(1066394..1066597)
                     /locus_tag="HG535_0D05490"
                     /inference="similar to AA sequence:RefSeq:NP_001032577.1"
                     /note="similar to Saccharomyces cerevisiae YDR461C-A;
                     ancestral locus Anc_5.583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144567.1"
                     /db_xref="GeneID:59236563"
                     /translation="MTDEKSSEPPTYEEAMMQDTVRQTEPLTPSLPTAPKENGGAYHV
                     HNPHLKSTRGYPGGNRLTYGSKS"
     gene            <1067014..>1067670
                     /locus_tag="HG535_0D05500"
                     /db_xref="GeneID:59236564"
     mRNA            <1067014..>1067670
                     /locus_tag="HG535_0D05500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288673.1"
                     /db_xref="GeneID:59236564"
     CDS             1067014..1067670
                     /locus_tag="HG535_0D05500"
                     /inference="similar to AA sequence:RefSeq:NP_010750.1"
                     /note="similar to Saccharomyces cerevisiae MRPL28
                     (YDR462W); ancestral locus Anc_5.584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144568.1"
                     /db_xref="GeneID:59236564"
                     /translation="MYFQVPCIDGLIIAFVVTFHPFCMIITFFQIQHATLTDLLTILE
                     RQIKQMFESSSGSRLGLTLMSNMLLINKCALGAAPAKNPSIGQFSVIFTRGKRTKSKG
                     GLPPLAQRVITQLSVLSASRKQPKLLKLSREDLIKHETIQRCWSTYQAELRAKRNEQL
                     KLQYKSISKAMNLLSELNPKLYEAAKSEEQGKRFPMDLRVPTEYPPNKIWYHAFKEKE
                     "
     gene            <1067877..>1069202
                     /locus_tag="HG535_0D05510"
                     /db_xref="GeneID:59236565"
     mRNA            <1067877..>1069202
                     /locus_tag="HG535_0D05510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288674.1"
                     /db_xref="GeneID:59236565"
     CDS             1067877..1069202
                     /locus_tag="HG535_0D05510"
                     /inference="similar to AA sequence:RefSeq:NP_013674.1"
                     /note="similar to Saccharomyces cerevisiae YMD8 (YML038C);
                     ancestral locus Anc_5.585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144569.1"
                     /db_xref="GeneID:59236565"
                     /translation="MIVEAPSSPLSSRCSFACCKNLDKKVVTVITMAQSLLILITGWY
                     FFSMTLALYNKWMFDPNRGMQISCPITVTAFHQFVLWGLSYTFVRYKRSKRLENALDK
                     EPRTDWKFCLKYTVPTAIASAGDIGFGNVSFKFVPLTIYTIIKSASIAFVLLFGCLFK
                     LEKFHWKLVLIVLVMCLGVVMMVLSPSKNKDEETGMQSTVFFGSSLVIVSSCLSGLRW
                     VFTQLILRFQEVEQDQEVALGNAEQVLYVKNSIRTKPHAIYTIYQLAPIMGVVLFVTG
                     LIIERPFPAVLKSRLFTLPEDSTQRSALSVLKGIVLLLIPGIEVFFMTICEFGILQVA
                     HVLTLSIAGIVKELLTIFVSMLLLGERLSGIRNWSGMIIILLDVAYYNYFRYQQDKKL
                     LVKNYSALPNILHGAGDGARDSMKDGSEYASEQELVPPVASQDYEMDTI"
     gene            <1069787..>1071604
                     /locus_tag="HG535_0D05520"
                     /db_xref="GeneID:59236566"
     mRNA            <1069787..>1071604
                     /locus_tag="HG535_0D05520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288675.1"
                     /db_xref="GeneID:59236566"
     CDS             1069787..1071604
                     /locus_tag="HG535_0D05520"
                     /inference="similar to AA sequence:RefSeq:NP_010751.4"
                     /note="similar to Saccharomyces cerevisiae STP1 (YDR463W)
                     and STP2 (YHR006W); ancestral locus Anc_5.586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144570.1"
                     /db_xref="GeneID:59236566"
                     /translation="MPSVALLRVEGSMLRNLALSIASFFRELVDVVVPSDKGEEFKKD
                     EEVNAERKAEDVFTGKKKREIVRETETEVVRETGTEVERETEAENDLELKSSKSAASL
                     FPAKHNVDAMLFGRSSVIPCSLDVDTLDTPMTLSVTPEGNFSCKLNNAPFAPTEDGSN
                     NQSVGDISPVFKNSVLPISPQSNISTTPLKEEEGTMKDEGSAETDKEGNYVCHYCDAK
                     FRIRGYLTRHIKKHAIRKAYHCPFYNSDAPPESRCHNSGGFSRRDTYKTHLKARHFIY
                     PKGVKPQDRNKSSGHCSQCGQYFENTDQWVEQHIETGECKGLPEGYLKNIKSERTSGK
                     LRMIKTSNGHSRFISTAQSVVEPKVLLNKDALEAMAIVAHNTNRSDILSKYGNNKIMM
                     SSDDFNGVPKVKRKYTRRKGILTKNSSANFEKKDTNSGLTRYSDTPRESRASPYESNC
                     PSESMDDETALNEISSSINPSPLDNHVLELVSSDSSESSHEELHHNGLEKNGQAIQPM
                     NISNFTNSVKFNDPFSVPLDMEQCSFFDGSFISYFSNNEELRNVHNHANNDFAANGAL
                     RNQINLIAQAENHLRENEQYLSFYNFKQGKDNTLASSDA"
     gene            <1071956..>1076257
                     /locus_tag="HG535_0D05530"
                     /db_xref="GeneID:59236567"
     mRNA            <1071956..>1076257
                     /locus_tag="HG535_0D05530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288676.1"
                     /db_xref="GeneID:59236567"
     CDS             1071956..1076257
                     /locus_tag="HG535_0D05530"
                     /inference="similar to AA sequence:RefSeq:NP_010752.3"
                     /note="similar to Saccharomyces cerevisiae SPP41
                     (YDR464W); ancestral locus Anc_5.587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144571.1"
                     /db_xref="GeneID:59236567"
                     /translation="MSQDEGDDINFNELVGNLLSTHNASNRNEENDDNSSNVPENSFL
                     KQNLPQDEDTNHVDLPDFNVEGDDDALAAVVANAIENMDQEGAPSEDFFEQEHAGNVS
                     KEQIEEHQQEDWARILEQGLLQGTDTDAIPDGQIDVPQEQLDQDDENLRRAILESLQE
                     LNVDSNDKGTSAKKSSKKSSKKKKKDKTKEKDPEKQKSATSKKKKRSKDHKKSKHAKS
                     AESTSISEDVIRGFMQRGAGSSEAEIDQPADTEDAETHALVEATLKAFERELLGTPTI
                     TPVTQQRKTASKKKSATNAPSSTKKKTSSKKKPEKAETVRIDPTSSTTLIHPTINQLS
                     GPTEEDKKKDNKKKKKKAAKDISESNEVYEDDEFSKALAEMVNQVVNTSLTETTNQPS
                     EAVTKQQKEFVEPLTVPEENKKIERRKSNEDSFDLNQIMQKAMTLAFQEQHQEGLDNS
                     VMEDFNRGLGDFGVTNVLDPTSVEIKKKKSSKASAKKTPPKKKKIGKSSTSIEASGLR
                     EEPFRKVKPAKPKREKILPSRDELFKKKYHQAARAAASAARKLITERNKASKASLRME
                     RKVAREEKRRKKKQEEEELARERKELKDIVAKGPPYPPDLRLTKSGKPKKPYRRWTKE
                     EMDKRAAVPADNLNRIKKEKKVKKKKSKKLKRVPLSTLKKIPLFNFVKGNVPSDIRQK
                     LNGIDESLKKIPLQNYKLDINRLAPPEKVSKEEMERFDAIKEDFDAAIKLKKSFALAS
                     FDITRKTVIRREKIALHPPWAIPSQPPFALPVARRRRKERTKKLKDFKSDRNSRKRQR
                     DYSIAFNARNRIIPAVLFPIINTLKAAAKAKAASGASSEEASNHLLTIIKHTKKSIAQ
                     TLQMSRRNYKQDYSTMKTESDINRSQERMKRVRRMPIFSLANIRQVEAKERASSQSLQ
                     EKSTPPSVIKIEEGTVPQDSLKDIPGDDHKVTFEINPNFSSKETAIEPIAIVGTNEAR
                     EFKVRNSSDVSVSKGPQECVDHTETGSSISQRTNKDKQDLTIVSENLSPQVISAEKGN
                     TVLQSMATNILTTSCEKETTNSQNVQKSETVEHKFSSALIPSPVKNELDNEVQSLTKQ
                     SYSGEQEVRNVVEVLMKRQFSRSDGSVVDLPPNLQNIISASIGELIPAFEDENRLEAT
                     IERENKRPRRGPSQVLNLDGLVPPSAQNFVPKVERKETFSPAVTRSKPLKKKGEQPTL
                     MYTFNIPDYRGTQGKRLMLLKRAKKHLTNDEMNALKKEMNKERKRKWREANVEKNWEN
                     DLRSRLRRRANLKFGDRDSEDKEKWFEVELAKNLADRGIKRSNETDMKKNSCSTNLSD
                     NEVLNMIAATLNKLEVARLLERELNDEVNKKTEGERKDENSGEGKHAAFEAKKSLTEK
                     TTDEDLSVADEKDTNQERTDELFEDGTLKRPYPDDIPVIIPLSKRPASSSSSTVS"
     gene            complement(<1076549..>1078147)
                     /locus_tag="HG535_0D05540"
                     /db_xref="GeneID:59236568"
     mRNA            complement(<1076549..>1078147)
                     /locus_tag="HG535_0D05540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288677.1"
                     /db_xref="GeneID:59236568"
     CDS             complement(1076549..1078147)
                     /locus_tag="HG535_0D05540"
                     /inference="similar to AA sequence:RefSeq:NP_011871.1"
                     /note="similar to Saccharomyces cerevisiae ERG11
                     (YHR007C); ancestral locus Anc_5.588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144572.1"
                     /db_xref="GeneID:59236568"
                     /translation="MSGSGSESFVAKIFEYGQLALSQFLSLSLAQQISIVVITPFVYN
                     IVWQLLYSLRSDRPPMVFHWIPWFGSAIPYGMRPYEFFKECQEKYGDIFSFVLLGKVM
                     TVYLGSKGHEFVFNAKLADVSAEAAYTHLTTPVFGKGVIYDCSNSRLMDQKKFCKSAL
                     STDAFKKYVPLIADEVYKYLRTSSNFGINKEKGGKIDVMVTQPEMTIFTASRSLLGEE
                     MREKLDTSFAYLYGDLDKGFIPINFVFPNLPLPVNKRRDHAQKTISDAYKSLIRERRE
                     RNDIQDRDLIDSLMKNSTYKDGTKMTDQEIANLLIGVLMGGQHTSAATSAWALLHLAA
                     RPDVQEELYQEQMRVLDNGKKELTYDSLQEMPFLNQTIKETLRLHHPLHSLFRKVMRD
                     MQVPNTSFVVPKNYHVLVSPGFCHLQDTYFPNASQFNIHRWDNDAASSTASGEEVDYG
                     FGTISKGVSSPYLPFGGGRHRCIGEHFAYVQLGVLLSIFIRTMKWHFPPGKDVPSPDF
                     QSMVTLPIGPAEIVWEKRDPAQVI"
     gene            complement(<1078560..>1079747)
                     /locus_tag="HG535_0D05550"
                     /db_xref="GeneID:59236569"
     mRNA            complement(<1078560..>1079747)
                     /locus_tag="HG535_0D05550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288678.1"
                     /db_xref="GeneID:59236569"
     CDS             complement(1078560..1079747)
                     /locus_tag="HG535_0D05550"
                     /inference="similar to AA sequence:RefSeq:NP_010753.1"
                     /note="similar to Saccharomyces cerevisiae RMT2 (YDR465C);
                     ancestral locus Anc_5.589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144573.1"
                     /db_xref="GeneID:59236569"
                     /translation="MSELHRLLTFPSRPITDAAYATELHRFLASGIPATYTLEQVAAF
                     EQGRGAEQDDIDGSNTTPLHILTRSLPLSLTEEETDVVLKMMDILFEYGAGWNFIDYE
                     NKTIGDLLLEKGQDRNGKLYKRVVAAGVSAELLLRKINGGEIEFLEVDRDDQAQEETV
                     STTAAVVQPDTDRTADDSKTYLATPLEYTDDSLITKDNKDGVMMDWETEIMAVAAKTI
                     CSTGSAKEKIILNVGFGMGIIDTFIQKEKPTQHYICEAHPDVLARMKTDGWYDRPNVI
                     ILEGKWQDSLNKLLDEGDTFFDGIYYDTFSEHYQDMLDLYDVVVGLLKPEGVFSFFNG
                     LGADRPLCYDVYREIVTIDVNNYGMNCQYANVSVNLNQDWQNVKRSYFNCNYYYHPRI
                     TFT"
     gene            complement(<1079911..>1080597)
                     /locus_tag="HG535_0D05560"
                     /db_xref="GeneID:59236570"
     mRNA            complement(<1079911..>1080597)
                     /locus_tag="HG535_0D05560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288679.1"
                     /db_xref="GeneID:59236570"
     CDS             complement(1079911..1080597)
                     /locus_tag="HG535_0D05560"
                     /inference="similar to AA sequence:RefSeq:NP_011872.1"
                     /note="similar to Saccharomyces cerevisiae SOD2 (YHR008C);
                     ancestral locus Anc_5.590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144574.1"
                     /db_xref="GeneID:59236570"
                     /translation="MLARSAIKNVGKTSSVFVAKRTKVSLPKLDWDFDALEPNISGQI
                     NELHYTKHHQTYVNGFNTAVEQLEDLNCQLKSDPSPTIAKKIVGVQQNLKFHGGGYTN
                     HCLFWKNLAPESQGGGKPPGGALGESIKSQFGSLDNLVSLTNSKLAGVQGSGWAFIVK
                     NLENGGKLDVVQTYNQDTLTGPLVPLVAIDAWEHAYYLQYQNRKVEYFKAIWNVINWA
                     EASKRFDEAK"
     gene            <1081420..>1083909
                     /locus_tag="HG535_0D05570"
                     /db_xref="GeneID:59236571"
     mRNA            <1081420..>1083909
                     /locus_tag="HG535_0D05570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288680.1"
                     /db_xref="GeneID:59236571"
     CDS             1081420..1083909
                     /locus_tag="HG535_0D05570"
                     /inference="similar to AA sequence:RefSeq:NP_010754.1"
                     /note="similar to Saccharomyces cerevisiae PKH3 (YDR466W);
                     ancestral locus Anc_5.591"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144575.1"
                     /db_xref="GeneID:59236571"
                     /translation="MSSKNLTRKRSPHDFVFKQELGHGSYSTVYKVFDKHSVNHVYAI
                     KVCSKAHIIKENKVKYVTIEKNTLNLLARACHPGIVRLYYTFHDEENLYFVLDYASGG
                     ELLQLLHKMGRFSESWSLHFSCQLIDTIEFIHSKGIIHRDLKPENVLLNRFGRLMITD
                     FGTAATPLNQQKQEDDQNESPRCSSFVGTAEYVSPELLLSNQCDFASDIWALGCIIFQ
                     FIMGVPPFRGKNELQTFEKIASLDYLWNNQHYSSNKIDPVIIKLVQKILVLNPQERLT
                     LTNMKKDEWFDKVDWNNKDHIWRGIWQVSEPAYGSSNGVGNGINNGISSGSTNGSTGG
                     FPPRQNLISNKPLHVIDTPIRSIPITKQKKKKPTKVSNTTSSIVEWRKKLGISLQQAQ
                     VPSSVPINNSKLVVPSPPLVPQPTSTYLRPAVSPRLMPSSTTPSPSVKRSTSQPSLSK
                     AAPSHDDLYRPASSPDDPNITDHNSNSHNNNITVNTTTNNNYNDIHRPKTMVLKQDYV
                     NIFEIPFKPDGPPMSLESYSKINNDIITELVSKFRPELKSFSKSPVLSTLFKDGTLSY
                     KNDGFSKHMVNVGDPDLSMYDFEFYEQKNDGFLILEKYKYKIWFISLPTIPVTNGLGP
                     IVNSDENWVDCFFRARQIMDEHKTVINKLKNVHLDEPFMALPSPIESRPSSSNVNDSI
                     KESAAISRKTQISDKSVNTKTSTFTESTSQVVRNVSSPPSFGNGVKRNGQKNSPLTLQ
                     PPLSSPAMVNQSKKMGYRSPSSPIYVRSPTLSPQSQSMKKYAVPNNMVISSSRYEVLN
                     ALKQNSGTNVASSGASAAFKNLQKKKMNQHK"
     gene            complement(<1084079..>1085824)
                     /locus_tag="HG535_0D05580"
                     /db_xref="GeneID:59236572"
     mRNA            complement(<1084079..>1085824)
                     /locus_tag="HG535_0D05580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288681.1"
                     /db_xref="GeneID:59236572"
     CDS             complement(1084079..1085824)
                     /locus_tag="HG535_0D05580"
                     /inference="similar to AA sequence:RefSeq:NP_011873.1"
                     /note="similar to Saccharomyces cerevisiae YHR009C;
                     ancestral locus Anc_5.592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144576.1"
                     /db_xref="GeneID:59236572"
                     /translation="MATDFIDKLTFLSHPSGKGQGKHHIVIVGAGIIGVCTAYYLTRH
                     ADFDPSTHHITILESKRVAGGASGKAGGLLASWAFPQQIVPLSFQLHQDLSDEHDGEN
                     NWDYRRLTTVSLEADVQNVGPNDDGEDSDSSYSSYSSSCSGSSTSTGSDSSATGNRLS
                     LKKKLKAKLASKNKSKTSSSELEIGSEDPSPKGSSRFHSSSNIVSSNIPQNAEESDKS
                     EESKKKGGASNNSTSNNDNNNSNNSNNSSNNNDDDDDIPLTNLNSDENSGFDMKQSAD
                     YSENKSTSATNSNLNSNSIPLGDPSNPLPSDLNWIKKNLVKDWSSLGGTDSTAQVHPY
                     KFTHFLLLKAMETEAVDLILGKVTKLQYNESGACCGISYNSTTDDDSVSNDIVDILDA
                     QQVVLTMGPWTSKLLPDCPISGLRAHSITLKPSTGTVSPYAIFTELKIGKNEYFSPEM
                     YARKDEVYVCGEGDTLVELPETTDAVEVVREKCDELYHYVSKLSKNLSNGHILKRQAC
                     YLPVLNVPTSSGPLIGETNVDNLYIASGHSCWGINNAPGTGKVMAELLLERETKSADI
                     SALDPSLYFDASILE"
     gene            complement(<1087194..>1087832)
                     /locus_tag="HG535_0D05590"
                     /db_xref="GeneID:59236573"
     mRNA            complement(<1087194..>1087832)
                     /locus_tag="HG535_0D05590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288682.1"
                     /db_xref="GeneID:59236573"
     CDS             complement(1087194..1087832)
                     /locus_tag="HG535_0D05590"
                     /inference="similar to AA sequence:RefSeq:NP_010756.3"
                     /note="similar to Saccharomyces cerevisiae TLG1 (YDR468C);
                     ancestral locus Anc_5.593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144577.1"
                     /db_xref="GeneID:59236573"
                     /translation="MDQDPFEQVVVDTGEQIDRLAHYFNSNSREENDEVYDILKDVEE
                     TIQDLEKSCIVMQRSGQDVSKRETQVHELVRALRELKAVSKSQPQVQSQAQPQLAFEE
                     TQTPDQEMSPMYENPFQEQMLREQDTHLDSIHHTMTNLHSQAQTMGEELQDQGQLLDE
                     MDGNMDTLTNKLSRGRRQLEWVYEKNKEKFNDCCIVLLIIALIVLLVLAFIA"
     gene            <1087968..>1088183
                     /locus_tag="HG535_0D05600"
                     /db_xref="GeneID:59236574"
     mRNA            <1087968..>1088183
                     /locus_tag="HG535_0D05600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288683.1"
                     /db_xref="GeneID:59236574"
     CDS             1087968..1088183
                     /locus_tag="HG535_0D05600"
                     /inference="similar to AA sequence:RefSeq:NP_010757.3"
                     /note="similar to Saccharomyces cerevisiae SDC1 (YDR469W);
                     ancestral locus Anc_5.594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144578.1"
                     /db_xref="GeneID:59236574"
                     /translation="MNEQDQPRDHDDLNKLINLSETVGGSQTRKYLNDKVTPHLLNGM
                     RLLAREKPENPLKVLGEYLIKQSDIEK"
     gene            complement(<1088215..>1089681)
                     /locus_tag="HG535_0D05610"
                     /db_xref="GeneID:59236575"
     mRNA            complement(<1088215..>1089681)
                     /locus_tag="HG535_0D05610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288684.1"
                     /db_xref="GeneID:59236575"
     CDS             complement(1088215..1089681)
                     /locus_tag="HG535_0D05610"
                     /inference="similar to AA sequence:RefSeq:NP_010758.3"
                     /note="similar to Saccharomyces cerevisiae UGO1 (YDR470C);
                     ancestral locus Anc_5.595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144579.1"
                     /db_xref="GeneID:59236575"
                     /translation="MEDSGNRLQARPYYNPEDFNAGYSAIFRPDKGVVDVNGQTMASK
                     LAVVQSSGSRIGKNAFSKKASGSLLSGLSFGDSKKLFTRDTNGTNIESHKNISDMEWS
                     DFLNVRTWKKILGQLCDQFLRKYFKHLIQQPFEVARVLLQVGDFNEIVERDNCSARLP
                     VELKNELADDPAYPEKDDFNEEIDFFPTTNDSSRWRSAVLNEEESKREHEDFVNANEI
                     IITPESNHTMDIMNALMDNEGIRGLWKANNTTFIYNFLSITLDAWFTGIISPFLGIPD
                     PYFMDLIHSPNLKASIILTLSANILTKIVLLPLDIIRTRFIVTSIHRGAKPIRSLKKL
                     IRNWSWSKDGVKISIDMWILTILQSVFNVTFNKLFDVLIYHEFNVEKHSQIKWYSSLK
                     FVSQFMELFAKLPIENLLRRCQVNYLINSNQNSLSIDRNDLVIKPIRYEGVWNSIKSK
                     KMTMELWNGWRVSLMSLVCYYGFEMMNNDPIDLEQEKF"
     gene            <1090751..>1091538
                     /locus_tag="HG535_0D05620"
                     /db_xref="GeneID:59236576"
     mRNA            join(<1090751..1090781,1091159..>1091538)
                     /locus_tag="HG535_0D05620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288685.1"
                     /db_xref="GeneID:59236576"
     CDS             join(1090751..1090781,1091159..1091538)
                     /locus_tag="HG535_0D05620"
                     /inference="similar to AA sequence:RefSeq:NP_010759.1"
                     /note="similar to Saccharomyces cerevisiae RPL27B
                     (YDR471W) and RPL27A (YHR010W); ancestral locus Anc_5.597"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144580.1"
                     /db_xref="GeneID:59236576"
                     /translation="MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKSHPFGHALVA
                     GIERYPLKVTNKHGAKKVAKRTKIKPFIKVINYNHLLPTRYTLDVEAFKSVVSTETFE
                     EPSQREEAKKVIKKAFEERHQAGKNQWFFTKLSF"
     gene            <1091872..>1093221
                     /locus_tag="HG535_0D05630"
                     /db_xref="GeneID:59236577"
     mRNA            <1091872..>1093221
                     /locus_tag="HG535_0D05630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288686.1"
                     /db_xref="GeneID:59236577"
     CDS             1091872..1093221
                     /locus_tag="HG535_0D05630"
                     /inference="similar to AA sequence:RefSeq:NP_011875.1"
                     /note="similar to Saccharomyces cerevisiae DIA4 (YHR011W);
                     ancestral locus Anc_5.598"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144581.1"
                     /db_xref="GeneID:59236577"
                     /translation="MERLMSFKRSLSYSLPCRFLKAPKFDVKFVTNNLHLYEKSIRNR
                     NLVDGSKLLEGLQALPELYQNEKVLLQKISDIQSRRKSLEGLIKVDKSKIEELGEEFK
                     HLKEAFKTLSDELNTSATKSFEICSSLPNLISSDAPLTKPEIIQWINPKESLPSDERR
                     HHVDIMVTKNMLDLKTASNISGTSWYYLLNEGAELEHALVSFAIAKAKEAGFQICIPP
                     SIVRDEIIDACGFRPRDMNNEQQIYHIDKSQLGLTATAEISLAGLGVNKVVDLCKGPK
                     KIAGVSRSYRSEAGARGKDTKGLYRVHEFTKVELFCWSKPKDSENVLEELKDFQIDLI
                     KSLGLTAKVLNMPTNDLGAPAYKKYDIEAWMPGRGSFGEITSTSNCLDFQSRRMNTKF
                     KNEYTGKLEFVHTLNGTAMAVPRMILSLIENFYDPNNKRISIPDCLRQYMGGKEYIQ"
     gene            <1093395..>1094373
                     /locus_tag="HG535_0D05640"
                     /db_xref="GeneID:59236578"
     mRNA            join(<1093395..1093442,1093516..>1094373)
                     /locus_tag="HG535_0D05640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288687.1"
                     /db_xref="GeneID:59236578"
     CDS             join(1093395..1093442,1093516..1094373)
                     /locus_tag="HG535_0D05640"
                     /inference="similar to AA sequence:RefSeq:NP_011876.1"
                     /note="similar to Saccharomyces cerevisiae VPS29
                     (YHR012W); ancestral locus Anc_5.599"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144582.1"
                     /db_xref="GeneID:59236578"
                     /translation="MLILTLSDAHIPDRAIDLPLKFKKLLGIPNKISQVVLLGNCTKS
                     YEFLKFVNEISSNVTFVRGEFDNEQLPTTRKNINKQGIPMDTVIKQGDFKIGCCSGYT
                     VVPKNDPLSLLALARQLDVDILLWGGTHNVEAYTLEGKFFVNPGSCTGAFNTDWPILG
                     QEEPARTKASPSPKDGGDEQDKSNEQTGRNEPADNREEDGNNSSENVAQSDSFADKTS
                     EDGSQKKNQDASGKIDLEKVNDEDEDEHEDENEELDIPDLELDGSNDPSFCLFDIQGS
                     TCALYIYIYVDGEVKVDKVVYKKSN"
     gene            complement(<1094802..>1095455)
                     /locus_tag="HG535_0D05650"
                     /db_xref="GeneID:59236579"
     mRNA            complement(<1094802..>1095455)
                     /locus_tag="HG535_0D05650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288688.1"
                     /db_xref="GeneID:59236579"
     CDS             complement(1094802..1095455)
                     /locus_tag="HG535_0D05650"
                     /inference="similar to AA sequence:RefSeq:NP_011877.1"
                     /note="similar to Saccharomyces cerevisiae ARD1 (YHR013C);
                     ancestral locus Anc_5.600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144583.1"
                     /db_xref="GeneID:59236579"
                     /translation="MPITIRRATVEDMVGMQNANLHNLPENYVLKYYMYHVLSWPEAS
                     FVATTTDISDSVGDELTIADENGNETKLDPNYVRQGEKLVGYVLAKMNDDPDQQNEAP
                     NGHITSLSVMRTYRRMGIAEKLMRQALFALREVYKAEYVSLHVRQSNRAALHLYRDTL
                     EFEVLSVEKSYYQDGEDAYAMKKVLDLEELKPSNYAHAKGAERIEDDFESDLLDATV"
     gene            <1095639..>1096487
                     /locus_tag="HG535_0D05660"
                     /db_xref="GeneID:59236580"
     mRNA            <1095639..>1096487
                     /locus_tag="HG535_0D05660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288689.1"
                     /db_xref="GeneID:59236580"
     CDS             1095639..1096487
                     /locus_tag="HG535_0D05660"
                     /inference="similar to AA sequence:RefSeq:NP_010760.3"
                     /note="similar to Saccharomyces cerevisiae TRS31
                     (YDR472W); ancestral locus Anc_5.601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144584.1"
                     /db_xref="GeneID:59236580"
                     /translation="MSQRIILPSTSDDRVFNNSDGYEYTIGPKQSLPNEASSQPTPSR
                     LYSESLMFRKQEVSLSAVTFLFGEMIAHIHNTSKTASECEVKLNDYGFVIGSKLLELL
                     NLRASVPSNTYLRSSNFLSSSTPTNTSANAMHSGSNTTASRTVSGVSDIYYNQENSAE
                     SLTTLISSMRSRDLTILDILQFIHGTVWSYLFGHVSDDLVKSSERENEYMIVDNLPLL
                     TQFIPNGVSCDFFVCGIIQGFLNNAEFPCSVTPHLMPLKGFDQRVIYLIQFDKHVLER
                     EGLRSE"
     gene            <1096667..>1097590
                     /locus_tag="HG535_0D05670"
                     /db_xref="GeneID:59236581"
     mRNA            <1096667..>1097590
                     /locus_tag="HG535_0D05670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288690.1"
                     /db_xref="GeneID:59236581"
     CDS             1096667..1097590
                     /locus_tag="HG535_0D05670"
                     /inference="similar to AA sequence:RefSeq:NP_011878.1"
                     /note="similar to Saccharomyces cerevisiae SPO13
                     (YHR014W); ancestral locus Anc_5.602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144585.1"
                     /db_xref="GeneID:59236581"
                     /translation="MPQKRYRVIKNSEVSKPLQARAVNVKVPTVESILKSSKPSYSQT
                     SRSNGSPPRKQSKRVKKHDLKAKNRRSSTIFSSDDVELKLVSQNCFRNTSVSKRNPER
                     LTENEEENSLKIEDFDQPPQSTSTPILGSSSYNSFQDLTSPHAPNAPYQMSPLLYSCN
                     PVVHQYPYCYPQPYVYSQAMFTNDSPLQKKAYQDHYKLSRNYVHPTAGFPQYRTQENK
                     DVHPQIQMSYPLMSGYDNARVQYTTTEPIFLPMIEPNPRNLVGRDFSDSELQRHASQV
                     NYLNAKRHVSSGNSSYKSSGGDATYQGSAKS"
     gene            complement(1097856..1097937)
                     /locus_tag="HG535_0Dtrna10S"
                     /db_xref="GeneID:59236651"
     tRNA            complement(1097856..1097937)
                     /locus_tag="HG535_0Dtrna10S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:59236651"
     gene            <1098162..>1099949
                     /locus_tag="HG535_0D05680"
                     /db_xref="GeneID:59236582"
     mRNA            <1098162..>1099949
                     /locus_tag="HG535_0D05680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288691.1"
                     /db_xref="GeneID:59236582"
     CDS             1098162..1099949
                     /locus_tag="HG535_0D05680"
                     /inference="similar to AA sequence:RefSeq:NP_014666.1"
                     /note="similar to Saccharomyces cerevisiae AHC1 (YOR023C);
                     ancestral locus Anc_5.603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144586.1"
                     /db_xref="GeneID:59236582"
                     /translation="MDDQDGSFTLHSSLGVLGSQSTGNTVPSQVLFMDTHDMPSRTNT
                     HPPASAYYQVATPKSPHELALDGDDEVHGGDSSNETIGPIGHSGHPTEGHHMMMGKSS
                     RESEEMERLKYETAKNEILDKLHLHTLIGHKEMQRVQLEIRRADAQMHLLKKLHEDKD
                     LLGKIEKCHERKNEMTRQELSEINATRNSTSGHLADASLIGLPPGTSPNDVSSASSGV
                     PTHHYHTRSKSQGNVNEVAHLRPANSAIIDLRLTGSKSISNSAFKGGNKEPEYEILPF
                     RPNQMNLHHRRNYSSTSLTSNSGVVGKTESNEAIFRRYDGILIVITCANCNRSGFTSA
                     QGIVNHARLKHGKTYSSQPLAVLHNQKVLDDDKQDPQVLEKFRGIGKDPKTDYLPCEI
                     AIPSGRRSSHREVSPKNTLNRKSESQGRHQSPHSSVHLEKMYNKDDFKDLVAMVNEAQ
                     NDLDVVLKHSESESRLCESEEGDNSLRDQCDESDYIATSSKNIAENSSASFSSIKNDP
                     ANAPSTKRSEKEGPAISSRITPKENGKKRKNETNGEERDLKERLRPAEKKARRDALAL
                     SNIPDHEKRSSHYNLRAKSKLKGINSKNQ"
     gene            complement(<1100160..>1102745)
                     /locus_tag="HG535_0D05690"
                     /db_xref="GeneID:59236583"
     mRNA            complement(<1100160..>1102745)
                     /locus_tag="HG535_0D05690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288692.1"
                     /db_xref="GeneID:59236583"
     CDS             complement(1100160..1102745)
                     /locus_tag="HG535_0D05690"
                     /inference="similar to AA sequence:RefSeq:NP_683715.1"
                     /note="similar to Saccharomyces cerevisiae BUD27
                     (YFL023W); ancestral locus Anc_8.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144587.1"
                     /db_xref="GeneID:59236583"
                     /translation="MEAFADSINASLQSLTEKKEFLEVKRDHYVTIRQHLHKFRENGD
                     EHQDSSDGLVFGDVIIAAKKVYLSIGYEYYVEKQCEEVLEFLRGQLDLMGTAIRQFQE
                     KISEAKETLKNIQSLSNSNGSQGEMDGEYLPPVEIREELDEEGNVISSTVTPTSTKKE
                     RLGIDEKKDGLSSFEQNLRDRLAAKDSKASTDNKVTISAPPESQKEVGDGLPASIDRD
                     NMYTFADLVRQLDEQDEQDDERENMHCADDDDDDDDDDDDDDDDDDDDDDDDDDDDDE
                     VEDGEEINQFSFIRGAPAQQAFMNQINKLRNQKRASDTRTEHVNAEEELRRAKFHHEV
                     DGHKSSVKSILKDSNKINKKSKKTVGFAAELDIKEVENLKAENKKNTQRFTVSSSFQP
                     PPNDRIGSAVSSENEFDSELFANLIGAQGPDEIHERYKEQVSKEVNNHAAQLKREERK
                     KRFSRFRKERNREPVSIASSTHDSEAVSAMKDLVIEHYEEEPLSLGDGSNKAGGIAAG
                     SAINSMVIQRSGDDLVPVNTTKKSSRGREEKPVSTVIKERTTNDSSDYDYNFSAIPER
                     TPENETCELVKSNNNLAVESTQYSKWNESKKADVGEEDLMFFRKKMISLNTTNKHTKN
                     SSKVGLKSLGDLASDEDESEDSAERTLPSNSQDPSDFRLETIINNKVNSDTSVKVPTI
                     DYRALSENTDDMARAYALGIYDDDLEEDPGVIIERIEDFEEHNKEVNLLKDEIEHFKL
                     SSSLEEEEAETKHLDDALVSDIQENEIPENYPGGNSTNRDVLNDEDDDLGLEYGRLSE
                     SIAIEYSHLKEKMASRRSYLHFRSSQNDDEKKQLEPIDEYGNPVKVSRFRSQMFQAGD
                     SQHFQ"
     gene            <1103662..>1106247
                     /locus_tag="HG535_0D05700"
                     /db_xref="GeneID:59236584"
     mRNA            <1103662..>1106247
                     /locus_tag="HG535_0D05700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288693.1"
                     /db_xref="GeneID:59236584"
     CDS             1103662..1106247
                     /locus_tag="HG535_0D05700"
                     /inference="similar to AA sequence:RefSeq:NP_116629.1"
                     /note="similar to Saccharomyces cerevisiae EPL1 (YFL024C);
                     ancestral locus Anc_8.47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144588.1"
                     /db_xref="GeneID:59236584"
                     /translation="MPQPSGSASSNKNKSINGDKSGAIEGSKGASGSNGNSGDIGAKN
                     GEPTSADVVGGPRFRHRKISVKQRLRIYKPNDLKNLDQEELQQRVAADIETGVEKNEE
                     KEVHLHRILQKSSGQLSIQKKDYIPTPDASETWKEFGQFYQGNFDEPASYIKFSATVE
                     DCCGSSYIMDEVDDTFLSEQINNKKQPLLSEDEFELLCSSFESAIHERQPFLSTDPQS
                     ILSLDELKPTIIKSDSNHQSLKISLAKDIGFSAEKPIVTEFDAESQSKVRSLTFLLEK
                     FGDQLYEHWKSRKIESSHTEIFPKLKFERPDEKEEVDPYVCFRRRDVRQPRKTRRIDI
                     LNSHKLRALHEELEHAQKLALLVAKREQVSLNLLEKELQVFDERGEFKKLKRALSIKE
                     DDELLINPKSRRLNIFANQKKQQQQQAAADAAAVEAAITSDSSMKKGARNKANKKDID
                     QCSKSHQKLNKQQQLQSQKNAIENSGSAVDNKQIALPAANSTGQQGPQPQMVASHVYV
                     RLPSSKVPDIVLEEVEDLLSDKEKNARKFVLDKMDKRKLEDGDIFFNITDDPYNPVFD
                     LVLPNDVIPSTAPFSSIASSRFEVDRSYYSPNLSDYMNGTTDNIRAYTRTGDKLPDKN
                     CKVKKIELYDPFQNHNEIHSREYPVKFRRRFGRHGIEYIDRKPNQFDANVEATLGDFL
                     NFDEIERQEKHATSAINVYESKWDELSRLYDKWKHDSPRNDYGLKVSEEPARLNQISN
                     ETQVIRFGTMLGSKSYEQLREVTIKYRQEYISRIKQQKINNQKQLLLQQQLQQQLQQQ
                     QQQQQQQQSSGKNINNGTLSRTPSIIASPAASNKMNDTSGSSDNNEANLFAANHKSSN
                     SSQTA"
     gene            <1106697..>1109825
                     /locus_tag="HG535_0D05710"
                     /db_xref="GeneID:59236585"
     mRNA            <1106697..>1109825
                     /locus_tag="HG535_0D05710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288694.1"
                     /db_xref="GeneID:59236585"
     CDS             1106697..1109825
                     /locus_tag="HG535_0D05710"
                     /inference="similar to AA sequence:RefSeq:NP_116628.1"
                     /note="similar to Saccharomyces cerevisiae BST1 (YFL025C);
                     ancestral locus Anc_8.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144589.1"
                     /db_xref="GeneID:59236585"
                     /translation="MGVRKLIQSLSRRTTAVWINDQNEKGSSLKHKPPQRQRDDRIAT
                     TDADNRTSNKPRCLKATIFHNYPLRICVLIGAFLMLLIVKFTIIESFEGADSSQCRSI
                     YMFPSYGRLNGFDLKHTALAQKYHLYLYREQGLDKEPMKDGMAQLDGIPVLFIPGNAG
                     SFKQVRSIAASCSRNYFQQREDIKNPNTRNLDFFAADFNEDFTAFHGRTMLDQAEYLN
                     DAIRYILSLYGHSSDSSTPAPSSVIIIGHSMGGIVARILPTLMNHVEGSVQSLITLSS
                     PHAAAPVTFDGDILKIYARTNDFWREQMQDRDSFFSKNMSLISITGGILDMMLPADYT
                     AVQDIVPLENGFTTYSSTIPNVWTPIDHLAVVWCDQLRTVVAKLLLETADYTASSRLR
                     TLEERMKTSRELLLSGFENYTQHDLTIVNSSISPDNKYAHLSQVGSGINDKSPETSIS
                     AIENLENEERSYQILLPKKGSLNLAILASTEGLCISFCKAKYPFDPKNIEPDDSDSCF
                     RGINYMKYAPASFKTTGHASDSSVNSNIKPFQMMNIGNSTLSHYDYVIVDKLPYAKFE
                     SNDFFISELTINGIEKSIDVTPLHIATMGLKLELSGKLIETVSFPNVWDSLLSYKVRT
                     HLITKETKELLFQPFVRQWIDDPFESKWHVNVTDFDFNINMHGVAPFIPLEETHDKSL
                     KLAVMTPPGAKLILDFRINWGLTIKMLFIRYRLTFLSLPVSVVSFVLAFQFYRYQEVR
                     VFPSFNNTLAFLLKTKGVYIFFGILFLSPLVNTRLIQKLLYFFDPVRLNRPFLLDERN
                     MHTNFYFLGIRSWFLSGIGILFVLMSIACLFLVAKIHDIAEYFVRKTKLKFSSSKSGS
                     KSPLRNRKIYESWKARIFACIILTFAVLFYIPYQLASAITLIIQVITCLRVLSNAENL
                     NPEKYNNLRNYNFSVFLLLLFVVLIDSPIIVVFLHNVAIRWETPFRSHHNFLAIAPTI
                     FLVNFNSGLKIPGFRSKKTYEGFATVLLLLYLSIFSLIYGSRNLYWIHHLANMLCAWL
                     LYGAYAASLPEE"
     gene            complement(<1109900..>1111309)
                     /locus_tag="HG535_0D05720"
                     /db_xref="GeneID:59236586"
     mRNA            complement(<1109900..>1111309)
                     /locus_tag="HG535_0D05720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288695.1"
                     /db_xref="GeneID:59236586"
     CDS             complement(1109900..1111309)
                     /locus_tag="HG535_0D05720"
                     /inference="similar to AA sequence:RefSeq:NP_116627.2"
                     /note="similar to Saccharomyces cerevisiae STE2 (YFL026W);
                     ancestral locus Anc_8.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144590.1"
                     /db_xref="GeneID:59236586"
                     /translation="MSYRLFSQDNIAATQEMMDSTLNSQAYNQSYNPNDGLLSFNSIY
                     GDNTAVTFQYVQALVNERTSQGIVFGTRCGAAVLTLVLMWMISKSRKTPVFIINFISL
                     SLVIVHSALYCRYLLSGYASIAYALTGFPQLVKASDLHAYAACNIVQALLVTSIETSL
                     FFQVRVIFAGDNSKRVGLILTTLAAALGIATVVMYFYSAIAPIVSLHSDSSEVSPTFF
                     NVSLILLASSINFTTFLLVIKLTIAVKSRRFLGLKQFDSFYILLIISFQTLMIPSILF
                     ILAYSLPEDKGTDYLIPIATLVVVLSLPLSSMWATASNKEFKSSSVSQFYPSSGGYSD
                     GSSNYCSDSDYISSKRSIKQKLFETYPKSRAESDKQSERTYCAGGDLEKGELHELSTP
                     ISQVDGHGFTSQQETEKVNHTHPIRIVSWTNSGEQSTWPISAGKTESSEDDQSGKLDF
                     NHDSKDEGFIETKRITLKK"
     gene            <1112304..>1113962
                     /locus_tag="HG535_0D05730"
                     /db_xref="GeneID:59236587"
     mRNA            <1112304..>1113962
                     /locus_tag="HG535_0D05730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288696.1"
                     /db_xref="GeneID:59236587"
     CDS             1112304..1113962
                     /locus_tag="HG535_0D05730"
                     /inference="similar to AA sequence:RefSeq:NP_444296.1"
                     /note="similar to Saccharomyces cerevisiae GYP8 (YFL027C);
                     ancestral locus Anc_8.44"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144591.1"
                     /db_xref="GeneID:59236587"
                     /translation="MDTLVGAESPSLSSSEESLSLHCDILADSLFDEKSLLNFFNEQE
                     QRDFKTSVIRNILHDRNYKTLCTLGMSNFGFVSTPLRKECWFELLSRQLRVSQGSGYT
                     TNKGCTREHRDENQVSLDVQRSFTSVTDEGRKEKLRKLLERIIVKILRRYPKLSYYQG
                     YHDVVSVFVIVFIEGHDYDDECNFLSLSGMTSKSDDNHSNGAAEDKSNGVSSSTTDLY
                     ENETTSKIGFDEDKLLRCVEAFTLLYLRDFMMDSLDFPIDQLRLIPEFIKKNSKAFYK
                     KLNLDKIEPFFAISSILTVFSHELKPSENEPDSLIFQIFDFVISSQSMVVPLAMYATL
                     IMEKKDTIIEAYNANIDNFENSVDLVHGVIQQVLVPTRCAEKIWKQILEEVRSNPSRE
                     HISKYRGLVNRYSTLLTTASGQLHTSYEVEDVIKLLEKEIALNSKRKTSKAHAKLHKT
                     NTMRTFARLFSSRSFPLICKVSIFVGMLAIFMKLYRDGSIKAMLPTLRIYLKKYQCSS
                     FAGLYRGLNYVWLDPLHELLKNPSLPRWASKVSRSISSSKDSDF"
     gene            complement(<1114008..>1116053)
                     /locus_tag="HG535_0D05740"
                     /db_xref="GeneID:59236588"
     mRNA            complement(<1114008..>1116053)
                     /locus_tag="HG535_0D05740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288697.1"
                     /db_xref="GeneID:59236588"
     CDS             complement(1114008..1116053)
                     /locus_tag="HG535_0D05740"
                     /inference="similar to AA sequence:RefSeq:NP_013156.1"
                     /note="similar to Saccharomyces cerevisiae SPT8 (YLR055C);
                     ancestral locus Anc_8.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144592.1"
                     /db_xref="GeneID:59236588"
                     /translation="MDEVDEILNQNRVPEEDEEEEEEDDTMLHGNIGKVNDMDQDQDQ
                     GDEEDENDQDDDDGNEDDDDDDEDDDEDDDDDDDDGDDDDDDDDDDDDDDDDDGDDDD
                     DDDDDDDENEDDRNDDDVNNANGGESNAADHPNRTFSTTMDSEDEHRHINGAKQNENG
                     NGNANGNTNANGEKHVDSADGMNFSHPQDDAKNNSNFDASSVQQAENEVTEEDKDVDM
                     DKPSGIDKVHNYYTQMLLSAKVADTYNIYPSAAIPIQTNVNALTMSKGLEYLFLGGDD
                     GFIRKYDFLNTVEGKLSLTILQRHSLAESIQNAGILVSYWENEVPQKRSQLKMLKNNK
                     EYEPKVSPVYSLEVQSECLFILSGLDDGGITLQGVRYMEGSISHYFKGRDGHSNIVNL
                     LKMNDDETRFLSGSWDKKILEWDLESGSLVNEFKGSTSELSSLEMRPLFSTVDIKDVS
                     INLKTDIEKNEKDDDMDSLFGDEDEDKADLSSHTDTERENEDTKNRNISEEISKTTLN
                     VVYDESVFMSSGLNGTVHIWDRRVPSSPVLNLEKGPKTPPWCQSACWYMDGDRVFAGR
                     RNATVEEFELRMPSAPSNVLKLPAISGPVTCVRAMPNNKQVLCASRDNIRLFNTANDM
                     NSKGTAVPFLIVPGHHGGVISNMYVDPTCRFLISTSGNRGWQGNSTDTTFIYEIDLN"
     gene            <1116250..>1117113
                     /locus_tag="HG535_0D05750"
                     /db_xref="GeneID:59236589"
     mRNA            <1116250..>1117113
                     /locus_tag="HG535_0D05750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288698.1"
                     /db_xref="GeneID:59236589"
     CDS             1116250..1117113
                     /locus_tag="HG535_0D05750"
                     /inference="similar to AA sequence:RefSeq:NP_116625.1"
                     /note="similar to Saccharomyces cerevisiae CAF16
                     (YFL028C); ancestral locus Anc_8.42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144593.1"
                     /db_xref="GeneID:59236589"
                     /translation="MSFAVEVLNLTYQFPGSETPSLTNIDLKIPWNTRTLIVGANGAG
                     KSTLLKLLSGKHLCLNGKILVNGSDPFSPVHSTKDGEEEYLITTYLGTEWCHMSIINR
                     DIGVAELLNSIGMPHFQQRGDTLCEILDVDLSWRMFKLSDGQKRRVQLVMGLLKPWKV
                     LLLDEVTVDLDVIARSKLLGFLQWETRTRQCSVIYATHIFDGLSEWPDRIWHLKEGSM
                     VDQLDYHRDIKFVDSSEATGNGSVTFSPDGPTVHISKVKSLHPLAQSWLHGDPSDLSH
                     LLISDVDQPLL"
     gene            <1117664..>1118764
                     /locus_tag="HG535_0D05760"
                     /db_xref="GeneID:59236590"
     mRNA            <1117664..>1118764
                     /locus_tag="HG535_0D05760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288699.1"
                     /db_xref="GeneID:59236590"
     CDS             1117664..1118764
                     /locus_tag="HG535_0D05760"
                     /inference="similar to AA sequence:RefSeq:NP_013157.1"
                     /note="similar to Saccharomyces cerevisiae ERG3 (YLR056W);
                     ancestral locus Anc_8.41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144594.1"
                     /db_xref="GeneID:59236590"
                     /translation="MDLVLEVCDRYVFDEVYARVLPASITSHFSNNAQSLLGLNRGFS
                     NSTFLEESLHSLNNLPRVNKDVYGYTPYLVDFTQRTFESLLPRYNMLREFLSLWAIVT
                     VFGWLLYLIAASLSYVFVFDRSIFNHPRYLKNQMSLEIKMALSAIPIMSVLTVPWFLM
                     ELHGHSRLYMEVDWENHGLRKIFVELASFLFFTDCGVYLAHRWLHWPRVYKALHKPHH
                     KWLVCTPFASHAFHPVDGYLQSISYHVYPVVMPLNKVSYLILFTFVNFWTVMIHDGQH
                     MYNNAVVNGTACHTVHHLYFNYNYGQFTTLWDRLGGSYRRPEDELFDPSLRSKATMEK
                     QIKECERFIKMMDDEDDSYRVYGTEERLKKVN"
     gene            <1119059..>1120141
                     /locus_tag="HG535_0D05770"
                     /db_xref="GeneID:59236591"
     mRNA            <1119059..>1120141
                     /locus_tag="HG535_0D05770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288700.1"
                     /db_xref="GeneID:59236591"
     CDS             1119059..1120141
                     /locus_tag="HG535_0D05770"
                     /inference="similar to AA sequence:RefSeq:NP_116624.1"
                     /note="similar to Saccharomyces cerevisiae CAK1 (YFL029C);
                     ancestral locus Anc_8.40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144595.1"
                     /db_xref="GeneID:59236591"
                     /translation="MTALSQLNASEKKLLKSTRLATIYTADTYAIKSVSRDFTIEPHN
                     PNFELSVLLKLSPKCNPYVIQLIDWRSVGDDLELLFPLYQMDLHDFMRRKYKSSLNPY
                     YTISEGTSCHAGFRNRFDVDKHAFNFVSQLAHGLDFLHSNGIIHRDIKPQNILIDRKN
                     DLTTLVITDFGISYDSQNLQQLKVEPLDKKITDVSTSVYKAPELLFGVKNYTYAIDIW
                     ALMVLISQWFQEKAENPHHSIPAIFDDGSGSFSDGGSGSDIKLIISIFDQLGRPSIAE
                     WPEVQNYGSCDALCGMFGSDGDNKYILNQSYEDRLKRLHAILPRLSEISNSKEQSALT
                     NCILGMLSFESSSRWKSIDIINELSR"
     gene            complement(<1120151..>1120375)
                     /locus_tag="HG535_0D05780"
                     /db_xref="GeneID:59236592"
     mRNA            complement(<1120151..>1120375)
                     /locus_tag="HG535_0D05780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288701.1"
                     /db_xref="GeneID:59236592"
     CDS             complement(1120151..1120375)
                     /locus_tag="HG535_0D05780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144596.1"
                     /db_xref="GeneID:59236592"
                     /translation="MNNSKKRSLTLTPSSNPGSTADKKRTLDGSPHRHDRSKENSMDW
                     QKQCIIQENELARLKKLNEYLKLERECNIK"
     gene            <1120586..>1122943
                     /locus_tag="HG535_0D05790"
                     /db_xref="GeneID:59236593"
     mRNA            <1120586..>1122943
                     /locus_tag="HG535_0D05790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288702.1"
                     /db_xref="GeneID:59236593"
     CDS             1120586..1122943
                     /locus_tag="HG535_0D05790"
                     /inference="similar to AA sequence:RefSeq:NP_013158.1"
                     /note="similar to Saccharomyces cerevisiae YLR057W;
                     ancestral locus Anc_8.39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144597.1"
                     /db_xref="GeneID:59236593"
                     /translation="MSLPKALGSSIRRIRSVILLALTISLLFYYTFQNEINMLNSFAE
                     NEYIPSNVSDLTADEQRDMTADEKDLITNVESSTSDLSNPDTLREKNRYFPLLLQDAS
                     NDPSLLLGASNKLDTSALFTYKEKYPVLNEVSLPLTFSYLANDYPRIQTSQYETGDLQ
                     RNDLLSKIRRVFSSTWAIDVLPSTISTSISHEWPILLVDSMDTLYIMRLFDEFEQAVK
                     IISNVNFKIPPESIKVIDVPDYGSRLLGGLISAYDLSQNSILLTKAIDVADFLLRSFD
                     TPNRIPILKYDWRSKTSNKFPYQNSHSAGLTSLSLEFLRLAQITRSGKYFDATEKIFR
                     TIAMSSDEFALPHMLPQIVDASGCTLISKKDVLSGKHLRDSKGMKSIDQNLNFVHCHQ
                     TGKLLRTAADKKGHQEIFEMKAQDHSLYGNLLKSLHILNGNDLIAMKDAHVDDNRKDS
                     ATRNNGGRLEKTTENNLDKAAAIKQIVTRAMDQINEYMSFNPLTPLSENLTFVSSLKA
                     IIHKAPASQQFSIEIIKSYDMHHERCSLAGTLGLASKIADSGSYIEIAKKLTSSCFEL
                     FRLFKGSYVEDLLLDPCEAQQCLFNVPEKLHRLSQNYYQVEGSGKIKSGDRKTITTEE
                     DIEGGDIERTLWFSESQGPSFLNLKSDDVQEETQEWKQHPSMPLWVNKMGKTNILSST
                     LIESVFYLYRITGETKWRKIGETMFKNTLEKLQALNAGAKGVWKVEEMHEDLEGKSLS
                     EWYSRTLKYYYLLFSSSDDYTLDDYVFTSGGHLLKREPKLKEVTN"
     gene            complement(<1123185..>1124594)
                     /locus_tag="HG535_0D05800"
                     /db_xref="GeneID:59236594"
     mRNA            complement(<1123185..>1124594)
                     /locus_tag="HG535_0D05800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288703.1"
                     /db_xref="GeneID:59236594"
     CDS             complement(1123185..1124594)
                     /locus_tag="HG535_0D05800"
                     /inference="similar to AA sequence:RefSeq:NP_013159.1"
                     /note="similar to Saccharomyces cerevisiae SHM2 (YLR058C);
                     ancestral locus Anc_8.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144598.1"
                     /db_xref="GeneID:59236594"
                     /translation="MPYALSDAHKKMVSAHLSESDPEVEQIIKDEIDRQKHSIVLIAS
                     ENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMELLCQKRALKAFNLTPDRW
                     GVNVQTLSGSPANLQVYQALMKPHERLMGLYLPDGGHLSHGYATENRKISAVSTYFES
                     FPYRVDPATGIIDYDTLEKNALLYRPKILVAGTSAYCRLIDYKRMREIADKCGAYLMV
                     DMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGVRNVNPKTGKEVI
                     YDLENPINFSVFPGHQGGPHNHTISALATALKQANTPEFKEYQQQVLENAKALEEEFK
                     KLGYRLVSDGTDSHMVLVSLREQGVDGARVEYVCENINIALNKNSIPGDKSALVPGGV
                     RIGAPAMSTRGMGAEDFHRIVQYIDKAVKYAGATQKSLPKEANRLKDFKAKIDEGSEE
                     LTNLKQEIYNWAGEFPLPV"
     gene            complement(<1125518..>1126297)
                     /locus_tag="HG535_0D05810"
                     /db_xref="GeneID:59236595"
     mRNA            complement(<1125518..>1126297)
                     /locus_tag="HG535_0D05810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288704.1"
                     /db_xref="GeneID:59236595"
     CDS             complement(1125518..1126297)
                     /locus_tag="HG535_0D05810"
                     /inference="similar to AA sequence:RefSeq:NP_116622.1"
                     /note="similar to Saccharomyces cerevisiae HAC1 (YFL031W);
                     ancestral locus Anc_8.36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144599.1"
                     /db_xref="GeneID:59236595"
                     /translation="MGENVAKSGERSVSVDIPADFKVALPPRKRAKTQEEKEQRRIER
                     ILRNRKAAHHSREKKRLHLQVLEHKCHVMEQILGKIGNIEKLVGDDEAGIALLREYEN
                     MSDECSTPRSSYSPTNAVKQSEVGVGLDVDMNVNMNDVITPAQQQKEDGDFLTAGHSS
                     SESSSSFSPNMALTPISFVKDEADAKNWDLLLTNENNTHAEVADPRSVSTNNETNNAM
                     ASREDNSLFPQLWLPFDGTEESSFELDDWRNPAVITATTCI"
     gene            complement(<1126696..>1127601)
                     /locus_tag="HG535_0D05820"
                     /db_xref="GeneID:59236596"
     mRNA            complement(<1126696..>1127601)
                     /locus_tag="HG535_0D05820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288705.1"
                     /db_xref="GeneID:59236596"
     CDS             complement(1126696..1127601)
                     /locus_tag="HG535_0D05820"
                     /inference="similar to AA sequence:RefSeq:NP_013160.1"
                     /note="similar to Saccharomyces cerevisiae REX2 (YLR059C);
                     ancestral locus Anc_8.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144600.1"
                     /db_xref="GeneID:59236596"
                     /translation="MVIKRLSFPVHISFSSIVVFGRNYSQLGRKRNPYLDQKVTSLNV
                     AISKSTMVNTAVATPAKQIFKPLVWIDCEMTGLDHTKDRIIEICCIVTDGHLNIVDDN
                     CYESVLHCDADVMAQMNEWCVEHHGKSGLTRKVIECEKTREQVEKELLEFIQKLVPQP
                     RVGVLAGNSVHMDRLFMLKDFPHVIDHLFYRIVDVSSLMEVSFRHNPTLASFAPRKDK
                     NHTAKSDILESIEQLRWYRDNYLKDEQETKYFVKQQQQERELDKLKQQLQTLQAQIQT
                     QDLPSTTEKRPKEIEHGPVLKSRKL"
     gene            <1128154..>1132974
                     /locus_tag="HG535_0D05830"
                     /db_xref="GeneID:59236597"
     mRNA            <1128154..>1132974
                     /locus_tag="HG535_0D05830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288706.1"
                     /db_xref="GeneID:59236597"
     CDS             1128154..1132974
                     /locus_tag="HG535_0D05830"
                     /inference="similar to AA sequence:RefSeq:NP_116620.1"
                     /note="similar to Saccharomyces cerevisiae RIM15
                     (YFL033C); ancestral locus Anc_8.34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037144601.1"
                     /db_xref="GeneID:59236597"
                     /translation="MDTATTDDNLLPIISKSASSSSSTSSSGYDKQLRLATEKNPVIL
                     MELAQDGAIRYISDTWETLIGPRHRTHIADLIVGSEDDKQVFHRAIEMMLMNDDLSYT
                     VTFNVLRTKDESISSAEVSGVHSNCSNEIISATEGDSDDSRIITLEACGILIRDNETH
                     LALHSMWIVKPYSLREFEEEVNSILPPDFIKRLGFGATLFAEYLKEIENEQIVDQDDL
                     PNPKMVLCRVCETIVPAWWLETHSEHCVCEHRLDSLIHLLHDNLVEALMLLKNDAIQE
                     YKQLPINVRSASTQMVLQSLKELCDIAINVNISEIRLPGSTQAATEDILMNPITLTQG
                     YQRAIYDFSPNTKWNIENVQNWQVNMKEELESNVGLSLLAHDTIDLAKKKIDAVLRLD
                     NAMTYSLKIKNEVNNWVLQLILIQIEKNRNNLRDNANAPDNICSLKGIVLSDQANEPP
                     AQENETFNSNELHSLEVHASLSKADVEREGPNDYVRFQQPQLHHVQEEIFANSYMQND
                     SMPEKRKEGPDIEVQRSGRVSSDQNSSYSSFSSTRFESKSLSRSLTPRQRLDDQQSIL
                     QAIGNESSNKKDLSTIDVTAIVDRTATSPSLPSIISTKPNSFTNSSLLPKYKSTVSLT
                     QGRSSPLPSMDAVHLSREDSSSRRSDDKSPVLLNSGLPKNYLTPEQYPSSSSLPKQPL
                     SPLLLATNQSKSTVSSIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKILKKSDMIA
                     KNQITNVKSERAIMMVQSDKPYVARLYASFQNKDNLFLVMEYLPGGDLSMLIKMMGFL
                     PEKWAKQYISEVIVGVDDMHQNSIIHHDLKPDNLLIDLNGHVKLTDFGLSRAGLVRRH
                     QNLSRPRKASLSLDSGDHSSVGSNDVKPQVTYVDHRTRSNSSSSSIIRPSSCNRKGSI
                     KHADIEQLQAGQLAHSAQSSHSMALGDITLKEKYRNDSLTSSNSNTDISALQRSDSQV
                     SFSLLNISRPSTPTLPILNTMHVRNTSNASDILSDTPVDLALFHPEDSRQDKSFFGTP
                     DYLAPETIEGTGEDDRCDWWSVGCILFELLYGYPPFHASSPEDVFKKILAREIQWPSY
                     SNPEEQEAFENSLAKDLLSKLLVIDPSERLGSNGAQEIKDHPYFADVDWNRVYDEEAS
                     FVPSIEHPEDTDYFDLRGAVLEDFDDTEGELGDTTVPGFTPLLNAGGSDRRHSASFSA
                     SHGEYSPNTPLNKLCVSSVLESVSKENSNRSSPTLKHFPLAIPPHMRDRRVSKLNDSQ
                     TEFGSFYFRNLSALDKANKDAINRLKSEHLTDSPGGHRRSSSASHVSSSSDSSGARTR
                     AGRVSASGSPGGVGHGPSKSFSVFDSPSLKVSSPDMSFGTDSNISARKGSGGNNHSSA
                     SSGILHFNDDFSTASKLRSPLSPTYGNSPHMTPSHTARSRLITNSSQPRRGSNDVSME
                     EHERLSAISRVNSLRFRRRSGRRSSGSSEVGYHMDVLVCEPIAIHRYRVSKDLESLGC
                     SVVSVGAGDELISRATSGVKFDLIFTALKIPKLGAVDIVRLLKHTNSVNSATPVVAIT
                     NYYQEAINDDVFDEVLEKPVAYDQLRKSVAKYALQKAQQQEDTIISDSDFESNS"
     gene            <1134303..>1136090
                     /locus_tag="HG535_0D05840"
                     /db_xref="GeneID:59236598"
     mRNA            <1134303..>1136090
                     /locus_tag="HG535_0D05840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037288707.1"
                     /db_xref="GeneID:59236598"
     CDS             1134303..1136090
                     /locus_tag="HG535_0D05840"