GenomeNet

Database: RefSeq
Entry: NC_050724
LinkDB: NC_050724
Original site: NC_050724 
LOCUS       NC_050724            1250112 bp    DNA     linear   CON 10-NOV-2020
DEFINITION  Zygotorulaspora mrakii chromosome 6, complete sequence.
ACCESSION   NC_050724
VERSION     NC_050724.1
DBLINK      BioProject: PRJNA670754
            BioSample: SAMN14605243
            Assembly: GCF_013402915.1
KEYWORDS    RefSeq.
SOURCE      Zygotorulaspora mrakii
  ORGANISM  Zygotorulaspora mrakii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Zygotorulaspora.
REFERENCE   1  (bases 1 to 1250112)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     The yeast mating-type switching endonuclease HO is a domesticated
            member of an unorthodox homing genetic element family
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1250112)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1250112)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUL-2020) Conway Institute, University College Dublin
            (UCD), Wolfe Lab, Belfield, Dublin Dulin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP058609.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: HGAP v. 3
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100.0x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1250112
                     /organism="Zygotorulaspora mrakii"
                     /mol_type="genomic DNA"
                     /strain="NRRL Y-6702"
                     /isolation_source="silage"
                     /db_xref="taxon:42260"
                     /chromosome="6"
                     /country="Italy"
     gene            complement(<9029..>10198)
                     /locus_tag="HG535_0F00140"
                     /db_xref="GeneID:59237264"
     mRNA            complement(<9029..>10198)
                     /locus_tag="HG535_0F00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289336.1"
                     /db_xref="GeneID:59237264"
     CDS             complement(9029..10198)
                     /locus_tag="HG535_0F00140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145231.1"
                     /db_xref="GeneID:59237264"
                     /translation="MFSLMLLVQLLLLWFPLACAKELLDVFTSLSTSTPNGNTPRVPW
                     AASMQFLITPSMDARAQDTFSLDLPCTLLVYGTNGGSSIDMIDQSGNSFATCELINGY
                     HTGPSRITCTLQQDVFYSPGQINFGFAWNVGQSPNSYSLQCAASFTSPRNTITWGGQS
                     TTVTINRESFYQSSGMDMSHTISASAVDTYYLGYTCSRTFSETIELQLRGSPSRTGSI
                     VSCANVDVYMTNSLNYWYMPMTAEALPSSSTVNCDVRTNTITINANNIPAGYHVFVNA
                     FQSRQFLSQETIQNTFIDTIYCRNSPNTNRYSRSWNFIRGSGNGAASMQISLPTTRTT
                     SWTGTGTTTYLTTQTSPRTTVEIIVGTPEISSTTYTPWTGTFTSTYATSTTFHRQ"
     gene            complement(<15821..>23047)
                     /locus_tag="HG535_0F00150"
                     /db_xref="GeneID:59237265"
     mRNA            complement(<15821..>23047)
                     /locus_tag="HG535_0F00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289337.1"
                     /db_xref="GeneID:59237265"
     CDS             complement(15821..23047)
                     /locus_tag="HG535_0F00150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145232.1"
                     /db_xref="GeneID:59237265"
                     /translation="MFSLMLLVQLLLLWFPLACAKELLDVFTSLSTSTPNGNTPRVPW
                     AASMQFLITPSMDARAQDTFSLDLPCTLLVYGTNGGSSIDMIDQSGNSFATCELINGY
                     HTGPSRITCTLQQDVFYSPGQINFGFAWNVGQSPNSYSLQCAASFTSPRNTITWGGQS
                     TTVTINRESFYQSSGMDMSHTISASAVDTYYLGYTCSRTFSETIELQLRGSPSRTGSI
                     VSCANVDVYMTNSLNYWYMPMTAEALPSSSTVNCDVRTNTITINANNIPAGYHVFVNA
                     FQSRQFLSQETIQNTFIDTIYCRNSPNTNRYSRSWNFIRGSGNGAASMQISLPTTRTT
                     SWTGTGTTTYLTTQTSPRTTVEIIVANPRVMSTTFTPWSGSYTSTISTSVATATGSDG
                     IPTISTLYYVETPEVNVASTTYTPWSGSYTSTISTSVATATGSDGIPTISTLYYVETP
                     EVNVASTTYTPWSGSYTSTISTSIETSTGSDGIPTISTLYYVETPEVNVASTTYTPWS
                     GSYTSTISTSVATATGSDGIPTISTLYYVETPEVNVASTTYTPWSGSYTSTISTSIAT
                     STGSDGIPTISTLYYVETPEVNIASTTYTPWSGSYTSTISTSVATATGSDGIPTISTL
                     YYVETPEVNVASTTYTPWNGSYTSTISTSVATATGSDGIPTISTLYYVETPEVNVAST
                     TYTPWNGSYTSTISTSIATSTGSDGIPTISTLYYVETPEVNVASTTYTPWSGSYTSTI
                     STSIATSTGSDGVPTISTLYYVETPEVNVASTTYTPWNGSYSSTISTSIATSTGSDGI
                     PTISTLYYVETPEVNVASTTYTPWSGSYTSTISTSIATSTGSDGVPTISTLYYVETPE
                     VNVASTTYTPWSGSYTSTISTSIATSTGSDGIPTISTLYYVETPEVNIASTTYTPWSG
                     SFTSTISTSIETSTGSDGIPTISTLYYVETPEVNVASTTYTPWNGSYTSTISTSVATA
                     TGSDGIPTISTLYYVETPEVNVASTTYTPWSGSYTSTISTSIETSTGSDGIPTISTLY
                     YVETPEVNVASTTYTPWSGSYTSTISTSIATSTGSDGIPTISTLYYVETPEVNVASTT
                     YTPWNGSYTSTISTSVATATGSDGIPTISTLYYVETPEVNVASTTYTPWSGSYTSTIS
                     TSIATSTGSDGVPTISTLYYVETPEVNVASTTYTPWNGSYSSTISTSIATSTGSDGIP
                     TISTLYYVETPEVNVASTTYTPWNGSYTSTISTSVATATGSDGIPTISTLYYVETPEV
                     NVASTTYTPWNGSYTSTISTSIATSTGSDGIPTISTLYYVETPEVNVASTTYTPWNGS
                     YTSTISTSVATATGSDGIPTISTLYYVETPEVNVASTTYTPWSGSYTSTISTLVATAT
                     GSDGIPTISTLYYVETPEVNVASTTYTPWSGSYTSTISTSIATSTGSDGIPTISTLYY
                     VETPEVNVASTTYTSRNGSYTSTASTGTTVLYDASQILSTSTHFYVETSNVNRTSTTY
                     TPWSGSYTSTISTSIATSTGSDGIPTISTLYYVETPEVNVASTTYTPWNGSYTSTIST
                     SVATATGSDGIPTISTLYYVETPEVNVASTTYTPWNGSYTSTISTSIATSTGSDGVPT
                     ISTLYYVETPEVNVASTTYTPWSGSYTSTISTSIATSTGSDGIPTISTLYYVETPEVN
                     VASTTYTPWSGSYTSTISTSIATSTGSDGVPTISTLYYVETPEVNVASTTYTPWNGSY
                     SSTISTSIATSTGSDGIPTISTLYYVETPEVNVASTTYTPWNGSYTSTISTSVATATG
                     SDGIPTISTLYYVETPEVNVASTTYTPWSGSYTSTISTSIATSTGSDGIPTISTLYYV
                     ETPEVNVASTTYTPWSGSYTSTISTSIATSTGSDAIPTISTLYYVETPEVNVASTTLT
                     TWGGSSTSTASTGTTVLYDASQILSTSANVDVGFPTSAHYCNSSRSTLQISSQPPANS
                     FQTTMSFSVSTLTPADTTQLTPTYGVTNSVESSYPLPVSSGVMFSTNSGIVTTNDGEI
                     SSNSVESSLTNSKIAETSVFTSPYSNVKSFTTYEISPSVSVYSSKSEKDSTSADNDDS
                     TGVSHTKSTSTQNNIRTSTKSEYSMVTPVQVVSSARTMPETPRVTVSVNGPSLSSGGD
                     SYTLSTVQEERSSSASLTVFSTGKFTSDKAISQSESSYYSLDIPRSSLHVTSMMVSKS
                     ESFHKSSSLVNSPTFSQKTSFVSVQNVGDHSDIFSSPSMRAASNSLTDSLLPPKSSEL
                     FTVSYHSQIGISSEGSIIATLSQTDTKPYKSDGGPRSPPTSTQTDSYFGTVRAHTSVR
                     SSIEAQNPSQNLLSGSDISSTRDEEIHVTPSYRVTSNEIPTTALRVTTLLGTESAVDR
                     RSSDLQATETSTAASSTSMSIRTFEGSAHRVKASWIFAFPLAFW"
     gene            <29240..>30166
                     /locus_tag="HG535_0F00160"
                     /db_xref="GeneID:59237266"
     mRNA            <29240..>30166
                     /locus_tag="HG535_0F00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289338.1"
                     /db_xref="GeneID:59237266"
     CDS             29240..30166
                     /locus_tag="HG535_0F00160"
                     /inference="similar to AA sequence:RefSeq:NP_014452.1"
                     /note="similar to Saccharomyces cerevisiae ESF2 (YNR054C);
                     ancestral locus Anc_6.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145233.1"
                     /db_xref="GeneID:59237266"
                     /translation="MAIESGDHSDFSSDDETSSKNFLIVSKKAGREVDAHLIDEGADE
                     KELSADFAIKSDPQEVQKGVTDEDDAKSSIQRELEKNNHKETVVTKKSSPHDKRTLNA
                     TKKLNHKTGVVYLSSIPPYMKPAKMRQILSKFGDVDRLFLRRENEQKHKQRTRGGGNR
                     KVMYEEGWAEFIRKRDAKLCAQTLNGNIIGGKKGSFYHDDILNVKYLPGFKWTDLTEQ
                     IARENDIRQSKLEKEITLANKLNAEYAKNVEISRTITNMRKSKKRSSNDDNQIHRNFK
                     QHKVSTTRADAPEHIKNTSSSNELGSVLNNLL"
     gene            <31139..>32358
                     /locus_tag="HG535_0F00170"
                     /db_xref="GeneID:59237267"
     mRNA            join(<31139..31183,31681..>32358)
                     /locus_tag="HG535_0F00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289339.1"
                     /db_xref="GeneID:59237267"
     CDS             join(31139..31183,31681..32358)
                     /locus_tag="HG535_0F00170"
                     /inference="similar to AA sequence:RefSeq:NP_014451.1"
                     /note="similar to Saccharomyces cerevisiae NOG2 (YNR053C);
                     ancestral locus Anc_6.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145234.1"
                     /db_xref="GeneID:59237267"
                     /translation="MYVLNKCDLVPTWVAAAWVKHLSKERPTLAFHASITNSFGKGSL
                     IQLLRQFSQLHSERKQISVGFIGYPNTGKSSIINTLRKKKVCQVAPIPGETKVWQYIT
                     LMKRIFLIDCPGIVPPSTKDTEEDILFRGVVRVEHVSNPEQYMPGVLKRCQAKHLERT
                     YEISGWKDATDFLQMLARKQGRLLKGGEPDESGVAKLILNDFNRGKIPWFVPPPEKGE
                     ENSKSIDAAPEDASQKVTKETV"
     gene            <32749..>34071
                     /locus_tag="HG535_0F00180"
                     /db_xref="GeneID:59237268"
     mRNA            <32749..>34071
                     /locus_tag="HG535_0F00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289340.1"
                     /db_xref="GeneID:59237268"
     CDS             32749..34071
                     /locus_tag="HG535_0F00180"
                     /inference="similar to AA sequence:RefSeq:NP_014450.3"
                     /note="similar to Saccharomyces cerevisiae POP2 (YNR052C);
                     ancestral locus Anc_6.379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145235.1"
                     /db_xref="GeneID:59237268"
                     /translation="MQPINMQAHMFPMGDQFFTHHPPNEQQPGMGMNGPQVFSPQLNQ
                     ARLLSQQPGIVQTTQGMSNPQELQNPYMLKQNMDSQLSQQQASFQHQHQHQPQQQNMS
                     INGPVGISAAAAAANRPPGLNILRQGAPGMNRPGNSHMPKQNLNNAGGASSVVLPPPN
                     HLFIREVWKNNLYAEFATIRKLAMEYNHISVSTEFVGTIARPIGNFRSKTDYHYQTMR
                     SNVDFLNPIQIGVSMCDANGNKPEDGPSTWQFNFHFDEGQEMMSSESFELLQKSGINF
                     DNHLNNGIDMFEFSQLMIDSGLLMDDSITWITYHAAYDFGFLVNILTNNCMPNNREDF
                     EWWVHRFLPNFYDLNLICKVIQDFRQQQQQQQPQQQQPQQQPQQFTLASLAEDLGISR
                     FPLFTTTAGQSLLTSLGFFQLSKLSMNKLPNGTTFETYRNLIYGINGE"
     gene            <34596..>35993
                     /locus_tag="HG535_0F00190"
                     /db_xref="GeneID:59237269"
     mRNA            <34596..>35993
                     /locus_tag="HG535_0F00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289341.1"
                     /db_xref="GeneID:59237269"
     CDS             34596..35993
                     /locus_tag="HG535_0F00190"
                     /inference="similar to AA sequence:RefSeq:NP_014449.1"
                     /note="similar to Saccharomyces cerevisiae BRE5 (YNR051C);
                     ancestral locus Anc_6.378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145236.1"
                     /db_xref="GeneID:59237269"
                     /translation="MNASLQDIVFAFLQTYYQRMSKDPSKVSALYSLTAELTHINYQV
                     EFDLGGETLPTIKLTGKENISKFFTRNNKKVSDLKVLIESCDFQTTGANHSSVLILTT
                     GEMFWTGTPTYKFVQSIILTPNPSKNDSFDITNDVVRFIADNLSPYALETIETIETTD
                     KKEIEPGEKASAAENSRMHMRTEETSKDDQSRDSTKAETGELIRDDGSDTKKPISIKE
                     EVKSNKEDRKKVNKVEDITKVKPGVQSCESAEEQNMKKENESTDSVKKKSNPDTHQTM
                     ETPTIAASPVPPVRMSWASKLAANVATSKVNPSVESTAENIKSESQVFKKPSEIKLED
                     LASRKENPGNKTMKKKTPMFSTINKDGFYPIYIKRTMGLTEDKLKSALESEFGSVMRI
                     TISDNFAVVDFETQKSQIEALEKKQLTVGENEIFFSRKTVKKPSSSPPVGSSMSLRSH
                     KKHTSYNNGSSKRKD"
     gene            <36382..>36958
                     /locus_tag="HG535_0F00200"
                     /db_xref="GeneID:59237270"
     mRNA            join(<36382..36694,36912..>36958)
                     /locus_tag="HG535_0F00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289342.1"
                     /db_xref="GeneID:59237270"
     CDS             join(36382..36694,36912..36958)
                     /locus_tag="HG535_0F00200"
                     /inference="similar to AA sequence:RefSeq:NP_010019.1"
                     /note="similar to Saccharomyces cerevisiae YCR095C;
                     ancestral locus Anc_6.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145237.1"
                     /db_xref="GeneID:59237270"
                     /translation="MLVPPANFGIAEEGIYRCSKLETLNLSFIETLNVKTVLFVGGQE
                     PSKFFKEFFNTTSIEWCLVKTTDFSSAGRPVDNANKSSTDSKENTINTDSDDFMGELR
                     PSDYSRERIEVILLKRF"
     gene            <38247..>39587
                     /locus_tag="HG535_0F00210"
                     /db_xref="GeneID:59237271"
     mRNA            <38247..>39587
                     /locus_tag="HG535_0F00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289343.1"
                     /db_xref="GeneID:59237271"
     CDS             38247..39587
                     /locus_tag="HG535_0F00210"
                     /inference="similar to AA sequence:RefSeq:NP_014448.1"
                     /note="similar to Saccharomyces cerevisiae LYS9 (YNR050C);
                     ancestral locus Anc_6.376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145238.1"
                     /db_xref="GeneID:59237271"
                     /translation="MVKRVLLLGSGFVAQPVVDSLSATDDIEVTVACRTLQKAEALAK
                     ASGSQAISLDVTDDAQIDAALKQHDIVLSLIPYTYHPNVVRSAIRLKKDVVTSSYISD
                     ALKELEPEIKKAGITVMNEIGLDPGIDHLYAVKTIDEVHRAGGKIKSFLSYCGGLPAP
                     EDSDNPLGYKFSWSSRGVLLALRNSAKYWKDGKIETVTSEDLMASAKPYFIYPGYAFV
                     CYPNRDSTIFKDLYHIPEAETIIRGTLRYQGFPEFVKVLVDIDLLKDEESKIFSGVIP
                     WNEALKQYLGANSSSKEDLIKAIDSKTNWKSNEDRERILSGFLWLGFFSETSIVPKGN
                     ALDTLCGRLEELMQYEDGERDMVALQHKFGIEWADGTTEVRTSTLIDYGKPGGYSSMA
                     ATVGYPVSIATKLVLDKTIQGPGLVAPYSPQINDPIMKELKEKYGIYLKEKTVG"
     gene            <39862..>40431
                     /locus_tag="HG535_0F00220"
                     /db_xref="GeneID:59237272"
     mRNA            <39862..>40431
                     /locus_tag="HG535_0F00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289344.1"
                     /db_xref="GeneID:59237272"
     CDS             39862..40431
                     /locus_tag="HG535_0F00220"
                     /inference="similar to AA sequence:RefSeq:NP_014447.3"
                     /note="similar to Saccharomyces cerevisiae MSO1 (YNR049C);
                     ancestral locus Anc_6.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145239.1"
                     /db_xref="GeneID:59237272"
                     /translation="MNMTATQGSGNLWHKFRSSTKSLSSSLSNLSIKGETDGDTVTST
                     VLHKAMVKFYKNQEPFTGFPGWLGHKEELPDEQKILKKQSHTSSNRISSGFSHIRKAS
                     SDNKKSHTRNPSFSNQPEHTSAGMAFHKIYHTDTPSSIPSSQLESHSQPLLNGESMKI
                     NSAPVTSNNSTMMMRERLKRQNTKSSLKP"
     gene            complement(<40710..>41897)
                     /locus_tag="HG535_0F00230"
                     /db_xref="GeneID:59237273"
     mRNA            complement(<40710..>41897)
                     /locus_tag="HG535_0F00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289345.1"
                     /db_xref="GeneID:59237273"
     CDS             complement(40710..41897)
                     /locus_tag="HG535_0F00230"
                     /inference="similar to AA sequence:RefSeq:NP_010018.1"
                     /note="similar to Saccharomyces cerevisiae CDC50 (YCR094W)
                     and YNR048W; ancestral locus Anc_6.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145240.1"
                     /db_xref="GeneID:59237273"
                     /translation="MFRRIPFLSRRKQDVEGDTRTLKKSRKPANTAFRQQRLKAWQPI
                     LSPQSVLPLLILVACIFAPIGIGLIISATNIQDLVIDYSRCGEEASRDAFEEIPSQHV
                     RYHFKKSVSTRPTWKVNDGGDNEDVCTLRFQVPNNIKRSIFIYYKLTNFFQNHRKYVS
                     SFDIGQLAGQAISAQDLDSSCDPLRISSDKAVFPCGLIANSMFNDTFSSVLAGQDGTD
                     DYILTNQGISWSSDRTRFKKTSYNASQIVPPPNWAKSFPDGYSSDNIPDLHTWGEFQV
                     WMRTAALPTFYKLALKNHTSELPSGNYSVDIGLNYPVISFGGTKSFVLTTSGIIGGRN
                     MSLGIVYCVVAGISAIFAIIFLLKVIIQPRAMGDHSYLNFQGNYENKDSSNSQRTTLR
                     EIL"
     gene            complement(<42136..>48705)
                     /locus_tag="HG535_0F00240"
                     /db_xref="GeneID:59237274"
     mRNA            complement(<42136..>48705)
                     /locus_tag="HG535_0F00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289346.1"
                     /db_xref="GeneID:59237274"
     CDS             complement(42136..48705)
                     /locus_tag="HG535_0F00240"
                     /inference="similar to AA sequence:RefSeq:NP_010017.2"
                     /note="similar to Saccharomyces cerevisiae CDC39
                     (YCR093W); ancestral locus Anc_6.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145241.1"
                     /db_xref="GeneID:59237274"
                     /translation="MQAASSELPAEIEDKDKEATRIIIAQVSLLIIALTEDNFADSEK
                     KIGHLLDKSSTVAYIKYWKKLITICSRDFGPDKKANQENNLVHRLLLKLFESIPYKAP
                     KIIDLLNLHIFYNDSFFDSIGSSAKDLVTFFNIEDHSRILFLLIPSLAIEYFQFKNFV
                     KMNNSRYFETTVLQGASTSLKVNLSQVFLSLEGENLNDMIALILSEILSPGSQGIQQA
                     PASGWFTPSNILAATEIGNIVFGCLDKIPKETMDWNRIFNLMSTKYFLMNAVKPTLAS
                     LSSLLSCLRYGYLLDQFFTCDWDINFKLELAYYVHKWNIADGCFDILTAEGTKKVTDL
                     IPNPKNSLLYLMSVATLDLELFLLRDELVNNQMLPYYQECFFEDFNYVPEYLAFALLN
                     DIKRFILLTENKNVIDEILVTLLVQVFEKTPTVLGILVRQLPDDARIVEAGKIILSKE
                     GRASADFAKILRDDGKLAYFIENVSFQESLRILPCACKLGWQNLPLHIKSHLNTETAS
                     QVLDCLDVQTRISDISSPFTSSNIFDLQSLHFLVTSLMKLPLKKEDRQRFESIQFSLI
                     ITFPRLINFGFGHDDAILGNGQLTPISNEIEKEMQDYLQKMYSGELAIKDIIDILRDF
                     RDSDVGRDQDVFACMTHAVIAESSFFRDYPLDALATTSVLFGSMILFQSLRGFVLDVA
                     FRIILGFAKEGPESKMFKFAIQAIYAFKIRLSDYPNYSRDLLENVPGLQSQPQVYQSV
                     LEASLKGRELNKDANLLSGVNPELISSKYLNVEEPKTTVAQENPPKEIVEKVLFVVNN
                     ITMDNFDVKITDLKSVLTPNYFSWFSNYLVNQRAKTEPNYHKLYSRILTSIGSDKLHE
                     RMIAVTGQQLFYLLAIKDVHSIDKNHLKNLSLWLGSITLAVDRPIRHRNIAFRELLLE
                     AYHDRRLDIIVPFVAKVLQGAAGSKVFKPPNPWTLGIVKVLVELNNKASWKLSLTFEV
                     EVLLKMLGLQMTSVMPSNFLDVENIADELSGSLGNMTLEQKHNEQQMQIIIMQQYQQQ
                     ILLSQQRQQRAASNGAVFPTDQGPIMVENSVPSDNPFSNLMGSTIFVTHPDLKRVFQM
                     AIAKSVREILLPAVDKSSSIAVVTTTKIILKDFATEVDEMKLKTAAVTMVRHLAESLA
                     RATSIELLRDGIRSTTQSLAPNIMGMPTSPDEELEAAINDNIGLAVAIIEKAAMDKAT
                     QDIGEQLMQPIVIRRYHKERRLEQPFLTQNTNPYSLKLPEPLGLKSTGVTPQQFRLYE
                     NSGKFALNVDSIANAPVHPRQQPANQQMLAQQQQQLQQQQQQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQAAVSQTAQMPMTMGQNQMSIQNPQNVNIQN
                     ELEQNHRVLVHLMDGLVLQIKENADKRSLLDLGGQNPIKAIIFQILTFIARSSQKDQL
                     ALKVSQAVVNSLFATSESPLCREVLSLLLEKLCSLSMVARKDVVWWLVYALDSRKFNV
                     SVIRSLLDVKLIEANELDNVLVTAMKSEMENSTEFAMDIIENTVISDSPILMRLDFIK
                     TLEYLGSSNDTQVKSFLERYESNEIIPVGKQVKVTRKERYFLVFTEWVKLLQRVETDD
                     ISTLVFIRQMMEKGVLSNSDSLIEFFKAALELSVFSFKESDPTGEVFTTIDAIGKLIT
                     KLLVLQAFSDISRSEYFNIVLSVIAVVFAKDHEQKYVTFNERPHFRLLSNLLYEWEVL
                     RGHDFIKISDNQTRRELSEFDQEFYDIFSTYLHSLQPIAFPGFSFAWVTLISHRMFLP
                     TMLRLPKKSGWKNLMLLLIDLLNFLDTYTSKNEVSNAVSVVYKGALRVFLGISNDNPE
                     FLIENHLEFMNNLPPSYFQLKNVILSSIPKKMMLPNPYDSNLSMEKLPACQELPEVFY
                     DPISDSSTLKKPVDNYLRIPTNSLLRTILHGIYKTEYDIKNGVGYDLLAIDSNLVRAI
                     VLHIGIEVGLENQKMPYSALFNAKSAYYTLLFNLIHEGTVELKYQVVQVMAEQLRYPN
                     IHTYWFSYVLKTMLTSKDWGEQLVDIQEIILRSLLERLIVNKPHAWGISVLFSQIIRD
                     KNINLLELPFVKNLPEIKNILAPLYKHTLSSQTYVISSNSKDSVLDRSSPNSLDASV"
     gene            <49227..>52295
                     /locus_tag="HG535_0F00250"
                     /db_xref="GeneID:59237275"
     mRNA            <49227..>52295
                     /locus_tag="HG535_0F00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289347.1"
                     /db_xref="GeneID:59237275"
     CDS             49227..52295
                     /locus_tag="HG535_0F00250"
                     /inference="similar to AA sequence:RefSeq:NP_010016.2"
                     /note="similar to Saccharomyces cerevisiae MSH3 (YCR092C);
                     ancestral locus Anc_6.372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145242.1"
                     /db_xref="GeneID:59237275"
                     /translation="MAGQPSISKFFKQVKINEYKTTVDVKNSAGRIRSELDSNADKMA
                     NEGGINPQTTLKDNIPQDATIKDCNMSNKNQAREHVIVDVDDSEEEGHSTAFQRKRTL
                     PNSFDTAAYSNNVIIKPKRQTTVNKFKDMKLTPLDQQIKELKESHLDKLLVVRVGYKY
                     KCFAQDAVIASQILQIKLIAGKLTFDNSNPQDEEFRQFAYCSFPDTRLNVHLERLVHH
                     DLKVGVVEQSETTAIKKYSKDKNKSNVFQRNVTNTFSKATYGINNTFSPRSGPILGEN
                     NSIWALSATVGPEKSRSYALISVNFSKGEVVYDSFQETSSSLEKLITRLSYLEPKEVV
                     SDGQFTIDITQCLRKRKCIIHESISNVTPNLQISETCEKLKMNEHQLKMVDLLYHYIK
                     SYGNEQILLLSSTYKPFVSNTHMLLTSNTIQSLDIFSNEGGKGSLFWVLDHTRTSFGS
                     RELKEWISKPLVNRSDIEDRLDAIQCIKGQINNLFFESLNRVLKSSPDLLRTLNRIAY
                     GNTSRKEVYYFLKQLALFANHFETHANFLHHQLESSDGKIRKNSRLLTRILTEMRDYS
                     KNSKVTHFLSMINVSAILEKDMEKQISEYFNLNNYDHSETLIQRQRQISAVKEELMDE
                     LVSIRKLLRRPHMDYKDAVDYLIEVRNTQIKDLPSDWVKVNDTKMVSRFHTPTTSRLV
                     EKLQYHKDLLLHEADEEFHRFLSRIKKEYSNLRSYLQNYAVYDAILSLAATSCNQGYV
                     RPVFTSKKQCIKSSNARNPVIESLDVSYVPNDINMNEEDGKVLVLTGPNMGGKSSYVR
                     KVALLVILAQIGSFVPADYFEVSIFDSMFTRIGAYDDILRGQSTFKVEMLDIMRILEG
                     FSKTSLLLLDEVGRGTSTEDGKAIAFSLLKYFIGRLDCPLILFTTHYPSLAGLSSTLL
                     KNYYMDYEEQRTAGESWSSVVFLYKLRPGTARNSFGMNVAKLAGIDKNIINTAFTVSE
                     CMRKESISSEKMALSFQMKKVMSSNASSNEKLVKLLHVGKQENNNAAGCS"
     gene            complement(<52403..>54973)
                     /locus_tag="HG535_0F00260"
                     /db_xref="GeneID:59237276"
     mRNA            complement(<52403..>54973)
                     /locus_tag="HG535_0F00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289348.1"
                     /db_xref="GeneID:59237276"
     CDS             complement(52403..54973)
                     /locus_tag="HG535_0F00260"
                     /inference="similar to AA sequence:RefSeq:NP_010015.3"
                     /note="similar to Saccharomyces cerevisiae KIN82 (YCR091W)
                     and YNR047W; ancestral locus Anc_6.371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145243.1"
                     /db_xref="GeneID:59237276"
                     /translation="MEDQELQSRRSPLGDRDRSLSFSKLLPRSFRRTISSASNSVSSI
                     SIQEPVETSVSPVNGADKEKGDKEKGNKESLERQQQGEEPSSPVLKEDIQSQSRSQTQ
                     SQAQAPEPAQAPAHSQGQSSRFSRFKSIFQGSSGSTEDISKTPVSYSSSAGEQITEET
                     SQSDTQSGNEPDRSHLHVTEGSPGSNQLYRRRSPSTPIMPSHLSSPNGKQKSRLDPKS
                     QSGHSSTNPFRQERDRSGTVRSNNPYFIYQGLPPHALSSQELDSSFNSTISKVPEIHS
                     PVTPGTPNTPSTQTSYIQKEHRNLSNLSLHEIKENEEVKEFYNNDDSYFTSQPKKDSR
                     PVSMTERIESPLLTPEGVQQYPSILVGFEDDEENDVNGEPLSKNDHNHSEKEKSPNKI
                     RQPTLRRAASVPDAIKDVVDSSTSHESSLPPSGTLSDLSEPKRSMRLRSKSFSNKFQD
                     IIVSPKSFEKVRLLGQGDVGKVYLVKEKRTNRLYALKIFSKAEMIKRKKIKRILAEQE
                     ILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYASE
                     VTAALEYLHLMGFIYRDLKPENILLHRSGHIMLSDFDLSIQAKDAKNPVAKGTAQSTL
                     VDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILTYEMLFGFTPFKGD
                     NTNETFCNILKNDVSFPNNNEISRSCRDLIKRLLIKNESKRLGSRMGAADIKKHPFFK
                     KVQWSLLRNHEPPLIPALTDDGYDFAKSSSNKNKTGASSKDGTSLEEQERIMFQEPVE
                     YDDEVSDDDPFHDFNSMSLMKQDSNFLIYGDNNSYGKISYTPNSNRSRSNSHKGFFKR
                     "
     gene            complement(<55285..>55689)
                     /locus_tag="HG535_0F00270"
                     /db_xref="GeneID:59237277"
     mRNA            complement(<55285..>55689)
                     /locus_tag="HG535_0F00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289349.1"
                     /db_xref="GeneID:59237277"
     CDS             complement(55285..55689)
                     /locus_tag="HG535_0F00270"
                     /inference="similar to AA sequence:RefSeq:NP_014444.1"
                     /note="similar to Saccharomyces cerevisiae TRM112
                     (YNR046W); ancestral locus Anc_6.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145244.1"
                     /db_xref="GeneID:59237277"
                     /translation="MKILTTNFLKCAVKACDKSNDNFPLRYSGSECELVQDPSIEFNE
                     EFMTNIMDRIDWDAVLSVAGDLGNTNLPSTKPLLNTAEQLSEDDLAVLRDLHVLLVQT
                     SIKEGTMTCRNCGHVYYIKNSIPNLLLPPHLA"
     gene            complement(<55909..>57285)
                     /locus_tag="HG535_0F00280"
                     /db_xref="GeneID:59237278"
     mRNA            complement(<55909..>57285)
                     /locus_tag="HG535_0F00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289350.1"
                     /db_xref="GeneID:59237278"
     CDS             complement(55909..57285)
                     /locus_tag="HG535_0F00280"
                     /inference="similar to AA sequence:RefSeq:NP_014443.3"
                     /note="similar to Saccharomyces cerevisiae PET494
                     (YNR045W); ancestral locus Anc_6.369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145245.1"
                     /db_xref="GeneID:59237278"
                     /translation="MRRGRFKLDTILSFKRWYGFTIKSNMFSKRRKAGGLIMNSQQSG
                     IGGLLWKYFNAPGNVMFVTFNIITFAGLVTFNSLISAQRRQVFELRLIEAQNNMVIQS
                     MGTLKNSTSEAIPTLKSNTKDEHVVKPKSDSPIHEYTFDEIELSSKPSRLTTYDSQVA
                     KMSLFHMMYAYFLMKHVTSNGTTNPKSILWDEEIKIIQEMLSNVDGAAKQAGRDKLLR
                     FFYSSWRKEFGSLFDNLHKSQKFHFPDWKYYPENMRYACSNLYKNDMHTIDDFAQFYE
                     SIHPKELKRLLRFWFADNLTLISPSVNGNKEDFYRTLIKDSYGDDPLFQKYSSILWNA
                     DSRKRFFFPTYADKQLRTASIDTILTVLQGYIILHEKKGIRHNAEIIRLISMIKKDCV
                     IAKNQTGKGVRIFLPTDTRTDLIDDEFEHYDRMLRDRQKCYELVSRNPKVIKLLDKIS
                     KWNETTTT"
     gene            <57575..>58132
                     /locus_tag="HG535_0F00290"
                     /db_xref="GeneID:59237279"
     mRNA            <57575..>58132
                     /locus_tag="HG535_0F00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289351.1"
                     /db_xref="GeneID:59237279"
     CDS             57575..58132
                     /locus_tag="HG535_0F00290"
                     /inference="similar to AA sequence:RefSeq:NP_010014.1"
                     /note="similar to Saccharomyces cerevisiae YCR090C;
                     ancestral locus Anc_6.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145246.1"
                     /db_xref="GeneID:59237279"
                     /translation="MLFLVVDAIMSDNIRCVSIKDNANTMAEYIFDITCTNCRETNDS
                     PVSINRYEKHEMPGSRGEASFVAKCKFCGKDISINIAQFELALLNSANADDELLGKIK
                     DKRRKRSLKTVDLKSAVLLEIDSRGSDITHFYPGNISFIVELMSGKKMEFQFEDDENE
                     WYDYDDKAEEEVSITEFKAQIIKGK"
     gene            complement(<58171..>61779)
                     /locus_tag="HG535_0F00300"
                     /db_xref="GeneID:59237280"
     mRNA            complement(<58171..>61779)
                     /locus_tag="HG535_0F00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289352.1"
                     /db_xref="GeneID:59237280"
     CDS             complement(58171..61779)
                     /locus_tag="HG535_0F00300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145247.1"
                     /db_xref="GeneID:59237280"
                     /translation="MPRSLILFLGLFVLTCCETAKGAYYANVTHSSALFDVVSGSSPS
                     SSNTGVGTAGFASTSVPHNSDGALTTGMPIHFSTFTSALCPNCLLEETGTTYNGVDHT
                     KSKSDSTLAFDFSYSIHTDLTDSAFTDTAFTDTAFTDTAFTDTAFTVQPTNTRGTGAI
                     SSISQAVSFAISTMLSVSSISNIKNSSGSQSVILSTETEVSRTAFSDQGSYFSTSSTT
                     DESTDHEGKNSVPITSISKSSSQIGNKTSTTYSLRLSTQTTSTPSTTIFSSNEINPSI
                     TSLEIASSNSEFLSGALIASGTVSNIPNYSSNTQNGNSNTSSSASRTFLSSLTATIHI
                     ETSPDASSIGSAILVSDMPSVDYATRANKTIGESAVSHLEKGNTTTSLPPSNYDLSKV
                     FAQTTIPVASLRTTTSVNNASSVVSYTTVLSTVSTTSNGVVTVYTTWCPLESTLSHNT
                     RFSGTEVESVSTAPTSNSLLTVDSYPGSTLDSNTLEAANNTSSHTISLKESTSYSLSS
                     VNVPTSSVASLRTPTSVNNASSVVSYTAVLSTVSTTSNGVVTVYTTWCPLESTLSHNT
                     RFSGTEVESVSTAPTSNSLLTVDSYPGSTLDSNTLEAANNTSSHTISLKESTSYSLSS
                     VNVPTSSVASLRTTTSVNNASSVVSYTAVLSTVSTTSNGVVTVYTTWCPLGIESTQKS
                     SLSIGSKPIGLPPTSGINLATNSVSFKQSFDTGGSSISTHREPTDISLPSVGVSASVT
                     IAVMTTTTVDAANKVISYTAVLSTVSTTRNGIVTRFTTWCPLSKLENKTYSRQSFLEQ
                     STTGYTSVETTGAHQPASITTNFQEGTAGSISGALTDSESFLSGTILITRESCSNDIC
                     EQSEKTSVRDKNQELASSTAETTSSAVKIVSTFTETICPTCTQAVPLTPTISSINRRS
                     SIAIASISSFISSKYLSSTTLVLPSPSSIIAGSVSSKTQETVYFQTSTSFKPSAESEV
                     LLNNPSTSSEFIQTSAMVKSSAQLSSNRFSQRQPPNQQSSSLQISASITTEYATETSS
                     SSNPSDQPRRPQLSSILSFDNPSLTILTKSTHSSGTSVHFLTTTEHERSKVSNSISTG
                     TKYIDTRSVLESESLRSPTSVASGAPTSTITIPFTVTTSNSQSSVTLLTSSGSTIITS
                     ASSPKYHGAGSSVSAMSSGGAGTTISNVVPLSQYTGSAVRLVPDLFYAYLALLAIS"
     gene            complement(<62189..>63961)
                     /locus_tag="HG535_0F00310"
                     /db_xref="GeneID:59237281"
     mRNA            complement(<62189..>63961)
                     /locus_tag="HG535_0F00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289353.1"
                     /db_xref="GeneID:59237281"
     CDS             complement(62189..63961)
                     /locus_tag="HG535_0F00310"
                     /inference="similar to AA sequence:RefSeq:NP_010012.1"
                     /note="similar to Saccharomyces cerevisiae ABP1 (YCR088W);
                     ancestral locus Anc_6.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145248.1"
                     /db_xref="GeneID:59237281"
                     /translation="MALEPINYTTYSREIEQEYLKVVRGVDEDTTWLIISPNTKKEYT
                     PEYVGSDFSEFLSMFEETKVQFGLARVSPPGSDVKKLILIGWCPDLAPLKMKASFAAN
                     FGTVANQLLKGYHIQVTARDEDDLDEAELLQKISNASGARYSIQMNDKKPVNRPANSN
                     RNFAKPVPGPAPQRERNVGTEAASPVTAASNVKSTSAGPPQPTKKPVSNDVDDWDEPE
                     VEERDFHEKPLKPSASSYRPVGKIDLQKVIAEEKAREDPRLVSAMHVSKKIAPQDDIT
                     NLKEQSKLKRDQEMSAFLGTKPLKAGPAPQKNDDMTIKGFKNEKTPAQLWVEKKAAEA
                     AAASGSKSTLYGNLQQEQEPQQSKSDVQDYNEEADVNDLKSKFEKLSSNAEPAIITPK
                     RVDETPIPKEDVYTAVKSDTSQFGRPLPGMHVEVSNEENEEVDEEDEWDEEEASPAPA
                     LPSRSSYISQEEKQKQPIQKEEPVEEEPVEEEPVEEEPVEEEPAEEEPAEEEPIEEEP
                     PSLPLRNFPPPPARKSVEPTKPALPSAIATYDYEAGEENELTFKENDRIIHIDFVDED
                     WWLGELEETGEKGLFPSNYITLEN"
     gene            <64650..>65084
                     /locus_tag="HG535_0F00320"
                     /db_xref="GeneID:59237282"
     mRNA            <64650..>65084
                     /locus_tag="HG535_0F00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289354.1"
                     /db_xref="GeneID:59237282"
     CDS             64650..65084
                     /locus_tag="HG535_0F00320"
                     /inference="similar to AA sequence:RefSeq:NP_010011.1"
                     /note="similar to Saccharomyces cerevisiae YCR087C-A;
                     ancestral locus Anc_6.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145249.1"
                     /db_xref="GeneID:59237282"
                     /translation="MVTFNCEVCNATVPKKNTEKHYYRCPDAYYTCIDCSKTFEDGVS
                     YKQHTQCISEDQKYQKSLYKGKKPKQKEQAPVKKVEEKEKTGKPTVESKVSKSDSKKS
                     TFPAMKSGESLYKILKTVKDKDTKKKLLKSLVVSEQGSLVLQ"
     gene            complement(<65103..>65648)
                     /locus_tag="HG535_0F00330"
                     /db_xref="GeneID:59237283"
     mRNA            complement(<65103..>65648)
                     /locus_tag="HG535_0F00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289355.1"
                     /db_xref="GeneID:59237283"
     CDS             complement(65103..65648)
                     /locus_tag="HG535_0F00330"
                     /inference="similar to AA sequence:RefSeq:NP_010009.1"
                     /note="similar to Saccharomyces cerevisiae CSM1 (YCR086W);
                     ancestral locus Anc_6.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145250.1"
                     /db_xref="GeneID:59237283"
                     /translation="MDSLTQYRDSIKERLDNADLLVAKLVHENTVLTQTVETKTQEIE
                     GFQQQIHGLEEKVRELTSLQAKQEENMEIVKDLFEHLCGVRVHKSYEDDTGLWFDTSQ
                     GSKNGIMDYKLGFVKSESFPGTEVIYVPLLKQRTSDELRILQNQIPAYMFDTLSFPLK
                     ALHQFYSKMARCLNKKVNENN"
     gene            <65735..>67942
                     /locus_tag="HG535_0F00340"
                     /db_xref="GeneID:59237284"
     mRNA            <65735..>67942
                     /locus_tag="HG535_0F00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289356.1"
                     /db_xref="GeneID:59237284"
     CDS             65735..67942
                     /locus_tag="HG535_0F00340"
                     /inference="similar to AA sequence:RefSeq:NP_010007.1"
                     /note="similar to Saccharomyces cerevisiae TUP1 (YCR084C);
                     ancestral locus Anc_6.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145251.1"
                     /db_xref="GeneID:59237284"
                     /translation="MPHYSFYAIIAVLKPIYKILYKIGKKQLNLSHSICFFSTGNRSK
                     GHRVNQAKMSSIVASSQTKLNELLEAIRLEFAQVSQEATSYRLQNQKDYDFKINQQLA
                     EMQQIRNTVYELELTHRKMKDAYEEEINRLKIELEQRDRRLASFTVHHQQQAQQQQQH
                     QLLHQQQAQQQQVQTAAPNTTVSGPSSFAAGSPASGTAGSQMPPQPTLPAVAATSNQS
                     PSLAPAPAASTTAAPSTPGFSGSAAPAQTPAPSGTGNESQAQTTLQKAGTSILPSTSP
                     LPQQEQLAKITKAEVTSKEMQKTQSKQTGSEGGDLPQEHYVVPYADRASHAKPIPPFL
                     LDLDSQTVPSHLKKQTNDYFVLYNPALPRELDVELHCSLDHTSVVCCVRFSNDGEFLA
                     TGCNKTTQVFKVSDGTLVARLSDDAATQINEQNDDNGNGEETNNDANFAASKSASTDL
                     YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVS
                     GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGF
                     LVERLDSENESGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRSGSNDSNTNGKP
                     TPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTVTGNPLLMLQGHRNSV
                     ISVAVANSFPLGPQYGVFATGSGDCKARIWKYTKKENGTEGDVNQPKVKELKE"
     gene            <68685..>69626
                     /locus_tag="HG535_0F00350"
                     /db_xref="GeneID:59237285"
     mRNA            <68685..>69626
                     /locus_tag="HG535_0F00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289357.1"
                     /db_xref="GeneID:59237285"
     CDS             68685..69626
                     /locus_tag="HG535_0F00350"
                     /inference="similar to AA sequence:RefSeq:NP_014001.1"
                     /note="similar to Saccharomyces cerevisiae RCE1 (YMR274C);
                     ancestral locus Anc_8.832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145252.1"
                     /db_xref="GeneID:59237285"
                     /translation="MVEFNAFWLSLYISGSYVAAIYSTTKQAEDYPSGRDDPRVIKSR
                     IQRVCFITLINAIKIPWILHSQVEQLSYREAFLNLGLIPGYYRKGNWDITTYIHDICK
                     GMALMAFLYVGPLLDSLLYLVFVTRGTGLKEFSDEVFSIWGLRNYFFAPFTEELFYTS
                     MLLNTYLALKPDTGLNFRLLIWQTPLFFGLAHAHHAYELLEQGILGWPTILLNTICQT
                     AYTTLFGTFTNYVYLRSGGNLWSCIVIHAICNYMGFPESSRLHMHFTVVKKPENIHVR
                     RLVDLWKKCYLVLLLMGILFFKNQFDALTQSKWNLGV"
     gene            <70033..>72870
                     /locus_tag="HG535_0F00360"
                     /db_xref="GeneID:59237286"
     mRNA            <70033..>72870
                     /locus_tag="HG535_0F00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289358.1"
                     /db_xref="GeneID:59237286"
     CDS             70033..72870
                     /locus_tag="HG535_0F00360"
                     /inference="similar to AA sequence:RefSeq:NP_013598.1"
                     /note="similar to Saccharomyces cerevisiae ZDS2 (YML109W)
                     and ZDS1 (YMR273C); ancestral locus Anc_8.831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145253.1"
                     /db_xref="GeneID:59237286"
                     /translation="MDSNYGTGEGIVLRGQSTNRVSLREKRKSEVLIAAKSLDNEVQN
                     VKNLKRISIGSIDLLMDPELEYRVNATSSTSIQNKNRNSWSSGSSSGGDIEENDRPDV
                     NDSNSGKGVALHTVQSEDSFENSFEATTAEYLDNEHGNSESEENKLVHSQELEPSPFP
                     ANRDLSGVGSLRRGAHKVPTRRPSSNRTSNSNTSSSTSLTQNLLWVPADQHPNVKPEN
                     YLELVQDTLHNIKLEDKTDHLVETNANKENLDVLDKLPADFSRKHESLVRRPSGLRKS
                     YTEFENELDVDSEIEWQTRPRSSTDPARPISLKDITEELTKISNKAGLTDSDAVTLAR
                     TLSMSGSFGDDESLTNKSRTENTNSKLAASVNEDDEFASNMFMKHGFVIPARSSLRRS
                     KFNTYRKRTMEGTLQSDRHTENSGNAACDPISNHKHLEMEPKVISDRSSLHVEETEQK
                     KENVSLLTNLVESNSSITSPSAASDFQDLYDHYRQSSIDWQKEGEQKSEENAQELIED
                     NTCLKNVRNESRDSPQKKNDWPWMNDMESEKTSPNAKQLTENNDVKSFDDDFIKATKH
                     SEQEFERLAPIRSNHSKNRHQPILLQKDSKPSPKKTPDNASKNKHSEESTALSNFINS
                     STSDKRQRLEMKFVSLFKRKGKSKSKSVSSTSKKHPHSEPKGKVSSQIGPDEAEGREL
                     QEEMPVFSRNSKNTSKIKSESKSENRLRSVPHDYASIHKSNQDKEELPALKPAVSVAS
                     TKNDIHVSNTLVGPQSDVVIESVQELDGDDSQDTSLDQSYNMHTEPLLVEKDLKQEKS
                     IISNPNDNHGPPAAVLPPRKLRFEDVQKPEKPNAPIQFSDSAFGFPLPMLTVSTVIMF
                     DHRLPVNVERAIYRLSHLKLSDPKRELRQQVILSNFMYAYLNLVNHTLYMEQASQDQS
                     MISLEEDESNAGSAYRTEHNAADGAICIPEI"
     gene            <74887..>75216
                     /locus_tag="HG535_0F00370"
                     /db_xref="GeneID:59237287"
     mRNA            <74887..>75216
                     /locus_tag="HG535_0F00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289359.1"
                     /db_xref="GeneID:59237287"
     CDS             74887..75216
                     /locus_tag="HG535_0F00370"
                     /inference="similar to AA sequence:RefSeq:NP_013599.1"
                     /note="similar to Saccharomyces cerevisiae YML108W;
                     ancestral locus Anc_8.830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145254.1"
                     /db_xref="GeneID:59237287"
                     /translation="MSSADTMYRMMILLEESINDEERKEQEELSGKEVKKTHEFVEEL
                     LMPFHIDELDILNVWFDKFDKEICIENEGHIKYEITSDGLIVLILDKELEALIERVKQ
                     FVEENSS"
     gene            <75852..>77000
                     /locus_tag="HG535_0F00380"
                     /db_xref="GeneID:59237288"
     mRNA            <75852..>77000
                     /locus_tag="HG535_0F00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289360.1"
                     /db_xref="GeneID:59237288"
     CDS             75852..77000
                     /locus_tag="HG535_0F00380"
                     /inference="similar to AA sequence:RefSeq:NP_013999.1"
                     /note="similar to Saccharomyces cerevisiae SCS7 (YMR272C);
                     ancestral locus Anc_8.829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145255.1"
                     /db_xref="GeneID:59237288"
                     /translation="MPGDQSKTLELFSQEQFAKHGNADDCWVTVSKRKIYDVSKFLKE
                     NPESANLLLQHAGTDISSVLEEQNDLKDLEKLLDEKYLVGYLATMEEEKKLLSNPDHK
                     VEVKLTKNDGDNFDSTTFVPKLPTEDKLSIATDYSQDFKKHHFLDLNKPLLPQVMFGT
                     YTRDFYVDQIHRPRHYGQKSAPLFGNFLEPISKTSWYVIPLVWGPVVIYHFSVALKHM
                     NPIFCVFFFGLGLFVWTLIEYGLHRFLFHLDDILPQHNIFYTLHFLLHGVHHYLPMDK
                     YRLVMPPTLFLVLCTPFYKLVFGLLPLYVAYAGFAGGLFGYVCYDLTHYFLHHSKLPR
                     FARKLKKYHLEHHYKNYQLGFGVTSWFWDKVFGTYLGPSSPISQMKYE"
     gene            77377..77448
                     /locus_tag="HG535_0Ftrna4Q"
                     /db_xref="GeneID:59237890"
     tRNA            77377..77448
                     /locus_tag="HG535_0Ftrna4Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAG"
                     /db_xref="GeneID:59237890"
     gene            complement(<77523..>78545)
                     /locus_tag="HG535_0F00390"
                     /db_xref="GeneID:59237289"
     mRNA            complement(<77523..>78545)
                     /locus_tag="HG535_0F00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289361.1"
                     /db_xref="GeneID:59237289"
     CDS             complement(77523..78545)
                     /locus_tag="HG535_0F00390"
                     /inference="similar to AA sequence:RefSeq:NP_013600.2"
                     /note="similar to Saccharomyces cerevisiae PML39
                     (YML107C); ancestral locus Anc_8.828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145256.1"
                     /db_xref="GeneID:59237289"
                     /translation="MDSLSHGRLQSLFGMMLRDSEGDKGRNLRMILGTPETRRIIKKW
                     KYRTKNCERATSRNAFLPEKLQKLQPLYYNVSEIVGKEYKGLQLYSLEQALERLNSIV
                     VGTNCVLLSWDDKWINELSLASKGWKFHSLAGETPNTLVLLCSCGRCDTKIYLDLHST
                     ENHNNDNVQNLINERYWEDIVTKSRPSQCPWVSNQFDLSDYHLKEANLIHDITRMQGH
                     ETVHFGTSGEITHNSTPLFSQEQLFSLSEFFKCADKRKLELMLRGFIPVEGCNDAVIC
                     VRCFRKAFIGSITGSDYLNPHAPWCRYHDETKLPTMITSQLLSAKKTDDIKKRLSDLE
                     NYFESV"
     gene            <78985..>79659
                     /locus_tag="HG535_0F00400"
                     /db_xref="GeneID:59237290"
     mRNA            <78985..>79659
                     /locus_tag="HG535_0F00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289362.1"
                     /db_xref="GeneID:59237290"
     CDS             78985..79659
                     /locus_tag="HG535_0F00400"
                     /inference="similar to AA sequence:RefSeq:NP_013601.1"
                     /note="similar to Saccharomyces cerevisiae URA5 (YML106W)
                     and URA10 (YMR271C); ancestral locus Anc_8.827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145257.1"
                     /db_xref="GeneID:59237290"
                     /translation="MPMVLEDYQKNFLDLAIESQALRFGTFTLKSGRTSPYFFNLGLF
                     NTGKLLSNLATAYAIAIIQSDLKFDVIFGPAYKGIPLASIVCVKLAEIGGSKFQDVQY
                     AFNRKEAKDHGEGGNIVGATLENKRILIIDDVMTAGTAINEAFEIIANANGKGVGSII
                     ALDRQEVVSTDDREGLSATQSVSKRYGIPVLSIVSLTHIIAYLDGRISPEEKSAIEQY
                     RQTYGV"
     gene            complement(<79918..>80718)
                     /locus_tag="HG535_0F00410"
                     /db_xref="GeneID:59237291"
     mRNA            complement(<79918..>80718)
                     /locus_tag="HG535_0F00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289363.1"
                     /db_xref="GeneID:59237291"
     CDS             complement(79918..80718)
                     /locus_tag="HG535_0F00410"
                     /inference="similar to AA sequence:RefSeq:NP_013602.1"
                     /note="similar to Saccharomyces cerevisiae SEC65
                     (YML105C); ancestral locus Anc_8.826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145258.1"
                     /db_xref="GeneID:59237291"
                     /translation="MPKIEEIDDYDDIDNLEMDLAELDPSLRTPIAPKIVPSVVRSQD
                     QEDGRLASQDIPASNSNQVAFINPETGKVDSSTQISKEEMDEFKKFQLLYPCYFDKNR
                     SHKEGRRAPRMLSVANPLAKTVADAVRSLGLLCIFEGEKSHPQDFGNPGRVRVLLKEN
                     GQLVSSAKAFSGGKKQLINKIGEYLIKHPTRIENLREIPYGPDFDDIEFKKIPLVGGF
                     KMNEIVPLHSAYLMGHPMTKSIYETAAPVDTPEKQFKPPKNKYKVIRR"
     gene            <80908..>81978
                     /locus_tag="HG535_0F00420"
                     /db_xref="GeneID:59237292"
     mRNA            <80908..>81978
                     /locus_tag="HG535_0F00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289364.1"
                     /db_xref="GeneID:59237292"
     CDS             80908..81978
                     /locus_tag="HG535_0F00420"
                     /inference="similar to AA sequence:RefSeq:NP_013997.1"
                     /note="similar to Saccharomyces cerevisiae RRN9 (YMR270C);
                     ancestral locus Anc_8.825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145259.1"
                     /db_xref="GeneID:59237292"
                     /translation="MSDIDDGDSLTGNQNIIDKATIDGANDLLNVLEQSHRSDLSLHL
                     YSSYLLKHLLYKANEKKHWLEIDQFVRTQIKNNWTSWPSPKTVISPGTDLLYEDIVVA
                     GQHERKQEQDYAQGTIKPGEVSHRALIHSKNMLRLELDSYWQHCFVQSSAKSGEVLDI
                     DKMFIPKSVSDEVINKIDSLLSGLHSRMAQMNKIEIRQDQVSHNVTITQAQNETVKVK
                     KIPKLTYRDIISQGCEMGEDMVEIYMKSLELYNDFPSKLKKNQYKLPKSVLRKYGPAK
                     KGKSGIHKLMRSREQFLDVYKLLQDKRLSAQDKAALKKLSNSVTENAIDKKTFFKIKG
                     FPTDEHTEDLYELDDCLAKVPT"
     gene            complement(<82008..>85424)
                     /locus_tag="HG535_0F00430"
                     /db_xref="GeneID:59237293"
     mRNA            complement(<82008..>85424)
                     /locus_tag="HG535_0F00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289365.1"
                     /db_xref="GeneID:59237293"
     CDS             complement(82008..85424)
                     /locus_tag="HG535_0F00430"
                     /inference="similar to AA sequence:RefSeq:NP_013603.1"
                     /note="similar to Saccharomyces cerevisiae MDM1 (YML104C);
                     ancestral locus Anc_8.824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145260.1"
                     /db_xref="GeneID:59237293"
                     /translation="MVENAGIFTYGIYIGAIIILFQITYQRAYDIIKWTSLISLIYAF
                     LFISFEEIERPPVKTLRRLKKLEKADEKELSSSEDTENSYVDSFFESYPEASEEIEQI
                     VDLLIQNFILSWFQSIDANPSSRFPLVIKKIILETICRLQKRLSGVDEADFVALKLLP
                     LLTKYFRIFCIAREAVLIDDSSSKSGLSNTNLKVAVQFNKYLKMHSGLSLRLSCQSSD
                     IENHVRTKVDRLLPYLISEKELNSPYVSILLREILSTSIIGPLVLKFSDPDNWNTILI
                     SICEKKLEERDQVLEVRRILSNEVELRRFCSRHNGEFERLLEMGLEFEIGHSEKYFED
                     FLRQLSLLDSAFHLWAVRHFLLSNVLMLQDKKMSPQEIEELKRRTSLSLKLIQTRLTY
                     VDSINNIGSFTSSINPESQQSDLNQILESFVASIQLISFDDILAEPMCLIYFESYLRS
                     HPYHYGISYLRFYELVEKMKTPLEDSRDITVTFPPSEINELREAAEKFNRLDDLRVLD
                     PGLVSNIQLFVSRTTSNDDQTVMLARRSMLLLQNEAKKALSKEFFEAFKDSKTFIGMV
                     SDPEFIGTDVFSKLLDLPENNTFREFGTSMAPKKSIPGAHIGDALDNILKVASRRRKK
                     SENQISDIEVIFGDEEGIPKPLSEDSLFGDLANNETDKAPTENSEEDHLSEDSFPKEF
                     SPPNLSGSRVERSFVDLEARIAYLTIAVDQIEKELRLLDHLLLKAELTNNQQQLKLLK
                     KSQRALVRDLENKELLRQQYSVQEDANSLFKKTKISIKSYYVDQPLKNQREVTYYLIN
                     VTHINNNLVTSWEIPRRFSEFYSLNLELKRKYKSLMKHLQRKEIFPEKIKISLRYHVS
                     KSLLYEERKAKLEKYLLELLSIPEVCQDGMFRRFLTNSALFSGERDEQAEQNDASDLE
                     SSTASLNHCMDIDLNGIPATDVQRRKIDPLNDEDLDIQSDVGHKVYTNCDVRNYEEKS
                     YVRSVCDFFISVFSLNKNNSGWLRGRAILKLLQQLLGTAADKYIKDTLKRLTSEEQIT
                     DVLRGFRTYLSSPNGFLAKRKLPKEVRTDGDIKRARNDSRLLIQRLFIEVFAKVVGFR
                     NAQNAAVNIHEMLQNSYINASLLLEILDVTLNEVFFNEKIKSQKKDGNAI"
     gene            complement(<85851..>86390)
                     /locus_tag="HG535_0F00440"
                     /db_xref="GeneID:59237294"
     mRNA            complement(<85851..>86390)
                     /locus_tag="HG535_0F00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289366.1"
                     /db_xref="GeneID:59237294"
     CDS             complement(85851..86390)
                     /locus_tag="HG535_0F00440"
                     /inference="similar to AA sequence:RefSeq:NP_013996.2"
                     /note="similar to Saccharomyces cerevisiae TMA23
                     (YMR269W); ancestral locus Anc_8.823"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145261.1"
                     /db_xref="GeneID:59237294"
                     /translation="MDSKEYLKCFGWKEGEALRTGGLKKPILVKHKRDKKGLGCAPGQ
                     DDSEAWWERIFDGQLKGLEINAGTKTHGISFNQKKVVASGHSKESSPLYRRFVRGESL
                     KGTIEDQDNDPLPQLIVFKGSKRTSGISDEKRLLKKRKKEKREKKEKRENRGKTEKKQ
                     KKKDKKTSKVQKKESKHKK"
     gene            <87457..>88725
                     /locus_tag="HG535_0F00450"
                     /db_xref="GeneID:59237295"
     mRNA            <87457..>88725
                     /locus_tag="HG535_0F00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289367.1"
                     /db_xref="GeneID:59237295"
     CDS             87457..88725
                     /locus_tag="HG535_0F00450"
                     /inference="similar to AA sequence:RefSeq:NP_013995.1"
                     /note="similar to Saccharomyces cerevisiae PRP24
                     (YMR268C); ancestral locus Anc_8.822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145262.1"
                     /db_xref="GeneID:59237295"
                     /translation="MKRSLDVEPTGPRKQVDINENRKRELTTVIVRNLPKSYNQTKLR
                     KYFQDCGRINQVDVCEALSKDGRLARIEFTSYNEVLTALTKTFSKIGNNEIQVEPLVD
                     CTIWMTNFPPQYTARDIINLLRRIDILTVSVRLPSLRFNANRRFAYVDLTSQDDVNRA
                     VSQLNDKTIQSYRLVVKKSNLLDISKRTDSAVLERREIMIRHLNLEQITEDRLKEIFS
                     TYGAIETVKVPHTGDRQHTDGYAFITFKEKSSADESLKADQTTLDGQQINVKLSDRKE
                     YLERQKVKRILFNKSQNDSIISLFPLSDHISKAQIESLLTEKLGLNANDMENLYLVSD
                     YEGALIVLKEAKLAAKCLMSLNGTEFKGRHLHCGTVRDLKDHDRNRKATAKSHFVNAS
                     RDHFIQTTLRDTNSSPKLSNEDFRKIFLNK"
     gene            complement(<88785..>93665)
                     /locus_tag="HG535_0F00460"
                     /db_xref="GeneID:59237296"
     mRNA            complement(<88785..>93665)
                     /locus_tag="HG535_0F00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289368.1"
                     /db_xref="GeneID:59237296"
     CDS             complement(88785..93665)
                     /locus_tag="HG535_0F00460"
                     /inference="similar to AA sequence:RefSeq:NP_013604.1"
                     /note="similar to Saccharomyces cerevisiae NUP188
                     (YML103C); ancestral locus Anc_8.821"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145263.1"
                     /db_xref="GeneID:59237296"
                     /translation="MEIQLDLSALSFVDVEYFIRSCPVDRAFAEPSFDVVNKFLITNK
                     DIFCATEIFNTSGIDNSEKDPKMVTTLNLRGIEYKGITKESCEEAFFFSKCLCLSLDE
                     CLRIITQIKQKRHSEIPQMQLAKYIFQERNATLKTISLLLDSVGSSELSDEPINFVLK
                     NKLKICESLIGTLNKLLQEVGEDKCIQWKNLNAQERKNLLQLKNTQNLIYVVNILRLL
                     TMLVLNVQLPVGIVKSWFHLLRDTRENVFFMLDPSSLIPNPVSVKIESLITINTLLIL
                     GLNSTSSTIDVETPYYKDEECFQEIHKTLEQNHISPVIIYMWSFVLFVKSFTLEEEPE
                     RELNFVGKVFGKIPISELTALFASRAEQAGVFEAIIGMSKSLSNDKFSSVIIASFLSF
                     AMHFIPLTVQTSRVIKTVLLSIPEEFVEQFLTSSEFEKKLSILKAKLPMIDDALLPLV
                     NISTAHIHFANFEWKNLQTYTCKQKLGELDYDIVDDDPVSLDMDVIVLKKEAFAHPPL
                     EFDQTVLMPIPEETRGKILPVSGNNEDVIAFIYAYNGWTVLGRMLQNICDYYVGGGIE
                     LENTIKDITVALIELVSKVVSPKIPLERSMEIVQYLSTNVADEDVLSLILKIFEHSLH
                     NRNYEVISVCSDFLTSLTPNYQHYVWSHLARSDLLDKYGKTGLATATLGSIELPYGEY
                     SFTLSLIKLTEEVTADSFSMDNEFSSKTKMDMLERLITQLIDISESYQYWKYSDINQR
                     FEIGFRLNSLFSKVLYNVYAIDPLSAPKQKVASILSGCSLKILNAYLTPQSPDVPAVS
                     SLLNALLSIQNIQISLLGDQAFSPIFTQLVKSSFELATLLISIRGQLKMKPSCLERLI
                     YTKSPELVEIYCQFSTLKRHVIRLFHSVVRVPWTDNYLFLLSYLGAKHSDIFLDSISS
                     DLEGPLANHKLSKDLYKFFGALMESKQDGLSILFLTGNIASRSNQDPVDKPRKRKSVL
                     SVLKENALKLDLLPESVGCCLLDSISYAFNTWANARDSKADEKFILALLKRVKDFKPV
                     SASSEEEMMLAAGRYKLISCILEIIALYLFTSTDIDSHIFQLLNQPDLAVLLGPFFNI
                     NGYNRHLHESLHQMFEKKWPKLKLSKFCASHLYQLDVFSLDSIFAISLMDQYFGDDEK
                     WIGTKEDRGYRAEVIAASINLKYVNCQIAAAKAWGALLTTFIKKTTKRLNDTFLDLAS
                     NFLKLNIESGIEASIFTDVYCERLELCFYILYSFQKKSEPIPEKTLHHILSLLTSVFK
                     SEEVRYIHNVSHSTKRDYYRPILRSVLLVLGSVTTGTHFLELEADQLLEFFEISFCKG
                     VQLIVSEILCDIGSSTSNGKQVVIFNIGERIQDLFLLLSLFTKIRTLNPTANFNIIMA
                     SSLNESGTLKAVLNLYSSSHLFNVNSEAILGSLILSFISELCTVDPIATKFINSGLFA
                     TLLESPLSIAIQDGGIKLEQQGSLHSIWTNGLLSIILLLLSKFGNKLLPECCLFISYF
                     SKQIETAIYRWSDSKLAVSTALIRETSQLILLQKILQNLNYQKYLSNSGNIISLTDEN
                     SEVELVIGLDTEEARKSLNIALKRLLTHPKYLNSRVVATTIEEQRLLDDDAKRGDFVR
                     EVSKNIEEMQASLLDD"
     gene            complement(<93907..>94833)
                     /locus_tag="HG535_0F00470"
                     /db_xref="GeneID:59237297"
     mRNA            complement(<93907..>94833)
                     /locus_tag="HG535_0F00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289369.1"
                     /db_xref="GeneID:59237297"
     CDS             complement(93907..94833)
                     /locus_tag="HG535_0F00470"
                     /inference="similar to AA sequence:RefSeq:NP_013994.1"
                     /note="similar to Saccharomyces cerevisiae PPA2 (YMR267W);
                     ancestral locus Anc_8.820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145264.1"
                     /db_xref="GeneID:59237297"
                     /translation="MIAWSLPRMKLNERPIARLKQINHILNPQRGFSSVKQGSKYSPN
                     FKQYLKLPNGETGSFFHDVPMDLNLKDRTAQMIVEVPRWSNGKFEISKDLEYNPIVQD
                     MKKGKVRFVHNIFPYCGYIHNYGAIPQTWEDPTENSRNGGLESLAGDNDPLDCCEIGS
                     SILQTGDIKTVRILGSLALIDDGELDWKIIAINVEDPISSQLQNLNDVNKYLPGILEA
                     TREWFRDYKIPDGKPSNSFAFNGQYKDVADTIEIIQDCHDSWKKLVSGSKENEDFKGL
                     PQIKRAGADFAVKADEQPAQPIPKDIHKWWYI"
     gene            complement(<95418..>98105)
                     /locus_tag="HG535_0F00480"
                     /db_xref="GeneID:59237298"
     mRNA            complement(<95418..>98105)
                     /locus_tag="HG535_0F00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289370.1"
                     /db_xref="GeneID:59237298"
     CDS             complement(95418..98105)
                     /locus_tag="HG535_0F00480"
                     /inference="similar to AA sequence:RefSeq:NP_013993.1"
                     /note="similar to Saccharomyces cerevisiae RSN1 (YMR266W);
                     ancestral locus Anc_8.819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145265.1"
                     /db_xref="GeneID:59237298"
                     /translation="MSEGGVSTQQVLTSLIANGVIFGAFLSVFLLLRLKLKRNYEPKS
                     TYDLISDEKKPEPLPPGLWQWFLPLLKKSDNFLIQQAGLDGYFFLRYLFLICAYCSIS
                     ALYIFPILFAVNATNENGQNGLDVLGFQNVNRPGRYYAHVFCGWVFFWMFMFVVYREL
                     YFYNSLRQAVLSSPRYASKISSKTVLFQTVPQQYLSESEFSKLFDGVKRVWIARGGHH
                     ELEKKIAQRDDLVNKLENALNSYIKKAIKQVGKLKKKNPEISISSDITQYVPEKDRPT
                     HKKKPIIGQKYDTIKYATENIPLLNREIETMQADSINADPFNSVFVEFESQYQAQVAS
                     QVATYHVPLALAPAYIGIEPDQVVWLNMRMFWWERIARNLGGIAIIIALLCFWSIPVA
                     FIGMISNVNYLIDQLHWLEFLRKLPEDLFGLLTSLAPTVALAWLMSFLPTFIRMVAKF
                     YGCASLQLVEYFAQQSYFGFQVIQVFLITTLSSSVTSTAVQIAQTPTNAMGLLAGNLP
                     KSSNFFISYIILTGMSISSGTLAQIIPVFFYYVFGYLFDNTPRKKYSRFTDLDAPSWG
                     TTFPVYTNLAVIIFAYSVISPIILLFGAAGFFLLYVAYLYTLMYVQKEAPDLRGICYP
                     RALFQTLVGVYLGQVCLLGLFSVGKGWGPIVLQVVGIIVTVLLHLKLNDAFDSLMHYV
                     PVDTMKPLDGKSDTPSFKNIYREESSEDEIKELPRFSIRKYEPRNSMAQTDKMSSLIS
                     DRTIEIASNTKYNEKSENHITWVPLLADGPSGTIPHAPFYKRFFLPHIYYSYKAVKAK
                     LPEIYGLADPDLNTSEEDLASAYNYPAINAKCPSVWIPRDPYGFSLHQVDELNTVVDI
                     SDVNATIDGNGNIWWKAGPPSAESIYDDDPFSDENVTPL"
     gene            <99712..>101016
                     /locus_tag="HG535_0F00490"
                     /db_xref="GeneID:59237299"
     mRNA            <99712..>101016
                     /locus_tag="HG535_0F00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289371.1"
                     /db_xref="GeneID:59237299"
     CDS             99712..101016
                     /locus_tag="HG535_0F00490"
                     /inference="similar to AA sequence:RefSeq:NP_013992.1"
                     /note="similar to Saccharomyces cerevisiae YMR265C;
                     ancestral locus Anc_8.818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145266.1"
                     /db_xref="GeneID:59237299"
                     /translation="MPEESHSALLKWNSCSALLDIPKKPNKAIKRIHIYDFDNTLYNS
                     PHPNAELYVKSMLNQLSNSSIVPNKSWWNETKLLKQSFDDMLECNAKQKKAYWNEDII
                     KLANLSHDDPETVSIMLTGRKEHLFAAIFTDMFLASNNVKFNAYCLRRESVGSSTNDY
                     KIVVIRELLENYSSSLEEIKLYDDRLSQTRRFESLFASLNPTYEWKVIHVPARFKLLR
                     PEDECRIIQATYSTLEAYPNISLEWTPRQCGYFLTRQSYGTLLRFTYCFLKKKYKMSL
                     LPYYPLFIPMVEAGHSVPETELIKIFSRNDAKVDGKLLDEDEIRKTFENQPNLKGSCF
                     THFDVVQIGIKEKNGGVNVLYKARPTNREGYEWSSFHEWLVTVDNRMDKKDAFQSFSV
                     HEILYDPAAAPSFNWVHLRKPLKIKTFVGHHSRLTLSSGKKM"
     gene            complement(<101621..>104026)
                     /locus_tag="HG535_0F00500"
                     /db_xref="GeneID:59237300"
     mRNA            complement(<101621..>104026)
                     /locus_tag="HG535_0F00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289372.1"
                     /db_xref="GeneID:59237300"
     CDS             complement(101621..104026)
                     /locus_tag="HG535_0F00500"
                     /note="Rover"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145267.1"
                     /db_xref="GeneID:59237300"
                     /translation="MPSLESSSDDEVTIVEQTMPLNTPLAHCSSSEPLTPPNENVIAS
                     TSNANQSEQQKKITSGWMGRSSFKSHFQFFFKHGRKVARCNYCGKTYKEGESTGNLSK
                     HITAVHRSVLKEKKVLKMQTLDTMSKSSKSLHLTEALIRECNKHPGTLESLLLITEGF
                     LPFNFVRLSTWSHLNRKYGGNTFIQSRTTLTKKIQHFRDCLNDTLRQNLKDTTLVNVQ
                     LDIWTAGNSQSFLAIMVSFAPNILNKELLEASNGSRLLLNIHGEASNTHLLDFVSLGD
                     KKHTGKNMCDTFMSVMEEYDLVDKLGTITMDNASNNGNFHVNLIYDHFNGLRPRGHRL
                     VGKVRFIRCASHVLNLQFQRIIKSLSRNSLFSNAFKKIRKLAKIMRYSTAINSSLKKN
                     NLPLIPYESPTRWLFTWKQVKIFLENYKAYKNWLGLVQERGQDHLVTRIQDHISFDSK
                     TINMLAYFVECGKIFDYVNKKFQDEEYNNLPQGVPLYYLLGHFYKSCLNVSTGKEIPK
                     SKKGMDFSFLNGPDTLSFDEKNIVLEAINVAYLCYQNYLSHIQANPLYYAAVMLDPTA
                     KHEQLYRMMEIDEFNLRMNQVNNFVRMYLNEEGVELGNGQQASPELSTIGREEDYYRC
                     FNVHEQPQPTETYSTASVCDVNENLEEWHRYQSEPVASGLSRIDAIKWWHANRCKYPS
                     LFKLAMSLLYTKVSSCDVERCFSLAGRVVRKDRARLHYKNVQTLMLLRDRFSKFGFYK
                     PSPILVLDSENETDLDLDNENNDIDCYLSDSSEEMHDSQDDSAATARLTSQEGINTPG
                     SAM"
     gene            <105324..>106847
                     /locus_tag="HG535_0F00510"
                     /db_xref="GeneID:59237301"
     mRNA            <105324..>106847
                     /locus_tag="HG535_0F00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289373.1"
                     /db_xref="GeneID:59237301"
     CDS             105324..106847
                     /locus_tag="HG535_0F00510"
                     /inference="similar to AA sequence:RefSeq:NP_013605.1"
                     /note="similar to Saccharomyces cerevisiae CAC2 (YML102W);
                     ancestral locus Anc_8.817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145268.1"
                     /db_xref="GeneID:59237301"
                     /translation="MEASNLQIYWHESQPIYSLCFQPDPSNKPKLITGGGDNKVRVWH
                     LNFEETHKTKIETIDFLSSLNQHEQAINAVRFNHKGDTLASAGDDGQLLLWKQSDQRQ
                     TQFGESDTAFEESWTVTKRFRSSSSRIGAFEIYDIAWSPNDDYIVTGSMDNAIRVFEI
                     SSGECIATASDHTHYVQGVVWDPLDKYIFSQSADRSVHVYEVIRNPSENEIVELKIKN
                     KIMKSELPVCKRESKDFDLQSTKLCFLFHNETLPSFFRRPAMSPCGSILCVPAGIFRT
                     DSSAEGATSPDVNNAVQIYTRSSMIKNINKPVMCIPFLKKPAIVVSFNPNLYKLTNDS
                     NSYLQLPYKLVFAVATSNEVIIYDTESIEPIALIGNLHYTTLTDLCWSKDGALLMISS
                     TDGFCSYISIAPGTLGEKLTHEETAKAIGVKRKQYNKDSSSEPAPCAEASPSPSHPKQ
                     ADIVNILPVKRKLGEKEKEMEERKTHKPSPEDERVAGSENSPQQLSKEKRAEFNQPL"
     gene            complement(<107374..>107964)
                     /locus_tag="HG535_0F00520"
                     /db_xref="GeneID:59237302"
     mRNA            complement(<107374..>107964)
                     /locus_tag="HG535_0F00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289374.1"
                     /db_xref="GeneID:59237302"
     CDS             complement(107374..107964)
                     /locus_tag="HG535_0F00520"
                     /inference="similar to AA sequence:RefSeq:NP_013991.1"
                     /note="similar to Saccharomyces cerevisiae CUE1 (YMR264W)
                     and CUE4 (YML101C); ancestral locus Anc_8.816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145269.1"
                     /db_xref="GeneID:59237302"
                     /translation="MDQSTLTLLLTILVGFVLLKWFAQSDQHPSAQQLGSDGANSELA
                     GANQNRAHPTRRGTARRPRRPVSPDMIEVVQSLAPHLHVEQIRYNLEETGSVEVTVER
                     FLRGDDFPFPPGYRASPTEPAGDRSAGNTDPRKRNNIRPDSLLTKFNVDPEADLSGRD
                     FKDLDTEERKQFMVWQARKSMEKRLETDERLRELLK"
     gene            complement(<108284..>108787)
                     /locus_tag="HG535_0F00530"
                     /db_xref="GeneID:59237303"
     mRNA            complement(<108284..>108787)
                     /locus_tag="HG535_0F00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289375.1"
                     /db_xref="GeneID:59237303"
     CDS             complement(108284..108787)
                     /locus_tag="HG535_0F00530"
                     /inference="similar to AA sequence:RefSeq:NP_013990.1"
                     /note="similar to Saccharomyces cerevisiae SAP30
                     (YMR263W); ancestral locus Anc_8.815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145270.1"
                     /db_xref="GeneID:59237303"
                     /translation="MARPTNSNSESESRTRATTSGGAVGNTTGGARSNTKQRLTAAQQ
                     QYLKDLVKTHVTNNHPDLTPKPTPIDFESYPDQFLRQYKERFKLKIEDNMTIQGYLLG
                     SQLGAKTCSYKKNAQSHDRRVHKKELATEVKKHFTSYGIKEAECIPQFIYKVKNQKKK
                     FRMEFRG"
     gene            complement(<109011..>110096)
                     /locus_tag="HG535_0F00540"
                     /db_xref="GeneID:59237304"
     mRNA            complement(<109011..>110096)
                     /locus_tag="HG535_0F00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289376.1"
                     /db_xref="GeneID:59237304"
     CDS             complement(109011..110096)
                     /locus_tag="HG535_0F00540"
                     /inference="similar to AA sequence:RefSeq:NP_013989.2"
                     /note="similar to Saccharomyces cerevisiae YMR262W;
                     ancestral locus Anc_8.814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145271.1"
                     /db_xref="GeneID:59237304"
                     /translation="MYNIRDISKGLAKEERRGHFIKNNASQITCALHESAIPVVCSVH
                     RLVYRSCKMNAPYVDAHCHLVMSEDGFGENAHPYACVDSTRCVMSTNANDWEKLRKIE
                     ATDIVRSFGVHPWYCHLFSIGRESVSKREHYESVLECKERQEQLAIIERLPDPIPLEK
                     YIQEEYDDELVGVIGEIGLDKLFRLPENGYFVHAKEPFRLTRVRVKLAHQIAVFERFC
                     QLAAQFDKPVSVHDVKCHGKLFEICTEILLPHEGVNVCLHSFTGSKEIISQQWIRYFT
                     EPRIFLSLSKYINFKSSEDGRALAVFVPNRCLLTETDLPIDAVKPDELTNALSYVCEE
                     LTEALQLGGLEATKQLIHTNFKRYLNR"
     gene            <110108..>113503
                     /locus_tag="HG535_0F00550"
                     /db_xref="GeneID:59237305"
     mRNA            <110108..>113503
                     /locus_tag="HG535_0F00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289377.1"
                     /db_xref="GeneID:59237305"
     CDS             110108..113503
                     /locus_tag="HG535_0F00550"
                     /inference="similar to AA sequence:RefSeq:NP_013608.1"
                     /note="similar to Saccharomyces cerevisiae TSL1 (YML100W)
                     and TPS3 (YMR261C); ancestral locus Anc_8.813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145272.1"
                     /db_xref="GeneID:59237305"
                     /translation="MYNSIPLPVKGIINSRFANEEREYIFWQISRTNSVIIFCLCSIW
                     LWQSLAEAVLEKNSHFRDNMTIIIASLFLPHQPQFELNATEEDNAELVDSNLVKVNNG
                     STDSLTTRKRTSSVHGKAPFVGYESTQDLLNPAENPSRIVTPTQSAANRNNAVSSEEF
                     MESLTAHGTSTGTPANPAAGDHTKASAEEFFSNVPYTSVPGTPGSDTNSETGNNGPSD
                     LTANLLKNVNKSLLYQSVLKNTGSQTSVEGNVKRSANSPGGGMVITPKSRSVPDVNSA
                     VGNFAKVKQQQQKSTLPSMRRIPRVSSGSHNMASGPSHLKYSQGADDIEETTSTESFI
                     SESESDEDVVNASDSDLELDGKTNYHVPKFGGYSNNAKLRASLLQNSHHIFGRVPWKI
                     VPSLKGNGALKNAVSVAVAEKTIVEDISWVGTIGIPTDEIPEDVQSKIAGKLHADYNH
                     ESVITDDVTFKGAYKNFCKRILWPTLHYEIPDNPNSKAFEDHSWNYYQSLNQSFADKI
                     KSVYKPGDTIWIHDYHLMLVPAMVREYLPQAKIAFFLHVSFPSSEVFRCFAQREKILK
                     GLLGANYLGFQTKEYARHFLQTSSRLLMTDVSDSELKYKGKVVSVRHTPVGIDVFNLD
                     AQLRQEGVIQWRQLISEKWKGKRLIVCRDQFDRVRGLKKKMLAYERFLRENPDYIQNI
                     VLVQICLVGEKDQDLEREIMIVVDRINSLSTNLSDSQPVVFLHQDLEFEQYLALSSEA
                     SMFIVSPLREGMNLTCHEFVACAQESNAPLLLSEFTGSAEILKDGALLVNPWDIDLFA
                     KSIKRALEMCPGEKRHLWKKMVKSVINNDADNWILTSLQDINNAWEFNKERSTVFNLS
                     GDQITKDYRASKKHMFILKISTPPNARMLTILSDLCSENIVYIMNSFSKATMESLYSR
                     VLNIGLIAENGAYVRLGGRWYNMVEHVSWKDEVIKILDDKVERLPGSYYKIADSMIRF
                     HTENAEDTERVSAVVGEAMTHINTLFGEKGVHAYVHKNIVFVQEEGLSLSAAQFLFKY
                     HNSNSDNYGKGQIALTPTDSSSRTSYFTSKSISQSIIDFVCVTGSSSPVIEPIFQLVK
                     EEVNRGALHFGHTIVYDGATSTYAKEHVDGLNELFTILEEIAE"
     gene            <113731..>114192
                     /locus_tag="HG535_0F00560"
                     /db_xref="GeneID:59237306"
     mRNA            <113731..>114192
                     /locus_tag="HG535_0F00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289378.1"
                     /db_xref="GeneID:59237306"
     CDS             113731..114192
                     /locus_tag="HG535_0F00560"
                     /inference="similar to AA sequence:RefSeq:NP_013987.1"
                     /note="similar to Saccharomyces cerevisiae TIF11
                     (YMR260C); ancestral locus Anc_8.812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145273.1"
                     /db_xref="GeneID:59237306"
                     /translation="MGKKNTKGGKKGRRGKNDNDGPKRELEYKEEGQEYAQITKMLGN
                     GRVEATCFDGVKRMAHIRGKLRKRVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARM
                     LKSQGELPENAKINETDNFGFESDEDVNFEFGNADEEDDEEDDDELDIDDI"
     gene            <114530..>118807
                     /locus_tag="HG535_0F00570"
                     /db_xref="GeneID:59237307"
     mRNA            <114530..>118807
                     /locus_tag="HG535_0F00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289379.1"
                     /db_xref="GeneID:59237307"
     CDS             114530..118807
                     /locus_tag="HG535_0F00570"
                     /inference="similar to AA sequence:RefSeq:NP_013986.1"
                     /note="similar to Saccharomyces cerevisiae YMR259C;
                     ancestral locus Anc_8.811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145274.1"
                     /db_xref="GeneID:59237307"
                     /translation="MPPNNSEDKFRDIKNFLITNNPSKIDAENREEVLAELVHSFHAI
                     FEPIRTEPQGISDTSRLLIVDLLSIWILRTTQIISNKKIETDKYKQIVNETLLSCHNA
                     TTIFQYVITFWSDGSAAFVNALSDMFGKLLRLIKLIFPANTCEDMLSHWLNSALKVPA
                     TLRVQYYLINALSTELDLFPILQKRPDFVESSLSLMWSDSLSTPIGKCLTSLLTNVYN
                     IHFLKDKEKITPWLELWYEPSLKYLCNSKLIKPIELYVLTPLFKIMPDEAFIAFSKRI
                     NALERPILIINIFRLGQELAIEEEPFHENKLISLETVESFLRLDAYKLQAFELLTFSV
                     KRSRKIHEYIFELIKENIDIFFQDAEVETRNYFCSSFKHFILRIRDSSYALNRTLVKL
                     RAADKFPEEQKEKQRDLKTYEDFLLWLSRYLKIKLCPGTQYSEIYTALRICEFLIVSG
                     IDKSVSEKYIDVKDMREWPFFISFCSDLSLARLLLDVLSSHFDDIRKIAKRLLLIIFD
                     SSEGQMLQGKLNWKKFEQTCTDFMDSYQYADIGAVLQCVLYDVSDNKHLFLEELLEKL
                     RFKTADNIHDYIKHLNQPISSYFTSMSLLLNENALEPNELKHVVQLCISLILENWSSV
                     KKILCYDTAKETLPTSYQGSLVGDQVVISTAFKTVKECSNLLNTILNICPLSSEQLTV
                     VGNLLIEQLFSIYHSGAFQAVLPSFQTCCRRAHKENPLQIEEWLEDITDILEFKTQYI
                     TRRSGGIPSMISTILSTENKKDRPLLRTAYFKLEKIASRPIDKHQDVVDLPQINAFNC
                     IRAIFIESKLSEPCTPYISSALALSLKNFTSDLWSLRNCSIMLFTSLQNRIFGKKGKN
                     VGASQFFARFKGIREILLQLLKNSLHVSSNTTEKLKRPRQVESIFLVLNILLRLKPTP
                     GYDGMEPFANEVILCLNNKSWKIRDMAARTLPHLIEGPLKWSAASLSRTSVTNQNSLH
                     GHLLVAAEVLKDVQIEETLAEGISALVDAIFAKQTEFLLRNRSYHTVKAYVELVDLLF
                     RKVPLVSKDERTKTLVSHVGEYYLKHDGEFFADGSKQMCLSCVLSFLLKHDHSSTMIL
                     CELGIRSEFFEVQLVALQFAIDYLDLQAMDCNCLMVAISELSQDVRNLPKINAVIITA
                     MNKSCRSQISDVLAILENPLKSEEEHIAELTSLGGVSGLTPGSDNELLISGIISKYLD
                     DSLPVDFRLASINSLDHYLGTKTNPELVLRVIEMLTDDDYTVRVTAARLLCDLFSLKG
                     RFKEHPSPCTVAKKTEQILFMNFSKEVVGNLMAQKLKVILASPNMQCIKNKKLEGLFE
                     PEKNNQFRNEVEQSIHYASIISQASFRDADFTIWVNKQRSKLLNFLRKENFSDTPLGW
                     SSKPDVFANLCVLRLLTKFTEPLQLGIFDQELRAHDIHPMVFERVCI"
     gene            120469..120542
                     /locus_tag="HG535_0Ftrna4N"
                     /db_xref="GeneID:59237889"
     tRNA            120469..120542
                     /locus_tag="HG535_0Ftrna4N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:59237889"
     gene            <120688..>122346
                     /locus_tag="HG535_0F00580"
                     /db_xref="GeneID:59237308"
     mRNA            <120688..>122346
                     /locus_tag="HG535_0F00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289380.1"
                     /db_xref="GeneID:59237308"
     CDS             120688..122346
                     /locus_tag="HG535_0F00580"
                     /inference="similar to AA sequence:RefSeq:NP_013985.1"
                     /note="similar to Saccharomyces cerevisiae YMR258C;
                     ancestral locus Anc_8.810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145275.1"
                     /db_xref="GeneID:59237308"
                     /translation="MVSQEEFKSILQASCRFLNQNDLTSLALTSKSVCHSIAVQQLYH
                     SISITRDPVIRSNECLLDAGRTYVSGYRALKKTDDQNDLFLYDRIERLMESSKLQHVK
                     EIDIQDSLFSDEECGNLLIRKFLDRVIELDKIESIDIRNDHLFLEHYPNILGLTNLKK
                     IKIVDTDALSKIRSFSKLKKIEWIVEQPRLTKQLLTPHVVDFFNKRIEACEFIVDNIN
                     SSSFQIIQFFYENGIQCENLRSLKFNHLYGINVHSEHHKDASLKWLKDVVCLEKLKTL
                     ELGISSENIDHDLIDDFLEELAPHLKSLRNLALIETTPEQNSDCTLKEVWDLTINRFI
                     LRIPDIGLNLHTLSISHKTPLNGLCSSAVQGNYTRRRVLYETVLPKLTSLRNLIAPNM
                     LQSLSVYEVLACDILWNGCECSYCKKVLPVFDEYIMNHQYYSRYNGRYMDIIPTVFFS
                     YAGDYLSRRFNNRVEWDTKVFDTAPLYRCWNFRGYEQIHHFDNYEDLFDESAFGPLCK
                     VISHFFNGYMDYLVKFLPNLEMAMFSGIYYTIDKEANTYECIYD"
     gene            <122845..>125211
                     /locus_tag="HG535_0F00590"
                     /db_xref="GeneID:59237309"
     mRNA            <122845..>125211
                     /locus_tag="HG535_0F00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289381.1"
                     /db_xref="GeneID:59237309"
     CDS             122845..125211
                     /locus_tag="HG535_0F00590"
                     /inference="similar to AA sequence:RefSeq:NP_013984.1"
                     /note="similar to Saccharomyces cerevisiae PET111
                     (YMR257C); ancestral locus Anc_8.809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145276.1"
                     /db_xref="GeneID:59237309"
                     /translation="MIRIKHSLLPFPHALRRKLTEPAIFVLQPRWFSCFKQIDEQRNK
                     DDIANWVRNSLHEPMSSPSPTVNFMHPEIQVIEVPAQGLDSNTISFVPMEEYFTRWNS
                     LFKVADENTIRLVISMIQSNKKAFSLQQLMPLVQHLKAKRRCYEIDTIFTAYQDYFSV
                     LKRHNLDPKVEHLFLEIMISTEATLGNYSLCETLFSDYIKHSKVKPRIISIGLRSFIE
                     NGNVQLAKEFFSQAVKNPDTFPMTNKELFLFLRDLSCYNDFASMRFSINLWLIEKCQE
                     NNLCVNTIPDFRTLSLLHRTFKLFKDETSLNNLLSNSVIETTGYKESILFQTTEFCQD
                     LRDRSIMYQNIDINEKIALFLEALKGEPLDRRDFYLNLLKTFVSIDDIKRLKYIMTVV
                     QEDRDVPLSNAFHVVIAKCFVNRGLLEHLMEYYTCVRKQGSKRLRLRVGHIRQLLDCA
                     LRSYPILAEEMTNELKILLNKGKYLRRLPRLKLLLLEIDRLRTQSMGKYYAYRTRVPK
                     LEYERLGVLRSQILSGDVAGAKSTILENIRQGITPRFDFYFLALRMCLDSDMPSLAKL
                     LDDSCSASFHKIPLKVHITWLRYEIISRYKNVLNGTEMLSSNKIQSLKDQLAEFKRNH
                     ESSMNFQNYLQLAQLCVYIRDYRHASALLLEAYGLIDKQSSQQWIMYYMTSLKVHARS
                     YKIAEFQELLKEWNTNPNAKWVTHSCIREIKSLSRLLHRRKDKLDVSLRSDPDSFKKI
                     TSEINFLVEKYVNYKFEGLNVMRKLTFFIKRWIEQESEDSSSSARKKR"
     gene            <125482..>126966
                     /locus_tag="HG535_0F00600"
                     /db_xref="GeneID:59237310"
     mRNA            <125482..>126966
                     /locus_tag="HG535_0F00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289382.1"
                     /db_xref="GeneID:59237310"
     CDS             125482..126966
                     /locus_tag="HG535_0F00600"
                     /inference="similar to AA sequence:RefSeq:NP_014587.1"
                     /note="similar to Saccharomyces cerevisiae PSH1 (YOL054W);
                     ancestral locus Anc_8.808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145277.1"
                     /db_xref="GeneID:59237310"
                     /translation="MSGALHNGVSERSKKTKGKILTSMLDSMVCSICHDYMFVPMMTQ
                     CGHNFCYSCITNWFESNTTVELTCPQCRCSIGEEPHLNNTLQQLLFGVVDTLNEKEKE
                     SKTLNSILGEKKAADSSYRFDLKSNNLFNGVFKTSALGVVDEDDDGILRCSNCHWELE
                     DDEDEVCPHCGCRIRSRMRSGNAGRNLEVEEDEEEEEEEEEEEEEEEEELAAAHNEID
                     TEILQELRDSIEHYKKQARSVIQEYRNEEQPLSRQFEQDFPHVVKIESAPDRMVYLPS
                     YSVYTQSDFTLAENDRDRRTRLIQRIESGDSLDMNQLRHDSPAQKPNPITGYYSEGDF
                     SESDSDDVTERNSNHDLVDLEAEDSREEEGQDSDFYEHNEEDDGFVTGDSLDDAGGEE
                     EYIEDEDENAYIDTDASEGTYGNDERNGLNDGAGDYDENDEDDDDDNDQDLYDLVDKG
                     TASKKRRLTSTSDANSANEEEDEEITMRNPRRRFKIVTDISDEE"
     gene            <127221..>127400
                     /locus_tag="HG535_0F00610"
                     /db_xref="GeneID:59237311"
     mRNA            <127221..>127400
                     /locus_tag="HG535_0F00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289383.1"
                     /db_xref="GeneID:59237311"
     CDS             127221..127400
                     /locus_tag="HG535_0F00610"
                     /inference="similar to AA sequence:RefSeq:NP_013983.1"
                     /note="similar to Saccharomyces cerevisiae COX7 (YMR256C);
                     ancestral locus Anc_8.807"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145278.1"
                     /db_xref="GeneID:59237311"
                     /translation="MSNKIIQLQRLFQASHKPLWWRHPRSPYYLYPFYGLLTVAVVTP
                     LLYIPNAVLGIKAKK"
     gene            <127989..>128999
                     /locus_tag="HG535_0F00620"
                     /db_xref="GeneID:59237312"
     mRNA            <127989..>128999
                     /locus_tag="HG535_0F00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289384.1"
                     /db_xref="GeneID:59237312"
     CDS             127989..128999
                     /locus_tag="HG535_0F00620"
                     /inference="similar to AA sequence:RefSeq:NP_014588.1"
                     /note="similar to Saccharomyces cerevisiae YOL053W;
                     ancestral locus Anc_8.806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145279.1"
                     /db_xref="GeneID:59237312"
                     /translation="MHFMLKRFLSASNVAVSWRSDIIRAVNFKRSFRSVPDDPKYVFS
                     KPPTSSKFPDDPQNKDGKHFFTPPNSANVKADAFSDEVTSIGQAIASQRRKKRRQLIS
                     LILFGTIGGILGYSVCYKAIYLREQSFIPLFPSSRIRKLSNKDKRRIAIKQVEDVARL
                     RVLEQLSQHPMIKDEYSVPLLDSNTQETPKVHNFEMWCEDQDPCVTGIVVEPNDSRAS
                     SHEWYKVPFLFKWRITHRPISISRTVTDFLNGIGLSSTDIFQIIAPENVYGSFKYEFP
                     IQGDDHSMHIWFLGEMDLGNESLVVFKGKFHVDAKLQQIDLLRKENNKLIRYILYKDD
                     RK"
     gene            complement(<129007..>129501)
                     /locus_tag="HG535_0F00630"
                     /db_xref="GeneID:59237313"
     mRNA            complement(<129007..>129501)
                     /locus_tag="HG535_0F00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289385.1"
                     /db_xref="GeneID:59237313"
     CDS             complement(129007..129501)
                     /locus_tag="HG535_0F00630"
                     /inference="similar to AA sequence:RefSeq:NP_013982.1"
                     /note="similar to Saccharomyces cerevisiae GFD1 (YMR255W);
                     ancestral locus Anc_8.805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145280.1"
                     /db_xref="GeneID:59237313"
                     /translation="MVLASIWADAPSGSVEHSKKTQRKKPTSGKNKKSGTNRISSAPV
                     TETSTEKKTFHEEKPKGRLVFSVKDVKIDKSTPASPRKGNNKKIDNATESNEKADKAS
                     KDKLEVLKKKIENQKKILQKAQHEKQQKALLEEFLNDDAKFDWGDEDEEDEIIEKLNN
                     SLKV"
     gene            <130948..>132141
                     /locus_tag="HG535_0F00640"
                     /db_xref="GeneID:59237314"
     mRNA            <130948..>132141
                     /locus_tag="HG535_0F00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289386.1"
                     /db_xref="GeneID:59237314"
     CDS             130948..132141
                     /locus_tag="HG535_0F00640"
                     /inference="similar to AA sequence:RefSeq:NP_013980.1"
                     /note="similar to Saccharomyces cerevisiae YMR253C;
                     ancestral locus Anc_8.804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145281.1"
                     /db_xref="GeneID:59237314"
                     /translation="MDSVSKNMDRAIAAEGSNEEEFDLSSADSSLVIATESRIQRISR
                     EYLKPNIGLVLLVVSQFFNSLMVVSTKVLETDEVGEDEEPIKPLQILLVRMAITYIGT
                     LIYMYCNRSTIQNVPFGPSSMRKWLVLRGVTGFFGVFGMYFSLLYLSISDAVLITFLT
                     PTVTVILAWVVLREKLTRMEIAGSVVSLAGVVLIVRPSFLFGTIVEPSGAVESEDPKQ
                     RLIATIVALIGVLGASAVYIIIRFIGSKAHAILSVSYFSMIVTIISLFGILLIPSMSF
                     QVPKDPKQWLLFSNLGVCGFVFQLLLTMGIQKERAGRGSLMSYTQLIYAVFWDVSLWH
                     HWPSFWSWLGMIVILTTTIIVGKFKPKQDTRTAVVPLPDQEVALSGTNYEHEVEHIPL
                     DEISK"
     gene            <132379..>132756
                     /locus_tag="HG535_0F00650"
                     /db_xref="GeneID:59237315"
     mRNA            <132379..>132756
                     /locus_tag="HG535_0F00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289387.1"
                     /db_xref="GeneID:59237315"
     CDS             132379..132756
                     /locus_tag="HG535_0F00650"
                     /inference="similar to AA sequence:RefSeq:NP_013979.1"
                     /note="similar to Saccharomyces cerevisiae YMR252C;
                     ancestral locus Anc_8.803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145282.1"
                     /db_xref="GeneID:59237315"
                     /translation="MFGRGLLRRITERKLISKSWTSSLPQQNVWSPYKKWYELSLHEK
                     QLFIRTFVDNYKRHYPGSKTNVSLRGLATGMDAHSDSPSVFGVFYNDIWGTVSRPPKA
                     ELATSNKRNRFNHPSFCTLLIKK"
     gene            <133394..>133984
                     /locus_tag="HG535_0F00660"
                     /db_xref="GeneID:59237316"
     mRNA            <133394..>133984
                     /locus_tag="HG535_0F00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289388.1"
                     /db_xref="GeneID:59237316"
     CDS             133394..133984
                     /locus_tag="HG535_0F00660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145283.1"
                     /db_xref="GeneID:59237316"
                     /translation="MTCNLLSPPFLSISHQPPDAIWICNYMTKTVMHRLIGTYPVKKG
                     ETGLALRASPRFVRGHAKWGEDQMAMSRGGAAGGFRICRDFPLSHTKFRNSRRQSNNF
                     RGATRTETSRTLAKPSGIGTRTAGKTQNTAKLQGQQKQKETPCGCIGILHLQMRKGVS
                     RTFHLRLRLADYVHRRSGLAFCHHDILFCCVMYVCM"
     gene            complement(<134074..>135846)
                     /locus_tag="HG535_0F00670"
                     /db_xref="GeneID:59237317"
     mRNA            complement(<134074..>135846)
                     /locus_tag="HG535_0F00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289389.1"
                     /db_xref="GeneID:59237317"
     CDS             complement(134074..135846)
                     /locus_tag="HG535_0F00670"
                     /inference="similar to AA sequence:RefSeq:NP_013976.1"
                     /note="similar to Saccharomyces cerevisiae GAD1 (YMR250W);
                     ancestral locus Anc_8.801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145284.1"
                     /db_xref="GeneID:59237317"
                     /translation="MLHKYTEKHRKPFTFVEEEKNDDFTKNLVDANLLPKELQDLNLG
                     SSSERAKSLSRHENRIFSNKYVIPDDGVPEQLAFDLVRNELTLDGNPHLNLASFVNTS
                     STALAKKLITENINKNLADNDEYPQLIELTERCISMLAQLWKCGKNGEEPIGCATTGS
                     SEAIMLGGLAMKKRWEHKMKDASKSTSRPNIIMSSACQVALEKFARYFEVECRLVPVS
                     SESHHSLDPKLLWDFVDENTIGVFVILGTTYTGHFENVEQVANTLQEIETANPTWSNR
                     EIPIHVDGASGGFILPFSFTEKQLAAAKVSYWGFNHPRVLSMNSSSHKFGMTTPGLGW
                     VLWRDGHFVPSELRFTLRYLGGVEETFGLNFSRPGFQVIHQYYNFISLGFKGYQTLFN
                     KSLFVARAFCFNLLKNKEMPDYFEVVSGIHNRISDGNLPAKLDDYWRHPDQFQPGVPL
                     AAFKLSAQFHKRFPDIPQAMLSTLLRLRGWIVPNYPLPKSTDGSDQSEVLRVVFRSEM
                     RLDLAQLLLTDIQNVVSKLIRCYSKVKEETAVATSSQNRNIRGDVIFDVLSTLADPAA
                     EQETPAEEVRETRKKMSKNYRGTC"
     gene            complement(<136751..>137947)
                     /locus_tag="HG535_0F00680"
                     /db_xref="GeneID:59237318"
     mRNA            complement(<136751..>137947)
                     /locus_tag="HG535_0F00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289390.1"
                     /db_xref="GeneID:59237318"
     CDS             complement(136751..137947)
                     /locus_tag="HG535_0F00680"
                     /inference="similar to AA sequence:RefSeq:NP_014590.1"
                     /note="similar to Saccharomyces cerevisiae SPE2 (YOL052C);
                     ancestral locus Anc_8.800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145285.1"
                     /db_xref="GeneID:59237318"
                     /translation="MTISIKELTNHSYIDHELSANLDSTEAFEGPEKLLEIWFYPNVQ
                     TIPRINGQKLTLRNIEVDKWVEILKLVKCEVLSIKSTGKLDAFLLSESSLFVYDHKIT
                     LKTCGTTTTLFCLERLFDIVKDELKWDLLNHTSDEGKYHPYKVFYSRRCFMFPLKQRS
                     IHKNWSNEIEYLNNFFRQGRSYLVGRNDQSNHWNLYVTETNKEMAKDSEVNPDDDQDE
                     TLEILMTGLDNNKAQQFICSRNVKDDLGADEGHAYGYKITKNTQLDCVYQNRMGSSFH
                     HDAFAFTPCGYSSNMIIDEEYYYTLHVTPEKGWSYASFESNVPVSTVSLHKQDNLQVM
                     NSVLNAFQPQDFCLTFFAKDMSNQSFTKLMQIVSQVSNYTKKDRIIYDLDDYQLLYMR
                     FERIVS"
     gene            <138846..>143555
                     /locus_tag="HG535_0F00690"
                     /db_xref="GeneID:59237319"
     mRNA            <138846..>143555
                     /locus_tag="HG535_0F00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289391.1"
                     /db_xref="GeneID:59237319"
     CDS             138846..143555
                     /locus_tag="HG535_0F00690"
                     /inference="similar to AA sequence:RefSeq:NP_013975.1"
                     /note="similar to Saccharomyces cerevisiae RKR1 (YMR247C);
                     ancestral locus Anc_8.799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145286.1"
                     /db_xref="GeneID:59237319"
                     /translation="MSFGGINTFQQYSTDYGLGHNGIKVSFNFFDGIPEASLLNSLAS
                     NELQLIFKLLLKKDEVTKEKALSDLLKLLNDFPSNKYLFADDIFSLCWSQVYPKLLLS
                     NSKNIRVQSHQVTSTLIKVLHKKIAKFLKDFIPPLLLGSCDSDSFVSKSCSNFISSAF
                     NGDSKKISALWTLFHEDILNLVKEVIVVENDGTISDERYIGKEDSQLRYNRLLTSTIL
                     LLNTLIASDEKNMDNHRITYKKILSSDSLWNLLSLKNTLFLKGYETVLRLLQLLYRIG
                     YLRSHKEILKISVRKLLKSLAQVNQKNILKVSDLMVSMLDSLNLLNEYKDGKIWTYDK
                     SSKEKLMSFLSVCCSNPHPGYFASMFRFYEGTAADALLNYEHEWLPLWRKSIKALNER
                     SFLGRYGADLLTEFWTYYLKFTDSTMESNAKSAAQSEILETLDSEKSLSKLPTLTLAL
                     KDSLPQDFVIEEIFKRLKLQDSVRAADHYLQNLLLLLITGSDTGESLRNLMDIFLDLI
                     NQNDITDEKIILINILIRTLVKADLKILCQEYTKYITVIPKLVNENVYDDLAGTVIDY
                     SNMKTTEKGKGEASMECIEEFFNVAITCQISDENIISTLKSMDKHTAEQLLGCQPLKE
                     FIDNYIDLYRYGDDGKLFKTPLISNEIIDRLFESAKVNNLVERFCDASVDLELEQKEH
                     LLKATDFLQTCMFNISEKCTSKVMQIAESFISCNSKITKKLSVTIVEHAKSRDSSHQE
                     RLCVDYAIQLLKSSRDNTELFFPPRLIELLDKAVPYIDYRFTLINCLGLNTHLLPTSQ
                     EEVDLNDMEELIKLGIFLDTICSEIPILLTDEVSVFLTMVSELAGDFNCLSIKPKESY
                     VNIKNSLLKSDNLKVSANYIILKLTDSAEANEESDVSTALFSLLLAKSASAVIQFYSF
                     RIIYKVLLNEVDSLSVSSLDRLLPSIEKFISNVVRSKTSKDHEYMASAVILSSVVNAN
                     CTSERSFMKLRNFLASECIGVGENEIYDKTCRTIILLINFISFSKELGPYTPIAPQRL
                     NMMLKTIEKWFDSDIPYNPQFSLMNLVLLNFFASLISNSLPVASNSAITDLAARLLTD
                     SLTLCELEDSSYLLELRLYSLKLYVAVSTAGIISPEYSTDIFTCLMELCLTDFKSETN
                     NQISVDFYRDLNKVFMKFDVKMLLDYYDAFLDSFLTKAGVKNFNRLRLIMIILRRLVK
                     ERQQEAVVEYELEKQQKLVRDDTKTEEVENFEEDNKEDEKFKLPQVLIEKLKEEVPQD
                     YLEYENEYQFLKYLWYWDLVLEFFDSSSYNLRQLFIEQLKFEDMINRFFNFVTDQIDL
                     QETKFWENVESIHFLSYSATGEDFSPFSEDVYVECKTLLAHSLYRMFDNVGSLTANWW
                     LNIKDRSFQSKVEKFVTKFISPILIQHELKIVSQKMGSLTSKDDALSIKINKVTDEVK
                     ATYLIDEQKLEISFKLPGNYPLTNIEVIGVSRVGISEQKWKQWILSTQRVITGMNGSV
                     MDSLELFTKNVNLQFSGFEECAICYSILHAVDRKLPTKTCPTCNNKFHGACLYKWFRS
                     SGNNTCPLCRSVIPFRR"
     gene            <143772..>145250
                     /locus_tag="HG535_0F00700"
                     /db_xref="GeneID:59237320"
     mRNA            <143772..>145250
                     /locus_tag="HG535_0F00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289392.1"
                     /db_xref="GeneID:59237320"
     CDS             143772..145250
                     /locus_tag="HG535_0F00700"
                     /inference="similar to AA sequence:RefSeq:NP_014965.3"
                     /note="similar to Saccharomyces cerevisiae GNT1 (YOR320C);
                     ancestral locus Anc_8.798"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145287.1"
                     /db_xref="GeneID:59237320"
                     /translation="MFIRKRKIKILVLFALGIAVISFAVRSVVQSQLNKEIVYFKRYF
                     EEKKDVIDLFNPLAIKQIPEEVIDQLYKTALQDSSKKNPKNQIDWSKYAYVTYATHAN
                     YICNSLIIFDALKSYGTKAKLVLLVSQDLVEPEKYDDFEIVNSLLRRLTEVGGDQVII
                     KFMKINKKSSDDTQWSYSLNKLEVFNQTEFDRVIYMDNDAILHDNLDELFFLPDYIKF
                     AAPLAYWDLKEHDITASYNEVRNYEKLPINLERYNDKIIPRIKKHKMIYNHLPSLPPN
                     LFLDTQNVAQDIIRSEFSFSSMFDHHITKQPNKINFASNLMVIKPSQETFKLLRDYLI
                     PAYLKKEEGYDMDLINNDLYNMKKLIRKQFNYFRRIRTHFVPEVLVLPFGRYDVLTGS
                     IKNRHEQSMLKNDVIGYRRVNSEGEELPKSVDEVIQDAKYIHFSDFPLQKPWEYESFE
                     EIECHADELKDNTIEEPEKTCTAWNSAYLTYMYSRNICWIGE"
     gene            complement(<145300..>145944)
                     /locus_tag="HG535_0F00710"
                     /db_xref="GeneID:59237321"
     mRNA            complement(<145300..>145944)
                     /locus_tag="HG535_0F00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289393.1"
                     /db_xref="GeneID:59237321"
     CDS             complement(145300..145944)
                     /locus_tag="HG535_0F00710"
                     /inference="similar to AA sequence:RefSeq:NP_014964.1"
                     /note="similar to Saccharomyces cerevisiae HSH49
                     (YOR319W); ancestral locus Anc_8.797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145288.1"
                     /db_xref="GeneID:59237321"
                     /translation="MNASLNDPATTVYVGNLDPKVTKAQLYELFVQLSPISRIRYPKD
                     KILQLHQGYAFVEFYTPEDCQYVAQLMNNTVYLYDRALKVRPANAQLSSNSSSVISVD
                     VNVLPIAKVFVKNLDNSIDENQLTKIFTKYGPLSKSSDVFHLSNGQLRCAYIYFKFYD
                     DADTAISSLNCELLANKKISLDYAFKDNVKGNVKYGGEVDRLLNKEARKNGILK"
     gene            complement(<146977..>149058)
                     /locus_tag="HG535_0F00720"
                     /db_xref="GeneID:59237322"
     mRNA            complement(<146977..>149058)
                     /locus_tag="HG535_0F00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289394.1"
                     /db_xref="GeneID:59237322"
     CDS             complement(146977..149058)
                     /locus_tag="HG535_0F00720"
                     /inference="similar to AA sequence:RefSeq:NP_013974.1"
                     /note="similar to Saccharomyces cerevisiae FAA4 (YMR246W)
                     and FAA1 (YOR317W); ancestral locus Anc_8.796"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145289.1"
                     /db_xref="GeneID:59237322"
                     /translation="MAQYSVEVGKAANEHETAPRRNIKAAKEPLVRPVGFSCSTVYEF
                     AMEAFQKNKSRPAMGWRDVVEIHEETKEVTKRIDGKDEKIEKKWQYYELSHYKYNTFQ
                     ELTSIMHDLGRGLIKLGLTPEESKLHIYAGTSPKWMKMFLAAQTQSIPVVTAYDTLGE
                     KGLIHSMLQTNTNAMFTDNHLLQSLIGPLEKTPEMKFIIHNEAITESDKRYGGKLYQN
                     AFNAVNKLKEIRPDITIISFDDLLKLGESARDEISTFLPKENDTSCIMYTSGSTGDPK
                     GVVLTHRNIIAGVAGVTDNVQGFIGIRDRVIAFLPLAHIFELAFELICFYWGGVLGYA
                     NVKTISSASVRNCKGDMEEFQPTVMVGVAAVWESVRKGIMAKISQLPTITQKIFWTAY
                     HAKIKMKRYHIPGGDSLGNLVFKKVKQATGGHLRYVLNGGSPISIDAQEFVTTLLCPM
                     LIGYGLTETTANTCVLQPDRFEYGVAGDLTAAVTVKLVDVEELNYLAKNNQGEVWIRG
                     ASVTSEYYKNPKETEDAFTKDGWFRTGDIGEWLPNGHLKVIDRKKNLVKTQNGEYIAL
                     EKLESVYRSSTFVQNICVYADQSRVKPVGIVVPNLGPVAEIAESNGILKKGDDVENHL
                     HDKKLQNIVLRELLKTGKSQGLIGIELLEGIVFFDEEWTPQNGFVTSAQKLKRKDIFN
                     AVKDDIQKLYG"
     gene            <150111..>150446
                     /locus_tag="HG535_0F00730"
                     /db_xref="GeneID:59237323"
     mRNA            <150111..>150446
                     /locus_tag="HG535_0F00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289395.1"
                     /db_xref="GeneID:59237323"
     CDS             150111..150446
                     /locus_tag="HG535_0F00730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145290.1"
                     /db_xref="GeneID:59237323"
                     /translation="MPLPLPRRVIHFPGRRCVVGMRGHQNVPIPCGLSMLTIPCFFLI
                     AKHRLRKYRFDIPRNDIKWPERYVVLSAIAVRLRRHRLRKDTADAASARDDITKIIAP
                     NLETPRQGK"
     gene            <151846..>152178
                     /locus_tag="HG535_0F00740"
                     /db_xref="GeneID:59237324"
     mRNA            <151846..>152178
                     /locus_tag="HG535_0F00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289396.1"
                     /db_xref="GeneID:59237324"
     CDS             151846..152178
                     /locus_tag="HG535_0F00740"
                     /inference="similar to AA sequence:RefSeq:NP_013972.1"
                     /note="similar to Saccharomyces cerevisiae YMR244C-A;
                     ancestral locus Anc_8.795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145291.1"
                     /db_xref="GeneID:59237324"
                     /translation="MGWFTKDAAAHEYQPNNRSARKLCWEARDDYFACLNSIHVVNAL
                     EPQHQQQIEKACSNQDRNFNENCAASWIKYFKEKRVVDHRKEQFMKDVERENAQIIEL
                     TPDQMVRK"
     gene            <152806..>153885
                     /locus_tag="HG535_0F00750"
                     /db_xref="GeneID:59237325"
     mRNA            <152806..>153885
                     /locus_tag="HG535_0F00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289397.1"
                     /db_xref="GeneID:59237325"
     CDS             152806..153885
                     /locus_tag="HG535_0F00750"
                     /note="ancestral locus Anc_8.794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145292.1"
                     /db_xref="GeneID:59237325"
                     /translation="MSFIVQKAGNQAIDVNRVSGVDYHLTTNGSDWLWAVASIFGLLT
                     VVYAALFFAAEYKGSALTRYALAVPFLISFFEFFFYFTYASNLGWTAIQAEFGHVTVD
                     DPVTTASPGYRQIFYSKFVAWFLSWPLLLFLLELAGSSTTVPASELETLSVFDMVHSL
                     LIQIFSAFFWVVSLLVGSLIRSSYKWGYWTFGAVTMLIGEAVIIRRHVFTLKLRGFSL
                     GMLCTASVIVWLYFVCWGLSEGGNVIQPNSEAVFYGILDLCIFAIYPAYLLFIVARFG
                     RWPSFSLRGGFGKDYHDTHTEKTSDPNSIRESGDTHVVGAVPGVVSATGPDTHPSTVS
                     PSANTTTARAATNPHPTATATAEEV"
     gene            complement(<154319..>155239)
                     /locus_tag="HG535_0F00760"
                     /db_xref="GeneID:59237326"
     mRNA            complement(<154319..>155239)
                     /locus_tag="HG535_0F00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289398.1"
                     /db_xref="GeneID:59237326"
     CDS             complement(154319..155239)
                     /locus_tag="HG535_0F00760"
                     /inference="similar to AA sequence:RefSeq:NP_013971.1"
                     /note="similar to Saccharomyces cerevisiae YMR244W;
                     ancestral locus Anc_8.793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145293.1"
                     /db_xref="GeneID:59237326"
                     /translation="MFLSLTLISALGVLDIVNGAPVQNVAGRHHHHESVEKRAGTCSF
                     PDHDGMVAVQKNGQNGGWAMHSDQTCSPGTWCPYACQPGQLMGQWDPSVTSYSYPGSQ
                     NGGLYCDSNGNLQKPNQDKDYCYDGVGTVSAQNNADQNVAICQTVLPGNEEMLIPTDV
                     DARSNQPLAVPGPDYWASTAAHYYVNPPGVSVDDGCVWGSESNPWGNWSPYVVGANQD
                     SNGNTFVKIGWNPIYLDSSFKNTKPSFGVKVTCDDESQCNNLPCSIDPSQNDINEVNS
                     SQDSNGAGDGAFCVVTAMNGAKAKIEVFNV"
     gene            <157129..>158475
                     /locus_tag="HG535_0F00770"
                     /db_xref="GeneID:59237327"
     mRNA            <157129..>158475
                     /locus_tag="HG535_0F00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289399.1"
                     /db_xref="GeneID:59237327"
     CDS             157129..158475
                     /locus_tag="HG535_0F00770"
                     /inference="similar to AA sequence:RefSeq:NP_013970.1"
                     /note="similar to Saccharomyces cerevisiae ZRC1 (YMR243C)
                     and COT1 (YOR316C); ancestral locus Anc_8.792"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145294.1"
                     /db_xref="GeneID:59237327"
                     /translation="MKLTGKEIRICSLLLLDTVFFVLEITIGYMSHSLALIADSFHML
                     NDIISLLVALWAVNVAKIRSPDATYTYGWKRAEILGALINAVFLIALCFTILIEAIQR
                     LISPPVIENPKLVLIVGFAGLVSNFVGLFLFHDHGSSHGHGHGHSHGGGSTAHADEEA
                     AEHHSHTHNVYTSSELEQNESDISIDHSNDNIRDVWPQSVVERMSNEHTGLLKKNDHT
                     HATEETSTDDKKAKKGPKSLNMHGVFLHVLGDALGNVGVIIAALFIWKTNYSWRFYSD
                     PLVSLIITVIIFSSALPLSRQCSRILLQATPSTISAEKVQKEILAVSGVKSVHDFHIW
                     NLTESFYIASLHVKIDCLPSQFTTVAKGIRNILHNHGIHSATVQPEFASKDVSLDTSK
                     RFSLLAGSGPIHNESPDDLTEQEGSTPTPGYGSTISDGNCLVDQAANCNADDCLPK"
     gene            complement(<158667..>159614)
                     /locus_tag="HG535_0F00780"
                     /db_xref="GeneID:59237328"
     mRNA            complement(<158667..>159614)
                     /locus_tag="HG535_0F00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289400.1"
                     /db_xref="GeneID:59237328"
     CDS             complement(158667..159614)
                     /locus_tag="HG535_0F00780"
                     /inference="similar to AA sequence:RefSeq:NP_014960.1"
                     /note="similar to Saccharomyces cerevisiae SFG1 (YOR315W);
                     ancestral locus Anc_8.791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145295.1"
                     /db_xref="GeneID:59237328"
                     /translation="MYTTPSNMSTPPRLRPLSIPTTPTKKVKATSLKGKQAEFTPSKA
                     PRKFHFMRKEEPFRGIGISELLPSLANIILNQSIKNEKAPELDEIESPYAFESDNTLS
                     SDIASFNLSSDSSSIPSSSPEFEEFSFAEPWVAPSMSKINDMALNLSRIYHSSFLPSI
                     ENSGSKTAVPYLKHRPCHRIKKPGRPILRLHSGSLNLLVSSSSGSLEDATIFATEINA
                     SLASPEGEKIPCIKNSFEKVTIPVNSSVKERQKKNRKKLLGECYESESESECTNQSDT
                     SDAAFIKGFEIKLDEDREKDFEKRVNEIKSVQWAKSLML"
     gene            <160976..>162007
                     /locus_tag="HG535_0F00790"
                     /db_xref="GeneID:59237329"
     mRNA            <160976..>162007
                     /locus_tag="HG535_0F00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289401.1"
                     /db_xref="GeneID:59237329"
     CDS             160976..162007
                     /locus_tag="HG535_0F00790"
                     /inference="similar to AA sequence:RefSeq:NP_014958.3"
                     /note="similar to Saccharomyces cerevisiae SPS4 (YOR313C);
                     ancestral locus Anc_8.790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145296.1"
                     /db_xref="GeneID:59237329"
                     /translation="MSVFHRKHSGSSKNLPVLLSSEGPSNFHADGLPDLVQDQVHGIA
                     NEVHEVVNGKKATIPSKTIDHFRSYPLVQQTRSFLHQIPVARVVLSNTKPMVKQVLES
                     KPLQLALPVTNAVDSVANLGLNLTEKIIPSLKTKTYQRLGEEAMIPYHFTAKYGKIAT
                     DQTFAIVEKNVYNPAHSQVLKFRKYYNEKFYDTKGKPLVRSTFDPVTAPVNNVFEKLT
                     IKYFPNGKDVPKEGYSSELNRSLALFINFVSRTAPIVEQNVLTITMLPCNYAKHVNDV
                     FNKSLDKQPQMTLKYSWTASKDAVKQLEREMIRYVKGKSPTKMLKRSKNTIQENVEQV
                     ENEIQAQVA"
     gene            <163126..>163566
                     /locus_tag="HG535_0F00800"
                     /db_xref="GeneID:59237330"
     mRNA            <163126..>163566
                     /locus_tag="HG535_0F00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289402.1"
                     /db_xref="GeneID:59237330"
     CDS             163126..163566
                     /locus_tag="HG535_0F00800"
                     /inference="similar to AA sequence:RefSeq:NP_013969.3"
                     /note="similar to Saccharomyces cerevisiae RPL20A
                     (YMR242C) and RPL20B (YOR312C); ancestral locus Anc_8.789"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145297.1"
                     /db_xref="GeneID:59237330"
                     /translation="MRIFAPNEVVAKSRFWYFLQKLHKVKRASGEVVSVNQIHEAHPT
                     TVKNFSVWVRYDSRSGTHNMYKEIRDVSRVAAVQTLYQDMAARHRARFRSIHILKVAE
                     IEKTADVKRQYIKQFLSKDLKFPLPHRVQNSTKVFSYKRPTTFY"
     gene            <163918..>164802
                     /locus_tag="HG535_0F00810"
                     /db_xref="GeneID:59237331"
     mRNA            <163918..>164802
                     /locus_tag="HG535_0F00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289403.1"
                     /db_xref="GeneID:59237331"
     CDS             163918..164802
                     /locus_tag="HG535_0F00810"
                     /inference="similar to AA sequence:RefSeq:NP_014956.3"
                     /note="similar to Saccharomyces cerevisiae HSD1 (YOR311C);
                     ancestral locus Anc_8.788"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145298.1"
                     /db_xref="GeneID:59237331"
                     /translation="MSEDNTIPTSNDSGYLNGNDDVTGLRSRKEKNQSQDQKNDKDQT
                     KEDIETWVKQHIPLTEIHLKSHEWFGDFITKHEIPRKVFHSSIGFITLYLYTKDVNYK
                     NVLPPLMYAFVILLTLDIIRLNWQLFNKAYCRTVGALMRRNEIHTYNGVLWYILGLIF
                     SFEFFSKDVALISLFLLSWSDTAASTVGRKYGYLTPKIARNKSLAGSLAAFAVGLATC
                     YMFYGYFVPHYAQFNKPGEIKWSPETSKLSLAKLSWLGGLVAALSEGIDLFNWDDNFT
                     IPVLSSIFLDLVIRISRK"
     gene            <165214..>166749
                     /locus_tag="HG535_0F00820"
                     /db_xref="GeneID:59237332"
     mRNA            <165214..>166749
                     /locus_tag="HG535_0F00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289404.1"
                     /db_xref="GeneID:59237332"
     CDS             165214..166749
                     /locus_tag="HG535_0F00820"
                     /inference="similar to AA sequence:RefSeq:NP_014955.1"
                     /note="similar to Saccharomyces cerevisiae NOP58
                     (YOR310C); ancestral locus Anc_8.787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145299.1"
                     /db_xref="GeneID:59237332"
                     /translation="MAYVLTETSAGYALLKASDKKIYKSTKLIQDLDTSDKVLKEFKI
                     AAFSKFNSAANALEEASSIIEGKVSPQLQTMLEEIKKDKKSTLIVSETKLANSINKLG
                     LNFNVISDAVTLDIYRAVKEYLPELLPGLTDNDLSKMSLGLAHSIGRHKLKFSADKVD
                     VMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKA
                     AETDMSSILPEEIEERVKSAAEVSMGTEITQVDLDNIKCLADQIVDFAAYREQLSNYL
                     SARMKAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKH
                     DTPKYGLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALSEDRDDSGEIGLESRA
                     KVENRLSQLEGRDFRTTPKVVREAKKVEITEARAYNADADTAAQVAESDSDDDSEDEA
                     EEKIDEKKEEKKEKKKEKKDKKEKKRKRDEEEEDTKESKKSKKDKKEKKDKKEKKSKK
                     SKK"
     gene            <167151..>168791
                     /locus_tag="HG535_0F00830"
                     /db_xref="GeneID:59237333"
     mRNA            <167151..>168791
                     /locus_tag="HG535_0F00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289405.1"
                     /db_xref="GeneID:59237333"
     CDS             167151..168791
                     /locus_tag="HG535_0F00830"
                     /inference="similar to AA sequence:RefSeq:NP_014953.3"
                     /note="similar to Saccharomyces cerevisiae SNU66
                     (YOR308C); ancestral locus Anc_8.786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145300.1"
                     /db_xref="GeneID:59237333"
                     /translation="MANDLGISLEETNALRKQLGLKPILVESAKSEESDNGMFESKQL
                     PNTEISLETTQFIEADKVSLLRKKLGRLNPKNNNKTSGGIDGDQSWLDSLGKRSLKPE
                     KKLRMKYEEEDEEADVNDLPMLKTSYTFEKLQSKEQVILTLKESTINNDDQDDDILEN
                     EKEAQERVDSKNIQLKQMNRDRRRKKMKLHVSSLDFKDENENSDSGSVLLIGAQSSLL
                     NEVKDNIEDESHSGRIKVKFEDKNISDNEDDDDKAVKIKKRKRKDINASLKKRRIKLP
                     TEIRKVALIDEDAENDDFDDFSLSRNVKRKAQLTDNVKTSENIALEIEKEKLERRRRL
                     ENISQITRVTKGLIVDEGETFFDSLKPDIIDMNDDYQEIHKTNAGKDDDTGESEQAPS
                     LNVKANGTAEVVQPDFHDGLASTLKFLQTRNVLPKKDPTQQAKDYEVADSAAQQKPRT
                     RYPMVTEPSAERSKAELNGIAHTSKAPNLQYYNPEIKLVYQDKMGNQLTTKEAYKKLS
                     QKFHGTKSNKKKQAQNQFKIEQRNRHAQLRHATDFDLL"
     gene            <169264..>170628
                     /locus_tag="HG535_0F00840"
                     /db_xref="GeneID:59237334"
     mRNA            <169264..>170628
                     /locus_tag="HG535_0F00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289406.1"
                     /db_xref="GeneID:59237334"
     CDS             169264..170628
                     /locus_tag="HG535_0F00840"
                     /inference="similar to AA sequence:RefSeq:NP_014952.1"
                     /note="similar to Saccharomyces cerevisiae SLY41
                     (YOR307C); ancestral locus Anc_8.785"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145301.1"
                     /db_xref="GeneID:59237334"
                     /translation="MITTQSTTTKRRASVHKNLYDPALYRFPEPPLGVFQPKKQSIQL
                     SSNEVISEDGDDKPSVAIEQVQEKFVSLFPHGIQQHLPEVDGKVTLVCLGWYVISSIS
                     SNLSKAILRDFTHPIALTEIQFLLNATFCILFISLVNFLKVEPFNKTTLSKACNNFPE
                     GILPNYLNGSFKDCVTGKFLHPSKVIIIATFPMGIFQFVGHITSYKATSLIPVSLVHS
                     MKALSPIITVGYYRLFQGKQYNPMTYLTLIPLILGVMVTCWSTHGNKKPNSKVNEAGL
                     SIVTGLFHATVSMLIFVSQNIFAKSILTVKAKNGILPSSESSPTLQKKEISSIQIDKI
                     TILFYCSCTGFLLTLPLFLSGELFKDQSVFKDLTLNSFYLILIHGVTHFLQAMLAFQL
                     IGMLSSVNYSVANIMKRIVIISVALIWESRFNFVQLLGLSMTLIGLYGYDKWGISRKA
                     GYQL"
     gene            complement(<170906..>171838)
                     /locus_tag="HG535_0F00850"
                     /db_xref="GeneID:59237335"
     mRNA            complement(<170906..>171838)
                     /locus_tag="HG535_0F00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289407.1"
                     /db_xref="GeneID:59237335"
     CDS             complement(170906..171838)
                     /locus_tag="HG535_0F00850"
                     /inference="similar to AA sequence:RefSeq:NP_013968.1"
                     /note="similar to Saccharomyces cerevisiae YHM2 (YMR241W);
                     ancestral locus Anc_8.784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145302.1"
                     /db_xref="GeneID:59237335"
                     /translation="MSANKQTAVLEKKPISFSNILLGAGLNLSEVTTLGQPLEVVKTT
                     MAAHRNISFFQAIKHVWSRGGIFGFYQGLIPWAWIEASTKGAVLLFVSAESEYRYKVM
                     GLNNFTAGIMGGVTGGVAQAYLTMGFCTCMKTVEITKQKSSAGGVPQSSWSAFKDIYK
                     KEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEEGIRNFTGKTNPDDKLTALEKIFAS
                     AIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKAFKYIYNSNGIKGLYRGVAPR
                     IGLGVWQTVFMVGFGDMAREFVGKLTGEKPAAKH"
     gene            complement(<172104..>172838)
                     /locus_tag="HG535_0F00860"
                     /db_xref="GeneID:59237336"
     mRNA            complement(<172104..>172838)
                     /locus_tag="HG535_0F00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289408.1"
                     /db_xref="GeneID:59237336"
     CDS             complement(172104..172838)
                     /locus_tag="HG535_0F00860"
                     /inference="similar to AA sequence:RefSeq:NP_014950.1"
                     /note="similar to Saccharomyces cerevisiae YOR305W;
                     ancestral locus Anc_8.782"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145303.1"
                     /db_xref="GeneID:59237336"
                     /translation="MRLFKRLLCNNTIRKFINQNGAISQSSVFQGTLYEYTVMRELQT
                     KLSMCELERVGGANDHGIDIKGSWHIKNIYRKMNPLLNLDQIEAPKRCRVNGAIFKPY
                     RSKALMEDLKVLVQCKGRTHSKVGPREFRELIGTFTSTVTPTNRNKTVMLMCSPHMLT
                     KNGLKLIEMLPIPVIYLRIELLRSAEGLYDLMNSGRLLNYYENQFAQQFLQGCGINEW
                     LKLTMYSATQQQDVIDEKATKTILSN"
     gene            <172978..>173217
                     /locus_tag="HG535_0F00870"
                     /db_xref="GeneID:59237337"
     mRNA            <172978..>173217
                     /locus_tag="HG535_0F00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289409.1"
                     /db_xref="GeneID:59237337"
     CDS             172978..173217
                     /locus_tag="HG535_0F00870"
                     /inference="similar to AA sequence:RefSeq:NP_014949.3"
                     /note="similar to Saccharomyces cerevisiae YOR304C-A;
                     ancestral locus Anc_8.781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145304.1"
                     /db_xref="GeneID:59237337"
                     /translation="MTADKSQLPAGSGSSEHEKEGSILSVTEEAETSNKTTAFELADT
                     IEQTLKELKQKLDENYQKFDKSVVILEQKLKEPGQ"
     gene            <173686..>175125
                     /locus_tag="HG535_0F00880"
                     /db_xref="GeneID:59237338"
     mRNA            <173686..>175125
                     /locus_tag="HG535_0F00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289410.1"
                     /db_xref="GeneID:59237338"
     CDS             173686..175125
                     /locus_tag="HG535_0F00880"
                     /inference="similar to AA sequence:RefSeq:NP_013967.1"
                     /note="similar to Saccharomyces cerevisiae CUS1 (YMR240C);
                     ancestral locus Anc_8.780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145305.1"
                     /db_xref="GeneID:59237338"
                     /translation="MARKSHRSSRTSKKLPDQKQEIAQLLDRKRQTHNAKDVADTHNG
                     KKKDAKELALEKQFSSIIEKFKIPDARKGRGQLIVKEEVAKGIRGHERDHDHDLLKED
                     PEKPKSKTRGRKQDQPSLSRLKCETSYPQMVEWYDCDAMYPHLLVSIKTSKNVVPVPG
                     HWQMKREYLSGRSLLEKRPFELPEIIRQTDIEQMRKTLPDGEDDDSTLSSKQVSRTRV
                     QPKLGTLDIGYAKLRDVFFKLGAKWKPDVLLPFGDLYYENRNLHEESEWRKFVKEKEP
                     GKLSTELREIMNLKEGQLPPWCMKMKSLGMPPGYPTLKIAGLNMGIENLSGDTYGRLE
                     RLHNKKRAAMFGAIISLEDDAQEQKGKKSIKKEEQKLIVPAAIDSKLGPLGENLKIEI
                     NRRTPTNHELSETASEPGRNSQRESKQLYTVLPERKADDMTANTGSKSMYEVLPAGKH
                     LATNTNLQDEYKLKSDGNEDEESIDKFRF"
     gene            complement(<175205..>176752)
                     /locus_tag="HG535_0F00890"
                     /db_xref="GeneID:59237339"
     mRNA            complement(<175205..>176752)
                     /locus_tag="HG535_0F00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289411.1"
                     /db_xref="GeneID:59237339"
     CDS             complement(175205..176752)
                     /locus_tag="HG535_0F00890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145306.1"
                     /db_xref="GeneID:59237339"
                     /translation="MIEYDLVIKNGLICTASDIYPADIAIANGKVCCIAKNIDENLAN
                     EVIDAEGGIITPGGIDAHVHVDEPMKLLGDVADTMEDATMSAVAGGTTTVIAFASQDT
                     SLKGPKALSESVGKAIALYGKQTLYCDYALHLIIAKLEKDGLAGRDILGEQLETLYAD
                     HSVTSLKLFMTYPGLQMSDYNILNTMYNTRKNGFTTMIHAENGDMVKWMIDSLEEQGL
                     TEPYYHGVSRPTIVEGEATNRAVTLARTMDTPILFVHVSSPQAVDVIRKAQTDGLKVY
                     AETCPQYVLLSDMDTKCHGNHDDKFIGAKNICSPPLREEECQKRIWQGMNDGSFTIVS
                     SDHCPYLYSDKGQGKHNAFKNGKNGDFKYIPNGMPGVSTRMPLLFDYGCLRGNLRSMM
                     KFVEINCTNPAKLYGCYPQKGALLPGSSDADLVIWYPNDIKTYKNRPKTITNALLQHA
                     CDYTPFEGFEIKNWPRYTIVHGRIVYKEGMIIRDNAKGSYLPRSKSSLCTPDGDWLTE
                     WRPIYAK"
     gene            <177222..>178724
                     /locus_tag="HG535_0F00900"
                     /db_xref="GeneID:59237340"
     mRNA            <177222..>178724
                     /locus_tag="HG535_0F00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289412.1"
                     /db_xref="GeneID:59237340"
     CDS             177222..178724
                     /locus_tag="HG535_0F00900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145307.1"
                     /db_xref="GeneID:59237340"
                     /translation="MSTQLKKDRKRKRSTTEDQEVSDSSKAKRQDKRVRREGKDEHNF
                     SYQYSQVLQLEHAVSKFLESYKCIVDLSPNLKIYNKFVDNRENIPMQILPSLARHKLK
                     LAAELRTLYELKESPFFKECLEYESKYDERDANAIFTNIKTEDIEKLSSECVDSRVMQ
                     DKLKGGVNDNGNDGPDGDDEDDDDAEDSYDPSRESKGGKWPPKLPEIKDPAIRARVFI
                     HKSNINDKVYLSEAEMINAHNERLEFLGDSVLNTIMTMIIYNKFPKFTEGQLSTLRMN
                     LVSNERIKTWSFMYGFDKKLSTNFDVTSDNASFQQGKQKLYADVFEAYIGGLIEDDSR
                     HNMPKVRKWLSKLSKPIIQKLTEKNIGLQATDNLNVNAKRQLYSLIGYAALNLHYVTA
                     KRPTAINPNTVVECRIGDGTVLGSGSGRNTKIAGIRAAQNVLSKKSALEKYAKARAAI
                     PKTESIVRHDDKSIKKNNQQNEPSSGSSPSGNANKRIRLGGDGQFILEDE"
     gene            complement(<178836..>182108)
                     /locus_tag="HG535_0F00910"
                     /db_xref="GeneID:59237341"
     mRNA            complement(join(<178836..182006,182091..>182108))
                     /locus_tag="HG535_0F00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289413.1"
                     /db_xref="GeneID:59237341"
     CDS             complement(join(178836..182006,182091..182108))
                     /locus_tag="HG535_0F00910"
                     /inference="similar to AA sequence:RefSeq:NP_014948.1"
                     /note="similar to Saccharomyces cerevisiae ISW2 (YOR304W);
                     ancestral locus Anc_8.778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145308.1"
                     /db_xref="GeneID:59237341"
                     /translation="MQSSGKQAVLKDAGYWQKRKTRFILDIDPKVAKQKDRSDTYKRF
                     KHLLSLTGLFRHFISMRAKQDKNMQKLLKEIDKDSNKRRNSAADTGSRHSRKTEKEED
                     AELMADEEQREADSLDDPNFITKTPSYIKNGKLRDYQIQGLNWLISLHENRLSGILAD
                     EMGLGKTLQTISFLGHLRYVKNIDGPFLIVVPKSTLDNWRREFLKWTPEVSTVVLHGD
                     KETRNHLLQDVILQAKFDVVITSYEMVIREKSILKKVAWQYIVIDEAHRIKNEQSALS
                     QIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDSEVFDDWFEQNNNEEDQD
                     VVVQQLHTVLNPFLLRRVKSEVEKSLLPKIETNVYVGMTGMQIQWYKSLLEKDIDAVN
                     GAVGKREGKTRLLNIVMQLRKCCNHPYLFEGAEPGPPYTTDEHLVFNAGKMIVLDKLL
                     KRMKEKGSRVLIFSQMSRLLDILEDYCYFRDYEYCRIDGSTSHEERIEAIDDFNKPNS
                     EKFVFLLTTRAGGLGINLVTADTVILYDSDWNPQADLQAMDRAHRIGQKKQVHVFRFV
                     TENAIEEKVIERAAQKLRLDQLVIQQGTGKKTANVGNSKDDLIEMIQYGARDVFSKSS
                     SSVTVEDDIDEILQKGEKKTMELNARYEALGLDDLQKFNGLENHSAYEWNGENFQKKP
                     TDTVKEWINPSRRERRKEQQTYSVDDYYKEIIGGNQKGIQKSSVKSTSQTKTPKPPKF
                     VHGQDYQFFPKELGPLQEKEQMYFKRKVNYKVTIYDVTPRSGSGNDSDEDEDAERKET
                     DEETKEKIKKEQAVIDSAEGFTEVDEETKQKLISQAFSSWTKRDFLSFISACAKYGRT
                     NLAMICKSIETKSPEEVEVYSKVFWQRYQEVSGWEKYIGSIENGERKNEKLRYQETLL
                     KKKIDQFRYPLQEMTLLYPPNNARRTYNTLEDKFILLTLNKYGLFADRLYEKLKQEIF
                     ISNLFTFDWFMRTRSVHELSKRSSTLLTLLMRENETPDFNKRKRNRAVAGEQTPGSQA
                     DNLTGTPNYDATLPEMHVDKKNKVQMEQKQIV"
     gene            complement(<182498..>186634)
                     /locus_tag="HG535_0F00920"
                     /db_xref="GeneID:59237342"
     mRNA            complement(<182498..>186634)
                     /locus_tag="HG535_0F00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289414.1"
                     /db_xref="GeneID:59237342"
     CDS             complement(182498..186634)
                     /locus_tag="HG535_0F00920"
                     /note="ancestral locus Anc_8.777"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145309.1"
                     /db_xref="GeneID:59237342"
                     /translation="MPQIKTNQKRKKDDPNTRDIFGRNSSYIWSCLPTMKGVESVDVY
                     SHDLENGYTPLHVTLKNGHLRKSYTLYKRWKNETEFLSHKFGGHVLNQMDREGLKPLE
                     LYNIEFQTHIQRYPRFVGYGKEGSPEIAWQNDTPKSSLNVKNSFMSIPADIESEVALQ
                     TRGGSHILTLGSNVNYQLGTGTKDDRQNMFQLGINQLSNHETDSDKISFIKIIMTRYH
                     SIVLTSTNKIFTCGNASRGRLGNGITDTPQLNFTETLDLHDSGVSDVVSSNHHSLVLT
                     NNSDIYSWGWNGYGQLGYPTNNKINDEKLLEKVCGSVPKRIPFFDDKDVLTIACSKVH
                     SCAVTKTGRVYLWGLNLGQMGGPKPTHLSPDTEYEGQNGYIISSPVCINLSHLSIQQI
                     VCTDFATFIRSSNNTLHVYSNYMFRTFKIPLPRAKTFKEIDAFAHFAPREIPSEVVDM
                     KCSNSFGNNICFKYTCGRVGMITMKDESSKIWTKFPNSLPVTICWIPNIQSRKCLDFA
                     VSCKGCLLITTLGGDVFTVTASNFTAEQIYSNKLVSGRPIGVSCDPSFGSFAILKDER
                     FEVPIIYPKDNLIYDLSQYSPLSGISPTASATMRGFSSTLEFKLANYHYNFEINEKVD
                     ELAESKRDIFSLLPFTSQHLPKFSGRRNSDLKYDVTIVDPLGKPILECHKLILQNRCS
                     KLKQSLIGHGRFITRDGCLQISLLSGINDGNWILQASSPNISPLDLSKTLKQIVHFLY
                     TDEKPHSLHIPKLLFELMDSSYHLTQLSHSMQRLLYSSVIQEGLEYSGDVILELKDGF
                     VCGHSLLLSSRCLFFQKCLKDQWRHTNNEGLNVIKLDNVESASTFNINCILKYIYGVP
                     YNEILDKIKFDQETEYIQFYLEMLELCDQLDIECFKNYVEGVIVKYMNGETAVPILVN
                     AVNSNSRLLAVNCCWYICTHVGLLFIKDNIDIIEQYFDDTIWELLEGVLKELKYGENK
                     DAGISWYEDASTNWLKYFQANLEMFNERFMDPRFLFIPVFDFKSDTTENLGRRNKKSN
                     RRRSSNYSFNKIQQHSVICGDSNSARKAPITSNTSNNAIPIRKNSWNFSEIASDNEAV
                     IDTEEFIDVVKKSKRRMSSQAPHVVEAQAPVPSSKVVVHKSKETAEEDLPSLLPSTSK
                     SVSPSPVFANGNSTSNAKITGAFKKESQKQRRKQLTDQETKQEPRSTKKTVWGGPSSP
                     SVTNSVASSGRKSLPSLYDDGSTGELTQTKKEKKKMAWSNSTNTEFVSHGNLSGITPY
                     LYKVSMAQSATSTSKPVRNAALPEAPPKPKLSLEERVAAQEFEKWFAEESAKVQTQLK
                     NDKRKARDEMQLMYNAANNLPDSIIGSSEFQTSSKKGRKLNLKFQNKNKDKSLIRTLQ
                     "
     gene            complement(<187642..>188832)
                     /locus_tag="HG535_0F00930"
                     /db_xref="GeneID:59237343"
     mRNA            complement(<187642..>188832)
                     /locus_tag="HG535_0F00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289415.1"
                     /db_xref="GeneID:59237343"
     CDS             complement(187642..188832)
                     /locus_tag="HG535_0F00930"
                     /inference="similar to AA sequence:RefSeq:NP_014947.3"
                     /note="similar to Saccharomyces cerevisiae CPA1 (YOR303W);
                     ancestral locus Anc_8.776"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145310.1"
                     /db_xref="GeneID:59237343"
                     /translation="MTQEKATFTIKNGPTFEGISFGAKKSVAGEAVFTTSLVGYPESM
                     TDPSYCGQILVFTQPLIGNYGVPSGTARDEFNLLRYFESPHIHVVGIIVAEYAYEYSH
                     WTAVESLASWCQREGVAAVTGVDTREVITYLREQGSSLGRITLASQEPVEYSDPMSTN
                     LVSKVTTREPFHVKALNSKCNIALIDCGVKENIIRCLTSRGANVTVFPYDYEIQNIAS
                     EFDGIFISNGPGDPTFCTKTVDNLKELLSIESLHGLPVFGICMGHQLLAMAAGAKIMK
                     LKYGNRAHNIPAMDLTTGRCHITSQNHGYAIDDSTLKPDWKPFFVNLNDKSNEGMIHI
                     SRPVFSTQFHPEAKGGPMDSAILFDKYFENIDSFKLEKSNNLKLANTSTTINVDTLAV
                     ERVF"
     misc_feature    complement(188886..188963)
                     /note="Short protein (HG535_0F00940, QLG73584.1) was
                     converted to a misc_feature."
     gene            complement(<189269..>190570)
                     /locus_tag="HG535_0F00950"
                     /db_xref="GeneID:59237344"
     mRNA            complement(<189269..>190570)
                     /locus_tag="HG535_0F00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289416.1"
                     /db_xref="GeneID:59237344"
     CDS             complement(189269..190570)
                     /locus_tag="HG535_0F00950"
                     /inference="similar to AA sequence:RefSeq:NP_014945.3"
                     /note="similar to Saccharomyces cerevisiae RAX1 (YOR301W);
                     ancestral locus Anc_8.774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145311.1"
                     /db_xref="GeneID:59237344"
                     /translation="MSESKNESEYDRVQEERLPTLYEVLLRKSTAPLDSWEFYTYLSQ
                     FPYAIDYLDFWIDLMAHIRLCKDYIRGLRDSIQWSSMADAEDDRDLEGKEGQRFSLTS
                     SVLLNALLNEGYLDHDDNHRISLFLQGNTEESQYISHLVNTWKVQSGSNEKETKERKE
                     TLPSMIDLIIRKENKEGRSRISSKQLANSAMGICNIYLMSPEQSPKYLINVPDGLKKE
                     LLYKIRTERRHDPEVFDDLKKLAYQFLEIDCFPKFLSTVALHNIHDQITNWRFTNELK
                     KEQNVHHSMSPYSNYTALSRIATGLFVLGLGFWIGYVLIFLHYSRGIRVVTIVPFFIG
                     CYSIVCGFYQVDILYAFFGYTQLLMDDPITFSKEYTNEPERRKAPTFFRLLGGRSRLI
                     VIQHPFTRQLLFKRGIWCLCLVLIFTAILTVIFSCVPSYRL"
     gene            complement(<190853..>192229)
                     /locus_tag="HG535_0F00960"
                     /db_xref="GeneID:59237345"
     mRNA            complement(<190853..>192229)
                     /locus_tag="HG535_0F00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289417.1"
                     /db_xref="GeneID:59237345"
     CDS             complement(190853..192229)
                     /locus_tag="HG535_0F00960"
                     /inference="similar to AA sequence:RefSeq:NP_013965.1"
                     /note="similar to Saccharomyces cerevisiae DFG5 (YMR238W);
                     ancestral locus Anc_8.773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145312.1"
                     /db_xref="GeneID:59237345"
                     /translation="METRMITLKQIVLTLLLCITQVIGIQLDTSSKDSICDATSLIQD
                     GMLDYYDGTRNGGIVGMFQSPYYWWQAGEAFGGMIDNWYFCNNNTYENLIYDALIAQT
                     GDHYDYMPGNQTMVEGNDDQGVWALTVMGAVERNFTNPTGGRPGWLAMVQAVFNQMYS
                     RWDTGACGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDIAEKVFN
                     WLVEVEYVVLKDQGNVFDGAETDDNCSNIIRFEWSYNHGVVLGGLAYMYNATNGSSTW
                     ETRVQQILGGAQEYFFNDSIMYESTCQRGSTITCNNDQRSFKSIFSRMLGLTSVLVPS
                     TSSSIDNLLRASAEGAAGSCTGGYDGHTCGLSWLTSSNDGIYGLGEQMSALEVMQNLL
                     IHDKPPPFKTDNGGSSSGDASAGLNTTTTNVLRNELDITTSDRAGAAVVTAVILLVLI
                     GGSIWMLF"
     gene            complement(<192547..>194769)
                     /locus_tag="HG535_0F00970"
                     /db_xref="GeneID:59237346"
     mRNA            complement(<192547..>194769)
                     /locus_tag="HG535_0F00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289418.1"
                     /db_xref="GeneID:59237346"
     CDS             complement(192547..194769)
                     /locus_tag="HG535_0F00970"
                     /inference="similar to AA sequence:RefSeq:NP_013964.1"
                     /note="similar to Saccharomyces cerevisiae BCH1 (YMR237W)
                     and BUD7 (YOR299W); ancestral locus Anc_8.772"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145313.1"
                     /db_xref="GeneID:59237346"
                     /translation="MFSQGSIPEVKEDVIGYALNERKLNIPQFKDLGPPDLITMIKYI
                     PSNHQSYNNTGDRHHQHHKNGSAALDKSSNGETSAAASTNGNVDQTSIVTGLHSKDKL
                     KGEIGTFFYSMGVDASDPTSIAVYLKTIADTISEEGQVWFGKTKNFNVAKISFSTWNT
                     FRKCDLNVVVHIPGTVQTFILDSQGEQLQMAGHGPETERDHELLWAETFFSGVVRAIM
                     LMRDNREEGEVQNLVETLILNPLTSGQLESVSETFIALFPLVYENGPHLGGPCDVTNI
                     TKVNNYLIETLVEIVKITKSVDQCRSMLEQLMVKNPEVVVILARVLLTNDMEIDAIDL
                     INGPLLSLQDDSLPPHLDYKCDLLSIQAEFLIDIKQDYKLAAKIGQAAVNCAPSEFRP
                     WYLLARSYIKLNDVENALLTLNSCPMTPLKEKYALKRVAPIPSDSSLHLPLPVDVIFD
                     DISSLDPLEIQREHKNADASLVNLAASNLKSVFQLAYKLLTEVVQITGWEALLKYRSK
                     IFVMEEEYQISSTDEVDKSKDETQTPSKSPENISDRGLRSKRLCERWLDNLFMLLYED
                     LKTYTLWQTEQLYFEAQYSKYNKLTFEWELFGLCARRLGHYPEAARAFQTGLSQRFSA
                     ECSRRLLEYCIKERQKVRLQSGSPNSEMSSSQIIGRINELDSTIIDLVVKICCWNHRW
                     YIEFSLLLINSLSEVIQDMGLTKISSEISSKYPESVYQLLSDNFLDFFTKYTNSFYDT
                     "
     gene            complement(<195008..>195502)
                     /locus_tag="HG535_0F00980"
                     /db_xref="GeneID:59237347"
     mRNA            complement(<195008..>195502)
                     /locus_tag="HG535_0F00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289419.1"
                     /db_xref="GeneID:59237347"
     CDS             complement(195008..195502)
                     /locus_tag="HG535_0F00980"
                     /inference="similar to AA sequence:RefSeq:NP_013963.1"
                     /note="similar to Saccharomyces cerevisiae TAF9 (YMR236W);
                     ancestral locus Anc_8.771"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145314.1"
                     /db_xref="GeneID:59237347"
                     /translation="MPSSQANGYGHAGSGNGSTSGNGVSGGSGAPGETASQDNIPRDV
                     RLLHLLLASQSIHQYEDQVPLQLMDFAYRYTRGVLKDAVVYNDYADNTGGLAVEDVRL
                     AIAARTQYEFKPTAPKELLLQLAAERNKKSLPQVMGMWGVRLPPEKYCLTAKEWDLND
                     DKTT"
     gene            <196018..>196479
                     /locus_tag="HG535_0F00990"
                     /db_xref="GeneID:59237348"
     mRNA            <196018..>196479
                     /locus_tag="HG535_0F00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289420.1"
                     /db_xref="GeneID:59237348"
     CDS             196018..196479
                     /locus_tag="HG535_0F00990"
                     /inference="similar to AA sequence:RefSeq:NP_014942.4"
                     /note="similar to Saccharomyces cerevisiae MBF1 (YOR298C-
                     A); ancestral locus Anc_8.770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145315.1"
                     /db_xref="GeneID:59237348"
                     /translation="MSDDWESSTVIGQRVRTGGGGGPRANVARSQGQINAARRQGLVL
                     SVDKKYGTTNTKADSEGQRLTKVDRETDIVKPKKLDPEVGKAISRVRTEKKLSQKDLA
                     TRINEKPTVINDYEAARAIPNQQVLGKLERALGVKLRGKAIGEPLGGPKKK"
     gene            <196752..>197975
                     /locus_tag="HG535_0F01000"
                     /db_xref="GeneID:59237349"
     mRNA            <196752..>197975
                     /locus_tag="HG535_0F01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289421.1"
                     /db_xref="GeneID:59237349"
     CDS             196752..197975
                     /locus_tag="HG535_0F01000"
                     /inference="similar to AA sequence:RefSeq:NP_013962.1"
                     /note="similar to Saccharomyces cerevisiae RNA1 (YMR235C);
                     ancestral locus Anc_8.769"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145316.1"
                     /db_xref="GeneID:59237349"
                     /translation="MSALHFQPQHEPSQVYSIAGKALKLTSAEDIEPVIDELSKLSKC
                     TKIDLSGNTIGVGASKALADFISKHDSVKDYVQEINFADLYTSRLVDEVVESLNSLLP
                     ALLSCNQLEILNLSDNAFGLRTIDILEKFISNAVHLKHLILSNNGMGPFAGERIGKAL
                     FHLSQNKLKSKEPMLETFICGRNRLENGSALYLALGLKSHGDGLKNVRLYQNGIRPKG
                     VSTLIQYGLRFNKNLKVLDFQDNTFTKTASSFLAKNLPIWKLSLIELNLNDCLLKKDG
                     CDEVFKVFQNDKFVNLEILKLEYNEMVQETVESSLLPALENGNLPNLKILEVNGNRLE
                     EDSEALDTLQGLFTELELDDLEELDSEDEDEDEDEEEEDEAEKFEEIETEVLEKNLLE
                     LSINDLADNLSKTHI"
     gene            complement(<198021..>199514)
                     /locus_tag="HG535_0F01010"
                     /db_xref="GeneID:59237350"
     mRNA            complement(<198021..>199514)
                     /locus_tag="HG535_0F01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289422.1"
                     /db_xref="GeneID:59237350"
     CDS             complement(198021..199514)
                     /locus_tag="HG535_0F01010"
                     /inference="similar to AA sequence:RefSeq:NP_014941.1"
                     /note="similar to Saccharomyces cerevisiae MUM3 (YOR298W);
                     ancestral locus Anc_8.768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145317.1"
                     /db_xref="GeneID:59237350"
                     /translation="MAVRDSVETNFFGSIHNIQKTWEVYDWICVSLRIAILCSYIISQ
                     SVISCCQRFLKFSVQNHLMNILLKINQTLCNCVPFFGKHLQQVLPKAISFISERVLPG
                     LEKLSQVVQLCFQLHVVEMTLKDKKNVQIFVTAESDDLNLYDENNRVMTTLLISNHRS
                     INDYVLINYLLQHSGYNSISFANKREILKNFWSTGELSFPRLKFLTWGKVVNFPHLSL
                     IKNILIKDENSFVMPKEIKQHLSKDGNEVVTIFPEVNILTTELSIVQRKLNQDYSFVA
                     KFYNVLYPRFKSFISVVRCFGNINRVKTKHHSSVFDNAKKILNNGVDKFVIKASSQSE
                     NTVEQDFAQASMVLGLQNSYGGEIKEEPSKCNNGKQEKAVPKELIRVNRNLFDFTIVY
                     YKPKCTNTKFDHDHLNGQFKLHNGYQLEQVNPSFFEMLQPEKVSIEENPTYTTTKPPI
                     VIMIHIKKHELGPLLPAKGRNLEKWLENQWSQKDKLIDCIENGISIR"
     gene            <199778..>200347
                     /locus_tag="HG535_0F01020"
                     /db_xref="GeneID:59237351"
     mRNA            <199778..>200347
                     /locus_tag="HG535_0F01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289423.1"
                     /db_xref="GeneID:59237351"
     CDS             199778..200347
                     /locus_tag="HG535_0F01020"
                     /inference="similar to AA sequence:RefSeq:NP_014940.4"
                     /note="similar to Saccharomyces cerevisiae TIM18
                     (YOR297C); ancestral locus Anc_8.767"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145318.1"
                     /db_xref="GeneID:59237351"
                     /translation="MLLLGLGKSFSSGRLGSQSAPKILNVGRTLLNRNLSLKPDLSKF
                     KLNSPPPGGVVGTSNDAFKPPEPDYFHGSYHWYYERITAASLIPLTSIPLYITLTGGV
                     VPPLLDAALGVVLLLHVNQGLTSCIIDYIPKRKFGIWHDLARYLLFGGSGLGLYGIYD
                     LETSNNGIVDLLTKILKEDESNLYIFGRN"
     gene            complement(<200593..>201822)
                     /locus_tag="HG535_0F01030"
                     /db_xref="GeneID:59237352"
     mRNA            complement(<200593..>201822)
                     /locus_tag="HG535_0F01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289424.1"
                     /db_xref="GeneID:59237352"
     CDS             complement(200593..201822)
                     /locus_tag="HG535_0F01030"
                     /inference="similar to AA sequence:RefSeq:NP_013961.1"
                     /note="similar to Saccharomyces cerevisiae RNH1 (YMR234W);
                     ancestral locus Anc_8.766"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145319.1"
                     /db_xref="GeneID:59237352"
                     /translation="MKTGFISSLLSESGYSLFTKHIEVHSVFRVIKMAGKKGGYYAVQ
                     KGRNTGVYSSWEECKAQVSGFSGACYKRFDTLAESQAFASNNSGYSGYSGYSRGSSDS
                     GNSENYNDSSTSIEYSRPTRHHNPSYSFNYPTFDSYYSSVSPSYTKFVSKSTPKINAN
                     SKTKNYYSVRSSSKESSSQIFDNWNDCQQYVKGRKGISFKKFDNQEDAINFMNGSSNP
                     DVNYRYIGVSAEQFGSQYKIPKKSVKYDKISTVYCDGSALANGTSSSRAGYGVYFKDE
                     EGYNISEPLRQGTQTNNRAELQAVSSCLDTIWENLTEREDKRNYEIKTDSEYVAKLLN
                     DRYTSLTPSEQSSMPNRDIALDLIKKFAKVKEFYEINKDQFENKGEFKIQWVKGHAGE
                     EGNEKADQLARAGALKL"
     gene            202750..202821
                     /locus_tag="HG535_0Ftrna5D"
                     /db_xref="GeneID:59237892"
     tRNA            202750..202821
                     /locus_tag="HG535_0Ftrna5D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:59237892"
     gene            complement(<202940..>206851)
                     /locus_tag="HG535_0F01040"
                     /db_xref="GeneID:59237353"
     mRNA            complement(<202940..>206851)
                     /locus_tag="HG535_0F01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289425.1"
                     /db_xref="GeneID:59237353"
     CDS             complement(202940..206851)
                     /locus_tag="HG535_0F01040"
                     /inference="similar to AA sequence:RefSeq:NP_014939.1"
                     /note="similar to Saccharomyces cerevisiae YOR296W;
                     ancestral locus Anc_8.765"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145320.1"
                     /db_xref="GeneID:59237353"
                     /translation="MRRIASGSSYSTSESLLTVPTVLQAYGTTVSSSELYLYTLRLLV
                     LEYINEPRFQEKYVRETVPATSVKEVSKSERRSRRVSWFSSGTAPVKGPTEVEILQNI
                     LPKLEKYLSKVAVGKVKLLNDKLRRSYLKFYNDVFLNPTMTQTLKSMQRFEELIVHFT
                     KAANGELNKLIVDNIQKELYTEISCFINILIELGSASITGSLKIKLEQYKDSVKPRKT
                     SLKKITSELSIEPSKLENTVNVTLRPTFRLNEVTHSSYFMELFQVDEVQLQQDIITAM
                     KVSQNHVYCEELLALRRRVANDTGQFSVQDFSSEKYYENWKTYEMSEIAVLLDKFNDK
                     GKSAVKYENLQNIIPKNSRDMFTALLVKIFRKESVNSIDSLGLSQTGLFFLTKASKYW
                     RVDYHSTLGSLSYTAANLSILDDEELNPKLTENLFSFINTRILRFEDNSNVAAWNDID
                     QRMWLVNLFHTSEQCINSINNLLTAIYTSTKPKFSPVLSFYYTYVETDPSMILFKKRS
                     AYSNTRPLRRLRKTIFETSERYYISLLEGVPKDNTIEIQHIQNVAELIIEQIKSIQKR
                     YSKPLLDNINLSFECATVLIEALASDAPTMIKRAEKYNEAKRGEAIPPVDALEAYSVF
                     KEVHDIYSQVKPGAAFPFKLESLFSRYLNDLCGEVCSRIPRVIESSIQNESWLSVNSE
                     TNFSSSVVDIFKMINESIAMFRKLQWEDKYENAKVITLLLKAFSDGIHTYATNSLAIL
                     EKDLLHDSSEMNINGEENKENVNDGRFSSEILRNWSFTDMKNAFRSSSVVMAPKPYQF
                     KKRTCVILNNLEAMIQKINDLDEQLKAEQLSEVIVHNERKMRGKKASFTNSKQTLHQI
                     YTVRVIGAENIKGFSNDGLSNAFVSLVDTKKRSEIGKTKTVAKSINPVWDEEFEIEIP
                     VEKSRSIALTVWHRPRGKLHQLSNYDICGNCSLLLDHRKFTDDGFPNEVMLLLGTQGR
                     LLLEVSLESEKMDPLFCIGRAYRTLTRTRDRAIELVINKFVTFIDYAFSRATLRAVCG
                     NYGTTPAPKDVIYDAIVPLFDYLNSNLSVIASTLSQTLLFKVMLKGWSYILGAADSLL
                     LPQLTMAKYKRLSGTKSRWENAVSSALGNAYTVSGYGRALTQLEIETIFVWVNALCID
                     FFHNHGEGPPLSDLKNKHYQTILLIPAFFDKSISELKREVDTLSPDYAKYLNQVTITN
                     SSSRKFSVKLSTLARNKTIMANASKKRRSKIRQQVEELESGQLERNAEILDVLLRTLI
                     AKGEMDYVHKHLTTREKVRKKVATEKLVKAAVDGQKNHRTH"
     gene            complement(<207066..>207722)
                     /locus_tag="HG535_0F01050"
                     /db_xref="GeneID:59237354"
     mRNA            complement(<207066..>207722)
                     /locus_tag="HG535_0F01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289426.1"
                     /db_xref="GeneID:59237354"
     CDS             complement(207066..207722)
                     /locus_tag="HG535_0F01050"
                     /inference="similar to AA sequence:RefSeq:NP_013960.1"
                     /note="similar to Saccharomyces cerevisiae TRI1 (YMR233W)
                     and UAF30 (YOR295W); ancestral locus Anc_8.764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145321.1"
                     /db_xref="GeneID:59237354"
                     /translation="MVDLHTYVPMIDAILSASNPDEVTPKRIRKALQELFGINLDTHR
                     KEVNQLIIQRFEESKQRPRYLITKEELRRKDEALASKLQTAAKRAKSSKSSSVKKKKK
                     RSNNDANSNPNALNLRKVMISEPLSGFLGETSLPRTQIVKLVWDYIKDHNLQNPDDRR
                     EILCDDRMKPIFGEKMTMFTLNKILSKYLSNSEEIGVKKSPSSPEDKLNFPEASEATE
                     "
     gene            complement(<207916..>208533)
                     /locus_tag="HG535_0F01060"
                     /db_xref="GeneID:59237355"
     mRNA            complement(<207916..>208533)
                     /locus_tag="HG535_0F01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289427.1"
                     /db_xref="GeneID:59237355"
     CDS             complement(207916..208533)
                     /locus_tag="HG535_0F01060"
                     /inference="similar to AA sequence:RefSeq:NP_014937.1"
                     /note="similar to Saccharomyces cerevisiae RRS1 (YOR294W);
                     ancestral locus Anc_8.763"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145322.1"
                     /db_xref="GeneID:59237355"
                     /translation="MSKDFKSLPVTVEKGIPVTYDLGNLSVFDSNALNKSDLDSSNAK
                     REEHLKDMTRDNVQLLINQILSLPMKTTTESAGGTSNQSASMTLIQLPEPTTELPREK
                     PLPKPKAPTKWELFAAKKNIKPKERAGKMVYDEEKGEWVPKWGYKGSNKTLDNQWLVE
                     VDEKVKGTENELVDPRTLNRAERKNLVKKNLRQQKKNSKNVLGSK"
     gene            complement(<208746..>210818)
                     /locus_tag="HG535_0F01070"
                     /db_xref="GeneID:59237356"
     mRNA            complement(<208746..>210818)
                     /locus_tag="HG535_0F01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289428.1"
                     /db_xref="GeneID:59237356"
     CDS             complement(208746..210818)
                     /locus_tag="HG535_0F01070"
                     /inference="similar to AA sequence:RefSeq:NP_013959.1"
                     /note="similar to Saccharomyces cerevisiae FUS2 (YMR232W);
                     ancestral locus Anc_8.762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145323.1"
                     /db_xref="GeneID:59237356"
                     /translation="MYKTSRFIEQINCPGTSSLTPIRDYENDFFHINDDKLPSKPKNT
                     YKKANLEPLLKKKGAKSNKRPASLVLAQFPEPVNKKQCSPLYSNDFKELAKVATQSPI
                     KSDPNSKISEFIRSIKLLYDNEVEYAKMMELSNSVYRKNLNENPAFKAKLLGVGSHNE
                     ISIFGNIETIASISRLFLNSLQGALVDQKFKEVDELFWEEIDKKSTLQEKLAKNLDIG
                     KIFNLNFLRIKSTYLTYFVTHRKQMEFLDYMRVGNEKLFEKWYKHCFTLANNNKLEDI
                     FELPIKRLSEWTLALEKLCILTKDELFESCIRDNIRNTLEQYRTFEKYVENEISEFNG
                     TVNYDFSLTPIEIIQSYGLDNVNVHTPLQNSNEKAEKDHKKGNKRLTCNSIKTFDRST
                     RTVSIFSGSSSRYSEYDIPSTIDASVQSTNSSSNLTSDSNILWDSTISDLTLCDHVEN
                     FKKVHRGLSNLKKILGKDDMISVLDIHLKHAALWGAVIECDGENIAIQEDATFFFSSM
                     HNEYINKLQRLREDVAVMKVTEMETLVKKPLVAMLKCCDSVKAQLHDLNVLKRDYMVY
                     LREKRSSLQDMKREILANHFKKLQAKLLHDLPIFMDLVYRTTSLVILNYHKMMQKYLE
                     ITAGGELFLIKDLERLGHLRKDAGRNFDILQSYSTSRFCSKRYVRDNWFFEQDQTESR
                     ILRKLFEL"
     gene            complement(<211071..>214190)
                     /locus_tag="HG535_0F01080"
                     /db_xref="GeneID:59237357"
     mRNA            complement(<211071..>214190)
                     /locus_tag="HG535_0F01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289429.1"
                     /db_xref="GeneID:59237357"
     CDS             complement(211071..214190)
                     /locus_tag="HG535_0F01080"
                     /inference="similar to AA sequence:RefSeq:NP_013958.1"
                     /note="similar to Saccharomyces cerevisiae PEP5 (YMR231W);
                     ancestral locus Anc_8.761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145324.1"
                     /db_xref="GeneID:59237357"
                     /translation="MSVSSWKQFQFYESTPIRDPLLGSDTPLYADPTLSAAAPIASSR
                     LALAIRSNVLRVVNLSKTEIEHEFVAFEQGFQITYLKVIGNNFLVAVGEQIGKPALIR
                     IFKLEKLPNNESSYHAQVEVKNGNNTYPISVMSVNKDLSCIAIGFVNGRILLIRGDLS
                     RDRGSRQRLIYEDSGREPITALFLNKEATNCFAATTSSILLFNTTGRNSGQPDIILNS
                     QQGIDLNCSCYSDFTGEYICSLKDCMHFYNEMGESHSLLFDLSNVKKLYSVDPDHILL
                     VVEAEQAQSSVLAVEEFTHSKANRVIIIDTKNKIISLNILISHAIIDIFSVVETNNTR
                     ATYLLTSEVLICKITEKPPQEQLDIVLQKEMFPFALDLAAQTSLSAFKVQEIHKQYGD
                     WFYKKGQKSEAVNEYIQCLDVVETSEIISKFGVNETPDPDGLKNLSDYLWSLVKSGIS
                     NSDHITLLLIALIKLRAEDEIIYFMNHYSRSGHYSKEPITKDVDDESYFYSDGSLFDL
                     ELVVRLLQESNFEKLASNIASKYAKDATIIVEILLQSLNDPHSALKYIKSLSIDETLR
                     VLVAFSKKLLEALPNDTNLLLIEVFTGKYKQKSYNLKPKQSETQSHSHEFLDDAKKVF
                     YSYKTFLNYINDTMINTAFEQDSLTDNASPTYHPPKPSLIFTSFLSKPFEFVVFLEAC
                     LESYQQYEGSKEDKQEILTTLYDLYLSLANDDVQERQKDWKSRAKKVLKESNSLVMTN
                     EAATTRSGVPSKPVDNSLMMLISHMNEMGIYSVATSTENENSSSTLDSGNRANLVNTF
                     RSLTFTDQTAECLQFLEKYEEQEPQLYRVALTYFVSSRRLLKAIGGEQVLKEKILNKI
                     LEKNLMPILDILQVLGSTNVVTYGLIKDMLISHVKEEEEEITKSEKLIKSYELELQTK
                     KEKLKKLLNFDEPTQIKVKNSKCLVCNTSVELPLIYFKCGHIYHVRCLNEEDKLENGE
                     RLFKCPKCVVEVEMSERLFHAQKAVGSKADLLQMALNDEDDSSNRFKVVTEFIGRGGL
                     EYSHITLEK"
     gene            complement(<214992..>215614)
                     /locus_tag="HG535_0F01090"
                     /db_xref="GeneID:59237358"
     mRNA            complement(join(<214992..215263,215569..>215614))
                     /locus_tag="HG535_0F01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289430.1"
                     /db_xref="GeneID:59237358"
     CDS             complement(join(214992..215263,215569..215614))
                     /locus_tag="HG535_0F01090"
                     /inference="similar to AA sequence:RefSeq:NP_013957.1"
                     /note="similar to Saccharomyces cerevisiae RPS10B
                     (YMR230W) and RPS10A (YOR293W); ancestral locus Anc_8.760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145325.1"
                     /db_xref="GeneID:59237358"
                     /translation="MPKEDRTKIHRYLFQEGVVVAKKDFNQPKHDEIDTKNLYVIKAL
                     QSLTSKGYVKTQFSWQYYYYTLTEQGVEYLREYLHLPEHIVPGTYMQDRSQNQAQRPQ
                     RRY"
     gene            <216239..>217201
                     /locus_tag="HG535_0F01100"
                     /db_xref="GeneID:59237359"
     mRNA            <216239..>217201
                     /locus_tag="HG535_0F01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289431.1"
                     /db_xref="GeneID:59237359"
     CDS             216239..217201
                     /locus_tag="HG535_0F01100"
                     /inference="similar to AA sequence:RefSeq:NP_014935.3"
                     /note="similar to Saccharomyces cerevisiae YOR292C;
                     ancestral locus Anc_8.759"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145326.1"
                     /db_xref="GeneID:59237359"
                     /translation="MSLRLFDRDQIDVTFEETTASSTRLRKWLDGVLDDVTHMRIYNV
                     SVIHWALLVVWLSLLLSFATVYGRLYSASALVATLCANVLLFGVSDIMAQTIQSFLSH
                     RIDPLSRAFDTPFFISGLGDELGFTRSGDEDEEVQSDHDYTDGDEDDNLSVFNDYGSP
                     MSNRAIANINSSADLYDAPDAPESHIFAFYRWICFMFWGFIISFFQVPWYKFLNFFYT
                     EDPSIIQVLERVLSDQLLYSPISLYCFFMYSNYVTESGDAATFDKKIQRLFISTLGCN
                     YLVWPMVQMINFSIVPKHLQVPFSSSVGILWNCFLSMRNASEPS"
     gene            complement(<217248..>221639)
                     /locus_tag="HG535_0F01110"
                     /db_xref="GeneID:59237360"
     mRNA            complement(<217248..>221639)
                     /locus_tag="HG535_0F01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289432.1"
                     /db_xref="GeneID:59237360"
     CDS             complement(217248..221639)
                     /locus_tag="HG535_0F01110"
                     /inference="similar to AA sequence:RefSeq:NP_014934.1"
                     /note="similar to Saccharomyces cerevisiae YOR291W;
                     ancestral locus Anc_8.758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145327.1"
                     /db_xref="GeneID:59237360"
                     /translation="MNGRQHSNGEERRGTHSQQRPSFSSVRTGSTSTTLTSDLIVEQN
                     NTEPYAGATFETVPSSIVSFHHPHSFQSSSIARGSVASNSGADERGRRLTEEDSLIYS
                     PSQRSRSSSHNPHFRFFTEEQISSAEGASTLERADYDTIWDSVPVYEQQAHHDSRLGS
                     QRSSIHSRSSRSSNLNGNLYGSASQERGRSLSRGSRNGSDHEVEEYSSSLHSSSSLQY
                     SIRDRIPAELEENGTESLDDRSSVNSGESSRSIGDTSDHLDNGQGQEDSHTNHKNSST
                     HAEYLKSSYHEKFYSDYIPHQYYQRFYIAEEDLVIGIGGYRTSRIRAFLYNTLCITTL
                     GLFYLLMRWMPYYKMKLCGIRVPLAKAEKVVIESEFGEYCCIDVKRCWYNRPMSTLLP
                     ITPSRMAERCNRDMPNNLHRTDDENPSIPILISFEYRYITFIYSPVEDIFKTNNNWVD
                     PDWVHLGSVTRGLSRNVWEDRVIAFGKNHINLNVKTVSQILFDEVLHPFYVFQIFSII
                     LWSLDEYYYYAACIFLISLLSVIDSLLETKKTSRRLAAISYFNCEVRVFRKEFWTHVS
                     STELVPGDIYEVSDPALTIFPCDSILLSGDCIVNESMLTGESVPVSKVPANQRSMHQL
                     IEDFQNTQISSYVSKSFLFSGTKMIRTRIPHGQTAALAMAVRTGFSTTKGSLVRSMAF
                     PKPASFKFYEDSFRYIGFMGLIALLGFSVSCFRFIQLGLDKKTMILRALDIITIVVPP
                     ALPATLTIGTSFALARLKKKGIFCISPTRVNVCGKIDVMCFDKTGTLTEDDLDIYGVH
                     LSEPVSYNKFKFSKLHSDIKSVFPKFSLNDCNSPLDFRSKNFLISMLTCHSLRLVDDE
                     LLGDPLDFKMFQFTGWSYDEDFQRHAFHSMYDQRHEGDIFPENFGIMPAVVHPNGNDS
                     NNRFTDNDPHNLLGIVRSFEFLSELRRMSVIVKPSSNDVYWAFSKGAPEVIASICAQA
                     TLPQDYDEILRHYTHTGYRVIACAGKTLPKRTWLYSQKVSREEIESNMEFLGFIIFEN
                     KLKEASKSTLATLREANIRTIMCTGDNVLTAISVGRESKLIQFDRVYVPYIDDGPRLH
                     ESVIFWRDVDNCENILDCRTLKPSDSIEDYTLAVTGDVFRLLFREESAIPDTYKDEVL
                     LKASIYARMSPDEKHELMEQLQKLDYVVGFCGDGANDCGALKAANVGISLSEAEASVA
                     APFTSQVFDISCVLDIIKEGRASLVTSFACFQYMSLYSAIQFITVTILYCRGSNLGDF
                     QFLYIDLLLIVPIAICMSWSKPYYKLSKKRPSANLVSPKILVPLVVSILVCLVFQLVP
                     WLLVQGKPWYIKPVIGGDDVVQSSENTVLFFVSNFQYILTAVVLSIGPPYRQPMHKNK
                     EFVIDIIFSILLSSLLMFINPRSFCGKLLQLTKTSKAFKIFIICWACINYYCQLYIPN
                     YMKQYFKKRNSSKKYKNILRQQDLSTV"
     gene            <222271..>227448
                     /locus_tag="HG535_0F01120"
                     /db_xref="GeneID:59237361"
     mRNA            <222271..>227448
                     /locus_tag="HG535_0F01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289433.1"
                     /db_xref="GeneID:59237361"
     CDS             222271..227448
                     /locus_tag="HG535_0F01120"
                     /inference="similar to AA sequence:RefSeq:NP_013956.1"
                     /note="similar to Saccharomyces cerevisiae RRP5 (YMR229C);
                     ancestral locus Anc_8.757"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145328.1"
                     /db_xref="GeneID:59237361"
                     /translation="MAPSDKRKRDQEFPLSREDSTKPLAASSLLRNAEEKSFPRGGSS
                     VLTPLELKQVTNEAAGDVLFGNKASTESTGQEKKTKKRKVSRAPNSKKTVEDEKDQFE
                     GLTEHINFKTLKIGSMLLGQITEINNKDIRVSFTDGISGYVSMMNISGQFTGILEALD
                     DNMGGEGVDEENASSDEEDSNKNNKKSSFELPDLHKYFQLGQWLRCSVTLNTALEPQS
                     GKLNKKRLELSIEPAMVNQFTEDDLDRFTVVQCAVKSIEDHGATLDLGVEGFEGFISK
                     KDCHNFDKLLPGSVFLCSVNKRAGRSVTVNLHFTAKSNKISKISTIEALVPGQTIDFL
                     CESVTGKGVAGKVLGLVSGFLGVNNIHSFGEDELKSQFPVGTNVKSKIIASLFSKDGN
                     RTLLLSTLERTVALDNSLKEIDALDAFSVGYVLDSCTVAGRDSEYLYLKLDNDRLGQV
                     HSSRVGDIEATATIKSRVLGYNNVDNLYELSTDPKTLALKYLRSKDIPFGETVTCEIT
                     AVSSEGINIKIFGGQFTAFVPPSHISDTRLVYPERKFKIGSKARGKILNVDKRGHIFI
                     TLKKSLVNSGDDIKIITSFSDAKQVFESDEKTLAVVQSFRPKGCVLSFFGGIKGFLPT
                     AEVSEVYVKRPEEHLRLNQTVIIKLLQVEEERSRIIATCKVSNDQGKQQKEAIEEMIL
                     GRSIIKVTIVEKTKDSLVVEMNEVGLRGVVYAGHLSDSRIEQNRAQLKKMKIGAELEG
                     LVIDKDTRTQVFNMTLKQSLIEDAEKGELPLLYEDVKAKDNQTAMHGYIKSFSAKGLF
                     VAFNGKFVGLVLPSYAVESKEVDISKTFYLNQSVTVYLLRTDDDHHRFLLTLKNPEER
                     ANTKRTNGSVNNAVDASVHSLEDLSLGRVVSAKIKGVKKNQLNVILADNLHGRVDISE
                     IFDNYDDIPSKKQPLGNFKSGDIIKVKVIGSHDVKGHKFLPITHMVNKSSVFELTAKK
                     FKVDSSESSTLTISDVSVGDELIGFVNNYSNNSLWLTISPSLKAKISILDLSDDNSTF
                     TESLEGQFPIGSVVKVTVSAVDSDHGYLTVTRRSHCVQGFDDIKVGNRMPASIVKITD
                     RYVLLNLGGNVTGISFAADALDDFSVPLDEAFSGMKNQTIPSEVISIASESKQIRLSL
                     RSKDSKTPLVKSHKDLKQGQIVQALIKSVTDKGIFVYLSSLIEAFVPVSKLSDSYLKD
                     WKQFYKVMQPVTGKVVKSDDDSRILLTLRESEINGDLKIMKTYSDIKVGDIFNGSVKN
                     VTDFGVFVKLDNTLNVSGLAHRSEIAEDLPKDLHSLFGVGDKVKVFVLKVNIAKKQLS
                     LSLKASHFTAKGESIEEGVSDAATKEYEEKYEAAASIEDEDEIMDDVNYSDDDSQTDE
                     RVEPCSESKSEIKAVTTGGLSLSAGFDWTTSILDQVQSDYESEDDIENFTEAKRTKRH
                     KNKNKFVEDRTIDINTRAPESVADFERLIMGNPNSSIIWMNYIAFQLQLSEIEKAREV
                     AERALKTISFREETEKLNIWIAMLNLENTFGTEDTLEDVFKRAVQYMDSFLIHTKLLS
                     IYHMSEKFDLEAELYKSTAKKFGSDKVSIWVSWGEFLLSRDLADEARSILSRALKVLP
                     KRSHIEVVRKFAHLEFAKGNPERGRSLFEGLVADAPKRIDLWNVYLDQEIKKNEKNKV
                     ENIFERVFAKKISRKQAKFFFNKWLEFEDQQQDIKTAEYVKAKALEYAEAHPKAQSA"
     gene            complement(<227668..>228693)
                     /locus_tag="HG535_0F01130"
                     /db_xref="GeneID:59237362"
     mRNA            complement(<227668..>228693)
                     /locus_tag="HG535_0F01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289434.1"
                     /db_xref="GeneID:59237362"
     CDS             complement(227668..228693)
                     /locus_tag="HG535_0F01130"
                     /inference="similar to AA sequence:RefSeq:NP_013955.1"
                     /note="similar to Saccharomyces cerevisiae MTF1 (YMR228W);
                     ancestral locus Anc_8.755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145329.1"
                     /db_xref="GeneID:59237362"
                     /translation="MSLPVKNLQILAQIKHYYGFRYLLNPVIHNKILDKLNLQKTYGN
                     FQDTKILDLYPGPAQHAAIFYNRFRPEQYTLMENRTDFFDYLKTEYSNSELQLAEKNP
                     YEWSSYTDLIDNEKQFVPDKQPLTQINNRFLVTANLTNASHEGLVMQWFTCIGNRNWL
                     QRFGRVKMLVWVPTPVAAKLLASPGSNARSKCSVVRETFTETHLIALSNTKECEMFHE
                     TEFEQMSPIVFPNTDVWQVRDKGIALLEINPTAHQVDLDNWDYVTKHLLILKKTPLKE
                     SLDSLGHGGKDYFNLKITDKNLLEKSPGQLTSVEFIYLSKLFDEWPFKPDIYMDFVDV
                     YQEEGLH"
     gene            <228966..>230642
                     /locus_tag="HG535_0F01140"
                     /db_xref="GeneID:59237363"
     mRNA            <228966..>230642
                     /locus_tag="HG535_0F01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289435.1"
                     /db_xref="GeneID:59237363"
     CDS             228966..230642
                     /locus_tag="HG535_0F01140"
                     /inference="similar to AA sequence:RefSeq:NP_013954.1"
                     /note="similar to Saccharomyces cerevisiae TAF7 (YMR227C);
                     ancestral locus Anc_8.754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145330.1"
                     /db_xref="GeneID:59237363"
                     /translation="MAVIKIKRRKDDVNNAGEPTPKKIRVKRKIKEEEVKPNLKVSLR
                     KSNISKKGINEEKGATVKVKLNLKKGGEQEKVSKAPRLRVKPIRVPGEGYDSEASDIE
                     DDPLIEEGIILRVLPDMQAEFVKNSIESGDYSGINIKWKGHGHAIVNINSVSYGAVVV
                     NLPTVVEAHKSVDRKNLLKTIDVSQMLLCIKVIENEEEVFTLTPPDSEDLVSKHFEEY
                     QDEINESKKKSLKGYNGGALTETELRYLDQIALKPYDYKHGITPPLYNARNRRFRRKM
                     GLDEFEYTEQAVERLLKQDDQSEEVTYELVDEDEVARRSTSAANLEQFSTSARDETGI
                     SGYADDEKEEDDLDLDAAFQSDEDAEAEAAAKTNDLFDEAGDDVEQYNGEEDEEEDEE
                     DEEDEEEDNDEEDDAGSDHDVVHKEEVNEGRQHNELLKDELLELKTTLDQTIQKLQTA
                     TNPLLKSRFVESIKKLEKEVELKRKQLKYSDESLQGDSSVASQINGTQEEFEEEENDA
                     DADDDDDDDDDIEAPEEEEGTDHVPDQELDQNDLDMMMLFGAEGDEADAD"
     gene            <231270..>236635
                     /locus_tag="HG535_0F01150"
                     /db_xref="GeneID:59237364"
     mRNA            join(<231270..231329,231392..>236635)
                     /locus_tag="HG535_0F01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289436.1"
                     /db_xref="GeneID:59237364"
     CDS             join(231270..231329,231392..236635)
                     /locus_tag="HG535_0F01150"
                     /inference="similar to AA sequence:RefSeq:NP_014933.3"
                     /note="similar to Saccharomyces cerevisiae SNF2 (YOR290C);
                     ancestral locus Anc_8.753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145331.1"
                     /db_xref="GeneID:59237364"
                     /translation="MNLDIPQRQFTKEEINRCYLRWQQLRNEHGDNAPNVPDYIYFTK
                     VLHVATRQQQELQQQQQELQQQQHQHQQFANGGSPSVPSQQRGNKDQIAQSNLPLLQT
                     FNQSRQSSLPVGSQHSSVEQTQDQPAQQNNGTPRPEHIPQKQQPTGTTPGSQPALNGF
                     ESGQSELLKAQITSLKCLVNQIPVPLQSQNEIQQSINNPPNFKKMLMALSEYVKRRQQ
                     LQQQQQQQATQQQQQQQQLQQQATQQQQQQQQQQQQQQMQQQKIQQQMQQRHMLQQQN
                     MQQAASEVSPVSHNAEASHTQQRPPQRQEKPQGPLAGQTPQQAMLQQRSNSILLQLQQ
                     KQLQQHLQRQHQQQMPQATQHGPDTPQEFIDRFNGQQASPAAVTPVAANNSMHVQEYN
                     GQNRPHIPSAVDVRNTPHESQAINHTQSQPLTNGSSKIALGNSEGAASTDSPMNDASS
                     VNDESKEPVFEGDKEPPTQEAPVSLEHFQATHKDITKIINVDNPDIMVDSFSLPDIPN
                     GMIDYASLFPNPQNPKLLIQPGILPSGIDTHTATEIYQTLLALNLDSAVDDCLNKVLD
                     ETVDEGSKNDALYDYYALQLLPLQKAVRGHVLQFMWYQHSLLTNTHPNFLSKIRSINV
                     QDALLTSELYKKHELSQYEKVRVEKSIRLEKIINISVKQYNGRLDVRTRRVKFGHRLI
                     TTHSMIEKDEQRRAERKAKERLQALKANDEEAYIKLLDQTKDTRITHLLKQTNAFLDS
                     LTLAVKDQQDYTKEMIDSHTKEKEDRDELVPEEEYADEIEYRSNVDYYNVAHRIKEEI
                     REQPSILVGGTLKEYQVKGLQWMVSLYNNHLNGILADEMGLGKTIQTISLLTYLYQKK
                     NVHGPFLVIVPLSTLTNWSSEFAKWAPSLRTISYKGSPNERKAKQAQVKSGEFDVVLT
                     TFEYVIREKAVLSKVKWVHMIIDEGHRMKNAQSKLSLTLNNFYHSDYRLILTGTPLQN
                     NLPELWALLNFALPKIFNSVKSFDEWFNTPFANAGGQDKIELSEEEMLLVIRRLHKVL
                     RPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQVMYQHMLKYRRLFIGDQANKKMVGL
                     RGFNNQIMQLKKICNHPFVFEAVEDQINPTRETNANIWRVAGKFELLERILPKLKATG
                     HRCLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSMLLQLFNAPQSEYFCFIL
                     STRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITENSVEE
                     VILERAHKKLDIDGKVIQAGKFDNKSTAEEQEALLRSLLDAEDERRRRREMGLDEEEE
                     MDDVEINDILARDESELSVFAEVDAERSRKALELNITTRLMENNELPEVYHQDIDREL
                     ELEKEESAAAVSLGGRGARERKSTTYSDNLSEEQWLRQFEVSDGEDNDGVGFKRKRFR
                     RPSGSVKKVKVEDSFSEVATIDPSPEPGVDNTSKEGSNDFENRRDESDPQMYENAHEE
                     KMDEGDEDSSEQVSVSSVGGKTSMKFARTAARGRGRGRGRGRGRGRACRGRGNALGSA
                     TISKGSARVGRGRGRPPKSKNGLNYARDPAATTQPYEVRSVVSQEAKELYEFALGYQN
                     PNDRRLSDIFLVKPPKALYPDYYQLIRFPVAFENINASIAAFAYSSLKEVLEDFHLIF
                     ANARIYNTEDSLVYTDSLELEKAITDKYRSLCNDNEPIDFTEFDEAFATKPLNLVSIA
                     ISDDIDTVDNVLPITKTELSSDAAVSVDESEDIAEEGSEEV"
     gene            237981..238053
                     /locus_tag="HG535_0Ftrna8A"
                     /db_xref="GeneID:59237901"
     tRNA            237981..238053
                     /locus_tag="HG535_0Ftrna8A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCA"
                     /db_xref="GeneID:59237901"
     gene            <238426..>239229
                     /locus_tag="HG535_0F01160"
                     /db_xref="GeneID:59237365"
     mRNA            <238426..>239229
                     /locus_tag="HG535_0F01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289437.1"
                     /db_xref="GeneID:59237365"
     CDS             238426..239229
                     /locus_tag="HG535_0F01160"
                     /inference="similar to AA sequence:RefSeq:NP_013953.1"
                     /note="similar to Saccharomyces cerevisiae YMR226C;
                     ancestral locus Anc_8.752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145332.1"
                     /db_xref="GeneID:59237365"
                     /translation="MSQGRKAAERLAGKTIFITGASAGIGQATALEYLDASNGNVKLI
                     LAARRLNKLEAIKEQIEKDYPAAKVYVGALDVTATDKIKPFLHSLPEEFKDIDILINN
                     AGKALGSDLVGTISAEDIQGMIDTNVTALINVTQAVLPIFKAKNSGDIVNLGSVAGRN
                     PYPTGAIYCATKHAVRAFTQSLRQELINTNIRVIEIAPGNVETEFSLVRYKGDPDKAK
                     KVYEGTTPLYADDIADLIVYTTSRKPNTVIADALVFATNQASAYHIHRG"
     gene            complement(<239299..>239988)
                     /locus_tag="HG535_0F01170"
                     /db_xref="GeneID:59237366"
     mRNA            complement(<239299..>239988)
                     /locus_tag="HG535_0F01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289438.1"
                     /db_xref="GeneID:59237366"
     CDS             complement(239299..239988)
                     /locus_tag="HG535_0F01170"
                     /inference="similar to AA sequence:RefSeq:NP_014932.1"
                     /note="similar to Saccharomyces cerevisiae YOR289W;
                     ancestral locus Anc_8.751"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145333.1"
                     /db_xref="GeneID:59237366"
                     /translation="MCADQVQSSPYAFYAYYQLYRELSEDTHSLDISFKRICHDLFPG
                     ATVDTSSKTSLFVTWEKKRKQKGNEYALRGCIGTFARLPILKGIERYSIISALQDRRF
                     PPITKNELPLLRCSCNILQNFETIYDGESHGGDIFNWELGVHGIELMFKNPQTGAVCS
                     ATFLPDVMTEQNWDKRDTFINLIEKAGFTGNPEELLDNYKDYFVQVIKYQGNKSRIAY
                     NEFIEFLNKFE"
     gene            complement(240116..240189)
                     /locus_tag="HG535_0Ftrna5N"
                     /db_xref="GeneID:59237893"
     tRNA            complement(240116..240189)
                     /locus_tag="HG535_0Ftrna5N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:59237893"
     gene            <242000..>246127
                     /locus_tag="HG535_0F01190"
                     /db_xref="GeneID:59237367"
     mRNA            <242000..>246127
                     /locus_tag="HG535_0F01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289439.1"
                     /db_xref="GeneID:59237367"
     CDS             242000..246127
                     /locus_tag="HG535_0F01190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145334.1"
                     /db_xref="GeneID:59237367"
                     /translation="MSKINYQNTPSIHERRKSLTIVRVSIKSDSPATQSYLGILQNSK
                     KKRPSMTKTPQTGELVEDNQHLLIDSGAAISVIRDPGLLHNINKHPNIGIADAQDREI
                     PISVSGDLQLSFPGTSIIHTEAVASTVPHVDILSLHELQKNGITVDFNNSQVTNNKGK
                     MVARIKKIGPYYWIPAKYIHKPHKKLNVMNVQKQPLFPMEFIHRLLGHVNIKTLRDSI
                     KQGMLTNLSMDDIDWSGYSNFQCEDCVSGKSKKHKHLVGSRLTYQKSYQPFEFLHTDI
                     FGPVPHMPTSSPSYFMAFTDEATRFRWVFGLWNKEAETVTSKFRELVNMVKTQFNTKV
                     RSFQMDRGSEYTNKTIRNFFKEYGIIPCYTSVGDSKANGVAERLNYTLLDDCRTLLRS
                     SNLPLHLWFYAVQFSTLMRNSLITSSVGTSSRAKAGLTGLDVSTILPFGQRVMVNNPP
                     KNKLRPRGIVGFALTPSAESHGYLIYIPSKHTVTDTTNYLIIRGDPHDRTDDADAVIA
                     PLLDQLEARQDGEFDNNMSTHSGGMEMDVSIHSGGTIHQRPVSPTPTADNLSTSSGGN
                     DPIQTGTTDTTEVIPEYIPEGNNDVLGPDIHDDPPEHTNDDPPEHTSDEIADNIEEHG
                     SNMINEDPRINLQSANHAVTYDNTESDDQPTQNEPTSNPINDPANDHPSSAIIDNTKT
                     PDPIPDTVSRRTINNDIDPSSAIASTVGIQASAYDDVAPTTEDERTTSSTSTAELDPL
                     PSEEDSPVPESTTVATPDSETPESISNVGGNDQSPEVNAKSLEERKNRIFQYRNGDIP
                     RVKPPSTKRKSSLALGEIEDRTQRKRPKRHILYVNAVHSNPTPHVKPSLSYYEAIVNN
                     DDKNDAKGYNEAYMKEYDQLIKMKTWDPNKPIKEKTIPRQQIINSMFIFNTKRDGRKK
                     CRFVARGDQQKAGTYKEDLKANTVHHYALMTSLNIALDKKMFITQLDISSAYLYAELE
                     EDLYIRAPPHMKLKGKAFKLNKSLYGLKQSGANWYKMIGSYLTNSCNMTELTGWPCVF
                     KDENECFVCLFVDDMIVLSKDIKAANKLVKTLKKKFETKVIHDGKLDENNMATYDILG
                     LEIEYTFGKKMTIGMENSLSEKLPHLGFDIEKDNKKFLVPGTPGEHIHKDNLVVEEDD
                     YKEKVKQMQKAIGLLSYVGYKYRFDILYYVNILAQHTLYPSEQVEKLTKQLLNFVWQS
                     KHKKLIWHANKHTKTNRITAITDASFANEEGFRSQLGHYYCLNGKVIGGRSSSEKLRV
                     ISSTEAEIYAVSESVPMLQGLACLVKQIDPSSSLRSKILTDSKPTISIVEDQSEDSRA
                     FRNRFFGTRAFRLRDEARRNDLKFEYIKTEDNYADILTKPTSIAIFKKLTHSWVK"
     gene            complement(<247422..>249140)
                     /locus_tag="HG535_0F01200"
                     /db_xref="GeneID:59237368"
     mRNA            complement(<247422..>249140)
                     /locus_tag="HG535_0F01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289440.1"
                     /db_xref="GeneID:59237368"
     CDS             complement(247422..249140)
                     /locus_tag="HG535_0F01200"
                     /inference="similar to AA sequence:RefSeq:NP_015463.1"
                     /note="similar to Saccharomyces cerevisiae RRP9 (YPR137W);
                     ancestral locus Anc_3.474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145335.1"
                     /db_xref="GeneID:59237368"
                     /translation="MAEIQTARRKRKRNNEQLPKNGDEEITDPSSEEVENSDNESSER
                     SDAEVLSSDEEFSGENPADKRRRLAKQYLENLKDEANDIMREESQTKEGEVNKGLVDD
                     YSNFDAREMDKDILASRLQQDVAEQHGRVHRFIADKLLLSEATTCFTRVGENNLTCIS
                     CFVPPVNKFNHLDDQRSAKNRGKLFAYTVSKDLQLTKYDVTDFSKRPKKLKYVKGGAK
                     YIPENPHEYENTTMGHYKEILTVAASPDGKYVVTGGRDKKVIVWSTESLAPLRVFPTK
                     DRRGEVISLLFRRNTDQLYVACADYKIRTYSINQLSQLETLYGHHDIVVDVSSLGLER
                     CVTVGARDKTAMLWKIPDETRLTFRGGDDTDRLKKKWLRENSVSSPDGEVTSPNESEI
                     PAFYSEGSIDVVSMIDDSHFVTGSDNGNICLWSLAKKKPVYTMRASHGIIPLPELTQI
                     SGEASDEVKSKQLEEKRLARPYWVTALHAIPYSNIFISGSWNGNLKVWKLAENMREFS
                     LLGDLSNCKGVVTKIQVVESGKHGKETFRVLATVAKEHKLGRWISKVPAARNGIYSAV
                     IQQGIF"
     gene            complement(<249493..>252261)
                     /locus_tag="HG535_0F01210"
                     /db_xref="GeneID:59237369"
     mRNA            complement(<249493..>252261)
                     /locus_tag="HG535_0F01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289441.1"
                     /db_xref="GeneID:59237369"
     CDS             complement(249493..252261)
                     /locus_tag="HG535_0F01210"
                     /inference="similar to AA sequence:RefSeq:NP_015461.1"
                     /note="similar to Saccharomyces cerevisiae CTF4 (YPR135W);
                     ancestral locus Anc_3.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145336.1"
                     /db_xref="GeneID:59237369"
                     /translation="MSKIIDKSVFDYGGKTLVSLASDNKTLCVANKNGLSKVLQINKP
                     EDEPEILEIAKNLTSIRCASDTTCLVTTLQGDAYRYDLEHPMDQLLVRSALPFRDCTI
                     LHGGRMAVFGGDDLEMSIVELDNEAFTKHVVKVDEQISQLSYSTQTNLLSVSFINGNV
                     QFFSLSSTRPNKVQELKGYIPANSYNDAHTDRLLQKLNEIDEVTYPETPDDGEDHDVI
                     KDAEFCDENRICTRPAWHPTGLQFGLPCEDSTVKIFSVKGYELIKTLVNSSFSKSHFI
                     DLQFEPLHGNYVAAVDLQNRLTIWNWLTSEISFKKEFKQKITNFVWRPQPDSKTLDLI
                     MGTWSGEIIIVHSAVESVKDVNSDYQSNVDGIKKTSLFVESDLEESDSDFATGRHQGP
                     SDKHIENGEHVFDENRDQDGSKRIYHFDDEEDFIDDDDGAGYVTEKKHKNDRSTFDSK
                     NYQGKFITPASHTYHYKPLSPGATPFGNSDRRYLTMNNVGYVSLVKNNLQNSITVSFF
                     DIGRFKEYHFEDIFGYDVCSLNENGALFAQSRSGQVHYRSHTMLNSNWTKTIPIQQGE
                     KITCVAATPKRIFLGTSFGYMRTFNQFGVPLSVEKMSPVVAISAQDYRVFAVHYSQYN
                     GVSYSIFEQSSHLSKYYQKECSLPIALPQSIARGNSNIETDFTSFNPLGIKSLFFSTY
                     GDPCIFASDNVLLVLSKWRHSAESKWLPLLDANMEVWRISGGNEKSQVHIWPLGLTYD
                     TLNCILVKGKNMWPEFPLPLPSEMEVRIPIYVKSVILQEIKKKRDEALAGEAEAATNT
                     GHERELTEVAVPSQMAAEEEFLRSKVLSSLLGDSLENDGELYGNENELLASLNGAYDK
                     SLLRLFATACSDQNSDMALSLAQELKQDRALIAAAKISERAELPNLVKRVNDLREARF
                     EQQMNYAQ"
     gene            <252640..>253416
                     /locus_tag="HG535_0F01220"
                     /db_xref="GeneID:59237370"
     mRNA            <252640..>253416
                     /locus_tag="HG535_0F01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289442.1"
                     /db_xref="GeneID:59237370"
     CDS             252640..253416
                     /locus_tag="HG535_0F01220"
                     /inference="similar to AA sequence:RefSeq:NP_011635.2"
                     /note="similar to Saccharomyces cerevisiae COG2 (YGR120C);
                     ancestral locus Anc_3.472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145337.1"
                     /db_xref="GeneID:59237370"
                     /translation="MDFLEDDEIDLDLPTVTDIDRDLFTKEVEKAGDISAACISFDVD
                     DFLMNNNFQYMPLEDLIKDFSHLSQNMVHILMDKITNKYDDCLKFCEPYIDRDNESAL
                     DLQKAKMDVNQFIAQLDKLMHKDLARTRKVISETLDYVRKLDDFWHQLDDQARIPDML
                     ALAKQLSKTLHMMCGTETLEETLCIELMAQLHSLVIRISSVLEGLSIINSTYVHHLQN
                     EYHGLLQEFQISLKILTDRCLQDPKQYEKLSRALVSTLHQ"
     gene            <253603..>255636
                     /locus_tag="HG535_0F01230"
                     /db_xref="GeneID:59237371"
     mRNA            <253603..>255636
                     /locus_tag="HG535_0F01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289443.1"
                     /db_xref="GeneID:59237371"
     CDS             253603..255636
                     /locus_tag="HG535_0F01230"
                     /inference="similar to AA sequence:RefSeq:NP_011634.1"
                     /note="similar to Saccharomyces cerevisiae NUP57
                     (YGR119C); ancestral locus Anc_3.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145338.1"
                     /db_xref="GeneID:59237371"
                     /translation="MFSFGSTNNNVGGSGTGSTLFGSKPSGGASFSFGQNSTGNAQQA
                     AQQPVGSSTGFGFGNNQPGTQNTGLFTGGQQSNVKAGSPFGNSTTSGAAANTGTGLFG
                     NNPGSTNNNASLLGQQSATGGGLFGNKKPTNGLYGSSNQTSQTSQNNSGGGLFNNSQN
                     NQTAPGGGLFGNNNQRNAGGGGLFGNTNQSTTGASGGGGLFGNANQSTAGTSGGGGLF
                     GNANQTTANTSTGGGLFGNTNQNSTGASSGGGLFGNTGQNSGSLFNQAGNNTNNSLFG
                     NSNTGVSTGGGLFGNQSGSLGNQQTSSTATTGGLFGSKPQNTTGGGLFGQGNTASGLF
                     NQTNGQSEAQSQQGKFGANFSTSTQPLFAWSNSQPNQSVSQQQQQQQLQQQQLQQQQN
                     QLFQQPQQLHLQQQTNYPLQIQEQVIKCKESWDPTSSNTKLRGFVYNKINENEAMLYH
                     KPPYVSQEEWDNVSDKKPSASFTPAEILGFEGLNQRTQLQRENVAQARLILNQILEKF
                     TQLQQKHELDTAARILKARSRNIQIEKRILRVGTQLAILKSRGLPLSVSEEKMWSQFQ
                     SLLQRGNDPAGLGKTNELWARLAVLKERAKNISDQLNSTLVVVSENGGALSNSIQNEE
                     ENNTKRADEEVEKRIDKVVETLSSQQRGISYLSSVLEKDHKTVDRILNNRSSR"
     gene            complement(<255708..>256604)
                     /locus_tag="HG535_0F01240"
                     /db_xref="GeneID:59237372"
     mRNA            complement(<255708..>256604)
                     /locus_tag="HG535_0F01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289444.1"
                     /db_xref="GeneID:59237372"
     CDS             complement(255708..256604)
                     /locus_tag="HG535_0F01240"
                     /inference="similar to AA sequence:RefSeq:NP_015460.1"
                     /note="similar to Saccharomyces cerevisiae MSS18
                     (YPR134W); ancestral locus Anc_3.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145339.1"
                     /db_xref="GeneID:59237372"
                     /translation="MSKRLSFLQDHCLLLTLGLFHRSVSPPNELLWTRNIASELSKIC
                     NILYARNTFSYRANSVARHQPTLDLVLSSSNVTRLAKIIFNLRGIKLNENEIETTPIL
                     NPVEESIDSVTEYRELDSVYESLKQQWNIASHREGYGKSALQPLISVSSLFFNKRPVE
                     AAYSATNELIPLSRSPGLQSDCVTTNPQTSTFFQVDEFAQNAKQSEFHHPELQQMQKG
                     SNFMLDDAARHFHDYIGQCKKFNHHQYLALTPKLYYNYDSFPVGLKKWLHDIDRLDMS
                     FKDKRAQSDRLDILLHGFKGFG"
     gene            complement(<256783..>256935)
                     /locus_tag="HG535_0F01250"
                     /db_xref="GeneID:59237373"
     mRNA            complement(<256783..>256935)
                     /locus_tag="HG535_0F01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289445.1"
                     /db_xref="GeneID:59237373"
     CDS             complement(256783..256935)
                     /locus_tag="HG535_0F01250"
                     /inference="similar to AA sequence:RefSeq:NP_015459.1"
                     /note="similar to Saccharomyces cerevisiae TOM5 (YPR133W-
                     A); ancestral locus Anc_3.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145340.1"
                     /db_xref="GeneID:59237373"
                     /translation="MFGLPQQEASEEEKKLHQQATNQTLINAAYLSALLWVSPIVWHF
                     VKKQWK"
     gene            <257157..>258281
                     /locus_tag="HG535_0F01260"
                     /db_xref="GeneID:59237374"
     mRNA            <257157..>258281
                     /locus_tag="HG535_0F01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289446.1"
                     /db_xref="GeneID:59237374"
     CDS             257157..258281
                     /locus_tag="HG535_0F01260"
                     /inference="similar to AA sequence:RefSeq:NP_015458.1"
                     /note="similar to Saccharomyces cerevisiae SPN1 (YPR133C);
                     ancestral locus Anc_3.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145341.1"
                     /db_xref="GeneID:59237374"
                     /translation="MEDEGLIRPEEGSNIDEALVERPENTESNNDDNQQDRQRKHIDA
                     DDSDEETDRLDVKNMSNFVPNGGKTGVNENSLEIDGSYRNRQELEDKLDRILKKPKVR
                     RSRRDEDDLEQYLDEKVLRLKDEMNIAAQLDIETLNKRLDTGDNSLIVMQKVKLLPKV
                     ASALSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAAIEKLPIKTEHLK
                     ESGLGRVVIFYTKSKRVEPQLARLADRIIAEWTRPIIGASDNYRDKRIMQLEFDAEKL
                     RRKSALDSAKSRKRKAGNGKRASSHGSSAQTLYEQAAARRNRAAAPAQTTTDYKYAPT
                     SNLNSTSNNARTTGVGTTLNNSEMYKRLSSRLNKNKRTAK"
     gene            complement(<258481..>259155)
                     /locus_tag="HG535_0F01270"
                     /db_xref="GeneID:59237375"
     mRNA            complement(join(<258481..258853,259091..>259155))
                     /locus_tag="HG535_0F01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289447.1"
                     /db_xref="GeneID:59237375"
     CDS             complement(join(258481..258853,259091..259155))
                     /locus_tag="HG535_0F01270"
                     /inference="similar to AA sequence:RefSeq:NP_011633.3"
                     /note="similar to Saccharomyces cerevisiae RPS23A
                     (YGR118W) and RPS23B (YPR132W); ancestral locus Anc_3.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145342.1"
                     /db_xref="GeneID:59237375"
                     /translation="MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFG
                     GSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEV
                     LLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"
     gene            <259881..>261272
                     /locus_tag="HG535_0F01280"
                     /db_xref="GeneID:59237376"
     mRNA            <259881..>261272
                     /locus_tag="HG535_0F01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289448.1"
                     /db_xref="GeneID:59237376"
     CDS             259881..261272
                     /locus_tag="HG535_0F01280"
                     /inference="similar to AA sequence:RefSeq:NP_011632.3"
                     /note="similar to Saccharomyces cerevisiae YGR117C;
                     ancestral locus Anc_3.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145343.1"
                     /db_xref="GeneID:59237376"
                     /translation="MNQEQAETVKDCCKIIVANYLKKNGFSHTLNAFLRESGQTSKVL
                     MDSDNGSIFEALETLVGERIEFGQEVVAQEMQKLTVNDRLVAIDTRKHFVPSWNHLLK
                     FSAVPLAVDKDALPGGLPLSVSWCDPDDSLIISTSIKEVCIYKEGRLYSDLSELGKKN
                     GIIRQCGSIGHTGAYYLCCLDGTLLVVNEGTSDYKFKLHQRIISHISFVPQVEGSWVI
                     VSCGLDNYLKLHKLDLATGDFEELWKVKLLSPCTSLQIARKANGCGSSDEIMIFLTRQ
                     DYTHVMCYTVARDRLLLTYKIALNNSQFNAFSFNVRDMVILGDKCIDGIPQLSSRSTL
                     AVATSHIPYMRLLLVEIPTWESAATAETTEKTFYDKMLRNMATEVSQDSYSQPILRTL
                     GNGNGGILVGGNQGLYAIDILRSDSWLITDIPEVFRSERIKCMETNKSGNKLAIFFSN
                     RSSCIFKVAEMVT"
     gene            <261283..>261945
                     /locus_tag="HG535_0F01290"
                     /db_xref="GeneID:59237377"
     mRNA            <261283..>261945
                     /locus_tag="HG535_0F01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289449.1"
                     /db_xref="GeneID:59237377"
     CDS             261283..261945
                     /locus_tag="HG535_0F01290"
                     /inference="similar to AA sequence:RefSeq:NP_015456.2"
                     /note="similar to Saccharomyces cerevisiae NAT3 (YPR131C);
                     ancestral locus Anc_3.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145344.1"
                     /db_xref="GeneID:59237377"
                     /translation="MKIENSITEKKVHFETEDNEKNQEMTSLQPFEATDLFRLNNINL
                     DILTENFPLGFYFEYLVFWPQLFFKSIETTIDENDNCSNISGYMMAKTEGKGHDWHCH
                     ITAVTIAPTFRRVSLASRLCKALEAITDSRPHEVNFVDLFVKCNNYLAIKLYEKLGYS
                     VFRRVIGYYSSGDDGYPTSLKNTDDNTDAFDMRKSMPRDKERSIRNDGRKHKCYPHDV
                     RF"
     gene            complement(<262074..>263141)
                     /locus_tag="HG535_0F01300"
                     /db_xref="GeneID:59237378"
     mRNA            complement(<262074..>263141)
                     /locus_tag="HG535_0F01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289450.1"
                     /db_xref="GeneID:59237378"
     CDS             complement(262074..263141)
                     /locus_tag="HG535_0F01300"
                     /inference="similar to AA sequence:RefSeq:NP_015454.1"
                     /note="similar to Saccharomyces cerevisiae SCD6 (YPR129W);
                     ancestral locus Anc_3.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145345.1"
                     /db_xref="GeneID:59237378"
                     /translation="MSQYIGKTISLISVTDNRYIGLLEDVDSDKGTVTLREVRCFGTE
                     GRRNWGPEEIFPTPTVYKSVKFNGNEVKDLSILDCKLEDVQPLVPPPGAGQRSTAPVA
                     PSAPHQVQPQVMHPQAQFSPQAQQVSQPPQASQPLQPSQPPQPLQHAQPQVPAAVAGY
                     GVYAPNPSMVAPPAAVSTEQTVKPKQPRKEKTLSKNRNQDRQPKGHSGSTEKKVEIPT
                     EDFDFQTSNAKFAKDGKTGSVPEDDSHGHPETPSEKSGDADDFYNQKSSFFDSISTST
                     ETNTNMRWQEEKEMNLDTFGQASARPRFGGRGGHRGGRGGRGRGRGRGGSSGRGRGGY
                     NFGNNNNNYGSHQTQNQNIEF"
     gene            <263455..>264438
                     /locus_tag="HG535_0F01310"
                     /db_xref="GeneID:59237379"
     mRNA            <263455..>264438
                     /locus_tag="HG535_0F01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289451.1"
                     /db_xref="GeneID:59237379"
     CDS             263455..264438
                     /locus_tag="HG535_0F01310"
                     /inference="similar to AA sequence:RefSeq:NP_015453.1"
                     /note="similar to Saccharomyces cerevisiae ANT1 (YPR128C);
                     ancestral locus Anc_3.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145346.1"
                     /db_xref="GeneID:59237379"
                     /translation="MASFEAALTGAVASSLANIAVYPLDLSKTLLQTQVDQKGYEEQK
                     SEESTRDRKYNSALDCIYRIFKARGFKGLYQGMTTSVLASFIQSFCYFFWYTLIRKYY
                     SSIKNKGARGRYAGFSTFEELLLGVVAAATSQLLTNPVSVISTRQQTMSSKSSEDAKV
                     GHIVKQIVKEQNGSITGLWKGLKVSLVLTINPSITYASYQKLKSAFFSADDSSRGNTQ
                     LSAGQNFMLGVLSKMISTIITQPLIVSKASLQRRGSKFTSFQQVLVFLYQTEGVLGLW
                     KGIRPQLAKGVLVQGLLFMFKGELSKFIHKLLLVYVRKFAKPTIRNGKQFL"
     gene            complement(<264556..>265611)
                     /locus_tag="HG535_0F01320"
                     /db_xref="GeneID:59237380"
     mRNA            complement(<264556..>265611)
                     /locus_tag="HG535_0F01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289452.1"
                     /db_xref="GeneID:59237380"
     CDS             complement(264556..265611)
                     /locus_tag="HG535_0F01320"
                     /inference="similar to AA sequence:RefSeq:NP_015452.1"
                     /note="similar to Saccharomyces cerevisiae YPR127W;
                     ancestral locus Anc_3.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145347.1"
                     /db_xref="GeneID:59237380"
                     /translation="MSSSSPEIKMLRSELSKIPIGYGLMSFTWRAEPIPQEQAFPALK
                     RGVEMAVKNGHKAFFNVGEFYGPDWSNLKLVRAFFEKYPALRESVIISCKGGMNNQTL
                     SPKGRYDDVVSSVEKCVSEIGGPIDLFEVARLDKSICTGGAVYPYESFKALAAMVENG
                     AIGGISLSEVTAEEIRAIAKDWHNYLVAVEIELSMFSPQVLTNGVAKTNSDFGLVTVA
                     YSPLGRGLLTGQVKSTSDIPKGDFRSLLVRFSDDSLKKNLVLVEFLKEEIVAKRPADN
                     PITLVEVSLGWVRHWNSRSEYANTHFLPIPSGSSVSKVEENMNEVKTVITKAEFQKIT
                     DFLKNFETTGDRYEVAH"
     gene            complement(<265907..>267304)
                     /locus_tag="HG535_0F01330"
                     /db_xref="GeneID:59237381"
     mRNA            complement(<265907..>267304)
                     /locus_tag="HG535_0F01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289453.1"
                     /db_xref="GeneID:59237381"
     CDS             complement(265907..267304)
                     /locus_tag="HG535_0F01330"
                     /inference="similar to AA sequence:RefSeq:NP_015450.1"
                     /note="similar to Saccharomyces cerevisiae YLH47
                     (YPR125W); ancestral locus Anc_3.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145348.1"
                     /db_xref="GeneID:59237381"
                     /translation="MLKPTVKMLIQGNKYRVAATNNALMPTSSITRSLKAANITRHTS
                     YRFNSSPSEKPSANKMVNVAPPKPSLWTRVKKEARHYVDGTKLLGLEMKISFRLLSKM
                     SAGYELTRREMLQLKRTTQDIIRLVPFAAFVLVPFAELLLPVALKLFPNLLPSTYESS
                     KDKESKLASLRKSRKLMAEIIKDNTSHFKPVNISDEQKAVFNKFYEHVRKTGEPESRQ
                     QLIQVARLFTDDTVLDNVTRSYLVAIAKYINLQPFGTDVMLRYRIRYKMLELKKDDLS
                     IYYEGIDQLSPAELFTACSSRGIRCLNVDDSVLRDNLRLWLNMRLKDKISSTLLIMAT
                     AYNYGEITSRKSLYDALCDVLSGIPDELYHEVKVNIVKEDHVSAKQRLVQLKEQEEIM
                     KEEEQQEKNSLVRVKDQLSLDDIDNQSTLPRHTPPLSFTGKMSPVAKTQEQVPQQSIA
                     QPSADASQNSTKSSD"
     gene            complement(<268496..>272857)
                     /locus_tag="HG535_0F01340"
                     /db_xref="GeneID:59237382"
     mRNA            complement(<268496..>272857)
                     /locus_tag="HG535_0F01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289454.1"
                     /db_xref="GeneID:59237382"
     CDS             complement(268496..272857)
                     /locus_tag="HG535_0F01340"
                     /inference="similar to AA sequence:RefSeq:NP_011631.1"
                     /note="similar to Saccharomyces cerevisiae SPT6 (YGR116W);
                     ancestral locus Anc_3.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145349.1"
                     /db_xref="GeneID:59237382"
                     /translation="MSDSENAEQGLQTRKEEEDPVINGGDEDKVPSDEEEGEDVFDSS
                     DDEDEEDDEEEARTVKEGFIVDDEDEDGEIGASNKKRRKHKRKHRETEEDDRLSEDDL
                     DLLMENAGVKRPTSSTSAGKLKRLKRAGDQDDTQRGESATEAPSKDGSDSHLQDFFSD
                     DEEENENKGDKDGLRTDREDEEMDNERHRSSNKSGILDELDDFIEDDEFSDEDEETRL
                     QRLEERKLLREQRMQQPVHITGLSSDKIDEMYDIFGDGHDYDWALEIENEELDQGTLD
                     ETAADENEESDELGATKASKKKITLQDIYDLQDLKRNLMTEEDMVIRRTDIPERFQEL
                     RAGLSQYIELSEEDQELEKNWISDKISIDKNFDLSYDLTEFKECVSNAIKFIAHENLE
                     VPFIYAYRRNYISSKDKDGFVLNEDDLWEIVGLDIEFHSIIDKREYVKSFYQELNVTD
                     PIVDEYFRNQSNASTAELNSLQDIYNFLEFKYAHEINDMLLRHSGKKHLKNSSYEKFK
                     SSALYQAINDVGITADQVGENISTQHQIHTPVDHPTLKPQEAVESILNANSADLQVFT
                     SNTKLALDTVKKYYALELSENTKIREKVRTDFYKYYLADVVLTSKGKREIQRGSIYED
                     IKYAINRTPMHFRREPDVFLRMLEAEALNLLTVRLHMSSQAQYVDHMFQVALETTNTS
                     LSATEWNSFRRSAFGQAMDKIFADISREIKDDLSKKCEKLVSKTIRHKFMTKLDQAPF
                     IPNPKDPKIPKVLTLTCGQGRFGSDAIIAVYLNRKSDFVKDFKIVDNPFDRGNPEKFE
                     ETLDDIIQSCQPNAIGINGPNPKTQKFYKRVQEVLHKKQIVDSRGHTIPLIYVEDEVA
                     IRYQNSDRAAQEFPNKPPLVKYCIALARYMHSPLLEYGNLSEEELTSLAIHPHQSLLP
                     REKLVKALETAFVDIVNLVGVEANKATDNSYYASVLKYIAGFGKRKAIDFLESLQRLN
                     EPLLARQQLITHNILHKTIFMNSAGFLYISWNEKKQRYEDLEHDQLDSTRIHPEDYHL
                     ATKVAADALEYDPDAIAEKEEQGTMSEFIEILREDPDRRSKLESLNLDSYAEELEKNT
                     GQKKLNNLNTIVLELLEGFEELRNDFHPLHGEEIFQSLTGENEKTFFKGAIVPVRIER
                     FRHNDILCLTNSQVDCIVNAQRHAGVQYKRPPSELYEIGKTYRSKIIFIDYENITAEV
                     SLLEHDIKHQYVPITFSKDPSIWDLKQELEDSEEEKKITMAEARAKRTHRVINHPYYV
                     PFNGKQAEDYLRSKERGDFVIRQSSRGDDHLVISWKLDKDLFQHIDILELEKENPLAL
                     GKILVVEGQKYHDLDQVIVECLQNKVRLLNEITSNEKFKSGNKKDVVKFIEDYSKVNP
                     NKSVYYLSFNYNNPGWFYLMFKVNAQSPLYTWNVKLTHTGFFLVNYNYPSVIQLCNGF
                     KTLLRSSTNRNKTATYH"
     gene            complement(<273158..>274261)
                     /locus_tag="HG535_0F01350"
                     /db_xref="GeneID:59237383"
     mRNA            complement(<273158..>274261)
                     /locus_tag="HG535_0F01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289455.1"
                     /db_xref="GeneID:59237383"
     CDS             complement(273158..274261)
                     /locus_tag="HG535_0F01350"
                     /inference="similar to AA sequence:RefSeq:NP_015449.1"
                     /note="similar to Saccharomyces cerevisiae CTR1 (YPR124W);
                     ancestral locus Anc_3.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145350.1"
                     /db_xref="GeneID:59237383"
                     /translation="MSMSMSMSVSMSMSSSSAALNTMSGSMSMISSSTQGSTTMSMSD
                     MSMSSSMVMPTSTVAAASSSSMSSSMDMSGMSMAASSTSGSMAAGMQMGTSTSSSSMS
                     TNTASANDMGGMNMGMNSYLTPRYMNYPVLFHGLSANTKGKAFGIFLLIVVAAFVYKF
                     TLFVSWCLEVKWFKKWNKGHKSTMGLAAKGLDFYNDEPIQVTHLPKLPVFVFDIFRPS
                     TIELAHDLIRTVLTFFATMLIYMLMLAAMSLVLTYVFAVITGLALAEVFFNRCKICML
                     KRWQIQAEIEKAKTGENDCQCNPEEDVSSNEKTVLSRRLSNTNEAVDPACCCASRAME
                     QEKQMENEIMENAKLQEQSGNMDSNLMPAEKFR"
     gene            complement(<274581..>275690)
                     /locus_tag="HG535_0F01360"
                     /db_xref="GeneID:59237384"
     mRNA            complement(<274581..>275690)
                     /locus_tag="HG535_0F01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289456.1"
                     /db_xref="GeneID:59237384"
     CDS             complement(274581..275690)
                     /locus_tag="HG535_0F01360"
                     /inference="similar to AA sequence:RefSeq:NP_011628.4"
                     /note="similar to Saccharomyces cerevisiae DAM1 (YGR113W);
                     ancestral locus Anc_3.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145351.1"
                     /db_xref="GeneID:59237384"
                     /translation="MDIKKRHGEIPIPYLSNEEHLDKDPCSQYPQASMSQEKSKTSTK
                     RSATEYRLSITSNPGSRRSSLGGTNTEGLAVGSNSRSGTINSIADDNENFVKEYILPQ
                     IRELSDSMITLDANFTQLNFIHESLVDLDESLGALLYGLMCNSWCVDFPHVSHDIEEE
                     LRIAKRLETLSHEKKALLHELNTLKNEAQPKKNDGVSQFVPPSFPSTQLRIPNPRVQG
                     GHMPLHQVSNGPQHQQHQDTAEDEIDNDDNNSEASFISNPGMEGSAKRHKSNKPSSGS
                     LRRKSILHTIRNSISTTTDFNADMKDTSDLRRSSRLSLAGGATRIVPGRPTTERSTGL
                     MINGHPVGTNASATKKSSNSVPTKRRFQANRPPFR"
     gene            complement(<275814..>276938)
                     /locus_tag="HG535_0F01370"
                     /db_xref="GeneID:59237385"
     mRNA            complement(<275814..>276938)
                     /locus_tag="HG535_0F01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289457.1"
                     /db_xref="GeneID:59237385"
     CDS             complement(275814..276938)
                     /locus_tag="HG535_0F01370"
                     /inference="similar to AA sequence:RefSeq:NP_011627.1"
                     /note="similar to Saccharomyces cerevisiae SHY1 (YGR112W);
                     ancestral locus Anc_3.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145352.1"
                     /db_xref="GeneID:59237385"
                     /translation="MVPLHRGSLVSSVRLSGLSLLKRSLKRTVVTSTVDWKPIKSTRT
                     PNEEESKGKGHGKKIVLGLMFAMPIISFYLGTWQVRRLEWKTKLIAKCESRLAYDPTP
                     LPKRFAPEMCENWEYRRVTLKGTFLHEEEMFVGPRVRNGVKGYILFTPFIRKDTGEKL
                     LIERGWVSEDKAVPTSRSLQHLSLPRGDNVELMCLVRAPHPRGTFQWEKSDKNSRLWQ
                     VADIYEMAESSGCPPIHLQAIYDMKDHYWPESNKEIEHDSQASNSTSSRWNFWPQNTA
                     ANVNSTDEKSLRFTSEEPDLKDGLEFNEWQFRNAGVPIGKVPKIDLKNNHLQYLVTWY
                     GLSLLSSVFLFVALRKYRKGSGVSQAQVKKDKLRHAKKFM"
     gene            complement(<277186..>278373)
                     /locus_tag="HG535_0F01380"
                     /db_xref="GeneID:59237386"
     mRNA            complement(<277186..>278373)
                     /locus_tag="HG535_0F01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289458.1"
                     /db_xref="GeneID:59237386"
     CDS             complement(277186..278373)
                     /locus_tag="HG535_0F01380"
                     /inference="similar to AA sequence:RefSeq:NP_011626.1"
                     /note="similar to Saccharomyces cerevisiae YGR111W;
                     ancestral locus Anc_3.456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145353.1"
                     /db_xref="GeneID:59237386"
                     /translation="MTILPNSDSLVFRETTDPEVIKYTHFQNGNNWKGELSLEEYVQR
                     EAVLGKSEIGQKGKSTETIKRFPEGHEWVGLKYFILENLEVNSEKVTDRIVSSCEILG
                     RLGSCVYPGSKVEPCLVATIGGVYTSPENRGKGYARQMIEALNDHLDGVRDAPNSPDL
                     IKNMVVILYSEVGEYYSNMGFKSEHVPLHIVTQLDEIEKRYCHQGTIEGRELGFGGYE
                     ELVALQDKAFSRNLEKVRKLNPYKFIFTVSADIDLYKWFAHRDLFIMKKTNRMQKDLK
                     FGFALSDNSHIIWHHNWSGDSLIIVKVFMEEGKPDAQLTLCKLITMAVKETKKTGLKS
                     LVFWDQEIEIKQFPELQKELLEMEHESNVYAKNSSLSAFRPPKGFGVDNVIWDNNTKF
                     CWF"
     gene            complement(<279712..>283311)
                     /locus_tag="HG535_0F01390"
                     /db_xref="GeneID:59237387"
     mRNA            complement(<279712..>283311)
                     /locus_tag="HG535_0F01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289459.1"
                     /db_xref="GeneID:59237387"
     CDS             complement(279712..283311)
                     /locus_tag="HG535_0F01390"
                     /inference="similar to AA sequence:RefSeq:NP_015447.1"
                     /note="similar to Saccharomyces cerevisiae AXL1 (YPR122W);
                     ancestral locus Anc_3.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145354.1"
                     /db_xref="GeneID:59237387"
                     /translation="MSWSNVKHYDIQFYTPVSLENRTHRLCKLPNGMETLLISDPTEN
                     SSGCSLTVATGSHNDPDEIPGLAHLCEHMLLAAGSRRFPVPGTYHGMIAKYNGLQNAF
                     TTGEQTSFYFELPSIHTSEEMSFHQAVEVFSSFFVEPLFQSDLINKEIYAIESEHNGN
                     LSSSSKIFYHAARLLSSEKHTFHRFGTGNMSTLKSMAQAQGLNLKDELQHYFDENYLS
                     SHMTLCIRGPQSVNALAKIAIKSFGDIPMYPSSRRNIIRSIKPSLRSPKKSSRRSKLT
                     SPVLTQEEDEIHTTKILSDTWKEKYANCLCFSESEKQNAIFVNVHKLPMSRIFFPVHW
                     QNTRFTKKDVVTFAHFWSEIFGDESEGSLCHYFKQEGWITSCYAFTSDFATNGMGLVL
                     ELSLTNTGWKKISSIVETISYVLIPLFSGNDTLTLSKFLSDQCSIDVLRFIYLPKESS
                     PMQECSSLSCLMQEDLEALDLRCLFKGSPILSEESSISFFHENTDSERWWIGQAINFQ
                     MFLKEFMTTNNIRLILLGDLSTCPFFTETIQQDYSNKALKRDAAYDFEYLKVILNLND
                     GKPSCNMHYNFHFPKENCFKPKWANCSSTLNEILMTSSNKCRSASLSFAINSDLIKTI
                     PTLVSQNEHHEMWILPDDVTGSLRFKSVVSIDVLSMQIKPSPENTMHLETLIQILFIS
                     LCPSLYPSIKLGFSYEFGCSTKGDVSISFTISGFSDGLKPVLVSLISTIRRIATDPEF
                     PSKELLRKARVLVRNTYQEAANRSGVDVASVGLLVVLEKNMWTFNERMNALEDIDMEG
                     FKAFCRSFLDGPKYLNLFIQGDISCADELNSYLNDSFTGHLQKYYKVQSTFKHHLSTK
                     ELEPGTNVYIQQPGQKDDPNNSIVYFIQTGKRNEMQILSLTAFTEYLLSLSIVSELRN
                     RRQIGYLVMGGLRLLSDTVGLHITVMSDANCMTLESHIDEYFAYLEKEILGKLSQETF
                     SENYVKPYVNLYKSTTADKLQKFAGPANLSNEIVGNVQSGDAFILNSSTMKRHKKFRN
                     QILDKQYEFCDRETCVDLNFISLLTLPRYTQFYKETISLFSAKRSKLSIMITSPMNDG
                     DVADRRLVSQLEFFLKMKGLVISSEEVADIVRAANGKPTLLAMQLFHSFKARNEAWKL
                     CSTILKEITKMIWYGLRPPRGSDTNSIAQAWDESKGPAVALKVIEDIKTYKDA"
     gene            complement(283836..283934)
                     /locus_tag="HG535_0Ftrna5Y"
                     /db_xref="GeneID:59237895"
     tRNA            complement(join(283836..283872,283895..283934))
                     /locus_tag="HG535_0Ftrna5Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:59237895"
     gene            <287275..>288879
                     /locus_tag="HG535_0F01400"
                     /db_xref="GeneID:59237388"
     mRNA            <287275..>288879
                     /locus_tag="HG535_0F01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289460.1"
                     /db_xref="GeneID:59237388"
     CDS             287275..288879
                     /locus_tag="HG535_0F01400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145355.1"
                     /db_xref="GeneID:59237388"
                     /translation="MSSSSENTENTQNDRSAKILRNVQQRLALNNVTNTITAQQNASH
                     QSSIRNLKSSLSMARDEGSRIPQFSKETYIHPSLANSSTLDPQNSSRSSTTNKSIDFL
                     SSKTASVGQGELGSFTVCENKENQDPFSSSRLLPSIREEGHHKSDEEHVLLKSQSSHI
                     TQTGKPDPKSSQIFLGNDKIDTSSDYQKSNSSSTNNNNNNSNNNNNNNNNNDSKNSIN
                     PRDMDAGKKRPISTLVEHDVPKKFKICDENGEEEYEWEDLDAEDANDPFMVSEYVNEI
                     FDYLSHLEVVTLPSEENLYKHRNIRQNRDILVNWLVKIHNKFGLLPETLYLAINTMDR
                     FLSKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFASETDGACTEDEIKEGEKFIL
                     KTLNFNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEISLVDFRFIGILPSLCAAAA
                     MFLSRKMLGKGKWDGNLIHYSGGYTKEQLAPVCHMMMDYLVSPIVHDEFHRKYQSRRF
                     MKASVISVQWALKVRKNGYDIMTLHE"
     gene            complement(<289134..>290375)
                     /locus_tag="HG535_0F01410"
                     /db_xref="GeneID:59237389"
     mRNA            complement(<289134..>290375)
                     /locus_tag="HG535_0F01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289461.1"
                     /db_xref="GeneID:59237389"
     CDS             complement(289134..290375)
                     /locus_tag="HG535_0F01410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145356.1"
                     /db_xref="GeneID:59237389"
                     /translation="MASLTGSANSSTRSSSENLKFNDTAALDTKVCNLKVSSTSGSPN
                     AKPRRALSEVPVNTQQTKELSEISGRVRREDSELTLQSFRKRKIYRDQEEENPTTKVK
                     ARKTSKTSDEEPQEEKILWKDLDANERKDVCMVTEYTNEIFSHLYKREMETLPSHNYL
                     TDTKSKHNLRPSMRAILIDWLVEVHEKFQCYPETLFLTINIMDRFLSMNKVTLSKLQL
                     LAVTALFIAAKFEEVNLPKLSDYAYITDGAATKNDIKNAEMFMLSSLEFNIGWPNPMN
                     FLRRISKADNYDFQTRSIAKFLLECIMCYHKFIHLKPSTMSAMAMYVAKQITSTHNKK
                     NLWDETFKHYSGGIDPYADAEFQSYCKDLIKEIASPTTKLDSLYLKFKKPKNGAMYYK
                     VFQWCQNQVETDESLNSLFSL"
     gene            <291488..>291730
                     /locus_tag="HG535_0F01420"
                     /db_xref="GeneID:59237390"
     mRNA            <291488..>291730
                     /locus_tag="HG535_0F01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289462.1"
                     /db_xref="GeneID:59237390"
     CDS             291488..291730
                     /locus_tag="HG535_0F01420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145357.1"
                     /db_xref="GeneID:59237390"
                     /translation="MGFWEDFKRKFALWKHTQDATPVEGETYQDPPKVSELPNMPDSS
                     GNLIAVSSGNREISPVLSAKYGINIPEKHNEIDDKI"
     gene            complement(291855..291926)
                     /locus_tag="HG535_0Ftrna2C"
                     /db_xref="GeneID:59237888"
     tRNA            complement(291855..291926)
                     /locus_tag="HG535_0Ftrna2C"
                     /product="tRNA-Cys"
                     /note="codon recognized: UGC"
                     /db_xref="GeneID:59237888"
     gene            <292108..>292965
                     /locus_tag="HG535_0F01430"
                     /db_xref="GeneID:59237391"
     mRNA            <292108..>292965
                     /locus_tag="HG535_0F01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289463.1"
                     /db_xref="GeneID:59237391"
     CDS             292108..292965
                     /locus_tag="HG535_0F01430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145358.1"
                     /db_xref="GeneID:59237391"
                     /translation="MRLIILCWGTLIILLQATKLCAYDYQVSSFTTSVLDRLNNAEGD
                     KVSINFMELLTIISNESGEKRLIASKVIDTAEEIIISGDNKEASPNKLHRFKILCDEI
                     MFLEQVFSSELNNHKWSSQFFHKKSLTRIIKTYIAYESYVLKRISEQTNASYSKTLRD
                     VTKHLLSCKNALLAGVRTLQLMHTAKGNEIHDLVTANFHSGDTSSINGENLVYAIMPQ
                     KGNQTQEIASDITYLRQNFLVLVKSGVFMMLCAAVRVYFCAFTFGAMMMSSSVIWMLV
                     YLQLMDKEL"
     gene            <294429..>295250
                     /locus_tag="HG535_0F01440"
                     /db_xref="GeneID:59237392"
     mRNA            <294429..>295250
                     /locus_tag="HG535_0F01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289464.1"
                     /db_xref="GeneID:59237392"
     CDS             294429..295250
                     /locus_tag="HG535_0F01440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145359.1"
                     /db_xref="GeneID:59237392"
                     /translation="MINGAFMQDLPGYGFSSRSRFPYHYPTSIVSDVQDWFHQKLYRW
                     FEKRGLLMNPENNLIMAHSLGAYLMCLYAAKYPDHFKKIIMCSPAGVCHSNLNKKLGN
                     TRIPWWYTKLWDRNISPFSLVRNASQLGSKITSGWTYSRFSKVLSEGTPLSVQQFEAL
                     HRYAYSIFNQPGSGEYLLSFVLRCGGSPRISLEDQIFKDCNNGIYQSNCEWLWMYGET
                     DWMDITGGFRVSDMLNRYSNKERSHVCIVPNSGHHLYFDNYNYFNEVLINEMKSM"
     gene            297820..297908
                     /locus_tag="HG535_0Ftrna12K"
                     /db_xref="GeneID:59237884"
     tRNA            join(297820..297857,297872..297908)
                     /locus_tag="HG535_0Ftrna12K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:59237884"
     gene            complement(<298280..>299719)
                     /locus_tag="HG535_0F01450"
                     /db_xref="GeneID:59237393"
     mRNA            complement(<298280..>299719)
                     /locus_tag="HG535_0F01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289465.1"
                     /db_xref="GeneID:59237393"
     CDS             complement(298280..299719)
                     /locus_tag="HG535_0F01450"
                     /inference="similar to AA sequence:RefSeq:NP_013482.1"
                     /note="similar to Saccharomyces cerevisiae SEC61
                     (YLR378C); ancestral locus Anc_4.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145360.1"
                     /db_xref="GeneID:59237393"
                     /translation="MSGGLLYLFKPFEAYLPEVNAPERKVPYNQKLIWTGVSLLIFLV
                     LGQIPLYGIVSSETSDPLYWLRAMLASNRGTLMELGVSPIITSSMIFQFLQGTQLLQV
                     DMQNKQERDLFQIAQKVCAIVLTLGQAIVVVLTGNYGRPSDIGIAISLLLIFQLMFAS
                     IIVLLLDELLSKGYGLGSGISLFTATNIAEQIFWKAFAPTTVESGRGKEFEGAVIAFF
                     HLLAVRKDKKRALVEAFYRSNLPNMFQVVSTVFIFLFVLYLQGFRYELPIRSTKVRGQ
                     MGTYPIKLFYTSNTPIMLQAALTSNIFLISQILYQKFPSNPVVRLLGVWGVVPGQPGP
                     QRALKGLSYYIQPPTSLKEIPLDPLKAVVYVSFVLGVCALFSKTWIEVSGTSPRDVAK
                     QFKDQGMVINGKRETSVYKELKKVIPTAAAFGGATIGVLSVCSDFLGTLGSGTSILMA
                     TTTIYGYYEIAAKEGGFSKNLVSGLSELM"
     gene            complement(<299963..>301465)
                     /locus_tag="HG535_0F01460"
                     /db_xref="GeneID:59237394"
     mRNA            complement(<299963..>301465)
                     /locus_tag="HG535_0F01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289466.1"
                     /db_xref="GeneID:59237394"
     CDS             complement(299963..301465)
                     /locus_tag="HG535_0F01460"
                     /inference="similar to AA sequence:RefSeq:NP_010229.1"
                     /note="similar to Saccharomyces cerevisiae MCH1 (YDL054C);
                     ancestral locus Anc_4.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145361.1"
                     /db_xref="GeneID:59237394"
                     /translation="MKIRKTKKKKNEIHAKSLGKHRSRSKPQDMALSQVEHYLTYHVR
                     QLLPHVLSKRSSKHVAYVFSLLSAVSSGFIVMISLYSDSWEKQLHYSAWQINMIASLA
                     NLGMYLTPPILGFLADTHGPITLSALGIIGFIPSYSYVAYIFNHPALSNDHTFHLILM
                     SFTVMGVSTSSLYFSALITCAKLYPDKRTLSISLPTTCYGLSSFLGSQLLNLPFFWST
                     NGDSTFLNLGRVFNTFACVYAVVGLLAWIATSTVSMFKHAAMSQQESCRNGNEDMDQN
                     ENDPLIAVEPVQERLAQKQFFKDPVALFVGISMILSLGPSEMFLANMGSLTKLLVGEN
                     AVLSSRLLSVYAVLNTVTRLSSGFITDFLATRDISPKWILISLLSLSLMAQFLITNFS
                     LSTTVVSPLKILLIGAMMGTVYGGLFTAYPVIILAMWGDKLFGTAYGSMMIAPAIGSV
                     VSCMAYADIFDSKCVTEDTNATSCIAPVFEITSAQLIICILVTVVVLRRH"
     gene            complement(<301589..>302158)
                     /locus_tag="HG535_0F01470"
                     /db_xref="GeneID:59237395"
     mRNA            complement(<301589..>302158)
                     /locus_tag="HG535_0F01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289467.1"
                     /db_xref="GeneID:59237395"
     CDS             complement(301589..302158)
                     /locus_tag="HG535_0F01470"
                     /inference="similar to AA sequence:RefSeq:NP_010230.1"
                     /note="similar to Saccharomyces cerevisiae PBP4 (YDL053C);
                     ancestral locus Anc_4.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145362.1"
                     /db_xref="GeneID:59237395"
                     /translation="MMASTTTASAKTGGNVQRTKLTGWAQAAARSLPKQTQSQAQTQP
                     QLQSQTQQRQQQQQQQQQQHQQQQQQQQQQQQQQQLQKSRSNTASPISQGNKTTSQSN
                     SASSKPITSSNNKKKSAKQSYNRDEVRNYMKSLFDQYSSTLSGQSIYHNMVQNKRQGQ
                     SLDWGTVTNSKYKNKKYGCLNEVAQALWN"
     gene            complement(<302661..>305066)
                     /locus_tag="HG535_0F01480"
                     /db_xref="GeneID:59237396"
     mRNA            complement(<302661..>305066)
                     /locus_tag="HG535_0F01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289468.1"
                     /db_xref="GeneID:59237396"
     CDS             complement(302661..305066)
                     /locus_tag="HG535_0F01480"
                     /note="Rover element"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145363.1"
                     /db_xref="GeneID:59237396"
                     /translation="MPSLESSSDDEVTIVEQTMPLNTPLAHCSSSEPLTPPNENVIAS
                     TSNANQSEQQKKITSGWMGRSSFKSHFQFFFKHGRKVARCNYCGKTYKEGESTGNLSK
                     HITAVHRSVLKEKKVLKMQTLDTMSKSSKSLHLTEALIRECNKHPGTLESLLLITEGF
                     LPFNFVRLSTWSHLNRKYGGNTFIQSRTTLTKKIQHFRDCLNDTLRQNLKDTTLVNVQ
                     LDIWTAGNSQSFLAIMVSFAPNILNKELLEASNGSRLLLNIHGEASNTHLLDFVSLGD
                     KKHTGKNMCDTFMSVMEEYDLVDKLGTITMDNASNNGNFHVNLIYDHFNGLRPRGHRL
                     VGKVRFIRCASHVLNLQFQRIIKSLSRNSLFSNAFKKIRKLAKIMRYSTAINSSLKKN
                     NLPLIPYESPTRWLFTWKQVKIFLENYKAYKNWLGLVQERGQDHLVTRIQDHISFDSK
                     TINMLAYFVECGKIFDYVNKKFQDEEYNNLPQGVPLYYLLGHFYKSCLNVSTGKEIPK
                     SKKGMDFSFLNGPDTLSFDEKNIVLEAINVAYLCYQNYLSHIQANPLYYAAVMLDPTA
                     KHEQLYRMMEIDEFNLRMNQVNNFIRMYLNEEGVELGNGQQASPELSTIGREEDYYRC
                     FNVHEQPQPTETYSTASVCDVNENLEEWHRYQSEPVASGLSRIDAIKWWHANRCKYPS
                     LFKLAMSLLYTKVSSCDVERCFSLAGRVVRKDRARLHYKNVQTLMLLRDRFSKFGFYK
                     PSPILVLDSENETDLDLDNENNDIDCYLSDSSEEMHDSQDDSAATARLTSQEGINTPG
                     SAM"
     gene            <305966..>307006
                     /locus_tag="HG535_0F01490"
                     /db_xref="GeneID:59237397"
     mRNA            <305966..>307006
                     /locus_tag="HG535_0F01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289469.1"
                     /db_xref="GeneID:59237397"
     CDS             305966..307006
                     /locus_tag="HG535_0F01490"
                     /inference="similar to AA sequence:RefSeq:NP_013481.3"
                     /note="similar to Saccharomyces cerevisiae FBP1 (YLR377C);
                     ancestral locus Anc_4.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145364.1"
                     /db_xref="GeneID:59237397"
                     /translation="MPTATGQPLKEDFDTDIVTLPRFLLESQKCAKNATGDFTLLLSA
                     LQFAFKFISQTIRRAELVHLVGLSGSSNSTGDEQKKLDVLGDEIFINAMKSSGNVKVL
                     VSEEQDDLILFPTTTGTYAVCCDPIDGSSNLDAGVSVGTIVSIFKLQPNSTGTINDVL
                     RSGLEMVGACYAMYGSSTHLMLTTGQGVDGFTLDTSIGEFILVYPDLQLPSHRNIYSI
                     NEGNSFYWTPLIRSFIEELKKPHEKDNGKPYSARYVGSMVADVHRTFLYGGLFAYPAD
                     NKLPNGKLRLLYEAFPMAFLVEQAGGVAVNDEGKRILEIMPNHIHDRTSIWMGSTDEI
                     NNYLRHIGKPEL"
     gene            complement(<307035..>307934)
                     /locus_tag="HG535_0F01500"
                     /db_xref="GeneID:59237398"
     mRNA            complement(<307035..>307934)
                     /locus_tag="HG535_0F01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289470.1"
                     /db_xref="GeneID:59237398"
     CDS             complement(307035..307934)
                     /locus_tag="HG535_0F01500"
                     /inference="similar to AA sequence:RefSeq:NP_010231.1"
                     /note="similar to Saccharomyces cerevisiae SLC1 (YDL052C);
                     ancestral locus Anc_4.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145365.1"
                     /db_xref="GeneID:59237398"
                     /translation="MYLLRGLIYYSRSTLAALVLCAGGLYGTVASILFTLVGKQYLAQ
                     WVTARFFYYAMAIVFGIDVKVENEHYLDNKPFIIVANHQSALDIFMLGRVFPKGCTVT
                     AKKSLKYIPFLGWFMALSGTLFLERSNRAKSVAVLNRGLENMKKKKRALWMFAEGTRS
                     YTTELTMLPFKKGAFHLAQQGGIPIVPVVVSNTSTLMNPKWKIFNRGCINVKILKPIP
                     TIDLKKEDIGKFSEDVRDLMVTELKKIGYSTYICDTDVPPEVKLLERRRLENEDSNES
                     DSSEALSSENSAERVTNTIKEFK"
     gene            <308147..>308914
                     /locus_tag="HG535_0F01510"
                     /db_xref="GeneID:59237399"
     mRNA            join(<308147..308188,308282..>308914)
                     /locus_tag="HG535_0F01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289471.1"
                     /db_xref="GeneID:59237399"
     CDS             join(308147..308188,308282..308914)
                     /locus_tag="HG535_0F01510"
                     /inference="similar to AA sequence:RefSeq:NP_013480.1"
                     /note="similar to Saccharomyces cerevisiae PSY3 (YLR376C);
                     ancestral locus Anc_4.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145366.1"
                     /db_xref="GeneID:59237399"
                     /translation="MDVLAHCRVYPLSNFYKPVNQFVSLPQNTVKGTLFCKEIAFLHV
                     IEHDFKLSTFKKQLYLNCKSNGNSTILLIDILSAWKEFINSTNDELFVMNSLSIMTMD
                     GLVNFLLHLNESPLYALKRCQKRDSFDKQLSGIIIDNISYFAHDPTSYGLLLKVLKLL
                     RKTFGCWIITISYGLEYYNGVENATSQLYKGGSQTKIPTGYINEMDVVLIRDTDSSAR
                     ISSSTT"
     gene            <309187..>310008
                     /locus_tag="HG535_0F01520"
                     /db_xref="GeneID:59237400"
     mRNA            <309187..>310008
                     /locus_tag="HG535_0F01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289472.1"
                     /db_xref="GeneID:59237400"
     CDS             309187..310008
                     /locus_tag="HG535_0F01520"
                     /inference="similar to AA sequence:RefSeq:NP_010232.1"
                     /note="similar to Saccharomyces cerevisiae LHP1 (YDL051W);
                     ancestral locus Anc_4.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145367.1"
                     /db_xref="GeneID:59237400"
                     /translation="MSSTKESGPETHSRRGSYVAIEFTPEISQQCLKQVEFYFSDFNL
                     PYDKFLRMTAEKNDGWVPITTIATFNRMKRFRPVDKVVESLRSSKKLEVSEDGENVRR
                     IEPFDLEGAKRAKMEQNKRTVAVMNFAHENVTDKIELQDKLEEFFCKFGQINQLRLRK
                     DHTKKFNGTVLIEFKDLKEAEEFLKTYTGESAETLSFETRKLDVFTKKQFDLQREATR
                     SKNFSGSGQKARSFTGHRKNMPKASRRRSSSKKDSKPEIEAPKAEEKPEEINKDE"
     gene            complement(<310064..>310861)
                     /locus_tag="HG535_0F01530"
                     /db_xref="GeneID:59237401"
     mRNA            complement(<310064..>310861)
                     /locus_tag="HG535_0F01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289473.1"
                     /db_xref="GeneID:59237401"
     CDS             complement(310064..310861)
                     /locus_tag="HG535_0F01530"
                     /inference="similar to AA sequence:RefSeq:NP_010234.1"
                     /note="similar to Saccharomyces cerevisiae KNH1 (YDL049C);
                     ancestral locus Anc_4.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145368.1"
                     /db_xref="GeneID:59237401"
                     /translation="MQALVVVDFCLLIVLLCIPASCDVQIIEPTVGLKFDVSKGSTDI
                     RIKWAVTENDIREEDISCYIFTLMSGPNTNIQVMSSLGTLSASDVKGMEYVFNIKNTV
                     GSNGDYYVQLLAQANDGYSIHYCNRFSLTGMVGENKASSSGEREPPQPELRMNTMDAP
                     IEVDSASFSVPYHLQNGRAKYAPMQQQPLTKITAVSWRRIHETSALTFYSVVRPSPDK
                     VTTITPGVSYVLSTGPNWATAAPMPRANGHWYHPRKKLSLKPRKIIF"
     gene            <311682..>312608
                     /locus_tag="HG535_0F01540"
                     /db_xref="GeneID:59237402"
     mRNA            <311682..>312608
                     /locus_tag="HG535_0F01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289474.1"
                     /db_xref="GeneID:59237402"
     CDS             311682..312608
                     /locus_tag="HG535_0F01540"
                     /inference="similar to AA sequence:RefSeq:NP_011574.3"
                     /note="similar to Saccharomyces cerevisiae ERG25
                     (YGR060W); ancestral locus Anc_4.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145369.1"
                     /db_xref="GeneID:59237402"
                     /translation="MSAVFANQTLVELIRDKSYSETLKNVYTFQPQLSFFEKYWSAWY
                     TYMNNDVLATGLMFFLLHEFMYFFRSLPWFIIDQMPYFRKWKLQPTKIPSVKEQWHCF
                     KSVILSHFLVEAIPIWTFHPMCVKLGISVEVPFPSIKRMALEIGLFFILEDMWHYWAH
                     RLFHYGIFYKYIHKQHHRYAAPFGLSAEYAHPAETMSLGFGTVGMPILYVMYTGKLHL
                     FTLCVWITCRLFQAVDSHSGYDFPWSLNKFLPFWAGAEHHDLHHHYFIGNYASSFRWW
                     DFCLDTEAGPEAKAAREERMKIKAESNAKKSN"
     gene            complement(<312789..>316841)
                     /locus_tag="HG535_0F01550"
                     /db_xref="GeneID:59237403"
     mRNA            complement(<312789..>316841)
                     /locus_tag="HG535_0F01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289475.1"
                     /db_xref="GeneID:59237403"
     CDS             complement(312789..316841)
                     /locus_tag="HG535_0F01550"
                     /inference="similar to AA sequence:RefSeq:NP_011575.1"
                     /note="similar to Saccharomyces cerevisiae ADE6 (YGR061C);
                     ancestral locus Anc_4.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145370.1"
                     /db_xref="GeneID:59237403"
                     /translation="MSVKILVGPNALSPFRVDNLTKGIEEYTNSTSIITEVRSCYVHY
                     IDTKVSELSEKDLKLLEVLLTYDTALDLETDALSKSLYDYVKQDTAGSNTGENTYLIR
                     IVPRSGTISPWSSKATNISTVSGLDDKVERIERGLALLIKTVPGFPLLENLNDVSLQS
                     VFDRMTQELYLDLPPTSDDLFTHESPKPLVHIPLVSESLKLSPRDALNKANTELGLAL
                     DKGEIEYLVRAFVEILKRDPTDVELFMFAQVNSEHCRHKIFNADWTIDGLKKNMTLFQ
                     MIRNTHKLTPDYTLSAYSDNAAVLDTENDAYFFTPDPKTKKWTSIKESVPMLIKVETH
                     NHPTAVSPFPGASTGSGGEIRDEGATGRGSKTKCGLSGFSVSDLLIPGHKQPWELDIG
                     KPSHIASALDIMIEAPLGSAAFNNEFGRPCINGYFRTLTTKVKNATGKEEIRGFHKPV
                     MIAGGFGSIRPQFVLKDKPITPGSQLIVLGGQSMLIGLGGGAASSIAAGEGSAELDFA
                     SVQRGNPEMERRCQQVIDGCVALGENSPIQSIHDVGAGGLSNALPELVHDNNLGAKFN
                     IRKVLSLEPGMSPMEIWCNESQERYVLGVSPKDLSVFEEICKRERAPYAVVGVATAEQ
                     RLIVDDPLLNTTPIDLDMSILFGKPPKMSRETVTENLQLSAADLSVIPSIEDAVERVL
                     KLPAVGSKSFLITIGDRTVTGLIDRDQFVGPWQVPVADVGVVATSLGDSVISSGEAMA
                     MGEKPVNALISAAASAKLAVAESLLNLFAADVKSLKHVKLSANWMSPASHPGEGSKLY
                     EAVQALGMDLCPDLGVAIPVGKDSMSMKMKWDDKEVTAPLTLDITAFAPVHHTSRTWA
                     PLLNKKLDDSVLVLVDLAALNKTVSLGGSALLQVYKQVGDSSPTVTDNTVLKGFLEAL
                     IELHKTDIVAAYHDRSDGGLLVTLLEMVFASRCGLTAVIDATEERALASLFNEELGAV
                     FQISQYRLEEFKSILAKYGVSNGYVSVVGRPDFDSQIVKVVDNEGKKLYTNTRGYLQQ
                     LWSSTSFEMQKLRDNPKTSSEEFHALKDDRDPGLHFSLTYNPTDDLQIGAQLSNVRPN
                     VAILREQGVNGQMEMAWCFQQAGFNSIDVTMTDLLEGRVHLDNFVGFAACGGFSYGDV
                     LGAGAGWAKSVLYHEGVRSQFVKFFQERTDTFAFGACNGCQFLSRLKDIIPGCENWPS
                     FERNVSEQYEGRVSMVQVIQDSSTESVFLNGMAGSKLPIAVAHGEGRAKFINKEQEQA
                     FEEQSLCGIKYIDNYGNATQAYPFNPNGSQSAIAGIKSPNGRVLAMMPHPERVCRLEA
                     NSWYPAEQFEEWGGYGPWIRLFRSARRWVS"
     gene            <317400..>317651
                     /locus_tag="HG535_0F01560"
                     /db_xref="GeneID:59237404"
     mRNA            <317400..>317651
                     /locus_tag="HG535_0F01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289476.1"
                     /db_xref="GeneID:59237404"
     CDS             317400..317651
                     /locus_tag="HG535_0F01560"
                     /inference="similar to AA sequence:RefSeq:NP_076903.1"
                     /note="similar to Saccharomyces cerevisiae YLR363W-A;
                     ancestral locus Anc_4.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145371.1"
                     /db_xref="GeneID:59237404"
                     /translation="MPQKALKTSKKVKDPRRITKRQKNLRKGAPLQIKSKKKSLLHLK
                     KLNRTASLTESTEKLIASKVGHLEVLKGTRRELAKEKNK"
     gene            complement(<317758..>318726)
                     /locus_tag="HG535_0F01570"
                     /db_xref="GeneID:59237405"
     mRNA            complement(<317758..>318726)
                     /locus_tag="HG535_0F01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289477.1"
                     /db_xref="GeneID:59237405"
     CDS             complement(317758..318726)
                     /locus_tag="HG535_0F01570"
                     /inference="similar to AA sequence:RefSeq:NP_011576.1"
                     /note="similar to Saccharomyces cerevisiae COX18
                     (YGR062C); ancestral locus Anc_4.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145372.1"
                     /db_xref="GeneID:59237405"
                     /translation="MLIKGTLSRTRLAKYKLRSHSLISGRRHLSVFQNVSELLVTMHD
                     TTGLTWLTLVPLTTITLRTLITLPLSILQRKRTVKQQQLRKLVQAITPVTKLRLASVT
                     ATNTNTNTNTVGDTISTAGNRTSEVFNGNAGSVSNKRSLTPQQITLLAVKETRNRQKK
                     LFARYSVQMWKNIMLPIVQVPLWVTISMGIRGLTDKQLLETNSYYWFSQIIAPTLDLS
                     LSLDSMPLLIPMVLGTLSLANVEYNGKVLASSSTLDAGIKVATNDSSRISQSMNSILN
                     ISRFSCVFMMGISSQAPLILSLYWISSQLYSFIQNVILNWLWPYQR"
     gene            complement(<318932..>319240)
                     /locus_tag="HG535_0F01580"
                     /db_xref="GeneID:59237406"
     mRNA            complement(<318932..>319240)
                     /locus_tag="HG535_0F01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289478.1"
                     /db_xref="GeneID:59237406"
     CDS             complement(318932..319240)
                     /locus_tag="HG535_0F01580"
                     /inference="similar to AA sequence:RefSeq:NP_011577.3"
                     /note="similar to Saccharomyces cerevisiae SPT4 (YGR063C);
                     ancestral locus Anc_4.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145373.1"
                     /db_xref="GeneID:59237406"
                     /translation="MSSERACMLCGIVLSANEFSNGGCPNCQSIFEEAGVSAIECTSP
                     SFEGLVGMCKPGKSWVAKWLAVDRYIPGMYAVKVDGRLPVEVIDLLPYYKPRDGSQVE
                     "
     gene            <319545..>319874
                     /locus_tag="HG535_0F01590"
                     /db_xref="GeneID:59237407"
     mRNA            <319545..>319874
                     /locus_tag="HG535_0F01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289479.1"
                     /db_xref="GeneID:59237407"
     CDS             319545..319874
                     /locus_tag="HG535_0F01590"
                     /inference="similar to AA sequence:RefSeq:NP_013468.3"
                     /note="similar to Saccharomyces cerevisiae YLR364W;
                     ancestral locus Anc_4.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145374.1"
                     /db_xref="GeneID:59237407"
                     /translation="MVDYNSEVRKLIGGHKFFLFSASWCPDCRYAISVFSKYGVIGKI
                     HNFDIASLSTKEQQEWRNAFQKVTGSRNLPTLYVNGSVWGTEAQLHKFESRDSLAEEF
                     AKIGLTS"
     gene            complement(<319915..>321747)
                     /locus_tag="HG535_0F01600"
                     /db_xref="GeneID:59237408"
     mRNA            complement(<319915..>321747)
                     /locus_tag="HG535_0F01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289480.1"
                     /db_xref="GeneID:59237408"
     CDS             complement(319915..321747)
                     /locus_tag="HG535_0F01600"
                     /inference="similar to AA sequence:RefSeq:NP_011579.1"
                     /note="similar to Saccharomyces cerevisiae VHT1 (YGR065C);
                     ancestral locus Anc_4.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145375.1"
                     /db_xref="GeneID:59237408"
                     /translation="MVFRRRWQMNLQWNKFTGCFDFISHSRFIPRLRVLPEELQEDGS
                     NIQSDESLSVESHVIHENKKDSENEAEEEHEVSENEEIDGLRTNMPYELRNEAGRRWY
                     KYFDEYEYRMNEEYKKSRKWYEFLYPNHATQTKAERKLLYKLDLVLALYLLVLCWSKS
                     VDTNNYTSAYISHMREDLNMKGNDYIYTSTISNIGAIVFQLPFMYLLPRYPAHIMLPA
                     MDMGWTWFTFACYRAKTLAELRAYRFILNAFGAAYYPVSQYLLGCWYAPDEISSRVCL
                     FFCGQLLGGVTSGLLQARIFRSLDGVHGLAGWRWMFLIDAVAISLPTAIMGFFILPGI
                     PSKCYSLFFTDEEIRIARARNKRNHIKDSVKESELKPLWSKDIWKKVFCTPAFWVLVV
                     FDTCSWNNMTAFSGSYSLWLRSNPNYSIEHANNLSVLPACLGFVYVFICAFGADLFRC
                     KWIFMVFAAIMNTVSCAILIKWDVSSSAKWFAFLTTYFSVSASPCLWSFINDFLRLDP
                     QVKAVTWIAIYSISQSTYAWIPSLAWQTIESPRFKTGYTVSLIFGAIYGLWTFVVLYF
                     YKRNEKKHALGNGIILYDTDKDIEIPQFVHRDMEEKNGYYYLKE"
     gene            <322991..>323711
                     /locus_tag="HG535_0F01610"
                     /db_xref="GeneID:59237409"
     mRNA            join(<322991..323123,323452..>323711)
                     /locus_tag="HG535_0F01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289481.1"
                     /db_xref="GeneID:59237409"
     CDS             join(322991..323123,323452..323711)
                     /locus_tag="HG535_0F01610"
                     /inference="similar to AA sequence:RefSeq:NP_013471.1"
                     /note="similar to Saccharomyces cerevisiae RPS22B
                     (YLR367W); ancestral locus Anc_4.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145376.1"
                     /db_xref="GeneID:59237409"
                     /translation="MTRTSVLADALQTINNAEKTGKRQVLIRPSSKVIIKFLQVMQRH
                     GYTGEFEYIDDHRSGKLVIQLNGRLNKCGVISPRFNVKIADIEKWTENLLPARQFGYV
                     ILTTSAGIMDHEEARRKHVSGKILGFVY"
     gene            complement(<323840..>326491)
                     /locus_tag="HG535_0F01620"
                     /db_xref="GeneID:59237410"
     mRNA            complement(<323840..>326491)
                     /locus_tag="HG535_0F01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289482.1"
                     /db_xref="GeneID:59237410"
     CDS             complement(323840..326491)
                     /locus_tag="HG535_0F01620"
                     /inference="similar to AA sequence:RefSeq:NP_011581.4"
                     /note="similar to Saccharomyces cerevisiae YGR067C;
                     ancestral locus Anc_4.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145377.1"
                     /db_xref="GeneID:59237410"
                     /translation="MAANQKKYSCYFCSKTFSRSEHQARHERSHTGIKPFECKVCRHA
                     FVRRDLLQRHIRTVHRDTLLMKRKSQQDQEQQESIARQNGVVEAEGGTADGGARGRGS
                     GSSFSSGSGSGSCSGSGSGPGSGPGSVCELGSTKNELYLELLVNSMIRVNNDATAPLL
                     AIKQGTFKKQSFDLGDEQCMVLQNLFARYASTATMSYENIRNFYNTGMRNLERVDKFK
                     LTLSEINNDRILAILCIGSMRNQQIRDDIWQISWSNINDIVALDIMQHGFALIDYKPA
                     DILQFFNKFQRVYLDSKINQLFYWQTFDSWVKLLRITNEPNNISSLILNNIVREKFIG
                     KFTVEEFFKNSRGSLQKLLLSSVDILSNVIYCHWLFFCKLNALQIFQNKIDFHNALKM
                     VNTHYVRISKERRQQREQKKFKVKLQYKTSVPESFKKTINQRSLPIQSDNHWLLLETF
                     WFEFMDQINSSRQIWFMDAIAPIDISLINENLSICALPILTIVQQTVNHEDIKKRYLS
                     LITDVVIFLIKIFEIELSVNNVKFHPNRIFKLLSNQSIQLLLVFEYLTIFQDSNIEMY
                     AIDHFMNEFIFSQGKVIDNMWDVRSSFLDTQSLIFIGFYQLVQAIIKNLKDEIITKKL
                     RKIQSLSHHLQSRLNELSIDSLNYQNEYYYDYDSQSSTNRSINDPWQSNNGLAIQSPG
                     SINSLPNNSVSSGSEGFNLQNVGMTHSSSLDSSTFRNSNVILPPLNMNMNSIRRPSLD
                     QSMMLRNQQDFSFQHHRQQYNNNIIPNNNSRNSLGNNGNNGSNSINHNNGQFYSYGAE
                     PVSPKTIPQTTEVLSPTFVTHVNNDTNPISSLTASSYVAPANASTVSPNSSCNVSDPA
                     FSDSGSPPTINNVRLPPPSHLFGVSSK"
     gene            complement(<327267..>328988)
                     /locus_tag="HG535_0F01630"
                     /db_xref="GeneID:59237411"
     mRNA            complement(<327267..>328988)
                     /locus_tag="HG535_0F01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289483.1"
                     /db_xref="GeneID:59237411"
     CDS             complement(327267..328988)
                     /locus_tag="HG535_0F01630"
                     /inference="similar to AA sequence:RefSeq:NP_011582.1"
                     /note="similar to Saccharomyces cerevisiae YGR068C;
                     ancestral locus Anc_4.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145378.1"
                     /db_xref="GeneID:59237411"
                     /translation="MFGPKSYLHGGGFAGINNKGPIVYFDIRVSSPYRDLILIKESQL
                     ETEEQLLSGKLILSINENFVLKKLSLKLVGRFKLDFLQLDHGSGVTNIVKDRKVVFET
                     NWDNLLVSSHGEVVRSNKTSLNHPMRSFSSPVVNRLIKKKSTTSHVLELPSDGFNGTP
                     FTDLDPEHSYLFHLHKGNYELPFDVRLPQDIPDTIEGLQSGSILYSFEAIIDRPQKIH
                     FHSHGFSTYKYLRIFRTLAMDHLALQQDVTVSNTYVDKLQYKISIPSKAIAIGGSTVI
                     NIELFPFRKGYKLEKITGSLKQWFVIRDTNDNLYDDQIVINKQSMTEFKDIENIQQRD
                     NLLLGNTTINSIFQLPHDLKKITQDVECANDLIHVKHKISIHVMLRHIHDNKTLEIKA
                     NLPVLLYVSPAERVQGRLVLLDSTNGNIHFRTNEYVDLFDPSATNSHSSITPNTHSLS
                     PSPSPAAMLLPPPNYMDRLKDSLVNGNRSVTRSAPVSPRLTHQDQHPPRHQDKEIDFF
                     GLPQPAATPVQLQNETQFRALGTASPTARQPAEPALPLPPAISELSEDERCQVPSYEQ
                     TMQEYPH"
     gene            <329198..>330961
                     /locus_tag="HG535_0F01640"
                     /db_xref="GeneID:59237412"
     mRNA            <329198..>330961
                     /locus_tag="HG535_0F01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289484.1"
                     /db_xref="GeneID:59237412"
     CDS             329198..330961
                     /locus_tag="HG535_0F01640"
                     /inference="similar to AA sequence:RefSeq:NP_013472.3"
                     /note="similar to Saccharomyces cerevisiae MDM30
                     (YLR368W); ancestral locus Anc_4.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145379.1"
                     /db_xref="GeneID:59237412"
                     /translation="MASSSITILPDEIWIEISQYLTVQDLFRLRVCCRKLNAKISSRA
                     IWKPICLKNWLNHQNNDPFMKITDNEENYLLKDDWFSYFRFRNNIDCGIMRNLRRIMQ
                     QKDSKKYWDEFQSLMRFKKSHIIPLLHRTVNKQYPRDEIPLHLIAICQKVLTSYRHEY
                     VVNLFTNENGGIEFVHNAEETIFLKLAAMDPSFDRLLHHRSQVFNKIHLLIKRDFNNS
                     SDEFMTLPTTLRVDKLICYLIELLNPFSNSRHLFLEDFILLRIYAGEAHGHPLLILAI
                     IQALASKYKVETLLCSSYLIIRDHRLKDGETYLTISSTGKPKIFTRGRLIHSLKHLVG
                     SSDYIIQNEIIPTILQPLKMKDCISTIFKELLPVYNKSKWYTMNPKTIESAKLIFPHS
                     GQPMSCDAVNYFLCVHKATDIGHRNEMRVSTLYTITRREVFRMLSKLYPGDLNEIKSL
                     LRRDSDSFVEPFLRYEEWLHQLHNISLETEDGMGLFVVSSRDLQLMCIVGTRQFSNQH
                     TYYTLMNALGEFYIELDENVEPCDWECNEDLISDFLSMASRSDLGLVFSGIDKSSHRL
                     EMNSIVQHIIDEKEQQASLGF"
     gene            <331125..>333125
                     /locus_tag="HG535_0F01650"
                     /db_xref="GeneID:59237413"
     mRNA            <331125..>333125
                     /locus_tag="HG535_0F01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289485.1"
                     /db_xref="GeneID:59237413"
     CDS             331125..333125
                     /locus_tag="HG535_0F01650"
                     /inference="similar to AA sequence:RefSeq:NP_013473.1"
                     /note="similar to Saccharomyces cerevisiae SSQ1 (YLR369W);
                     ancestral locus Anc_4.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145380.1"
                     /db_xref="GeneID:59237413"
                     /translation="MTTYLKRLYRSGKNTYRLDRMLSLSKLSRIHITASPRQLTRSIS
                     SRVVGIDLGTTNSAIGYIRDSSDKRSATIIENDEGQRTTPSVVAFDKDGRVIVGAAAR
                     RQAAINPENTFFSTKRLIGRLFEDKEVQRDLKSVPFKIVKSNQSGQAYVKTTFGDVKS
                     PSEIGSLILQYLKRTAEDYLEETVENAVITVPAYFNDSQRQATKDAGRLAGLKVLRVV
                     NEPTAAALSFGLDDSKNSGIIAVYDLGGGTFDISILDIEDGVFEVRATNGDTHLGGAD
                     FDNVVINHIIDSFLKENPEIEKSAIIEDMDTMQRLREVAENSKIALSHVNETTIEIPF
                     LFENKHLLTTMKESELDDMTMHLIERTIGPVRKALKDADIEAKDVDDLILVGGMTRMP
                     RVRSVVREIFGKDPNTSVNPDETVALGAAIQGGVLSGEIQNVLLLDVTPLTLGIETFG
                     GAFCPLIPRNTTVPVKKMEIFSTGVDGQTGVDIKVYQGERGLVRDNKLIGDLKLTGIT
                     PMPKGVPQVCVTFDIDADGIINVSALERSSGSEKSIQVVANSGLTEQEIAQIVEDANK
                     NREKDNIIRQRVELLTKADIMISDSENTFEKFKGVISSDESYPEVLEELKKTREMIND
                     FKNNDSDLTRDVNDVKRATDEFQKRALKLFQSSSKRQSESKK"
     gene            complement(<333230..>333839)
                     /locus_tag="HG535_0F01660"
                     /db_xref="GeneID:59237414"
     mRNA            complement(join(<333230..333754,333834..>333839))
                     /locus_tag="HG535_0F01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289486.1"
                     /db_xref="GeneID:59237414"
     CDS             complement(join(333230..333754,333834..333839))
                     /locus_tag="HG535_0F01660"
                     /inference="similar to AA sequence:RefSeq:NP_013474.3"
                     /note="similar to Saccharomyces cerevisiae ARC18
                     (YLR370C); ancestral locus Anc_4.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145381.1"
                     /db_xref="GeneID:59237414"
                     /translation="MPAYHSTFPVDPQNDRMVGNIALLPLNTKFRGPAYPANSDYDII
                     DECLDLFRANSFFKNFEIKSPADRVLIYGILFINDCLAHLKITTTYNEALKALTNVAL
                     DNFTIPGTPGFPMNTVYSVPVTDHNAMELLRTYIQQFRQELAIRLLERLYRDSKESPS
                     KFWLAFTRRRFMNKSL"
     gene            <334270..>338265
                     /locus_tag="HG535_0F01670"
                     /db_xref="GeneID:59237415"
     mRNA            <334270..>338265
                     /locus_tag="HG535_0F01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289487.1"
                     /db_xref="GeneID:59237415"
     CDS             334270..338265
                     /locus_tag="HG535_0F01670"
                     /inference="similar to AA sequence:RefSeq:NP_011584.2"
                     /note="similar to Saccharomyces cerevisiae ROM1 (YGR070W)
                     and ROM2 (YLR371W); ancestral locus Anc_4.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145382.1"
                     /db_xref="GeneID:59237415"
                     /translation="MVNVSSSQDRRSVYSEIFGIERKSNSLTLDLIYDRENDYNNKQE
                     SYEARLPDKIEDIEQLNEVLSEEIFNDFLPETEDVLEKEGYILPYKTHIRRVSDTPSL
                     LSGEHTPQGSPKRSSSSKAPFSPTIHEKTVYTHQKSALQPTVPKTTGLSDARLANATV
                     SVNSDSSCQAKKEDKTKTEQTPRRTPSLPQLSISGLKKQSSFSHSNGGTPTMKKSPLQ
                     GFGFFSRPSSRDLQEQQQHPNHYNQQQHPQQNQYAVDSHHFQQQQFQQAPIAGNSSRT
                     MSINSSTLKNFASSLQSKTTSGRKIPQKYDTFSNTFSEHHNHHPSGYPQAANTAGLSS
                     YGNYTLGNKQSSSSLGLGLKSRNSSASLSSKRFTSASGASLLYEHRNSGSIPSSKPIV
                     SASNKKPQVYPALLSRVATKFKSSIEVGDHKKDGLIYRDAFTGHQAVDVICSIIRTSD
                     RNLALLLGRSLDAQKLFHDVIYEHRLRDSPHEVYEFTDSSRVIGTGTTGVVAVNSRDP
                     LMLLPSSSQVNSIPYSGSTIVNSGSASSLKSDQTTSQDSKVTQNPASIHNVNGVFTLL
                     VECYSPTCTRDRLCYSISCPRRLEQQARLNLKPNGGLKRNISMALDEEEEEKPSWTSS
                     VSKEIWENLPKSEIKRQETIYEVFITEKNFVKSLEITRDTFMKTLAETNIIPADIRKN
                     FIKHVFAHINDIYSVNRRFLEALADRQKSSPVVKGIGDIILRFIPFFEPFVSYVASRP
                     YAKYLIETQRSVNPYFARFDDDMMSSSLRHGIDSFLSQGVSRPGRYMLLVREILKSSD
                     AEKEKRDHENLTKAMEALHDFMKRIDRASGAAQDRHDVKLLKQKILFKNEYVNLGLND
                     EKRKIKHEGVLSRKELSKSDGSVVGDIQFYLLDNMLLFLKAKAVNKWHQHKVFQRPIP
                     LPLLFVCPSEDMPSSRKFIGTKPDCFAGVLQPEHAQINSKNAMTFLYYGAKQKYQVTL
                     YAAQVAGLQTLLEKIKQEQGRIISETNMLNVIKISDKFFDYTNKINSVASCDGGRKLL
                     IATNSGLYMSNIKRQKNKETGKRTTYFSTPVQLVQRNNISQVAVLDEFQSILLLVDKK
                     LYRVPLALLAVESNGTSFFKKHSKELVNHVNFFAEGDCNGKRLVVTAHSSSHSVKYFE
                     HDHPLLSERNGGGKNGKRKITEVIFDSEPVSISFLKANLCVGCKKGFQIVGVSQNAHE
                     SLLDPADTSLEFALRDTLKPMAIYRVGDTFLLCYTEFAFFVNTQGWRKRDSHIIHWEG
                     EPQKFAIWYPYILAFDNNFIEIRKIDSGELVNCVLGEKIRLLQTSSQEILYVYEDSRG
                     YDTVASIDFWG"
     gene            <339978..>341030
                     /locus_tag="HG535_0F01680"
                     /db_xref="GeneID:59237416"
     mRNA            <339978..>341030
                     /locus_tag="HG535_0F01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289488.1"
                     /db_xref="GeneID:59237416"
     CDS             339978..341030
                     /locus_tag="HG535_0F01680"
                     /inference="similar to AA sequence:RefSeq:NP_013476.3"
                     /note="similar to Saccharomyces cerevisiae SUR4 (YLR372W);
                     ancestral locus Anc_4.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145383.1"
                     /db_xref="GeneID:59237416"
                     /translation="MDQVVDQVAEEILVEQTVPPLLQFIDSIPWIKYHVPSVDHPFGL
                     ELWPIFSCVFEKITGYPAENFDFIRGDTFMANGYHAVGVIIVYYIVISSGQAILRAFN
                     AGPLKLNFLFQLHNLILTSVSLALLLLLVEQLIPMVYRNGIFWAICSKEAFAPKLVTL
                     YYLNYLTKFLELFDTVFLILKRKKLLFLHTYHHGATALLCYTQLTGRTSVEWVPISLN
                     LAVHVIMYWYYFLSSRGIRVWWKEWVTRFQILQFLIDLVFVYFATYTFYAHKYFDKIL
                     PNKGTCYGTQDAAAYGYLILTSYLFLFISFYIQSYRKSSKRAETVANEKRENAAATGR
                     SSGVKTSSTKATSRKA"
     gene            <341438..>341929
                     /locus_tag="HG535_0F01690"
                     /db_xref="GeneID:59237417"
     mRNA            <341438..>341929
                     /locus_tag="HG535_0F01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289489.1"
                     /db_xref="GeneID:59237417"
     CDS             341438..341929
                     /locus_tag="HG535_0F01690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145384.1"
                     /db_xref="GeneID:59237417"
                     /translation="MMSTALHSDRDPDPEGLLSEDHIARSTNWSADDVRANPRRRRAC
                     DKRGNGCRLRLSEAGPRKTGGACDHPKKAMLAWNQPVTGLGRTGKGSRSCVVLNCALR
                     CAVVCPPHRDRVTLEELNWKADSVTSRFGPPQTATHRAPRSTTLAKMTGCRKGEKRKK
                     KKF"
     gene            <342526..>343761
                     /locus_tag="HG535_0F01700"
                     /db_xref="GeneID:59237418"
     mRNA            <342526..>343761
                     /locus_tag="HG535_0F01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289490.1"
                     /db_xref="GeneID:59237418"
     CDS             342526..343761
                     /locus_tag="HG535_0F01700"
                     /inference="similar to AA sequence:RefSeq:NP_010235.1"
                     /note="similar to Saccharomyces cerevisiae STP4 (YDL048C)
                     and STP3 (YLR375W); ancestral locus Anc_4.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145385.1"
                     /db_xref="GeneID:59237418"
                     /translation="MHAIMSSNRTDANRLNPAFGSVQQFGMSNGGGGDGRGGVVVTGG
                     GRGGEAGSAGSGAALGSGAMGSMGGVSGGGVAGHVTLPPISSFDNLIRAAEKQYSETA
                     PGRRVHMHNDLALMTSPVLLSYQLTSPHHASSVVQRRLSSASSVSSSASVSSSSISHN
                     AQLQSAEPSLSPLQRNPPTSSSSLSSATKNSHSTSNVSSSANSSKTNSKIHKARKKKE
                     CPICHNFYANLSTHKSTHLTPEDRPHKCPICNRGFARNNDLIRHKKRHWKDEIVAHNE
                     HKDDCHHCASEEDDDTDHNTSTMTEYDQLKSLHQIKGTFKCPYNSSLIQLDMEVYPYK
                     SKPLKFETSNCHQTGVFSRCDTFKNHLKALHFEYPPGTKKRDRAVVPGRCKHCGLKFP
                     NVDVWLNEHVGKTCGYSYH"
     gene            complement(<343893..>345185)
                     /locus_tag="HG535_0F01710"
                     /db_xref="GeneID:59237419"
     mRNA            complement(<343893..>345185)
                     /locus_tag="HG535_0F01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289491.1"
                     /db_xref="GeneID:59237419"
     CDS             complement(343893..345185)
                     /locus_tag="HG535_0F01710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145386.1"
                     /db_xref="GeneID:59237419"
                     /translation="MSKIETAGGSATSTETTEAMNSGGKSAIDINGNVCKVPDFTIKD
                     ILGAIPEHCYERRLYESLYYVFRDITCVASIGVFANKYAYPFLFDGIAIDTMYTKLAK
                     FTFWFGYTCIQGLFCTGIWVLAHECGHQAFSDYGVINDFVGWLLHSYLMVPYFSWKYS
                     HSKHHKSTNHLTRDTVFVPPTTEQFKKKRGLVGDMIYNHSGDSPIRTLIELLLQQLAG
                     WIAYITTNVTGQDYPAVAAWKCNHFYPTSPLFEKKDVLYIFLSDVGVLTQLLVLKIWY
                     DKFGGWSVFINWFIPYLWTNHWLVFITYLQHTDTEVPHYDADEWTFAKGAAATIDRKF
                     GFVGPFMFHDIIETHVSHHFCSRIPFYNARDASAAIKKVMGEHYKSSDENMWKSLWKS
                     AKSCQYVEGDNGVLMFRNINKVGIDFTNDGNNDIKKNK"
     gene            <346831..>347502
                     /locus_tag="HG535_0F01720"
                     /db_xref="GeneID:59237420"
     mRNA            <346831..>347502
                     /locus_tag="HG535_0F01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289492.1"
                     /db_xref="GeneID:59237420"
     CDS             346831..347502
                     /locus_tag="HG535_0F01720"
                     /inference="similar to AA sequence:RefSeq:NP_013467.3"
                     /note="similar to Saccharomyces cerevisiae NMD4 (YLR363C);
                     ancestral locus Anc_4.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145387.1"
                     /db_xref="GeneID:59237420"
                     /translation="MNEYNFILDASCFEKGLGIIKRWLKECPGKVKLRLYIPTYTLNE
                     LDFLKFKKKSYTAKESLKFIDIVSTDNDSSFGPEFIIEFPEILELVTWSEVLEFVNDA
                     SKKDTLNKLPGRIKGLMKSCLYKCQFDDGSDGLKWIFISEDPLVRDMADICRVPCCSI
                     VDADSILDKDMNTTAYQENQKFNNLVSQNGIKEETSTRGKKTVTTKFENTLYAPRGSG
                     KLWTP"
     gene            complement(<348069..>349550)
                     /locus_tag="HG535_0F01730"
                     /db_xref="GeneID:59237421"
     mRNA            complement(<348069..>349550)
                     /locus_tag="HG535_0F01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289493.1"
                     /db_xref="GeneID:59237421"
     CDS             complement(348069..349550)
                     /locus_tag="HG535_0F01730"
                     /inference="similar to AA sequence:RefSeq:NP_011573.3"
                     /note="similar to Saccharomyces cerevisiae SPR3 (YGR059W);
                     ancestral locus Anc_4.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145388.1"
                     /db_xref="GeneID:59237421"
                     /translation="MEKKAARFFINMSLTEDVKVEQLEQSIDIFNDGRHIFDPDRTAI
                     VDINFSVLSEPPLGQGSTLPTLEVSRILEDYDMKFEELLRQKELITIHQGLQFNLMVA
                     GQSGLGKRTFVNSLFNTIIIPSPRKNRNNHCGSTGTRILECHKAKINFGSTLLSLKVV
                     TTPGYGGKLDNSFAWIPLVNYVEEQLRSYVFQEEQPQRETLCDNRVHCCLYFIPPTNK
                     EVSPLDIITMRELSKRINLIPIIAKADALNRDELNAFKQKVRKTLQENEVRVCRLLES
                     ELSHFDDIFNEFPLDIISSNDMVFSGSGNYIRYRKYSWGSINVEDPTTSQQTLLKQIL
                     FDTHFFDFITSMESYYEKYRSCFLRGRVSKARYYLDHNDISLPPIDNETLEIITALDF
                     DNLDNNGLLNYSCYKIFDKKYMDSLVMENSPRFVQKVLELQKKMEAIIKRFDQEFKEE
                     EETLINMQVEFNDEAEKLNCDIQNLQLECYALENSISKRKTTM"
     gene            complement(<349802..>350892)
                     /locus_tag="HG535_0F01740"
                     /db_xref="GeneID:59237422"
     mRNA            complement(join(<349802..350767,350848..>350892))
                     /locus_tag="HG535_0F01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289494.1"
                     /db_xref="GeneID:59237422"
     CDS             complement(join(349802..350767,350848..350892))
                     /locus_tag="HG535_0F01740"
                     /inference="similar to AA sequence:RefSeq:NP_011572.2"
                     /note="similar to Saccharomyces cerevisiae PEF1 (YGR058W);
                     ancestral locus Anc_4.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145389.1"
                     /db_xref="GeneID:59237422"
                     /translation="MCPKKLNYAAGDDLMLYATPKEAMRESRRRMEEEKQKRQQKYEM
                     RMAPNQRVDPTMHNAPLPLPITHASPIVNNSMQHPHNSAPYYDPRQNIPSGLPVQIKR
                     TSPTSRATQRARPPPISSQPSMTPPPQRIMSSPSTLNSPATVNTARSSQEVLEESKDL
                     QIATQLFANHDIRGKGRLTPEELQNLLQNDDSSHFCISAIDALINLFGASRFGTINQA
                     EFISLYKRVKNWRKVYVDNDINGSFTISVSEFHNSLQELGYQVPFEVSERLFDQYAEF
                     MNQTVNGKELKFDKFVEALVWLMRLTKVFRKFDYGQEGVATIHYKDFIDETLYLGRFL
                     PR"
     gene            complement(<351077..>353152)
                     /locus_tag="HG535_0F01750"
                     /db_xref="GeneID:59237423"
     mRNA            complement(<351077..>353152)
                     /locus_tag="HG535_0F01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289495.1"
                     /db_xref="GeneID:59237423"
     CDS             complement(351077..353152)
                     /locus_tag="HG535_0F01750"
                     /inference="similar to AA sequence:RefSeq:NP_013466.1"
                     /note="similar to Saccharomyces cerevisiae STE11
                     (YLR362W); ancestral locus Anc_4.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145390.1"
                     /db_xref="GeneID:59237423"
                     /translation="MMTDATFVEEFLKGLNCEQHLERFVACKLTSPDEIRYLDREVLC
                     ALGVHKLGDRLRILRKVQAMNAGQAKENYTANLNEIIEKISTLSAGELTVHEELATEK
                     HSVIFILNDGSAKKVNVNGCFNADSIKKRLLRRLTPRTESDDGYAVQDYDVFVVDYVK
                     NVLHLLYDVELVTICHSSDRVEKNRLMFVPKDQTPSDKAILTSKKLYLKTIKVASHQH
                     STTNQGAPMMSASTAELVSGASETYGQLRVDNSRERIRKIFNQRPPSEFISTNLAGYF
                     PHADMKRLEKTLKESFRQSARLSAIQGRVPTGDSNKVGDILLKHSNAVDTALLQSLDK
                     KEEHDQKDDQTHVAYDPAVERKQSARKEKEFDDEETDRIELWNSGSDEKFDENTEDYT
                     VSLPTTIDKPKTWLKGARIGSGSFGTVYLGMNARTGELMAVKQVELQASVLPGGSKKQ
                     ENWDLNQEQKVKNASRIHRKMIDALQHEMNLLKELHHENIVTYYGSSQESGNLNIFLE
                     YVPGGSVSSMLNSYGPFEESLITNFTRQILIGVVYLHRKNIIHRDIKGANILIDIKGC
                     VKITDFGISKKLSPLNKQQNKRASLQGSVYWMAPEVVKQTATTEKADIWSTGCVVIEM
                     FTGKHPFPDFSQMQAIFKIGTSTTPEIPSWATEQSRDFLEKAFLLDYKKRPSAAELLQ
                     HKWLENLLT"
     gene            <353442..>353714
                     /locus_tag="HG535_0F01760"
                     /db_xref="GeneID:59237424"
     mRNA            <353442..>353714
                     /locus_tag="HG535_0F01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289496.1"
                     /db_xref="GeneID:59237424"
     CDS             353442..353714
                     /locus_tag="HG535_0F01760"
                     /inference="similar to AA sequence:RefSeq:NP_878134.3"
                     /note="similar to Saccharomyces cerevisiae YLR361C-A;
                     ancestral locus Anc_4.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145391.1"
                     /db_xref="GeneID:59237424"
                     /translation="MDQEEHKEKKSAIQKPARPIEEMEAEVKNPRYTMRHKGRDVEVD
                     MDKISKPHAVSACKGFPDINIGHMAERSNAGGLLRNDGHRPSSEKK"
     gene            <353918..>355648
                     /locus_tag="HG535_0F01770"
                     /db_xref="GeneID:59237425"
     mRNA            <353918..>355648
                     /locus_tag="HG535_0F01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289497.1"
                     /db_xref="GeneID:59237425"
     CDS             353918..355648
                     /locus_tag="HG535_0F01770"
                     /inference="similar to AA sequence:RefSeq:NP_013465.1"
                     /note="similar to Saccharomyces cerevisiae DCR2 (YLR361C);
                     ancestral locus Anc_4.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145392.1"
                     /db_xref="GeneID:59237425"
                     /translation="MRILSKKYLRVLLYLALAISGLFWYRRLTMYAHPVDDAKDQDTK
                     KQLAKTWLQTNNLEHWSGSKIFVVNVGRKKCYHVGKLLERCFIEYEMAPHTAKHAERK
                     LISKDLRGSYGFNWFGVSEYVFYDTLSIESLSSTDEEVYSQLVAVHSISNKKTLNAFE
                     WIDNVFVEAVRILPNLSIDNYIISNLDILFGEDCVDPRPGWQLNKSWSFSKGRFPSFL
                     SYKYLDHTEKEDYTKQLQIRRDGKLKIVQLADLHFSVGKGECEDEFPASDNCEADPKT
                     LRFIEGILDIEEPDLVVFTGDQIMGQRCVQDSTSALLKVLAPVIERKIPWALIWGNHD
                     HEGSLDRWKLSEFTAALPYSLFSMSARDTNDNSFGVGNYILQLQGSTEEKATITLYFF
                     DSHSYSRSGKIYPGYDWIKEAQWEYMRERYDNEYSKHIAKDAHLSMAFFHIPIPEYLS
                     FQSKKNPNEQNPKVGTFKEGVTAPKYNSGGIFTLDYLGVDATSCGHDHCNDYCILDDS
                     SSRKIWLCFGGGSGEGGYAGYGGTERRIRIYEFDTKERAIYTWKRLNGSLKEKFDYQP
                     IVSGGVPNFE"
     gene            complement(<355614..>356894)
                     /locus_tag="HG535_0F01780"
                     /db_xref="GeneID:59237426"
     mRNA            complement(<355614..>356894)
                     /locus_tag="HG535_0F01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289498.1"
                     /db_xref="GeneID:59237426"
     CDS             complement(355614..356894)
                     /locus_tag="HG535_0F01780"
                     /inference="similar to AA sequence:RefSeq:NP_013464.3"
                     /note="similar to Saccharomyces cerevisiae VPS38
                     (YLR360W); ancestral locus Anc_4.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145393.1"
                     /db_xref="GeneID:59237426"
                     /translation="MPPYLLKRRLRHIRSIKLSNIAISEANSITEHFQLLSCFITLES
                     HKGQLLYVSELQEASMNMIQFNELPKQDNPITSFLLKILISAPDNPNSSPLDVPADNE
                     KMWIFFRKYNVDLNKLRRMEQDEMVENCNYPIFEIVDGLYVLPDALTVSMAPASGLHR
                     RTPSNYKVKQSFSFNSVLKLTMITEYMRQIKDETEFTSHRLDKLMRSVHKETDRIIKV
                     IKNSNEELKKNIERKKESKKNINESFRSPKHARQSSLVSQHPSLNDYYGNTYSDFIQV
                     KNRLELIRSKKVNQLISVFQGTVLFDPEVGFLELRDSPSSSVYDKIKLKLLDEECILS
                     LASKSEVERYATNASLGYYLLFILLMANEVFEVPLPYSLHFYGSTSIVETNHPLYLEN
                     SIALKNLENFSKAVSYFNRDIVQIIQNLELRQTL"
     gene            <357076..>357795
                     /locus_tag="HG535_0F01790"
                     /db_xref="GeneID:59237427"
     mRNA            <357076..>357795
                     /locus_tag="HG535_0F01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289499.1"
                     /db_xref="GeneID:59237427"
     CDS             357076..357795
                     /locus_tag="HG535_0F01790"
                     /inference="similar to AA sequence:RefSeq:NP_011571.4"
                     /note="similar to Saccharomyces cerevisiae LST7 (YGR057C);
                     ancestral locus Anc_4.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145394.1"
                     /db_xref="GeneID:59237427"
                     /translation="MAPIIISLGHFCDKHGPRVVLVTQAGIKGSTGDELLLPTYPTDS
                     YCKSCSLTFPDGDRNDVRSFKSNIASRSYVTTQYSSIRYQLLTLIVRRCFSEETMIYD
                     GRPLVFYDDLRGFNLAIGFKLRDETARGNERRYCWILTIDSKNHNSSMKLLSEHWNFI
                     TSGFSKAIQYINETHDKESERQNKLHNENNIKLMEGTYLRGNKAKMPRNLCELTNDNL
                     LFVRIHKWNAFILNSIMESHD"
     gene            complement(<357854..>359302)
                     /locus_tag="HG535_0F01800"
                     /db_xref="GeneID:59237428"
     mRNA            complement(<357854..>359302)
                     /locus_tag="HG535_0F01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289500.1"
                     /db_xref="GeneID:59237428"
     CDS             complement(357854..359302)
                     /locus_tag="HG535_0F01800"
                     /inference="similar to AA sequence:RefSeq:NP_013463.1"
                     /note="similar to Saccharomyces cerevisiae ADE13
                     (YLR359W); ancestral locus Anc_4.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145395.1"
                     /db_xref="GeneID:59237428"
                     /translation="MSDFDKYSTPLSSRYASKEMSGIFSLRNRFSTWRKLWLNLAIAE
                     KELGLTVVTDKAIEEMSNHLAITDEEIAKASAQEAIVRHDVMAHVHTFGETCPDAAGI
                     IHLGATSCFVTDNADLIFLRDAYDLLIPKLVNVINRLANFAMEYKDLPVLGWTHFQPA
                     QLTTLGKRVTLWVQELLWDLRNFVRARNDIGLRGVKGTTGTQASFLALFHGDHNKVEA
                     LDKRVTELLGFDTVYPVTGQTYSRKIDIDVMAPLSSFAATAYKMATDIRLLANLKEME
                     EPFEKSQIGSSAMAYKRNPMRCERVCSLARHLGSLFNDAVQTASVQWFERTLDDSAIR
                     RISLPSAFLTADILLSTLLNISSGLVVYPKVIERRIKGELPFMATENIIMAMVEKGAS
                     RQEVHENIRVLSHQAAAVVKEEGGDNDLIERVKKDQFFKPIHSELESLLDPSTFVGRA
                     PQQVEKFVNNDVKNALQPFSSYINDADVKLNV"
     gene            complement(<359484..>362135)
                     /locus_tag="HG535_0F01810"
                     /db_xref="GeneID:59237429"
     mRNA            complement(<359484..>362135)
                     /locus_tag="HG535_0F01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289501.1"
                     /db_xref="GeneID:59237429"
     CDS             complement(359484..362135)
                     /locus_tag="HG535_0F01810"
                     /inference="similar to AA sequence:RefSeq:NP_011570.1"
                     /note="similar to Saccharomyces cerevisiae RSC1 (YGR056W)
                     and RSC2 (YLR357W); ancestral locus Anc_4.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145396.1"
                     /db_xref="GeneID:59237429"
                     /translation="MSNEDVGSIGEEARKELQSALREEYDALFRLKEDNGLEIYPIFN
                     VLPAKKEYPDYYALIKNPVSFNTLKKRVLHYMDAQSFVNDLVQIPWNAKTYNTKESAI
                     YKYATILEKYINDEVVTRLKKKFPSVEYPYLGPLPDEVDTKRPITQLKTNLYNSKGGH
                     SLRVRKEHQENRSDSVDVEYAEGEEDDDGEGEHEGEGEEEDDDEYIEGRKLPNLRINL
                     HRGMTNSQSGGRSNSSTPKPSYGRHQQQRTHMRRGRPPVIDLPYVQRMKNILKMLKKE
                     IDDENEPLTATFEKLPDELRDPKYYSMVSNPICLEDIRKKIKTRKYKDFQSFQNDFNL
                     MLANYRLYHRTEPQYIKRAATLEKKYNAMARHELSKPDRDYMPEGELRYPIDELVLNG
                     KSYRIGDWVLLENPNDSTKPTVAQIFRLWSTSDGKRWLNACWYLRPEQTVHRVDRLFY
                     KNEVVKSGQYRDHLVEEIVGKCYVVHFTRFQRGDPDIKLEGPLFVCEFRYNENEKIFN
                     KIRTWKACLPEEIRDQDEATIPVNGRKFLKYPSPLRHLLPSNATPKDPIPQPTEGAVN
                     APPLIGGVYLRPKLERDDLGEYATSDDCPRYIIRPGDPAEDGKMDFETSTIITSAPAA
                     ASLSKTNLSNPRLAAMKQNRSGTGLNSLRNGGYVPGIAGSSANLATATGLSGSGSGIG
                     TPNGLAPGQQLTVHGLKQHQLNKQQLHLQQQQQQKRSQASGYSLTTIVNNLAAQASKT
                     SLGISVDAPGAYLLPISITKNVDGLLRADYASQVRRLGKDQVPRRKRNKGEVIWFRGP
                     SVAIEERLLNSGDEFLQPPLNRWFSKNKKQKTVAAADEQQDIESAMGSEDEQDNLPDT
                     FPLALRPSAKFMAFKIASRDNMQTESL"
     gene            <363032..>365425
                     /locus_tag="HG535_0F01820"
                     /db_xref="GeneID:59237430"
     mRNA            <363032..>365425
                     /locus_tag="HG535_0F01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289502.1"
                     /db_xref="GeneID:59237430"
     CDS             363032..365425
                     /locus_tag="HG535_0F01820"
                     /inference="similar to AA sequence:RefSeq:NP_014072.2"
                     /note="similar to Saccharomyces cerevisiae EGT2 (YNL327W);
                     ancestral locus Anc_3.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145397.1"
                     /db_xref="GeneID:59237430"
                     /translation="MKYITSVVTSIATSITLFGSIVSAASGSNGAFFTSLEVFNTLSG
                     DFNCTDPNQWFVINAGLYIPEGSNEPIYLSVPDSLGNLPNGSFPLKAKNDVIGAIENI
                     GSNNFTLTFNDHIQQNTTTSFSVLTKLTAETQEKISKPQVLNLEFDVSSGDSFTSAIN
                     FIPKDVNQLSTNGGIYAENNTAWFIADLPLSALDQPSRFSSRPTIKSSYKFNTSLTAC
                     EMILKVDDLNRPLKTVPFTALHDQSDSSQISIYINTNIDGGKYLRIKYFSEPLTSSAI
                     GNMISLQATDSENTRLAKRDNAPQTITANYYSGNDTGTNDSNGSDLQSIQQSPMRAMY
                     INATSSSGADSYETYSLLSRTGSAIVTQIGTWIPISTIRTDSSLSIITTPPTASQTTS
                     IISTQNARLGSSSAVNSSATSDVETASPSSATLSTVAQASALSTSRSSFSNSGSLYIS
                     AANSSKSTNSQTTTTARSSVSSSSAISNSTQSLKTLRSTRSDETSSRTTFAPYSADYN
                     KSDSYLTYSVISFTNDGELTSFTSWFAIATESASSSFFTSSSLSTTPSVISTGSKNTA
                     TAPVNTSLSTMYDSTQEYSLITKTQDGKTIVSTSWFPVSTIKSSSSFVKQTIVSTISK
                     GAQSSADSTYETYSLVTRTVSGAEVISSDWFPVNTVENSTSFAVPVTSSTVSLAVTTS
                     QANSDYETYSLVTKTKSGEKTELTNWAPISAVQPSTKTVSQDSCMSCIVTTDSSVPLM
                     STGTTLSIMAQTATSQLDMFTLSQNSSVPALSIYEGEAKRTSFGFGGILVGLLLLLF"
     gene            complement(<365607..>366590)
                     /locus_tag="HG535_0F01830"
                     /db_xref="GeneID:59237431"
     mRNA            complement(<365607..>366590)
                     /locus_tag="HG535_0F01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289503.1"
                     /db_xref="GeneID:59237431"
     CDS             complement(365607..366590)
                     /locus_tag="HG535_0F01830"
                     /inference="similar to AA sequence:RefSeq:NP_014073.1"
                     /note="similar to Saccharomyces cerevisiae PFA3 (YNL326C);
                     ancestral locus Anc_3.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145398.1"
                     /db_xref="GeneID:59237431"
                     /translation="MGGSNFHITVIFPRCLVSFLYCWTAYVTLSRAKQIPQLFARVLI
                     FGYLLLGLYTYFKLIWTSPGSPLDFPELRVNDIYAAEMGGELPPEFLAKRSITSKNNG
                     RFRLCRTCSVWKPDRCHHCSSCNRCILKMDHHCPWIPGCIGFGNQKYFIQFLIYSTLY
                     ATAILVISSAQFYMWFHDGVFERELIDMLLLSVWLLAFAISIAMMCFSVFSILQVNRN
                     QTTIEMYGYQRYREELAVLGNAHLDQDDTNAFDLGSRLENWTSVMGSKWVEWLLPIQR
                     LEIARNRHSWNEKGLFFELGPGINDGILETLDLQNRLLRRVTPRSSIDNNK"
     gene            <366836..>367558
                     /locus_tag="HG535_0F01840"
                     /db_xref="GeneID:59237432"
     mRNA            <366836..>367558
                     /locus_tag="HG535_0F01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289504.1"
                     /db_xref="GeneID:59237432"
     CDS             366836..367558
                     /locus_tag="HG535_0F01840"
                     /inference="similar to AA sequence:RefSeq:NP_014499.2"
                     /note="similar to Saccharomyces cerevisiae RRP40
                     (YOL142W); ancestral locus Anc_3.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145399.1"
                     /db_xref="GeneID:59237432"
                     /translation="MSTIILPGDDIHVFEDRQISLGPGMYCNPATEEIEAVNAGVEVI
                     SETKKGQAVYVDYDCKRYVPSVGDLVIGIIVGQYSDNYKVSLSNFSSSVSLSYMAFPN
                     ATKKNKPTLKVGDLVYARVRFAEKELESEIECVDSTTGQDGGFGLLDGGMLAEIKLAY
                     ARSLMFDEKFPLLPLLAKFVQFEVAIGINGIIWIKCEEVKHTLACYRSILECQKVPTS
                     SYKAIVKENFGKIVNTVEDDNQ"
     gene            complement(<367599..>370217)
                     /locus_tag="HG535_0F01850"
                     /db_xref="GeneID:59237433"
     mRNA            complement(<367599..>370217)
                     /locus_tag="HG535_0F01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289505.1"
                     /db_xref="GeneID:59237433"
     CDS             complement(367599..370217)
                     /locus_tag="HG535_0F01850"
                     /inference="similar to AA sequence:RefSeq:NP_014074.1"
                     /note="similar to Saccharomyces cerevisiae FIG4 (YNL325C);
                     ancestral locus Anc_3.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145400.1"
                     /db_xref="GeneID:59237433"
                     /translation="MENNQGAGSSEYFSGQPPTAVTHKQRRTTKFVLGKFTIYGTKER
                     IYIVGSNRRETMFRILEIDLSIPQDELSVLEDNVFFTRNEIMNILSGLEEASEEGLQK
                     KLTCYGLMGFIRFTGCYYLVTVTKCSQVAVIAGHFIYHIDGTELVPICNNYKRPDKYS
                     TEANLISTFQNLDLTKTFYFSTTYDITNTLQTHLLREKLKAVDRSDISIPNGIPDINE
                     MFIWNSYLLKPILSCIDTVYDWFQPVIHGFIDQVNVSVLGKSIYITLIARRSHQFAGA
                     RFLKRGVNKQGYVANEVETEQIVADMVLTSFHQPGNGYYDSDRYTSFVQHRGSIPLYW
                     TQEASNLTAKPPIQINSVDPYFSSAALHFDMLFQRYGNIQVLNLIKTKEKNPRETKLL
                     REFEECIAYLNQFLPDVKKIDYKSWDMSRASKQDGQGVIEFLEVYAAGTVARSGVFHN
                     GRTFKETLIQEGICRSNCIDCLDRTNAAQFVIGKRALGVQLKTLGIIGDSYLEYDSDI
                     VNILTELFHDLGDTIALQYGGSHLVNTMETYRKINQWRSHSRDMIESIKRFYSNSFID
                     AQRQDAINLFLGHYVWKKGYPALWEMNTDAYLHNEYSSEGEKRSYTHWWNNYHIIGVS
                     EYIKRNILDQGNDLTFEKVFRNVRGYPGAFDNYWNEYYIPRNVTWMHDLFAYNMNSTR
                     RYHTMRTNRKELSPFASRKQSWINSKLRTITLDQKTTDSKRQRMGNRNQEKLDSKDEL
                     QLSNNNLDMALQIKSKYIINSNSSLYEKFPALLDTWEIHFSEPSDANSFEDRSHSEND
                     IITDSESTEKSHGDYYNDILVDTHYYDVLFKVDDYEPYEEYRKHFLCSETSLSPEDLK
                     LYQKFAFNTQKDLVFA"
     gene            <370536..>372578
                     /locus_tag="HG535_0F01860"
                     /db_xref="GeneID:59237434"
     mRNA            <370536..>372578
                     /locus_tag="HG535_0F01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289506.1"
                     /db_xref="GeneID:59237434"
     CDS             370536..372578
                     /locus_tag="HG535_0F01860"
                     /inference="similar to AA sequence:RefSeq:NP_014500.2"
                     /note="similar to Saccharomyces cerevisiae PPM2 (YOL141W);
                     ancestral locus Anc_3.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145401.1"
                     /db_xref="GeneID:59237434"
                     /translation="MAASSIATPLTDKQKRQLEKLQRRKKYSDLAIQGTNNSSIASKR
                     SVEVLYCKQLEENKSIDNGDGSKEYFKYFVPKAPKRSPCINRGYWLRLHAIRSRLEQI
                     ADYTNKDIVVINLGCGFDPLPFQLLDEENAENRHYAKRFSFLDVDYADLIKRKTEIIK
                     STPELVKIIGGCFDESKSNTDGFSSAKYEVLACNLNQPESFRKLLENKRLSNRDLVKV
                     FIAEVSLAYMKPDHADAIISLCATLPSSHFLILEQLIPQGPYEPFSKQMLKHFIKNDS
                     PLQSVLAYQTMSSQVQRFTRLGFKFVNEGDMYQLWQSVDSDSRLRIQNIEPFDELEEF
                     QLFSHHYIILHGANFECDFSHKFVDRPKVESLSSLNAHFTKLKYSINRKFGSAVYDAG
                     EGNIIYFGGCDPCRVNDIQRVDPQTGEKIEINCMNSPSARMCHTVVAYPHGGKLFLLG
                     GRKGPIQGFSDTWLFDYESKQWEQGPDLPETRFRHCAKFISEDQILLFGGNTRGAQFL
                     IFEPASRRFKNCKFEGAKMLESPLISASMDYNIECNKGVIIGGSHDGTHVSNTLFVFS
                     CRGKEISILKEFSHPLLQRYGSKVTFLNDREILIAGGTSSDRLFGRHNAIILVNIETE
                     DIKEVPIAPEIWEHYPLFLVGFELLLLPNNEILIIGGGATCYGFGSVWNQGFQIKL"
     gene            <373678..>374916
                     /locus_tag="HG535_0F01870"
                     /db_xref="GeneID:59237435"
     mRNA            <373678..>374916
                     /locus_tag="HG535_0F01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289507.1"
                     /db_xref="GeneID:59237435"
     CDS             373678..374916
                     /locus_tag="HG535_0F01870"
                     /inference="similar to AA sequence:RefSeq:NP_014076.1"
                     /note="similar to Saccharomyces cerevisiae LEM3 (YNL323W);
                     ancestral locus Anc_3.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145402.1"
                     /db_xref="GeneID:59237435"
                     /translation="MVGFNLNQVGTFWKKDHEQKESPREEEQDELDASEFEDEEEQPK
                     HIKTRRPKDTNFTQQRIAAWNPILTPKSVVPLYLIVAVVCVIVGGCLLSISSKVSEIT
                     IYYQNCTQEAPTGNTWSDMPSDRYTLIFTGNTTSHVAPQWRYVSDPTDTSEESGTCQI
                     RFTTPQEITSDFYVNYMLENFAANHRRYVLSFSEDQIRGRRASYADIHENAGINCKVL
                     GRDSDDNMIYPCGLIANSMFNDSFPFQLTNVQDPSNNYSLTNKGINWHTDRERFGRTH
                     YNHTEVVPPPYWRSVYPNGYNETNMPDVNNWEEFQNWMRPAAFDKFAKLIRRNENDSL
                     PAGQYQLDIGLHWPVAHFDGKKAVYMTHGSSIGSRNYSLGVVYLIGGCICAAFAIVLL
                     GFWLLSGRKIADPKYLSWNQ"
     gene            <375255..>376526
                     /locus_tag="HG535_0F01880"
                     /db_xref="GeneID:59237436"
     mRNA            <375255..>376526
                     /locus_tag="HG535_0F01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289508.1"
                     /db_xref="GeneID:59237436"
     CDS             375255..376526
                     /locus_tag="HG535_0F01880"
                     /inference="similar to AA sequence:RefSeq:NP_014501.1"
                     /note="similar to Saccharomyces cerevisiae ARG8 (YOL140W);
                     ancestral locus Anc_3.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145403.1"
                     /db_xref="GeneID:59237436"
                     /translation="MFKRYLSSTLIKRISSSLDEKAYQVTTYARPDDLCITRGSNAKL
                     YDDINGKEFIDFTAGIAVTALGHANPKVAEILFEQGSKLIHSSNLYYNAECLDLSRKL
                     IEKTRKFGGQYDASKVFLCNSGAEANEAALKFAKKHGVSINGKKQGLISFENSFHGRT
                     MGSLSVTSNPKYRTPFGSLVPNVTFLNVNDELTKLTDFISSKKDETAGLIVEPIQGEG
                     GIFPIPTETLIQLRKVCKDNDVVVIYDEIQCGLGRSGKLWAHSYLPKEAHPDIFTTAK
                     ALGNGFPIAATIVNEKINNALKVGDHGTTYGGNPLGCAVSKYVVDVIADEKFLEQVEE
                     KGQLFQERLLKLKERFPKQIVDIRGKGLIIGAEFSEAPTRVIAKARELGLLVITAGKS
                     TARFVPALTIENETIEKGLDIFEKAVESVYA"
     gene            complement(<376620..>377483)
                     /locus_tag="HG535_0F01890"
                     /db_xref="GeneID:59237437"
     mRNA            complement(<376620..>377483)
                     /locus_tag="HG535_0F01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289509.1"
                     /db_xref="GeneID:59237437"
     CDS             complement(376620..377483)
                     /locus_tag="HG535_0F01890"
                     /inference="similar to AA sequence:RefSeq:NP_014077.1"
                     /note="similar to Saccharomyces cerevisiae KRE1 (YNL322C);
                     ancestral locus Anc_3.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145404.1"
                     /db_xref="GeneID:59237437"
                     /translation="MLKGYCFAVLLLLRVVAGVVTTSTVTLTNGVGVVITQLTVFDPA
                     TQTGTTRTGTATGTLTGTATTGTGTATTGTGTATTGTGTATTGTGTTTTGTGTTTTGT
                     GTGTGTGTTTTGTTTPGVAATTTSSSASSVLSSGSGASTSSSSRTSSGVATPRQDGTR
                     PDPSTDFTAPPDEAVTTLSIDSFVTITEGTTRTYTSSRGRTSDMWVTVVRGGHTVVVQ
                     TTFAQRFTSQYAVEARPSSGSIGLGTISGTIGQVRSDMRETVRYGNAPRIFSIGLLPL
                     ASTFAFLIYLF"
     gene            <377776..>380745
                     /locus_tag="HG535_0F01900"
                     /db_xref="GeneID:59237438"
     mRNA            <377776..>380745
                     /locus_tag="HG535_0F01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289510.1"
                     /db_xref="GeneID:59237438"
     CDS             377776..380745
                     /locus_tag="HG535_0F01900"
                     /inference="similar to AA sequence:RefSeq:NP_014078.1"
                     /note="similar to Saccharomyces cerevisiae VNX1 (YNL321W);
                     ancestral locus Anc_3.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145405.1"
                     /db_xref="GeneID:59237438"
                     /translation="MPKDGPLYALHSNGTVASGAGGGNSGTGSNHVGNNNNNNVGTDH
                     VYRVFSVDDDPDEIEHDIRYLEGLHDGLKCALHGAKTKNHQNAGISNSTPTLSAAGPS
                     GTENGTGISDEERGGASGGASELALKPQNSSKQDVAVKSPSKTAGQSEVDPYTFAILD
                     RERNHNRDNSNNNSESHGNDGEDYEHPDDYLRRGQNIDAEDGRGFDRHSNASSLESFT
                     LRERQDAINETHPFGIRIWKPALYKKQRSVQKVAAEDIHETTLKKITWQVQLTNIIWC
                     ITMGLALFSFCYCVGAVVCTFGFFTKSSRQYASFLFKLAKYLFWPFGKIVYLTQEKQY
                     LEEDRDEGISAQQFYNWATSYSNRLFFHRSQAEDSNSLINKSNSKNNTVLQHPSYGSI
                     REHLSATNQTSSRHGTSTPILRDTENNEEYLDSTDENNAGSAHRRYFGRGKWTWGRIV
                     FYSCFHLVLQPFVLILTLITWLFVFTIPMSNILWNLLYHIRRHPLAMGFKSIKNTTNQ
                     ETPIMKIKKTNVLLCTFRCAGWHYYKFTVDGTNIIVVNLLFLVFFTIVDFYFLKQYLG
                     LKSWINHDTTVFALCLASIIPLAFYIGQAVASISAQTSMGLGAVINAFFSTVVEIFLY
                     CVALKQGKGLLVEGSMIGSILGAVLLLPGLSMCGGALNRKTQRYNPASAGVSSAMLIF
                     SMIVMFVPTILYQIYGGYEINCNENIMPLSLSNVAMAMSKKTCYFSRPPLKFTKMYVQ
                     VLEPISVSCAIVLFLAYIVGLWFTLRTHAVVIWQLPISDQAKDVSSSRVLEQNADSQQ
                     ESAEENGGHESPNWSRGKSTFVLLFATISYAIIAEILVSCVDTVLEDIPSLNPKFLGL
                     TIFALVPNTTEFLNAISFAIHGNVALSMEIGSAYALQVCLLQIPALVVYSILYTWNVD
                     HSTITIRDSMFALVFPNWDLIACMASVFMFTYLYAEGKSNYFKGSMLILLYIITVLGF
                     YFQGVIDGWNISHDMGI"
     gene            complement(<380888..>381520)
                     /locus_tag="HG535_0F01910"
                     /db_xref="GeneID:59237439"
     mRNA            complement(<380888..>381520)
                     /locus_tag="HG535_0F01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289511.1"
                     /db_xref="GeneID:59237439"
     CDS             complement(380888..381520)
                     /locus_tag="HG535_0F01910"
                     /inference="similar to AA sequence:RefSeq:NP_014502.1"
                     /note="similar to Saccharomyces cerevisiae CDC33
                     (YOL139C); ancestral locus Anc_3.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145406.1"
                     /db_xref="GeneID:59237439"
                     /translation="MSVEEVTQKFEETVSVDDEGPKTVLSGTNFDVKHPLNTKWTLWY
                     TKPAVDPSESWSDLLRPVTSFQSVEEFWAIMQNIPEPHDLPMKSDYHAFRNDIRPEWE
                     DEANAKGGKWSYQVRFKKNDIDELWLRTLLAVIGETIDEEDAQINGVVLNVRKSGYKF
                     ALWTKSEDKEPLVNIGARFKQVLKLTDADHIEFFPHSAANEKHHSPSITL"
     gene            <381888..>382742
                     /locus_tag="HG535_0F01920"
                     /db_xref="GeneID:59237440"
     mRNA            <381888..>382742
                     /locus_tag="HG535_0F01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289512.1"
                     /db_xref="GeneID:59237440"
     CDS             381888..382742
                     /locus_tag="HG535_0F01920"
                     /inference="similar to AA sequence:RefSeq:NP_014079.1"
                     /note="similar to Saccharomyces cerevisiae YNL320W;
                     ancestral locus Anc_3.21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145407.1"
                     /db_xref="GeneID:59237440"
                     /translation="MLIKIAKMIIEGCVAVSTISFAALYLFQNKLVYPSWAQGARDFV
                     DTPESYNLPYRRVVLTTEDNVKIEAYDMQKENSTATVIILCPNAGNIGYFVPIADIFY
                     RQLGTSVFLYSYRGYGHSEGSPSEQGLKMDADCVMSHLSSDPFHKTQKLVLYGRSLGG
                     ANAIYIASKYQHLVDAVVLENTFLSIRKVIPYVFPWLKYFALMCHEVWNSEIAITKCD
                     PTVPFLFLRGLKDEIVPPVHMKQLYNLCPSTQKRVFEFPLGFHNDTIIQPGYWDIIQD
                     FLKTCGCL"
     gene            complement(<382779..>386621)
                     /locus_tag="HG535_0F01930"
                     /db_xref="GeneID:59237441"
     mRNA            complement(<382779..>386621)
                     /locus_tag="HG535_0F01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289513.1"
                     /db_xref="GeneID:59237441"
     CDS             complement(382779..386621)
                     /locus_tag="HG535_0F01930"
                     /inference="similar to AA sequence:RefSeq:NP_014503.2"
                     /note="similar to Saccharomyces cerevisiae YOL138C;
                     ancestral locus Anc_3.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145408.1"
                     /db_xref="GeneID:59237441"
                     /translation="MSSNSLSRSQASSSFGRSDFKPISAGRSSFRIHHYSNGNQVPSM
                     GSSPKARTSPWSSFGNNGFLNEGSWRESHYGEVDTSTEAPAPRRQQRPSVPKSSGLIY
                     HTKAKKELASIDKINDPSVHGLVCAGKAHLGYYRFSEENHSITCTHDFMTTESSGQQG
                     SFSPIIKKRGRQTKLSTIADVKTGYYSHKNYAAICHNSTVVSVYDLNKTSSLENPLVT
                     TLSEHVRSVNCFEFNSVQTNLLISGGQDACVKVWDLRSSGMNKGSRSDVKISTASDSI
                     RDVKWMPIQNYAHVGSPQDVKNGNNAGFKFASIHNSGMLLLFDLRQPNQVERRINAHT
                     GLGLCLNWHPSCEYIATGGRDGKCCLWYVGDKPQHDTNPHFLQMSSMYTPHALNTTGS
                     NSLAVLPEVTINTGLPVTKLKFCPGSNTNALNASLALSSMNEEAAVTVYSLARKYIPK
                     HVLTTAAPSLGLVWWDDKLIFSVDKDDHITGWNVQQEPTVLDNLSRCTTKWRDIGGNG
                     LLFTDQQKGGYDVEQTPAVLLEDKKNLSHKASISSVTNIKNTSRFMESMKKGMSHTNL
                     PSFSADRSSLLKPGHSFSGKSLGPGSLGLSHHNSSVSSSPFNFASDAPELRNIESPAV
                     VTLDLPLILNSMRLSRIPAQKSKSLYPEASAIVESPVKVFKFLARELEFSYNHAKRQG
                     EAKTYNQEASSNDEEIKEDLMERYGLSENTTWAALVNKKNESDASRNRHISKGTDSKG
                     IDSNAESISKKEDAQNYEKTSELRKKKSALTESINDLTSVVQQKIDLLMELIPICTHN
                     ASVYSYIDDLPNFKIWLLVRDSLLWDLKKMSTENPAIPIDDCNTLPIQMQEVSRNASI
                     TADDNDLSESACESGATSGINSYVEDLPQALRENYNESFKKKKSSEMVSDLKRQFMAE
                     KVANTENQRHLHHVQDKNSKSWKEIEDATERGDVSNVYDGSDIEDDNDTEPISLGEGD
                     GIPILGKRPHRLSFIDTFMTDVRSPGVPENESYMKSRHALSLSHSSPVSKMSSLHSLN
                     PHSTSTALPKKTAGLMALTGSPDLKKPQLSKSKLSEFGQLLARHRSSDLLQDDFNSKK
                     FKTKSVIPPWNTKKLMKQLYEQAAETGDVLLAVNILLLFQNVYHITTTDIVKSSLAQF
                     TKILHQYELFEISAAILKYSPWDDIMHTEGGQSSIQLFCDKCGTLIMNESSKEKYTLE
                     CQKVGNDDPMKRFGYWYCDACKKPNTLCVVCEKPLKNLCMVILDCGHQGHLECLQEWF
                     LQEGMTECPAGCMNNIGI"
     gene            complement(<386962..>388524)
                     /locus_tag="HG535_0F01940"
                     /db_xref="GeneID:59237442"
     mRNA            complement(<386962..>388524)
                     /locus_tag="HG535_0F01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289514.1"
                     /db_xref="GeneID:59237442"
     CDS             complement(386962..388524)
                     /locus_tag="HG535_0F01940"
                     /inference="similar to AA sequence:RefSeq:NP_014081.1"
                     /note="similar to Saccharomyces cerevisiae HXT14
                     (YNL318C); ancestral locus Anc_3.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145409.1"
                     /db_xref="GeneID:59237442"
                     /translation="MSSIYNKKNPEEDAKEGLSKELSGDTVDLPKDLSPHSDMLTLEK
                     SPCLLKPIFLCVCISFGGFMFGWDVGTIGGITNMQSFQAYFGTITDPVTGLKRFPDLI
                     IGLLISIFNIGCAIGGLTLAKLGDFKGRKLGIIAAIAVYWVGLQLQVINHQKWLQFFF
                     GRVVTGLAVGSTAVLIPMFISESAPTKIRGSMVVLYQLMVTLGILAGNIINYICLKSF
                     SSQPNDNRQWQVPLLLGFAWSVIILVGLSFTPESAQYLMLKRNDVQKAKRSFSLMNGI
                     DEEDEKTYEFIEESMREKQDMLKMGKQQGIFEFITGKPKLGLRLLIGVLVMTFQQLSG
                     INYFFYYGTTIFERAHLDPYLTPIVLSGVNFGATFVGIYLVEALGRKSCLLLGSVGMF
                     CCMMIYASVGSFALESVSSAGIMTATTCVYIFFFATTLGPVTFVLVSELFPMKTRATS
                     MAICSSFNWLFNFAISLLTPTITSKIGFLYGYFFAGCLFLSALCVWILVPETRNKTEA
                     DINRIYECTNSE"
     gene            <389564..>390922
                     /locus_tag="HG535_0F01950"
                     /db_xref="GeneID:59237443"
     mRNA            <389564..>390922
                     /locus_tag="HG535_0F01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289515.1"
                     /db_xref="GeneID:59237443"
     CDS             389564..390922
                     /locus_tag="HG535_0F01950"
                     /inference="similar to AA sequence:RefSeq:NP_014082.1"
                     /note="similar to Saccharomyces cerevisiae PFS2 (YNL317W);
                     ancestral locus Anc_3.25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145410.1"
                     /db_xref="GeneID:59237443"
                     /translation="MDDLGSQDHSQKRYLAQRRTVDVSSPYEKLYYYRKHGLPLPTIQ
                     PETTFTSDLMPPAAYHHNGRVINIPNKFTHLSSNKVKHVIPALKWTPEGRRLVVATYS
                     GEFSLWNGSSFNFESIMQAHDSAVTTMEYSHAGDWLISGDSDGTIKIWQPNFNMVKEL
                     DQAHTECIRDIAFSSNDSKFVTCSDDNILKIWNFSNGQEERVLSGHHWEVKSCDWHPE
                     MGLIASASKDNLVKLWDPRSGQCISTLLNFKHTVLKTKFQPTRGNLLVAISKDKSCRV
                     FDIRHSLRELMVARDDVDYMTLLWHPIDESMFTVASYDGSLKNFDLSQNTTGPTHTIP
                     YAHDKCITSLSYNPVGHILASASKDRTIRFWTRARPFDPNAFDDPTYNNKKVNAWYLG
                     INNGINAIREKTENGAAPPLNTDTTSSSTSNWSMASSNGISALPGLETTSKTSSLPGL
                     SV"
     gene            complement(<391130..>392362)
                     /locus_tag="HG535_0F01960"
                     /db_xref="GeneID:59237444"
     mRNA            complement(<391130..>392362)
                     /locus_tag="HG535_0F01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289516.1"
                     /db_xref="GeneID:59237444"
     CDS             complement(391130..392362)
                     /locus_tag="HG535_0F01960"
                     /inference="similar to AA sequence:RefSeq:NP_014505.1"
                     /note="similar to Saccharomyces cerevisiae PFK27
                     (YOL136C); ancestral locus Anc_3.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145411.1"
                     /db_xref="GeneID:59237444"
                     /translation="MSGTSLNGSLKSNSTSENSLFSLNKKVYSNLLLQKSSYYYANDE
                     IDENNESDVPLPHGLSLNNLSTEHLPTLSRVNSHSPSPLTFKSTRDYSRLMNESTVKD
                     SKFVFVLVGLPAVGKSAVSSQLIQFLRNNPATHSLRCTSFNAGKVRRKMSYRNLGMRS
                     MQLANNSSDDLFSPKNTEKKEKYARITLDKLIKELDSDICDVAIFDATNSQVQRRKFV
                     FSEISSYNQDIHSNFSIIPIVLQITCDDQSFVKFNIHNKTFNEDYFDKPYHYAIADFA
                     RRLKNYCSQFTPFSKNEFALLVDSFDTKGLNSGLFAYNIINSGLVSTTSINSRHLPAN
                     CSDKVMEMIMLAEYFVEHYASLFGSSYIERVKDFFSEQKQNHLKLGSLDYFSSLSAVL
                     DENYFIELQEILEKNLGK"
     gene            complement(<392839..>393486)
                     /locus_tag="HG535_0F01970"
                     /db_xref="GeneID:59237445"
     mRNA            complement(<392839..>393486)
                     /locus_tag="HG535_0F01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289517.1"
                     /db_xref="GeneID:59237445"
     CDS             complement(392839..393486)
                     /locus_tag="HG535_0F01970"
                     /inference="similar to AA sequence:RefSeq:NP_014506.1"
                     /note="similar to Saccharomyces cerevisiae MED7 (YOL135C);
                     ancestral locus Anc_3.27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145412.1"
                     /db_xref="GeneID:59237445"
                     /translation="MSNGETNEISSLYPAAPPYITFFTDENISQLAEYQKSVKKNGNG
                     NGNGNGVDEITCALDYLIPPSMPSGLQYRAFGSVWHVKDHLPDLETMGLTQLYKKPED
                     ATAAGSTSYQYKTQELKKLLKSLLLNYLELVGVLSINPELFQPKVEHIRTILVNTHHL
                     LNEYRPHQSRESLIMLLEEQVEYKKKEIQTINQICAEVRDTLVKIQDSAVETTAD"
     gene            <393746..>394123
                     /locus_tag="HG535_0F01980"
                     /db_xref="GeneID:59237446"
     mRNA            <393746..>394123
                     /locus_tag="HG535_0F01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289518.1"
                     /db_xref="GeneID:59237446"
     CDS             393746..394123
                     /locus_tag="HG535_0F01980"
                     /inference="similar to AA sequence:RefSeq:NP_014508.1"
                     /note="similar to Saccharomyces cerevisiae HRT1 (YOL133W);
                     ancestral locus Anc_3.28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145413.1"
                     /db_xref="GeneID:59237446"
                     /translation="MSEMDKMDVDLEDAGSEAVPGEVNTEAAEQTPKKKPKKFEIKKW
                     TAVAFWSWDIAVDNCAICRNHIMEPCITCQPLAMTDTDTECVAAWGVCNHAFHLHCIN
                     KWLKTRDVCPLDNQPWKLARVGR"
     gene            complement(<394227..>395207)
                     /locus_tag="HG535_0F01990"
                     /db_xref="GeneID:59237447"
     mRNA            complement(<394227..>395207)
                     /locus_tag="HG535_0F01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289519.1"
                     /db_xref="GeneID:59237447"
     CDS             complement(394227..395207)
                     /locus_tag="HG535_0F01990"
                     /inference="similar to AA sequence:RefSeq:NP_014083.2"
                     /note="similar to Saccharomyces cerevisiae PHA2 (YNL316C);
                     ancestral locus Anc_3.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145414.1"
                     /db_xref="GeneID:59237447"
                     /translation="MTESRRKNVIYLGPQGTYTHQAALQQFDDHDQFDLIPAKSIPEC
                     LDELENNPCIHYAVIPLENSTNGQVVFSYDLLRDRMLKSLNPDTSSNRVIPPLQIIAE
                     QYVSIEHCLISREHLTMSELGKYKIIRVYSHPQVWGQVNQYLKELQQEYPNTTFEKLD
                     TSSTSEAVIKVMDSKTNEHENVLNLAIASEFAAKLNKVNVLQRGINDQLGNTTRFMVF
                     KKRKEQSPAMKCAGSKVNLLTFTTKQDDPGALVDVLTVLKDYSVNMCSINTRPFNTVT
                     LERKWQYVFFLEYYENNENIDWTKFYQQFGSYCLEWCLWGTFYRDPRYYN"
     gene            complement(<395482..>396462)
                     /locus_tag="HG535_0F02000"
                     /db_xref="GeneID:59237448"
     mRNA            complement(<395482..>396462)
                     /locus_tag="HG535_0F02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289520.1"
                     /db_xref="GeneID:59237448"
     CDS             complement(395482..396462)
                     /locus_tag="HG535_0F02000"
                     /inference="similar to AA sequence:RefSeq:NP_014084.1"
                     /note="similar to Saccharomyces cerevisiae ATP11
                     (YNL315C); ancestral locus Anc_3.30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145415.1"
                     /db_xref="GeneID:59237448"
                     /translation="MGSLRQGILSFQLQLISRAVSKEKSALIGKTFKPAIYQQSCYST
                     DFKQKPYKEKLLTKAREKGFETVEELLEKSKEDLLRKKREFCKIDPLKELENYEQRMK
                     MSENNAGLTKSKGPIDPNMSATPFKTFDSFLKLDKVKDLSKQEIEFLWRAKWVNKDNS
                     LCAVVPLDVFNKMVTKVRENPVFVLPLPRVITGGNEAEGANKEQGVELHYVQWQFVGP
                     NTTHCIITSLAEYKLHNEYSKPHTIFQFHSDLAKEKKCIFMNGQVEPDTNVSLQDAQL
                     LLLNVQRFYGAMGEITPAARQRVQLLQDFTGGSSDFSVDKLISLSQSMEN"
     gene            <396844..>397965
                     /locus_tag="HG535_0F02010"
                     /db_xref="GeneID:59237449"
     mRNA            <396844..>397965
                     /locus_tag="HG535_0F02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289521.1"
                     /db_xref="GeneID:59237449"
     CDS             396844..397965
                     /locus_tag="HG535_0F02010"
                     /inference="similar to AA sequence:RefSeq:NP_014085.1"
                     /note="similar to Saccharomyces cerevisiae DAL82
                     (YNL314W); ancestral locus Anc_3.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145416.1"
                     /db_xref="GeneID:59237449"
                     /translation="MDDRALTDHDDLLLRLMDRYKPHLRPYAYRLQTWEQVLEEYNSQ
                     TGSKYRQIRTLKKKFEKLRDAYTAGDDKIEVGNLELLQKLLRESHQQTSARSQSQMTK
                     IHHSTEGEIIAGNLKIAKSRDSHLISQRQDNLKENLLENEKNASPSNDTSRESSGPNQ
                     PPPLDSITIGFPHSHGHPHNDSKASETSSPSQIPIASSSYDRGLGLTDNHLDPINNVA
                     NIEAAKTNTPSTKGSPEDEHVNAQMNTRVLSNLLSQFATQHQYSKSVASSQSSPFPIS
                     NMPINSQASSLTLEVLYAELQNIRVSQEELRNEVLYRLDIISAGLAENLNQIRQQGKS
                     QVVKASVSTDNQFHIDSHNHRHGNRLRNDSDDDRERSLG"
     gene            complement(<398000..>400717)
                     /locus_tag="HG535_0F02020"
                     /db_xref="GeneID:59237450"
     mRNA            complement(<398000..>400717)
                     /locus_tag="HG535_0F02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289522.1"
                     /db_xref="GeneID:59237450"
     CDS             complement(398000..400717)
                     /locus_tag="HG535_0F02020"
                     /inference="similar to AA sequence:RefSeq:NP_014086.1"
                     /note="similar to Saccharomyces cerevisiae YNL313C;
                     ancestral locus Anc_3.32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145417.1"
                     /db_xref="GeneID:59237450"
                     /translation="MSVLLYSHLLLASDTKVLENDGLENCDAKSIEWAKHILSGRPSL
                     VFQEAVLPLKDTLNLKSALDNANIVDVLRNSILEKLCDNSEHLLLLAISLLQTFLQSN
                     YTGPLPPRSSLYILLNGNTEQAEQINRLLIASLSSGGQQAYDLIDDPLSLVLSLLIFE
                     KITNQTVLSENATDSNMAVPDIATLTSSGFSSVAHWWLGRALLVHLSLLPEPSGIIPS
                     VLSVIFSSIDLAHAIANDLPEHSSQDVTLRIYTIFYLENVKCSLAINTEQLCLASLTK
                     VKKLRKFEFVLTGARAKRTKFQRESHSGLIILAKSSDELFRENQSNIENVSPEEFHLE
                     SEILLEKPFFESIADEPLDEQVVKKQRLDVDAGIEEEKLLPLALCQENIPKELMLLDP
                     NAQPKLADYDDIQLLLRFYVIRQSSPAKDPLVEEELKALISRVIYQEGVKNWTIYSRA
                     LWERSILETSKAKTVERGILQMQSLVEELGLRIESRLLPEGNINSHLRLSYIHQIPLL
                     PRWELDAALAEKYMSLGVLRSAIEIYERLRMSCEIALCYAAVGDEKKAEEVLVKRIEE
                     NPNDARALSILGDIRQDPGLWEKSWKIGKYVNAKNSLARYFYNPPASSGLSRNYDATL
                     EHLNDSLRQYPLSFDTWYFYGCVGLECDKMALAAEAFSRCVSLDPTHALSWSNLSAAY
                     VQLGKLKEAFSCLRKAVSSDAQKNWRIWENYMLVALKLNEWNDVLLACKKLVDIRRDK
                     SGDGSIDVQIVEKLVEVLISSDYPTGDNQQLTHYQKSCTEFICVTLPSVITSDARCWR
                     LVAKVELWRKRPWAALDCHEKAYRAISHNPDLEIDENVWSETVDACEDLIAAYESLGE
                     IEGKFGPGSLVCKDWKYKSRATIKALMSKGKNRWDDSVGWERLLEMRNQ"
     gene            <400996..>401879
                     /locus_tag="HG535_0F02030"
                     /db_xref="GeneID:59237451"
     mRNA            join(<400996..401002,401068..>401879)
                     /locus_tag="HG535_0F02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289523.1"
                     /db_xref="GeneID:59237451"
     CDS             join(400996..401002,401068..401879)
                     /locus_tag="HG535_0F02030"
                     /inference="similar to AA sequence:RefSeq:NP_014087.1"
                     /note="similar to Saccharomyces cerevisiae RFA2 (YNL312W);
                     ancestral locus Anc_3.33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145418.1"
                     /db_xref="GeneID:59237451"
                     /translation="MATYQPYKEYSSVGGGGFENTESRPQTGESTASPSRSTRLTPVT
                     IKEVLESRQEVQDGPYVVHSQELHHICFVGVVRNIVDHTANIVVTVEDGTGQIDVRKW
                     SQDAKDLATSQDDNMNKNYNSQLAQQYHIGTYVKVFGALKDFTGKKNIQYAVIKPIES
                     FNDVLAHHLEVIKCFAIATGKFQQVQGTKPIENGAQSLFVQDTGSSDDIAGTVLKFCR
                     EQCQGKDANSFAVPIQLIAQTLNISEATAKDCCTKLTEQGYIYPTLTEDLYFAI"
     gene            <402097..>403551
                     /locus_tag="HG535_0F02040"
                     /db_xref="GeneID:59237452"
     mRNA            <402097..>403551
                     /locus_tag="HG535_0F02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289524.1"
                     /db_xref="GeneID:59237452"
     CDS             402097..403551
                     /locus_tag="HG535_0F02040"
                     /inference="similar to AA sequence:RefSeq:NP_014509.1"
                     /note="similar to Saccharomyces cerevisiae GAS4 (YOL132W);
                     ancestral locus Anc_3.34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145419.1"
                     /db_xref="GeneID:59237452"
                     /translation="MILPSGISSVWAAAAFLTFIPMSYVSALIDPIEVDGKQFVYSST
                     KEPFYIRGVDYQPGDSSDVNYEHDPLTDANVCARDILLFQDLGINTIRIYSVNPDLNH
                     DKCMSMLATAGMYLILDVNSPLPNQHLNRYEPWTSYNPVYLEHVFKVVAQFSHYNNTL
                     GFFAGNEVVNDRRSAQYSPTYIKALVGDMKAYQEEHCERKVPIGYSAADDLNYRVPLA
                     SYLECSEDSTNDMSVDFYGVNSYQWCGKQTMQTSGYDKLVDAYRTYSKPVFLSEFGCN
                     RVLPRTFEEISPLYSGDMYTTFSGGLVYEYSQEDNNYGLIQLDDDGNAQILQDFHSLK
                     KQYEKVEMPSREDVEEAIANDPIMSEIDKNHSPLCQSKYENLNIKTKIEKGLASSLIK
                     HGVSVEKGEYVPLTEEDMETTYAISDVDGTDWKTNRRIKAIRDAEPISFKDPSESKDD
                     ENFEEPKRNSSDLINVSLWCILFAYLLNFMFCSL"
     gene            complement(<403629..>405851)
                     /locus_tag="HG535_0F02050"
                     /db_xref="GeneID:59237453"
     mRNA            complement(<403629..>405851)
                     /locus_tag="HG535_0F02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289525.1"
                     /db_xref="GeneID:59237453"
     CDS             complement(403629..405851)
                     /locus_tag="HG535_0F02050"
                     /inference="similar to AA sequence:RefSeq:NP_014088.1"
                     /note="similar to Saccharomyces cerevisiae YNL311C;
                     ancestral locus Anc_3.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145420.1"
                     /db_xref="GeneID:59237453"
                     /translation="MNRLQLFGTSKYFSLSSKDTTSEIPKKHERKTSSRKHGTRCPDS
                     TEVQDDSLHLLNLPFKILTQILECLDVSTLLSLCRVNSQLYDIISNRFLYQDVVLDNK
                     LSLLKFNALIHSEFHSANALLGRKEESIDSQNIRFLVKAIEFSNPQCQDALLKYGKFH
                     NRKGQASVIGGSYVFNNESRTVSSNSRSSSLTRKQSNSNSNSFLGSTNYIVPQDTSHV
                     PPFECYKQLNKLESQYSHYTYIELMLAIIDHLPNLCHVRLTNVEPNFKIPLWYSVFND
                     GSRDFFKKIINGQQSINSGDLRSFEISTKFIADYEKKFYSLSRIKTLEIRATLDKRNK
                     QQVYLRPNLLCCFGIINELILQDLIIDNDSLDTPLEYVPFHLRLDAPGVYDLHSTVHL
                     LTLKSCKIIPGNGILKLFHDYFKCVRNVKLLNFTSKYDMLLCSCFSSLTDLTIDCNSP
                     CFINQQLVSDNYYYNDDIPNSEVDSDSDCASFTETLFEEPVDICLQAPPPTTAVVISL
                     NLNYLPRIPYGQNKKRQAYITKSQDEYFHQLRIPSFHYFYHYFKKLWDRLPRKNINIS
                     VVNIPFTNVFPLSPQYFCEKTIRSLDDDQQTLIPSYNENNAVPETVSTQNYWDGAVRE
                     CFKNCLLQFHENQPQSDLMESEILGQMDNGFFNNYKNSKCFQDIPNTNLWCFLKSLSE
                     FKSVHIQMLRKWLFCTPRSRYDWELLLKPVLNVNVPIEVRDRDGVMLYSYGTKRMTKR
                     "
     gene            complement(<406142..>406702)
                     /locus_tag="HG535_0F02060"
                     /db_xref="GeneID:59237454"
     mRNA            complement(<406142..>406702)
                     /locus_tag="HG535_0F02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289526.1"
                     /db_xref="GeneID:59237454"
     CDS             complement(406142..406702)
                     /locus_tag="HG535_0F02060"
                     /inference="similar to AA sequence:RefSeq:NP_014089.2"
                     /note="similar to Saccharomyces cerevisiae ZIM17
                     (YNL310C); ancestral locus Anc_3.36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145421.1"
                     /db_xref="GeneID:59237454"
                     /translation="MLLRSSLLLRQPRRLLITEQCKITSSLIKAIIHQRIGCRSFITS
                     NRLLNDEKRKNEGSKMATLKVDKPMMMIAFTCKKCNTRSSHTMSKQAYTGGTVLIKCP
                     SCNARHLIADHLKIFRDDSVTIEDILKAKGESLSSTTDDLVFEDIPENLRNVIGHYAK
                     DAPKDLRKKLDNEVVRELPNPSKDAQ"
     gene            <406896..>408077
                     /locus_tag="HG535_0F02070"
                     /db_xref="GeneID:59237455"
     mRNA            <406896..>408077
                     /locus_tag="HG535_0F02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289527.1"
                     /db_xref="GeneID:59237455"
     CDS             406896..408077
                     /locus_tag="HG535_0F02070"
                     /inference="similar to AA sequence:RefSeq:NP_014090.2"
                     /note="similar to Saccharomyces cerevisiae STB1 (YNL309W)
                     and YOL131W; ancestral locus Anc_3.37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145422.1"
                     /db_xref="GeneID:59237455"
                     /translation="MMAIAGEIQGQENLSDEQEQEIANMILKRAELAQMTRQLKVNLS
                     KVPSPNVSHDSNCKVTRKRKSKTGGDREIEEAISKVSPKKNRVKNDADIKDKGNQDDI
                     HLSPVKAYRRPGTPPPGPPASSSSSLRSDGDLLGKSEDIPTTPKPNKSQNIPPVIVSG
                     VTSVKDKDNKHAHLDHGMKQVMRTPRRLSNHTRTGSENDVAVDLLMYLATSPYTSSSS
                     LRGSRHGAHEMSHIPTTPMAYGNGNAGSDDEDEAIRFSHLKPSISSPQSTFKVPMHVV
                     HNSIPSSASHSELLMESPSLYMVAASPSPQKRIYVNLSSHESHSNSASSGLLPHVPST
                     PSRELRTSASHLLRTPNFNMGDYVHNLFSPSPRGNTITSAGNASSTSQNNPAESTGTN
                     K"
     gene            <408608..>411139
                     /locus_tag="HG535_0F02080"
                     /db_xref="GeneID:59237456"
     mRNA            <408608..>411139
                     /locus_tag="HG535_0F02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289528.1"
                     /db_xref="GeneID:59237456"
     CDS             408608..411139
                     /locus_tag="HG535_0F02080"
                     /inference="similar to AA sequence:RefSeq:NP_014511.1"
                     /note="similar to Saccharomyces cerevisiae ALR1 (YOL130W);
                     ancestral locus Anc_3.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145423.1"
                     /db_xref="GeneID:59237456"
                     /translation="MSDGYSSHSRSSSDLSPTASLGSSMMSMNTEDHNELYDHRQHQD
                     SLSVPNNGANAAINNNSTENVQNVPGASVAAPLASDAPATSPLSLLGVSRGRGVRTTQ
                     SNSSSTVPMASSGARASRLAQTVSNHRTSFDKTEFGSKPKFKNTKKSKALHSRRGSRS
                     YSISENITKLKEDLTSSANASRPPNQSADSANAPNQQRSRANSTASQNTNSNKLNLTR
                     SISHLNTGNNTGKQQQRRASFDSDDSQASRDSMETEEDVCFPIEPQYHIRVNGIHFGE
                     LEDFAETTNEQRSHYIEPANMQGAYESSPAFRNGGTSSSTSTTISSAALKYTPPKQTI
                     EKIGSHTSKNYFNPQPGISFGSNKIEQEDQHDTYEKEHYQNNGQYEQQQSLYTPMEPP
                     FYVPNRFSFFSSESEETVHATDIPSLLKPGQHFSELFRDGEPTWWLDCSCPTDDEMKC
                     ITKAFGIHPLTAEDIRMQETREKVELFKSYYFVCFHTFENDHESEDFLEPINVYIVVF
                     RSGVLTFHFNPISHCASVRRRVRQLRDYVNVSSDWICYALIDDITDSFAPVIQSLEYE
                     ADSIEDSVFMARDLDFARMLQRIGESRRKTMTLMRLLSGKADVIKMFAKRCQDEANGI
                     GPALTSQINIANLQAAGINHSNKDTMLQQTTQPRGDIALYLGDIQDHLLTMYQNLLAY
                     EKIFSRSHTNYLAQLQVESFNSNNKVTEMLGKVTMLGTMLVPLNIIPGLFGMNVRVPG
                     GDGVGSFGWFFGILSVMVLLALSAWFGASFWIKRIDPPTTLNEAAESGAKSVISSFLP
                     KNTRNNEGKKVPAASKFNPLHRQYPGLPPSNHSVASLPSKYSRYD"
     gene            complement(<411340..>413091)
                     /locus_tag="HG535_0F02090"
                     /db_xref="GeneID:59237457"
     mRNA            complement(<411340..>413091)
                     /locus_tag="HG535_0F02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289529.1"
                     /db_xref="GeneID:59237457"
     CDS             complement(411340..413091)
                     /locus_tag="HG535_0F02090"
                     /inference="similar to AA sequence:RefSeq:NP_014091.1"
                     /note="similar to Saccharomyces cerevisiae KRI1 (YNL308C);
                     ancestral locus Anc_3.39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145424.1"
                     /db_xref="GeneID:59237457"
                     /translation="MPRKKSSAKKARETAVKEAKQVHVKIGAQEDKETELPTIETPKE
                     ISDASGDESSSEEEDDYGELITEEVEEGIQKVLKAIRANDKEVLFNPKVRFFHDAERT
                     ANANEKNEKHKPIYLKDYHRMNILAGNTFAEDEEQEESTIDGKQSYVDQQKEEKTKLL
                     DEIKNAFDEGVESDQEDEDFLKKKTPSKKVEKSNLNLPDPAQNQEKFLDEFINNQAWI
                     PRKGDKVVSLDHDSDMQEDDDEFEDAVEQFETAYNFRYEDPNSADIVSYARNQATARR
                     AASKSRRKKREEEREIKNKEMLETERSIQKKKTEKVHKLTDVLEQLKKEYGADIDEAM
                     IKKITNTLLNNEYKEEDWNEVLSGLFNEEFYEQKGKPTWDDDDEVMADFYEDQDIEEA
                     EDVDVEKEEEDDIQDTDKHQDEKSSNKSRKEKKKGKMAEKKEKKNLRALVENAVEDNK
                     LAIIDEVEKSKEERKSRARSKEEQDLKFRYREVSPESFGLTTKEIFAADDAQLNQFIG
                     LKKFAPYRPKEQRMRDKRKVTKAKRLREWRKEVFKNENGMIASDGNTDGSIIIPVDSD
                     SKTEKKVHKARKHKSSS"
     gene            <413407..>413961
                     /locus_tag="HG535_0F02100"
                     /db_xref="GeneID:59237458"
     mRNA            <413407..>413961
                     /locus_tag="HG535_0F02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289530.1"
                     /db_xref="GeneID:59237458"
     CDS             413407..413961
                     /locus_tag="HG535_0F02100"
                     /inference="similar to AA sequence:RefSeq:NP_014512.1"
                     /note="similar to Saccharomyces cerevisiae VPS68
                     (YOL129W); ancestral locus Anc_3.40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145425.1"
                     /db_xref="GeneID:59237458"
                     /translation="MDLEQERGIFRFPFKFPTSAGIRRLCVYFSGILYAVGFWLFLDA
                     VIYSKHANASDVHVTFVDWIPFLCSTFGTMIVNSIEKNRLLQGALSSGSGITSLGGDS
                     LDSSVAWQARVVLFFGFALLAGGLSGSIVVLIIKFLVKNYNTYPTVGMGINNVLGNFC
                     IVLSCIVLWIAQNMEDEYSYSLTL"
     gene            complement(<414785..>415930)
                     /locus_tag="HG535_0F02110"
                     /db_xref="GeneID:59237459"
     mRNA            complement(<414785..>415930)
                     /locus_tag="HG535_0F02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289531.1"
                     /db_xref="GeneID:59237459"
     CDS             complement(414785..415930)
                     /locus_tag="HG535_0F02110"
                     /inference="similar to AA sequence:RefSeq:NP_014092.1"
                     /note="similar to Saccharomyces cerevisiae MCK1 (YNL307C)
                     and YGK3 (YOL128C); ancestral locus Anc_3.41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145426.1"
                     /db_xref="GeneID:59237459"
                     /translation="MSNSLSSAKCEEFIANDVTSNRSNNTRRMLVKEYKKIGHGAFGT
                     VVQAYITPDKQKWYGPFAIKKVPAQTEYKSRELQILRITDHPNVVRLEYFFTHVSPVD
                     NKVYQHLAMECLPETLQLEISRYSSNKLELPLKHVKLYSYQITRGMLYLHAFGICHRD
                     IKPSNILVDPTTGVLKICDFGSAKKLEQNQPSISYICSRFYRAPELIVGCTQYTTQID
                     IWGLGCVIGEMLIGKAVFQGQEPLLQLREIAKLLGPPDKKFIFFSNPAYDGPLFSKPL
                     FSGSPQSRFEKHFGHAGSDGIDLLMKVLVYEPQLRLSPRRILAHAFFGDLKKEEYFFP
                     RGQTQPVQLPNLFQFSQFELQVIGEYLDKIAPPKNKLRNDEETATVD"
     gene            <416496..>417218
                     /locus_tag="HG535_0F02120"
                     /db_xref="GeneID:59237460"
     mRNA            <416496..>417218
                     /locus_tag="HG535_0F02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289532.1"
                     /db_xref="GeneID:59237460"
     CDS             416496..417218
                     /locus_tag="HG535_0F02120"
                     /inference="similar to AA sequence:RefSeq:NP_014093.1"
                     /note="similar to Saccharomyces cerevisiae MRPS18
                     (YNL306W); ancestral locus Anc_3.42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145427.1"
                     /db_xref="GeneID:59237460"
                     /translation="MLGLFRGLCGMGMAQSGRCTRSALNIAGLNGTIRHKSESADGRD
                     AASVLKFSSITDSIGRNNKDISNVISPISGLGSEQNKDDGSKTARKAHEVPVKYVLNC
                     IFGKNNSHFTYSAVVEDVNYLRNNPGLSYNEAFLYYLKLPQRVKFSVSTGYLGFRKAA
                     RGEYEASFQTAAKVFQMIHEKKLLNKEIEIVMKDFGKGRAAFVAALNGKEGNFIRKHI
                     IRISDKTALKFGGVRSPRTRRL"
     gene            <417972..>418719
                     /locus_tag="HG535_0F02130"
                     /db_xref="GeneID:59237461"
     mRNA            join(<417972..417984,418304..>418719)
                     /locus_tag="HG535_0F02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289533.1"
                     /db_xref="GeneID:59237461"
     CDS             join(417972..417984,418304..418719)
                     /locus_tag="HG535_0F02130"
                     /inference="similar to AA sequence:RefSeq:NP_014514.1"
                     /note="similar to Saccharomyces cerevisiae RPL25
                     (YOL127W); ancestral locus Anc_3.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145428.1"
                     /db_xref="GeneID:59237461"
                     /translation="MAPSAKATAAKKAVVKGTNGQKALKVRTSPTFRLPKTLKLARKP
                     KYASKSVPHYVRLDSYKVIEQPITSETAMKKVEDGNTLVFQVSMKSNKHQIRKAVKEL
                     YEVDVLSVNTLVRTNGTKKAFVRLTADYDALDIANRIGYI"
     gene            complement(<418952..>419851)
                     /locus_tag="HG535_0F02140"
                     /db_xref="GeneID:59237462"
     mRNA            complement(<418952..>419851)
                     /locus_tag="HG535_0F02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289534.1"
                     /db_xref="GeneID:59237462"
     CDS             complement(418952..419851)
                     /locus_tag="HG535_0F02140"
                     /inference="similar to AA sequence:RefSeq:NP_014094.1"
                     /note="similar to Saccharomyces cerevisiae YNL305C;
                     ancestral locus Anc_3.44"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145429.1"
                     /db_xref="GeneID:59237462"
                     /translation="MSKVNQPPPYQEYESLNHDHNVQVPVEQRRSNVPEDFKYSVTIS
                     ACEFEIRQKFMAKVYSILSVQLLTTLVFSMLALRSKGLQLFIVNHMGLYILGIIVSLV
                     TCLWIAWAPRRELYEMENEISDPLVAGPSNGTSARSENIPWYCLSKRGQYILLSLFTI
                     SEAYCLGSSIMFVPQDIVMNAIVVTTVVVIGVTLMALSGKFEIALESAMSIYYWLNLA
                     LLVMIGIGISFLFMGGMGSKMNLFYGWIGAIVFTVYLFIDTQLIFRQMFIGEEIKCAL
                     SLYLDIINLFLSILRIMQSSDDN"
     gene            complement(<420196..>421311)
                     /locus_tag="HG535_0F02150"
                     /db_xref="GeneID:59237463"
     mRNA            complement(<420196..>421311)
                     /locus_tag="HG535_0F02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289535.1"
                     /db_xref="GeneID:59237463"
     CDS             complement(420196..421311)
                     /locus_tag="HG535_0F02150"
                     /inference="similar to AA sequence:RefSeq:NP_014515.2"
                     /note="similar to Saccharomyces cerevisiae MDH2 (YOL126C);
                     ancestral locus Anc_3.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145430.1"
                     /db_xref="GeneID:59237463"
                     /translation="MPHSLTASLTKVSILGAAGGIGQSLSLLLKTQLNMYLGDLQNTH
                     IHLALYDVNQNVLEGFAADLSHVDTPISVSYHSSSTPNGIRDCLVNTDLILIPAGVPR
                     KPGMTREDLLSINAGIISQLTESIEAHADLSRVFVLIISNPVNSLVPVMVEKLNRSAA
                     SEGLQIERRVFGITTLDTVRASTFLREVMVKHDPTTISDPLPQVPVIGGHSGETIMPL
                     FSLAQPFWQLSADERKYLVHRVQFGGDEIVKAKKGLGSATLSMAHAAFKETVKFLTLI
                     IGKSRTIQGTFYISLLNREKAPVNESARKLLPLIANQPYFSVPVTIEPANGYTDIYYK
                     IVEVMDKYERNTMLPQCLSKIGSSIEAGVSIGSADKS"
     gene            <422366..>423844
                     /locus_tag="HG535_0F02160"
                     /db_xref="GeneID:59237464"
     mRNA            <422366..>423844
                     /locus_tag="HG535_0F02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289536.1"
                     /db_xref="GeneID:59237464"
     CDS             422366..423844
                     /locus_tag="HG535_0F02160"
                     /inference="similar to AA sequence:RefSeq:NP_014516.1"
                     /note="similar to Saccharomyces cerevisiae TRM13
                     (YOL125W); ancestral locus Anc_3.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145431.1"
                     /db_xref="GeneID:59237464"
                     /translation="MAIRVRAHFVRDGWRRWQPGRQICDEVEKKQRTSQSDDARVGEA
                     TAATMTAEPATAGAAAAAATLHDDRRCTFYMVQKQRRCGMMCKKGCDMCSEHSGFSSQ
                     GTAARRVPCPLDPKHSVCESNLRKHLLKCSKLKLRHANDDKPYYCLDFNAAAHRCHDV
                     GAGSGGDADGGVNDDNADINEIIVKMIPILEDVYSKNFVDELPLDVKRNDFMLNGRFN
                     QLVANKKHAIQQSSLIQHLCTRNLTRNTSFVEFGCGRAELSRYVNQFVTHENTARSSP
                     HSQHFVLIDRASNRMKFDKKFADDFEEMTGSGAPHPMTHRYRIDIKDLKLDPLLQDGN
                     YVAISKHLCGVATDLALRCIANSEKLVQPGQLQLQGLCIAMCCRHICDSEEYVNPAYI
                     RELIRDYDADYTSFFRALQKMCSWATCGRKPGLKDDDTNGHFTQLTVQQRESLGFMAR
                     RIIDHGRYKWIASIVPQDYKVELLRYVPLNVSLENVAMIIHK"
     gene            <424212..>425498
                     /locus_tag="HG535_0F02170"
                     /db_xref="GeneID:59237465"
     mRNA            <424212..>425498
                     /locus_tag="HG535_0F02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289537.1"
                     /db_xref="GeneID:59237465"
     CDS             424212..425498
                     /locus_tag="HG535_0F02170"
                     /inference="similar to AA sequence:RefSeq:NP_014095.2"
                     /note="similar to Saccharomyces cerevisiae YPT11
                     (YNL304W); ancestral locus Anc_3.47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145432.1"
                     /db_xref="GeneID:59237465"
                     /translation="MSRKKRYSVYIPTTPLSPILPIYPSPIDTKHALQSSRTSRASSP
                     FITHNDHQVPNRLSSRDSSSSFYRVASSGVDQISIDSLPANTPNIKLLLIGDAGVGKT
                     AVILGYCNELPSKGQLKIMNDAGTPIRDKRKNTENLNSSKSSKRKNNRTIQMKKRYSL
                     NDYEELFNKKHNSNSLTNFTNLSNDEISEDGNEENLDELVVETRSTIGVDIKTSIVNI
                     DNRFFKCILWDTAGQERYRNAMIPILYKDANGIILTYDICNMQSFENCCNHWLKEALE
                     NFDQSDLQNIRFYLIGNKIDLYTERKVTHENVIEAIEKIETNFKVTISGNFEITCKWP
                     HVVERTVNMIIQDLVENACYEVMDYSAEQTPSLDGSAESNNSKNSDNESDENTLRYRH
                     FNNNKTDRNKKNSNTVDISKPNNYFEVSSSDGSCCV"
     gene            complement(<425566..>426867)
                     /locus_tag="HG535_0F02180"
                     /db_xref="GeneID:59237466"
     mRNA            complement(<425566..>426867)
                     /locus_tag="HG535_0F02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289538.1"
                     /db_xref="GeneID:59237466"
     CDS             complement(425566..426867)
                     /locus_tag="HG535_0F02180"
                     /inference="similar to AA sequence:RefSeq:NP_014517.1"
                     /note="similar to Saccharomyces cerevisiae TRM11
                     (YOL124C); ancestral locus Anc_3.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145433.1"
                     /db_xref="GeneID:59237466"
                     /translation="MKKKYLVYMVQVHSNFRRAELESLADLYQLEIDFSSYRDDSPFF
                     VVELEDDKAASDWIKRSILSRAIYEYWGEGDNLHELHESIRGQPFYEKYKSDNRTKTF
                     KFEFESYRGSSKANRVKQIESFSYVEFQGKIDMKRPQEIFTVIEEYEPISDNLPGTVP
                     IKLFFGRLIQCSDRAAVEKYDLKKRPYKGTTSFEAELSLVSANIAQVKPGSIMYDPFS
                     GTGSFLCSGGHYGALVIGSDIDGRMIRGKGAQHNISTNFEMYGDSARFLNVLTMDFTH
                     NALRRTLVIDTILCDPPYGIREGIKVLGAKNPERFIGKENVEIDGTKAFARRDYIPTK
                     KPYSLDALLDDLLQYASERLPVGGRLAFWMPTANDENIETIVPLHSNLELRYNCVQEF
                     NKWSRRLLVYINRGSEYSGNENIGQKRSQANFRDRYFSHFN"
     gene            <427724..>429415
                     /locus_tag="HG535_0F02190"
                     /db_xref="GeneID:59237467"
     mRNA            <427724..>429415
                     /locus_tag="HG535_0F02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289539.1"
                     /db_xref="GeneID:59237467"
     CDS             427724..429415
                     /locus_tag="HG535_0F02190"
                     /inference="similar to AA sequence:RefSeq:NP_014518.1"
                     /note="similar to Saccharomyces cerevisiae HRP1 (YOL123W);
                     ancestral locus Anc_3.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145434.1"
                     /db_xref="GeneID:59237467"
                     /translation="MNSDDEDFNDIYGDESTSTTTVVENKEETNKDAIKTTTNGDSTS
                     NATSSLDQLAALQALSSNLNKVSTPNSNNSSNETSSESKSNNYNNNINNNINNNIDQQ
                     GVNSSGNPNEKPGQGTEMSWEQLQQTMSQFNPQPTQQQQQQQQAALNSVKADLSRDIC
                     KMFIGGLNWETTEDALKDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTFDEPSSVDEVV
                     KSQHILDGKVIDPKRAIPREEQDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQLM
                     LDKDTGRSRGFGFVTYDSPDAVDKVCQNKFIDFKGKKIEIKRAEPRHMQKQQGNESSI
                     QSSSGMPNPMAQMYQNPMMGGMGGFNPMFNPQAMAEYYQKMQEYYQQMQQQTGMDYSQ
                     MFQQQMQQMSMMMPGYNMPGMGNTAGSPTNGSGTPNAGDESNSNNNSTSNVQTIGGEP
                     SSDQKNDEADPSSDNGDNKLQINLPRGPRGPSSSEKGSHYGRNDRGERGERGDRGDRG
                     DRGDRGDRSDRSDRDYHYRGGHRNNYRGGNNNGGGGYRGRSGFNRRNNGYHPYNR"
     gene            complement(<429544..>431130)
                     /locus_tag="HG535_0F02200"
                     /db_xref="GeneID:59237468"
     mRNA            complement(<429544..>431130)
                     /locus_tag="HG535_0F02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289540.1"
                     /db_xref="GeneID:59237468"
     CDS             complement(429544..431130)
                     /locus_tag="HG535_0F02200"
                     /inference="similar to AA sequence:RefSeq:NP_014519.1"
                     /note="similar to Saccharomyces cerevisiae SMF1 (YOL122C);
                     ancestral locus Anc_3.50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145435.1"
                     /db_xref="GeneID:59237468"
                     /translation="MESSGPQESTSRIADPQRTDSPRSNDDWNVKDTFIIEEQIEVSE
                     GSHKDVSIMETLKKSFFKYLKFVGPGLMVSVAYIDPGNYSTSVSAGASNQFSLLCIIL
                     MSNFIAIFLQCLCIKLGSVTGLDLSRACRAYLPRWMNLTLYFFAECAIIATDIAEVIG
                     TAIALNILIKVPLPAGVVITVIDVFAIMFVYKPGTSSIRFIKMFEYGVALLVLGVCIC
                     FAVELAYIPKTTSVRRIFRGFVPSSQMFEHDGLYTAIGILGATVMPHSLFLGSGLVQP
                     RLLEYDVSHGNYSISDSDLADKKSKEEVLETKYFSYKPSLAAIRYCMKYSFVELALTL
                     FTLALFINCSILIVSGATLYGTEGAADADLYTIHDLLSKTLAPAAGTVFMVALLLSGQ
                     SAGVVCTIAGQIVCEGHINWKLVPWKRRLVTRAISMIPCLVVSICIGRPALSKALNAS
                     QVVLSILLPFLVAPLIYFTCKKSIMNAEVKDEDGSVTRKVNMANNWFTTIAAVLIWIF
                     LSFLNVYAIVQLGISHGDIN"
     gene            complement(<432509..>433357)
                     /locus_tag="HG535_0F02210"
                     /db_xref="GeneID:59237469"
     mRNA            complement(join(<432509..432923,433338..>433357))
                     /locus_tag="HG535_0F02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289541.1"
                     /db_xref="GeneID:59237469"
     CDS             complement(join(432509..432923,433338..433357))
                     /locus_tag="HG535_0F02210"
                     /inference="similar to AA sequence:RefSeq:NP_014097.1"
                     /note="similar to Saccharomyces cerevisiae RPS19B
                     (YNL302C) and RPS19A (YOL121C); ancestral locus Anc_3.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145436.1"
                     /db_xref="GeneID:59237469"
                     /translation="MPGVSVRDVAAQEFINAYASFLQRQGKLDVPGYVDIVKTSAGNE
                     MPPQDAEGWFYKRAASVARHIYMRKEVGVGKLNKLYGGAKSRGSRPSKHVNASGSVNR
                     KVLQALEKIGVVEHSPKGGRRISENGQRDLDRIAAQTLEEDE"
     gene            complement(<434174..>435047)
                     /locus_tag="HG535_0F02220"
                     /db_xref="GeneID:59237470"
     mRNA            complement(join(<434174..434622,434936..>435047))
                     /locus_tag="HG535_0F02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289542.1"
                     /db_xref="GeneID:59237470"
     CDS             complement(join(434174..434622,434936..435047))
                     /locus_tag="HG535_0F02220"
                     /inference="similar to AA sequence:RefSeq:NP_014098.1"
                     /note="similar to Saccharomyces cerevisiae RPL18B
                     (YNL301C) and RPL18A (YOL120C); ancestral locus Anc_3.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145437.1"
                     /db_xref="GeneID:59237470"
                     /translation="MGIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPF
                     NKVVLKALYMSKINRPPVSISRIGRALKQEGASNKTVVVVGTVTDDSRILDFPKATVA
                     ALRFTASARARIVKAGGEAITLDQLAVRAPKGQNTLILRGPRNSREAVRHFGFGPHKG
                     KAPRIQSKGRKFERARGRRRSRGFKV"
     gene            complement(<435495..>437015)
                     /locus_tag="HG535_0F02230"
                     /db_xref="GeneID:59237471"
     mRNA            complement(<435495..>437015)
                     /locus_tag="HG535_0F02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289543.1"
                     /db_xref="GeneID:59237471"
     CDS             complement(435495..437015)
                     /locus_tag="HG535_0F02230"
                     /inference="similar to AA sequence:RefSeq:NP_014522.1"
                     /note="similar to Saccharomyces cerevisiae MCH4 (YOL119C);
                     ancestral locus Anc_3.53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145438.1"
                     /db_xref="GeneID:59237471"
                     /translation="MFPVNIVARPGRLLFSKSRSKKSSSLENAAIEMTNGNNSNSNLR
                     SGYEGKPDVEDAILRKNNEVLVPQFSTSVITAEISNNENDVLLLDKDKEFPDGGMQAW
                     LAVLGSFVGLIPVFGLMNSIGAIESYISKNQLANVAPSTISWIFSLYLSISFFSCILA
                     GGYFDRNGSRMPLCIGTIAYVGGVMALANCSTVWQFILSFSVLTGTGSGILMTPLVSI
                     VATWFFKKRATATSIATMGGSVGGIIFPVMLRNLYVEVGFQWAIRILGFICLSCLLVS
                     ILLAREKEIPVAQPFNSKRELLAWYLSSSFNWRYYLERNFFLVALGVALEESSLTTSA
                     TYLGSYALMRGNNETIAYALITVTNAVGILGRYIPGYVADRYMGRFNIVILTVSIAAL
                     SDFIIWLPFGGHIGALWAYVCVYGFSTGSILSLTPVCIGQISKTEDFGKRYSTAYCLQ
                     ALLTLAVLPIGGSIIGGGSVSEYNKFIAYVSTLMAAGAICFLMVRYYCVGIGMRKF"
     gene            complement(<437343..>437909)
                     /locus_tag="HG535_0F02240"
                     /db_xref="GeneID:59237472"
     mRNA            complement(<437343..>437909)
                     /locus_tag="HG535_0F02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289544.1"
                     /db_xref="GeneID:59237472"
     CDS             complement(437343..437909)
                     /locus_tag="HG535_0F02240"
                     /note="ancestral locus Anc_3.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145439.1"
                     /db_xref="GeneID:59237472"
                     /translation="MFSSLTARSNLNNSGVKLARSFKSFAPVLFNAGESIPKGLPGLQ
                     ENSPGNQVDIGKEVSKGKYIIVGLPAAFSPACSASHVPGYIKYLSELKSKGIKQVFVT
                     TVNDSFVTAAWAKNLNTPDDIRIIADTQGAFAKAGGHLFDSSKIFGNERSVRFAAIVN
                     DGKVVEEFEEPDKTGVDVSSAENVLKHL"
     gene            <438127..>440037
                     /locus_tag="HG535_0F02250"
                     /db_xref="GeneID:59237473"
     mRNA            <438127..>440037
                     /locus_tag="HG535_0F02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289545.1"
                     /db_xref="GeneID:59237473"
     CDS             438127..440037
                     /locus_tag="HG535_0F02250"
                     /inference="similar to AA sequence:RefSeq:NP_014524.1"
                     /note="similar to Saccharomyces cerevisiae RRI2 (YOL117W);
                     ancestral locus Anc_3.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145440.1"
                     /db_xref="GeneID:59237473"
                     /translation="MSEDDANYDDFMMSDEEDMGVIEMEDETEDEAVNGIEDETEDKD
                     EGLLEEGGEARYEIGRSDKCEKHNEQFLALQFEIAQSCADEQDFIRAREVYHNVLQYA
                     QKNDNLVEESFKSITEILRSRSMEVHYSKISEEMCDFILHDFTAFVDFTNENYERIRS
                     DVFQETVSVLLADLFPNLNREFLFAVESIDQYSLLLKMKLQMKCLQLFDDNFNRRRIS
                     LHAVNFGKISATIWHDRLEKGIIDQRSLSELQALCGHEDSTSRIDTICLILQCYICNF
                     IENKRCCPETWTKYVDEFESMTASSISVSQRLGSMIQLHLSKAIIILNRINSRERGIN
                     TQEFHHEVQTLKSEFWECLQHIEEIGGSKQNFTTAYEKFILTGFTFTSMILHLKTENK
                     INPFDLEQIKIAYNVPIVIVLRKIYDNFTALNLVGLYNSIQRLERLKNNFEGVIETIY
                     HLAQLIKLWTKIAPVYSCLSFTDVQNLLKLDDTRCMTRDELLTILMKSIMNDNADLFY
                     KLNLTKDLVYFGDENKVQLSMYPKESFKLNQKDTRDLEFANNIGIFDNPKSLKNLTLP
                     EFFDSLQSSRDNVQSMNRNHEQQQENLTLATSVSTASVASQHSTGFQPTHMRYSHKYN
                     ELSELLQVKLGL"
     gene            <441433..>442806
                     /locus_tag="HG535_0F02260"
                     /db_xref="GeneID:59237474"
     mRNA            <441433..>442806
                     /locus_tag="HG535_0F02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289546.1"
                     /db_xref="GeneID:59237474"
     CDS             441433..442806
                     /locus_tag="HG535_0F02260"
                     /inference="similar to AA sequence:RefSeq:NP_014525.1"
                     /note="similar to Saccharomyces cerevisiae MSN1 (YOL116W);
                     ancestral locus Anc_3.57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145441.1"
                     /db_xref="GeneID:59237474"
                     /translation="MDQDRVLMEDRLSNLERQISVFERMVHMLSSSLDHRFKKYDMVI
                     CSQQQQISELNAVISTFLNDEYRHAGILREKLTGTLHGISATAASIGSVVNTNGRYVP
                     DSTTRALDPDGIFSDILGEESPHSSTRNSSKHRPDDSGPFHQQYGGTTSSQSVAPIQH
                     DSASVTVNTHIGNNNAKTNGADELNNNSKNNNHNDNNSSSNNNNNNNNNNNNNNNNNN
                     NGNGNGNGGSNRSNNNNNHNNNNNDHHTSDGNKVISHTDDRQLSMLSYGDFDHIQASE
                     KTNPGHSVAAQTHFYDNHHTHDGHGRRLSAEECDQQTDIQAQSNGGGNEMGTDLKEEQ
                     YLTSKGRKRKRSVYVGNFQFLKSPHSVMEVWKEYTQGFNGQPSIREMENIYQTGWRRD
                     PAVNKRYSRRRVLCKAIETGLARGFSLDYIVNILEDYRYINREKGLKQPIGWICQGQN
                     IPESLRG"
     gene            <443072..>445162
                     /locus_tag="HG535_0F02270"
                     /db_xref="GeneID:59237475"
     mRNA            <443072..>445162
                     /locus_tag="HG535_0F02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289547.1"
                     /db_xref="GeneID:59237475"
     CDS             443072..445162
                     /locus_tag="HG535_0F02270"
                     /inference="similar to AA sequence:RefSeq:NP_014100.2"
                     /note="similar to Saccharomyces cerevisiae TRF5 (YNL299W)
                     and PAP2 (YOL115W); ancestral locus Anc_3.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145442.1"
                     /db_xref="GeneID:59237475"
                     /translation="MRRSDLGKSIDGQKKNKSAVHSRDNKKTRRMRKSSLSKAQKNFQ
                     VFNDVDNHVNKYENLTVDSSESEILDKKHHISDDILIIDEEDNDDGYDDYDGHYDSPR
                     DVPTVLISSDGEIESSNEPVPRLGSVDGNALAANDDFIALSNSSEEEQTMAEKENDEG
                     IQEAQMETNKMSNPHLRTLNSDYPWILNHDHSRQKEIADWLTMEIKDFVGYISPNKNE
                     IETRNRTISKIRQAIKQLWPDADLNVFGSYATDLYLPGSDIDCVVISKNSDKENRNSL
                     YSLASHLKKKKLASRVEVIAKARVPIIKFVEPESQIHIDVSFERTNGIEAARLIREWL
                     DDTPGLRELVLIVKQFLHSRRLNNVHTGGLGGFSIICLVFAFLHLHPRIITNEVDPMD
                     NLGVLLIDFFELYGKNFAYDDVSISVSDGKPTYIPKSDWKDLNTRGTFTLAIQDPGDP
                     SNNISRGSFNLRDIKKSFAGAFYLLTNRCFELDMATFKDRLGKSILGDVIKYRGKARD
                     FNDERNLVINKAIEENERYHKKRSRIVHEEVFIDPSGDEAVDQAIDEEEDMYHIEEPP
                     TKKRKRDKQKEKGKHKKRSKTASPTPNVVIDNNGSSDSKRESSKAPPKDDNPKNSVES
                     LMGLPTDDEDDDDGDGYNPLEAEEKTTTKTNNDTNDDDDQDGESSLKKYTVDAQTRRD
                     YWLGKSNAMSSNST"
     gene            complement(<445169..>445693)
                     /locus_tag="HG535_0F02280"
                     /db_xref="GeneID:59237476"
     mRNA            complement(<445169..>445693)
                     /locus_tag="HG535_0F02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289548.1"
                     /db_xref="GeneID:59237476"
     CDS             complement(445169..445693)
                     /locus_tag="HG535_0F02280"
                     /inference="similar to AA sequence:RefSeq:NP_014527.1"
                     /note="similar to Saccharomyces cerevisiae YOL114C;
                     ancestral locus Anc_3.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145443.1"
                     /db_xref="GeneID:59237476"
                     /translation="MWHTKGIERFVQFVRFSSSNGARKVAIQWLKYLSVDTVPLKLFT
                     IRYDRSSGPGGQNVNKVNSKCTLTLSNFSKCSWLPNEVRQQLIEKPVRYYAKRSDSLV
                     VQSDETRSRDANKHVCLMKLVTEIRNSCWFPGEIDQTTVKKWENIKKNADRKRIRQKK
                     ISSEKKKLRSKLDF"
     gene            <446291..>448882
                     /locus_tag="HG535_0F02290"
                     /db_xref="GeneID:59237477"
     mRNA            <446291..>448882
                     /locus_tag="HG535_0F02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289549.1"
                     /db_xref="GeneID:59237477"
     CDS             446291..448882
                     /locus_tag="HG535_0F02290"
                     /inference="similar to AA sequence:RefSeq:NP_014101.1"
                     /note="similar to Saccharomyces cerevisiae CLA4 (YNL298W)
                     and SKM1 (YOL113W); ancestral locus Anc_3.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145444.1"
                     /db_xref="GeneID:59237477"
                     /translation="MSLSAAANKISDNDFQNIGPAPRPPGMMKSQASGYNQTKPITRF
                     NTNTPPRQGNTRSVSQPTMYFKKRAGWISCKDDGLLSFLWQKRYMVLNDSYLILYKND
                     KVAEDPVLQIPLTSIVSVSRTQLKQNCFELVRSNERVSSSSNSIASSGSGSSSGGTDS
                     SSRKTIYISPKTEQELHNWLDSIFVKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMP
                     SNWEKLLKHSRITGEDWNNDSAAVIQVLQFYQEYNGISNNNNNKSNISLANGNKAQSH
                     IQSQSLNNNNSDNNINTINSDTIKPLNYKNSNSNPKDFKVTGNSGTKSAGFSSQRSTP
                     LSASSENANASSKPSITPLYTKTSSPQHSKVYQQQHQHSHMQQSMNAQSPTGTLYNKK
                     AAAPRDYYNQHIQQQPQQYKPQQQRQQSSGQVNPHRPQHNMVNPYALNKPSIPSTVSQ
                     VTIPKVSNLDTQNQNVTLSKLQPQRAAPQPPISNPNFKKEGLSGNVVNNASNQQRQPH
                     PVAQHPTQPLRQAPKKPEADSKKDVAVTKQRKQTKPSMSNAEIMAKLKSVTFNNDPSS
                     YFNMIEKAGQGASGSVYLAQRIELPCTQEDSDSNTLDEPPQIGDKVAIKQMVLSKQPR
                     KELIVNEILVMKDSRHKNIVNFLEAYLKTEDDLWVVMEFMEGGSLTDIIENSPTNGSE
                     HSPMTEPQIAYIVRETCQGLQFLHDKNIIHRDIKSDNVLLDTRARVKITDFGFCAKLT
                     DKRSKRATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPYLNEDPLKAL
                     YLIATNGTPKLKSPESLSLEIKRFLSVCLCVDVRYRASTEELLHHTFFSMACESQDLT
                     PLLDWKR"
     gene            complement(<449068..>453927)
                     /locus_tag="HG535_0F02300"
                     /db_xref="GeneID:59237478"
     mRNA            complement(<449068..>453927)
                     /locus_tag="HG535_0F02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289550.1"
                     /db_xref="GeneID:59237478"
     CDS             complement(449068..453927)
                     /locus_tag="HG535_0F02300"
                     /inference="similar to AA sequence:RefSeq:NP_014102.1"
                     /note="similar to Saccharomyces cerevisiae MON2 (YNL297C);
                     ancestral locus Anc_3.61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145445.1"
                     /db_xref="GeneID:59237478"
                     /translation="MSVVNKEFNAFWKQLYSELQSLSSEAKKRNNAIRQASDKSIEIL
                     KTVHSYDELSQHPDFVVPFILSCSSNNAKFTTISMQCLQGLASTPCLPQDKLSDVLDG
                     FIDATQLALEIKLKVLQVLPIFFKNYSQYVFGPLCAKLLRCCSNLLHSPNKSSMVVGT
                     ASATLQQLIDEIFERVLSEDSALEEGDYSVLVGNNESIKVNAYRFDANRLFSDLCSSF
                     DITDSQEHGIDESFLDTKNLPVTYGLEILESILQNGKGIFLKFTDMQFLLRIKTVPFL
                     LRCISSGKHFSIVLRSFRCINLLMNEDYLLVLELEMEVILSLLIHALSIDSDSSLWKK
                     ALSLEIFANVAQNFNLLAEVFMTYDNFPDKKHVITNLLNELLRLLSDEDVKNCLCESD
                     VIEKLDQPIISAEVLPLKIQYIHMLDKSNAPSVNIIYIIWLILTIPNEMSDGLSVATL
                     KFSQSADELSSADHLERLTIVYQGIFSGLFEIHCKFLFSTSLDTPLFHSLIRAFQKLA
                     HAAGMLSLSKELNRCLDLFSQAIVTNGITNNPMHLETSQQSTIFNTLSGSLVGPTSSD
                     KVSSEFQFRRIFPPRNINQRQVSLFRALISLSVSLGPALDSENWSYILKTWQWISYYV
                     YGPSADIMEEFYAQDVPPSPSMTKNEILSVENSIVKLYESTTSYGSTAFKAILEQLIS
                     ECQCSLFPREMNDDVDASSNKTTACRQIEGCACNRLFYITQIGELAIYNSSRFFTDQK
                     NKETALMAVNYLIELVANRDLPNLTIRLYAAKTFTDIIRKVCFEVGSIEDQDLRVARF
                     HILESVILDSILNCINALKELDVTKNTIHNGVLKAESEILLQLLSALKDILNEFGDII
                     NTSWSAVFMIVNSPFEWLKKDLNDVLVEDESDSSLVNGILQKYKEMIQVSYDVFKLIS
                     DDFLQSLPIQIIKIVIDTLLNFVMQELNLNISFSSISQFWLVGDYLRQRKDQPLISNE
                     EKEFLHDIESGRLEEIISSHDAGAYKMYNGLWLYLLKKLIECSEDKRIEVKNGAVQTF
                     FRIVDSHGAFFPDWNLIFLEVIKPLLTNKWSVRDQTSDAEFWNHTFEGLVDLYPSHFT
                     DFSEDGAGTEQWRMLLDFIESYVGSGSTDVAYVAIVNYHTLLKSMLDMAYLPKEVLDK
                     VMDIWSRYNIVYGDLTDNTFAKRSNYDCVQEFIASFPHLYKLIMKYEGVTVEFLEKIL
                     SLFNSAVRYPLLPENIRDKIKPSSLQLAVLTGLSTFAQSENGNIEVLILFQLSAIMAL
                     PFETKEKIEKKLLPKLPVSSRSRIPSFEAVSFSAFKLLKERLEAERNWAFLTERASIK
                     IMNNLSNVISRKPFFEVVKDSEEPIWIMVSRCFRDISLKMFSVSSTLRAIDQSRRDFC
                     DIFVGVAASILKRIDAIADKKTGSLDAIEYAHYREILLKKEIIQYLDKTQIDNFLTAI
                     WECSFLYEFSEVENEILDLSESLSSLASKLSQFEFADVAGSTTETPILSKYQCSIACL
                     KDLISFAIIPGSEYEEIRRSCSPYLVCRLAFALRRYISNESLVRRAPIPKVRKIELEI
                     LLVGLHDILEPTNENTKSTDEAILTALKVLHPLILRTIPLSHKLDVLQKDVLELSLGF
                     TRLISKSDI"
     gene            <454408..>455898
                     /locus_tag="HG535_0F02310"
                     /db_xref="GeneID:59237479"
     mRNA            <454408..>455898
                     /locus_tag="HG535_0F02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289551.1"
                     /db_xref="GeneID:59237479"
     CDS             454408..455898
                     /locus_tag="HG535_0F02310"
                     /inference="similar to AA sequence:RefSeq:NP_014104.1"
                     /note="similar to Saccharomyces cerevisiae YNL295W;
                     ancestral locus Anc_3.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145446.1"
                     /db_xref="GeneID:59237479"
                     /translation="MLRQAYIWNKALHASKQGPQGSQKVSVKRLYSNGKRSKKGNNLS
                     SDLKEQEDLKNRVNDETQKSVTGKAYERVEASEKGDNGTVQVSSIRKSILVPKVPSTD
                     YIPTRDVQTEGLYAGYRPLFLGNSPVRADRRYNALDNFFSSFANLKVAEDTKGSGAVS
                     VSETIEDLKRNNTDDNLQNSSGRNRKPIIPWDASISGMVYDDQAFKDVPKNVMSRLKP
                     FKIVRVERNSDKKRQEKYTDLIKMKVHNSAMNDDSEIVNISRVAHVGQRNHIWDNDRS
                     DSKNQAAMNARKNYQRESSDYAYKHKFIKSDQRTFKTDVEKINRLLAKEFYKQTGLTI
                     KSELLKNQLPLYIYVDKSISAKILFRRFLKKRIIEDIEPVLATLLSSYDTRDQAERFQ
                     QKINLRINNIIRSLSEHLPSVYFTSKSVDCILHSSPISGFKRINWLKPHKRRCIFWGK
                     NIEMDYFFHLNHEYNVSRGGVKYMRYPVNLHWKNFDGAFSEWDYFA"
     gene            complement(<456048..>457643)
                     /locus_tag="HG535_0F02320"
                     /db_xref="GeneID:59237480"
     mRNA            complement(<456048..>457643)
                     /locus_tag="HG535_0F02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289552.1"
                     /db_xref="GeneID:59237480"
     CDS             complement(456048..457643)
                     /locus_tag="HG535_0F02320"
                     /inference="similar to AA sequence:RefSeq:NP_014105.1"
                     /note="similar to Saccharomyces cerevisiae RIM21
                     (YNL294C); ancestral locus Anc_3.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145447.1"
                     /db_xref="GeneID:59237480"
                     /translation="MIRDLSWKLDPGDRNYASCQPQELGNGIIIGSLLPNIAYLADNI
                     KFQSYCDGQLPVYNAARMTDFSYPYLDIVKEDWQAYIEADDILTGSFSYGIYPVLLSL
                     TANFVITVFLTLLIFINIKSKHSKYTSILLKVGAVISSIKIIIFVTRALKELCRLHDD
                     YGVATTYRIMLLFSSDLSFSILDLISIFLLQLCQVMIAIRLFSRNLEKRLVFLLGASL
                     VIVANVLWAIPQFSDVINRDDPHAELLAPFVYLFRIAIAASYASTIISYGILKRRFCF
                     ATSQMAILTTLTVLVVLLQPALFLADVSNVWLSGVGELFNTTCYVGSTSIVWEWLDRL
                     GVSERREQAQSILGRPIYEDEQSDYHIAKYALRVQKALTHAKSGNLEERKQISSLCEA
                     RSSSCTNFIDTEGEITFQNDEANYIGGQVDGESINQVKFKQQQSFKEVTQQKITVVCD
                     RLLYYADQVVSKSWGTLSLSSKSTDDSTKREKMVRKRVGLDRPNEVYIYSTKDVIFEP
                     DGDIEEEEEQKEANEQRYHSHDA"
     gene            <457961..>459928
                     /locus_tag="HG535_0F02330"
                     /db_xref="GeneID:59237481"
     mRNA            <457961..>459928
                     /locus_tag="HG535_0F02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289553.1"
                     /db_xref="GeneID:59237481"
     CDS             457961..459928
                     /locus_tag="HG535_0F02330"
                     /inference="similar to AA sequence:RefSeq:NP_014106.1"
                     /note="similar to Saccharomyces cerevisiae MSB3 (YNL293W)
                     and MSB4 (YOL112W); ancestral locus Anc_3.64"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145448.1"
                     /db_xref="GeneID:59237481"
                     /translation="MSVDILRTTEGIEQHKPLMNEGIGVAAEQTESTKVARNSGPRKS
                     PSAPNFHEKTYAGHSMSEPTLLRNCNGDNLLNLGDNLSFNDRDANLSVINLYDDEVIS
                     RQMDDFEDNNDEDSQQNVDSDEGNTPTMSMLQNNCNGSETEHLDRYGFKKQNNFITVE
                     EYNKWWKDYSQYCIRRKHKWKLLLAKSGLPMDNDSPNRFPSRSEKLKRYVRKGIPAEW
                     RGNAWWYFARGQEKLTKNKGLYDKLLQKMDDLLKKKKKKKPMQDLDIIERDLNRTFPD
                     NIHFQRETFQLDEPPMIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFMDEEKAFW
                     MLVIITSRYLPGVHNVNLEGVNVDQGVLMLCVKEYLPEIWPFIAPLHKRSPINLGNSK
                     YNFGKNEFLYRLPPITLCTASWFMSCFVGVLPIETTLRVWDCLFYEESHFLFKASLAI
                     LKLSEQTLLKNRPQRVLRHYSLSNGNYHSKDLRINQDESEMEVFQVIQSFPKHLINPN
                     DIFDKVIFKKRVALNRLDQDEIDRCRKYVTTQRQRYKNYNEIVGSNLHHDDDEINDSN
                     AQKNDLLSNGPQDYGSINNENNEEQISGAASDMKVNSNNRIGNDLVNNALSSEVYGFK
                     KSLSGVHWNNSIKEKVRQMRKKRGKDDDVLL"
     gene            complement(<460039..>460665)
                     /locus_tag="HG535_0F02340"
                     /db_xref="GeneID:59237482"
     mRNA            complement(<460039..>460665)
                     /locus_tag="HG535_0F02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289554.1"
                     /db_xref="GeneID:59237482"
     CDS             complement(460039..460665)
                     /locus_tag="HG535_0F02340"
                     /inference="similar to AA sequence:RefSeq:NP_014530.1"
                     /note="similar to Saccharomyces cerevisiae MDY2 (YOL111C);
                     ancestral locus Anc_3.65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145449.1"
                     /db_xref="GeneID:59237482"
                     /translation="MSSPEYEFVSKFLTLVSISEPVLTADYKLPLQHVTKLGVALPAL
                     KYRYDFKKSRNSSRNNDASGGPAIALNLKSIRAPKFSIDQQFAGNDTVYQVKEYLVKE
                     GKAQQIQQFKLLVKGKVLHDSELVSDVASGGTNIVVMISKPIVDEGSPSSVSSSSLGE
                     KVATTEPIDIDAEIPWNDIQSALKSSLNSEEAVAQAMDRLKRGYELAK"
     gene            <460724..>461572
                     /locus_tag="HG535_0F02350"
                     /db_xref="GeneID:59237483"
     mRNA            <460724..>461572
                     /locus_tag="HG535_0F02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289555.1"
                     /db_xref="GeneID:59237483"
     CDS             460724..461572
                     /locus_tag="HG535_0F02350"
                     /inference="similar to AA sequence:RefSeq:NP_014531.1"
                     /note="similar to Saccharomyces cerevisiae SHR5 (YOL110W);
                     ancestral locus Anc_3.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145450.1"
                     /db_xref="GeneID:59237483"
                     /translation="MRYYFSLPFFAQIVQCPHHKQALTIRGSKGATHPIRTRNMEPGI
                     LREHSPSAVNSDTISKHGTELPEVQDSNYPQKPVFFNYHEFSETYYIDLSLPCNQIEH
                     SEAYGLCITHFPNIYAPMGSKVFEDTRIVRIPRRYETTLEYPDFSTCLPGLEPAALIN
                     EQEGRTRFVPHGIFDNRELFGYSSVSPLSDFFTETEFEEIITSINENMCKASRIYSWF
                     NLLTLVADMLTLGLWHWLSARYITPDPMQEVEDHIAKLNELPAFKKRNIKILSPRRSG
                     YLSVCA"
     gene            <461779..>463005
                     /locus_tag="HG535_0F02360"
                     /db_xref="GeneID:59237484"
     mRNA            <461779..>463005
                     /locus_tag="HG535_0F02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289556.1"
                     /db_xref="GeneID:59237484"
     CDS             461779..463005
                     /locus_tag="HG535_0F02360"
                     /inference="similar to AA sequence:RefSeq:NP_014107.1"
                     /note="similar to Saccharomyces cerevisiae PUS4 (YNL292W);
                     ancestral locus Anc_3.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145451.1"
                     /db_xref="GeneID:59237484"
                     /translation="MNGIFAIDKPGGITSNQFMMKLQHALTSSQIFSKEIQRATAERM
                     REYQQQTGKKASKRKLRKVSKVKMGHGGTLDPLASGVLVIGIGSGTKKLANYLSGTVK
                     EYEAEALFGVSTTSGDVEGEILSRNSVAHLNTEDIKSVEEKFKGCLKQTPPIFAALKM
                     NGKPLYEYAREGKPLPRAIEPRQVTIYDLKLFPDTLSKNHKYPILRPESGEVKDDIKL
                     LNSGLLDDTLYFSKEYCESRGMESEVAQIERPLPITEQETGQIEKFGNEYRAPLLHFT
                     AKVSSGTYIRSLISDIGKAVRSSSYMVKLTRSQQQDWSLNRRNVFKLEDFIQRDEKVW
                     SKVLELVLEKGAEIDVVDELAKAEKEFASEKQKTEKINQVNDDHNESNLSTETLAVET
                     HPNEANTKKRTIDEIE"
     gene            complement(<463009..>464748)
                     /locus_tag="HG535_0F02370"
                     /db_xref="GeneID:59237485"
     mRNA            complement(<463009..>464748)
                     /locus_tag="HG535_0F02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289557.1"
                     /db_xref="GeneID:59237485"
     CDS             complement(463009..464748)
                     /locus_tag="HG535_0F02370"
                     /inference="similar to AA sequence:RefSeq:NP_014108.1"
                     /note="similar to Saccharomyces cerevisiae MID1 (YNL291C);
                     ancestral locus Anc_3.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145452.1"
                     /db_xref="GeneID:59237485"
                     /translation="MMQFVTMRIQRWHWILTLYALFSLVAAFGATFGLQQEKRFLKGF
                     DQDISYHDYDGDATGLDRYSDNSNSTGILDSNHIYEWTPISTNISAGQRDVFTFSVES
                     LSSSPKKLSTFEVMIFLSGNICNQPTDTTDKLLRVTYSFDEIILSNSSMGECAYFTNG
                     YMQALATCPLKDISNGSVAAYPYLYVVVEAVNVTTNEILPLGAEALNDVWHYEMTVSE
                     NDLVYQWDSRQSLDILDTDHNSALVATDRGLSILSYLNGVKEDTVNNSVPIDSSLYDI
                     YLYSEEEASKIEDSLKLSLCAVTSGSYLATSANKNYTGDRDYRTSLDNLDLEIIKSPA
                     NRTWHYQEQFYITGLNSSSSYTVYLTKKIGRAGNLSQVGGVLFSKSTFSTRNSNDCSL
                     IFGLDFCSGVAYSVPNSASQPNNKTFLAEQFDNLAKSSYVGFSKALQNIPCNIELDAK
                     YSPLRTCDDCAHSYKNWLCAVTIPRCSAEASDIYKRRDKDKNRSHFLSESFRASADYY
                     EILPCVEMCYSLVRDCPSEFQFSCPDSLVHKDLFHMSYNFFDPYSNIMTCNFIGNDTD
                     IFISLFNAQKDEG"
     gene            <464948..>465955
                     /locus_tag="HG535_0F02380"
                     /db_xref="GeneID:59237486"
     mRNA            <464948..>465955
                     /locus_tag="HG535_0F02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289558.1"
                     /db_xref="GeneID:59237486"
     CDS             464948..465955
                     /locus_tag="HG535_0F02380"
                     /inference="similar to AA sequence:RefSeq:NP_014109.1"
                     /note="similar to Saccharomyces cerevisiae RFC3 (YNL290W);
                     ancestral locus Anc_3.69"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145453.1"
                     /db_xref="GeneID:59237486"
                     /translation="MSDTYYAINDDNLPWVEKYRPETLDDVYGQSTVVTTIRKFIEEG
                     KLPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFAS
                     TRQIFSKGFKLIILDEADAMTNAAQNALRRIIEKYTKNTRFCILANYVHKLTPALLSR
                     CTRFRFQPLPREALDRRMNMVLINEHLKITSEARDALLKLSRGDMRRVLNVLQASKST
                     LDDPINEEITADVIYECCGAPRPADIETILESILKDDWTTAYYTLTKLCSTKGLALVD
                     LLEAISEVLEQYELQNEETRIELLTKMADIEYSISKGGNDKIQSSALIGAIKTSFENE
                     V"
     gene            <466358..>467239
                     /locus_tag="HG535_0F02390"
                     /db_xref="GeneID:59237487"
     mRNA            <466358..>467239
                     /locus_tag="HG535_0F02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289559.1"
                     /db_xref="GeneID:59237487"
     CDS             466358..467239
                     /locus_tag="HG535_0F02390"
                     /inference="similar to AA sequence:RefSeq:NP_014110.1"
                     /note="similar to Saccharomyces cerevisiae PCL1 (YNL289W);
                     ancestral locus Anc_3.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145454.1"
                     /db_xref="GeneID:59237487"
                     /translation="MSEYHKALKVLMQSPVTDDMIKFLTNQTLRVLPNVQTPAQTSAY
                     PSPPSSPPKKHLQPQRLPSLMSFISRLVRHTNVYTSTLLTTVCYLNKLKCILPRDATG
                     LPSTIHRIFLACLVLSAKFHNDSSPLNRHWAKYTDGLFSLEDLNLMERQLIQLLNWDL
                     RVTNDDLILDLRFLLEPIVADIEKTSRQRKRIEKQKLLQQQRHRMIESAGTVRSLSNS
                     SSTTKLYDHQRNVSICSDLSSSTLVDYDLNANTTPKPAANTKKACRNSWEALEHELNQ
                     VLMQHDTCSDTYNACNY"
     gene            complement(<467939..>468511)
                     /locus_tag="HG535_0F02400"
                     /db_xref="GeneID:59237488"
     mRNA            complement(<467939..>468511)
                     /locus_tag="HG535_0F02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289560.1"
                     /db_xref="GeneID:59237488"
     CDS             complement(467939..468511)
                     /locus_tag="HG535_0F02400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145455.1"
                     /db_xref="GeneID:59237488"
                     /translation="MFSASVWAYSAVADISCFLSSSICSIKRRCTGSKTKIPKGRDGG
                     RLPRKTRPVNLCPLYSYEHHRIGIPKRVIFFFLIFLFLFLFLLLCLHRAGQCSAMQMA
                     TDRKKFMCTEQREYRLTVAAKRQIETPMSFFLLDVPMCQTRADTPDTFQMRGAARLCV
                     CCGVWRKECAKHRAQEHQRRSEKVADRPQR"
     gene            <469072..>470166
                     /locus_tag="HG535_0F02410"
                     /db_xref="GeneID:59237489"
     mRNA            <469072..>470166
                     /locus_tag="HG535_0F02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289561.1"
                     /db_xref="GeneID:59237489"
     CDS             469072..470166
                     /locus_tag="HG535_0F02410"
                     /inference="similar to AA sequence:RefSeq:NP_014111.1"
                     /note="similar to Saccharomyces cerevisiae CAF40
                     (YNL288W); ancestral locus Anc_3.72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145456.1"
                     /db_xref="GeneID:59237489"
                     /translation="MFNSAYQAPMLPQQGGPHAIPQGIPQAMPQGQGGPQGTSQSGPS
                     VQGNIAMHALDDPNVYHWICQLTYGPQKEQALLELGRKREQFDDLAIILWSSFGVMTS
                     LINEIISVYPMLQPQLLSNQLSNRVCNALVLLQCVASHSETKHLFLQAHIPLFLFPFL
                     NTTSRQRTFEYLRLTSLGVIGALVKNDSQEVINFLLRTDIIPLCLRIMQSSSELSKTV
                     AIFILQKIVLDDIGLQYICATMERFYAVTNVLKDMIDQLTLHTPPGRLLKHIIRCYLR
                     LSDNLEARGLLKIALPPKLRDNTFTEVLRDDVGSKRCLAQLLLTLNEDSTTAPINPSL
                     HRIQVPPGTNNNNNSNSNIINNNGTSSTVI"
     gene            <470486..>473296
                     /locus_tag="HG535_0F02420"
                     /db_xref="GeneID:59237490"
     mRNA            <470486..>473296
                     /locus_tag="HG535_0F02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289562.1"
                     /db_xref="GeneID:59237490"
     CDS             470486..473296
                     /locus_tag="HG535_0F02420"
                     /inference="similar to AA sequence:RefSeq:NP_014112.1"
                     /note="similar to Saccharomyces cerevisiae SEC21
                     (YNL287W); ancestral locus Anc_3.73"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145457.1"
                     /db_xref="GeneID:59237490"
                     /translation="MSTHTYKKFESSESGDLPDKMTIYQSCMSEFNESQINAKKCRLL
                     IARLLRLLANGETFPETEATALFFSISKLFQHPNDSLRQAVYLAIKELSGISEDVLMA
                     TSSIMKDVQNGSDLVKPDAIRSLTAVLDESTAFSAERLLKSALVNKHPSISSAALCTS
                     YHLLPIAETTVKRFANETQEAVVDLKPFPHKNIVGDYYPNSTFITQYHALGLLYQLKK
                     NDKMALLKMIRQFSDNNMLKNQLAKVELVKLVNEVTTKDPQLFIDFQPLLNDWLSNKF
                     ESVQLETAKLITNFATRNSRLISSELFAAAITTLQSLLTVPRTSPKFAALRILNRISM
                     VSPEKIVVCNPELESLINDSNRNISTYAITTLLKTGTAKNISSLISTITKFIHDVSDD
                     FKIIIIDAIRSLSLNFPNEWKSIVNFLIDVLKNGEGGFKFKNNVVEALIDIVSFVPQA
                     KETALENLCDFIEDCEFNEILVRILHLLGKEGPSTSTPSLYVRHIYNRVVLENSIIRS
                     AAVISLSKFALSKNDSTLTESIISLLKRIANDQDDEVRDRATISLKFIDSARKSNNQE
                     AQVFIESKYSYDLSALESKLATYISSDKDSFSTPFDVKAIRRFTEDEAKAMELRRKQD
                     QFLKGNLENGRESTPGFTEESAIADSNENSNFSGPSLDDHEQDLLSTKYVDELMSIDQ
                     IKKFGSLVNSSKAVALTDPEAEFIVRGVKHLFKENVVFQFNITNTLTDTALDNVTLTC
                     TPENPDESQLEELFTIPIVRLLPSEEGACYVAFSKSEEIVMENFLNTLTFTTRELNQE
                     TNEPFEGDEGFQDEYDIDSIFLNAGDYIKSSFVGDFSSTFDELPNEEVAVYNVKENIS
                     LQEIVDRLIVNTSCLPLESTQYASSDSNSHTLKLFGKSALKGSKIAVIVQLIKTSKGI
                     AMKAQGRAEDVTLCADLVNGLM"
     gene            <473563..>474405
                     /locus_tag="HG535_0F02430"
                     /db_xref="GeneID:59237491"
     mRNA            <473563..>474405
                     /locus_tag="HG535_0F02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289563.1"
                     /db_xref="GeneID:59237491"
     CDS             473563..474405
                     /locus_tag="HG535_0F02430"
                     /inference="similar to AA sequence:RefSeq:NP_014113.1"
                     /note="similar to Saccharomyces cerevisiae CUS2 (YNL286W);
                     ancestral locus Anc_3.74"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145458.1"
                     /db_xref="GeneID:59237491"
                     /translation="MDKEELELKCHLKEIKKKELQRRKLEQSKRKDITEEKKYEPTAI
                     YISNLSTKDIDEQQLINEFSKYGAIRKDQEGNVRCKLYKDSEGKLKGDALIIYVRKES
                     VPMAIEMMDGYRFKNSVLDVKVADFENQRKRSFEPEDSDNSEKTKKQQKTLSGPRESK
                     KMQQVSQKFEENQDKIVRSIKISNIVGIYDQLSKEELNDIKADILEGCLDFGPVEDVQ
                     LSPDSGEAAVVFKYLKDAQSCSKKMNGRFFGGRELVSFLMNEEVSSQSDNLKNYALED
                     DLIE"
     gene            complement(474606..474677)
                     /locus_tag="HG535_0Ftrna8G"
                     /db_xref="GeneID:59237903"
     tRNA            complement(474606..474677)
                     /locus_tag="HG535_0Ftrna8G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGA"
                     /db_xref="GeneID:59237903"
     gene            476314..476385
                     /locus_tag="HG535_0Ftrna9G"
                     /db_xref="GeneID:59237907"
     tRNA            476314..476385
                     /locus_tag="HG535_0Ftrna9G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGA"
                     /db_xref="GeneID:59237907"
     gene            477924..477996
                     /locus_tag="HG535_0Ftrna7T"
                     /db_xref="GeneID:59237900"
     tRNA            477924..477996
                     /locus_tag="HG535_0Ftrna7T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:59237900"
     gene            <478110..>480026
                     /locus_tag="HG535_0F02440"
                     /db_xref="GeneID:59237492"
     mRNA            <478110..>480026
                     /locus_tag="HG535_0F02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289564.1"
                     /db_xref="GeneID:59237492"
     CDS             478110..480026
                     /locus_tag="HG535_0F02440"
                     /note="similar to Saccharomyces cerevisiae MNT3 (YIL014W);
                     ancestral locus Anc_7.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145459.1"
                     /db_xref="GeneID:59237492"
                     /translation="MTSILRPVGRSRLFKGWFLRRILLLLSVTLITYLALSNSQLDDE
                     EFGGYAHARHAREFSPFHWIQRRMDKATADANKSKPSWLNPFSYLPLTSGITAVESKV
                     LLNWEDISKAQKCRYMIDAIYRTNGDWSNSRITEFSGQDLDDVLISLLGERLRLFNYC
                     FASTEKTTIQQVLDVKSVLNPSDSLGISPNDFLRRMFPFLRDVNASDEPLWPIITDLK
                     TGLKLAIPEVPADFNENFWFYWREYSQGRGIVITLAESTKTLFFNQLKVLDYMKNKLP
                     IQVVTKGTEFSAEFVEELSNVVRTSEQRVYLVDCATVLDSDFSQRFVVNVINKWLAVI
                     FNTFEEMVLLDVDAVPFISLDVFLDDPQYKLNGMLLYKDRNMPSEHTLGYCIDMLAEV
                     EPSYQEENLINSKLKFAINEVSFDDDSEEATVFRGFFHNKFLHHVDSGLVVINKSSNL
                     NGLLFSFMLNLDAKMRRCVYGDKEIFWLGQLFAGQSYAIYPVDGGIIGPLVEVPAEKS
                     STSIYQICGAQMAHSSRNDQLLWTNGGLKTCKITNSADADFQKDFDYFENRYENAENL
                     RSIYDSSLRIEGLIIPNTSENPWMQLQECSGYIYCATALKDRDSFEETGHLITFEEET
                     QKKLSEIAHIWNRS"
     gene            complement(<480070..>484167)
                     /locus_tag="HG535_0F02450"
                     /db_xref="GeneID:59237493"
     mRNA            complement(<480070..>484167)
                     /locus_tag="HG535_0F02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289565.1"
                     /db_xref="GeneID:59237493"
     CDS             complement(480070..484167)
                     /locus_tag="HG535_0F02450"
                     /note="similar to Saccharomyces cerevisiae PDR11
                     (YIL013W); ancestral locus Anc_7.123a"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145460.1"
                     /db_xref="GeneID:59237493"
                     /translation="MSFSKYFRSIPDCSVTFDGASIRLDQNHFINNHSEDFDIENSAK
                     HGTFLNDLVFRAVGGEMVLVLGKSSSSFFKALFENHDRMSYFPEGSIRFKDNEYKSFS
                     TKCPQHIIYNNEDDIHFPTLTVKQTVDFALDCKFSLSKSERDELRDALLEELGLANVA
                     DTRVGDEAIRGISGGERKRISILETFIANGSFYLWDNSTKGLDSSTALEFLNTLKRLT
                     QTTKSVNFVKISQASDKIVQKFDKILLLSESYQVFYGTVEECLEYFTCTLEIPKDPNL
                     CVIEYLTSILNFRPESTEHGMKMTLPHFQVMTPNFEEYLHQKWIVSCNHDNWKHITSR
                     QIEEGCDRFNDDDLTPLFDTTRCTQIRCCTRRAFQRLLGDKGFIFAQVVSAVVEALVT
                     GSLFYDIPLTTLGSFSKGSLTFFAVLFFTFMALADIPDTFQRQMVVNKQVKLHFYSRW
                     IEAFGNTIHDYVFKLIIVILFTIILYFLAHFQADAARFFTFLLFLSIFNFTMVSLFSF
                     IAFITPNISIANSVAGIVLLAIAMYASYVIYIQDMHPWFVWIAYINPAMFAMEAILSN
                     ELFNLQLDCSEMIVPRGLNYSDVPFSHKTCAWQGATLGRSFVYGKDYLKQALNYTYGH
                     VWRNFGILLGFLAFLLVISLLAAEYVPPLFNKMTDYEILGRFHDYNAARKSSRGYMVQ
                     DERPDHSSSSSIDLFMSQKNIISKSDECMETGTYVESQNHVFSWSNIEYTVNGMKLID
                     GNSGFVATGMTALMGESGAGKTTLLNIFSRMTKSGVVSGQFLIDGKPLENLTAFSRSI
                     GFVQQQDVHLDLLTVLESLEVSCVLRGDGDKSYINVISDLLKLNPNVLVRDLTPTDRK
                     LLSIGVELVTKPSLLLLLDEPTSGLDSQAAMTVVKFLKKLSLQGQAILCTIHQPSKAI
                     YSQFDNIMLLKSGGKCVYFGPAQSAARFFLKYDETLTFDGESDNPADFVIDVVGHNGG
                     IKEEEENTGGKVMNWPQIWNDSLENEIVSEKRENLEQEALELSIDFTRSVRKEVSYTK
                     QLLLITKRQYLCMKRDRAYVISKFALNGGAGLFVGFSFWNTKYNITGLKNATFLCFMS
                     LCISSALINQVQNKALEAKGVYLTREASTNTYHWSIFLLAQLIVEIPLAIASSTLFFL
                     CCYFCCGYSFAPHIAGVFYLNYIVFSLYYLTFGMWLIYSTPNLQTAAVIVAFLYSFTA
                     EFCGVMQPYSLMPGFWKFMYRASPYTYFVENFVSLLLHERPVICKPMEVVPTMPPLGE
                     TCGEFMQDFVDEFGGKMVNPNSTSICAYCAYAIGDEFLKDQFMSYSHIWRNSGIELAF
                     IGFNVAAMFAGFYVIYVRTGWISTTKNFLQKLLCSKYVKKHVNSY"
     gene            complement(<485345..>486046)
                     /locus_tag="HG535_0F02460"
                     /db_xref="GeneID:59237494"
     mRNA            complement(<485345..>486046)
                     /locus_tag="HG535_0F02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289566.1"
                     /db_xref="GeneID:59237494"
     CDS             complement(485345..486046)
                     /locus_tag="HG535_0F02460"
                     /inference="similar to AA sequence:RefSeq:NP_010927.1"
                     /note="similar to Saccharomyces cerevisiae TIR1 (YER011W);
                     ancestral locus Anc_7.161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145461.1"
                     /db_xref="GeneID:59237494"
                     /translation="MSLTKSAILIALAVAGVSAIEPIQSAEINVILSDARGHLQDYMS
                     VMTTINIPPAIMEIGMAMATATDDSYTTYYSEIDFDQVNTLVRELPWYSSRLAPALTA
                     AMSTVPTGSESDSSTSTTGSSSAVPSTSSVSSSSAATSSSETSSSEVASSSSGASSSS
                     EVASSSSSASSSSEVASSAVASSTVASSSEIMSSTMSSSSTGAVPSASQTINGAAKAA
                     VGMGIGCVGAAAFLL"
     gene            complement(<486670..>487380)
                     /locus_tag="HG535_0F02470"
                     /db_xref="GeneID:59237495"
     mRNA            complement(<486670..>487380)
                     /locus_tag="HG535_0F02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289567.1"
                     /db_xref="GeneID:59237495"
     CDS             complement(486670..487380)
                     /locus_tag="HG535_0F02470"
                     /inference="similar to AA sequence:RefSeq:NP_010926.3"
                     /note="similar to Saccharomyces cerevisiae YER010C;
                     ancestral locus Anc_7.158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145462.1"
                     /db_xref="GeneID:59237495"
                     /translation="MGVVCEELSKYSTCDISDGLLNFCNIEDGGFFPNLTRWSGNDSK
                     ETVAGKAYTVLFAPIDDPREAVNYIDSVPEGSFLVISLTKDLQSHHAPYVRITQAVYG
                     GLMSTRAQYLKSEASAVFGRIRDLQEHQQLKHSVFSYGLSSCGPNKVVKPVAVNVSLT
                     ILINDGSEKVIYPGDHIIGDVHGIVRIPSAKVDLEKLLDYVKVSVKADELVAQDITFG
                     VPAKQAQKDRRVILKSFR"
     gene            <487615..>488121
                     /locus_tag="HG535_0F02480"
                     /db_xref="GeneID:59237496"
     mRNA            <487615..>488121
                     /locus_tag="HG535_0F02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289568.1"
                     /db_xref="GeneID:59237496"
     CDS             487615..488121
                     /locus_tag="HG535_0F02480"
                     /inference="similar to AA sequence:RefSeq:NP_012270.1"
                     /note="similar to Saccharomyces cerevisiae IST3 (YIR005W);
                     ancestral locus Anc_7.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145463.1"
                     /db_xref="GeneID:59237496"
                     /translation="MNQIRAIQKINEAELQNGILKSEVSWHNEYKNQAYVFIGGLSTL
                     LTEADILTIFSQFGVPVDIFLVRDQETGDSKGFAYLKYEDQRSTILAIDNLNGATIAG
                     RAIKVDHAMYTPNSNYQRYREAVQQELRRDKVEVPADLRIGEQKERNADDDNDAFSDP
                     MAGFASDK"
     gene            complement(<488255..>492682)
                     /locus_tag="HG535_0F02490"
                     /db_xref="GeneID:59237497"
     mRNA            complement(<488255..>492682)
                     /locus_tag="HG535_0F02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289569.1"
                     /db_xref="GeneID:59237497"
     CDS             complement(488255..492682)
                     /locus_tag="HG535_0F02490"
                     /inference="similar to AA sequence:RefSeq:NP_012271.3"
                     /note="similar to Saccharomyces cerevisiae PAN1 (YIR006C);
                     ancestral locus Anc_7.160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145464.1"
                     /db_xref="GeneID:59237497"
                     /translation="MFGSYNTSGNSRPPATGYFPQQQNSQQQQQQQPLNQMGGTNSVY
                     NSQQGAPTSLGNGSMFSNMPPQGLGGNMNTGINNMQQTANYYPSIPSAGGFANSTDTG
                     NNGLHSNVSNLNSGSYQQPQTQSQMQAMQPQSTGYYNVPFQQPMLQHPQMTGMPLSQQ
                     QTQQTQQTGLQPQHTGYGQLPETQNTLLPQQTGFYAQTSQQPLEPLKPTATGFVNSFA
                     NNGINSDIKIPVRRLSFITANDQAKFEKLFRSMVPRGSNTISGNDCRKVLIKSGLQPS
                     QLARIWALCDSSKAGALLFPEFALAMHLVNTVLQGDSIPYEFDTKTKNEISGFIDAIN
                     LSIAAESTTDLPNTRTPFDDLLSAGLSNVQPQGTGIMPQTSFGIPLQSQTTGSAMINS
                     AATGYMPQTSFGAPGQMTGSALNNFQAPLQPHNTGYLSQSLNAPSNVQTTGAGIINPQ
                     NTGGFAQGYSNQMNGNMSALQPQSTGGFTAATQSYPTVNPSLQPQSTGGHVAGTQIYP
                     TVNSSVQPQLTGGFSQGLQPQLTGNNSSNFQQQTTGMFSNLKPQNTGSFGSSISAIPI
                     TQQLQPTSFNSDLQQQNTGTLQQQSTGGFSSLLPPQMRANIAMQQPQATGGPPNVSFQ
                     QQSTGGYFPNLSVGSGSAPMVNQPQQTGNMFPLQNQQTGFLPASGFNPTKPLTAQKTG
                     FGNNEIYSQSNFGSNFTAQTEDSITDEEKSLFYKVFETYDKENRGLLDASSAVEIFRK
                     SGLNRTDLETIWALCDINNNGQLNKQEFALGMHLVYRKLNGFQLPSRLPLNLIPSSRK
                     ILDNVKDQLKNVRAEDDKKNVTKTDALSYKNNDDEEVLPSFRNRRKVFNTTAANFSPS
                     SSPVSTPTQHKEVPKLQINRNKERGEQLYKAIAEKKQLIRGQRARKLTPSTDDFDRIE
                     VLKGKIRAFERASDVQNASVPSELKAKFDSFMQKLPNVFYRINEVDSAISAAKIEIFR
                     QKNPSCLVGSGPNGEITEDDKRKAKSKALLKSRMDALTGKVSSANDSFEAKEAQYNAE
                     IAKIKSESSKNLEIIADIRRSIAELSASLTTSLNGGTVSNRAADFEKWELGAGLEPDV
                     GSFINDLRSTSSAQHFQEEAKINSQQQQAVSSHRNTAQNYPNYTSEPERQISSREVGA
                     QVRGADDRSMKKSDNAEDDAEERQLQEELNRLKLKKKEEKEKRLAELRRQIEAAQAES
                     SDDEGAESVPIYKSVGGQNTVPLNDSRTSVLNVQSQHSSANVAPTGTGGPNPFFKQSG
                     STTSSFDSRAAEVQRRLQRGLDHNDDDDWSDGEPENQKLPASSTIKVEENATSKKSFQ
                     PDSTAISSPVLSTAVPYVSSNENVVAKVSSPVPIAPPIPQVGSTSAPPVPIAPPLPQV
                     GSNQETPVPIAPMPPAADKFVEVEPTSAASSSTQTNAPSSFMAPPPLLPTNQAQTASG
                     EESGGDDSDDLLSIPDSVASEDHGAPPSGIPPPPPLPSM"
     gene            complement(<493589..>496654)
                     /locus_tag="HG535_0F02500"
                     /db_xref="GeneID:59237498"
     mRNA            complement(<493589..>496654)
                     /locus_tag="HG535_0F02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289570.1"
                     /db_xref="GeneID:59237498"
     CDS             complement(493589..496654)
                     /locus_tag="HG535_0F02500"
                     /inference="similar to AA sequence:RefSeq:NP_012267.1"
                     /note="similar to Saccharomyces cerevisiae MPH1 (YIR002C);
                     ancestral locus Anc_7.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145465.1"
                     /db_xref="GeneID:59237498"
                     /translation="MVMNNAELDSSAGRGIALREKSSQADAVNRMVSKSVIRKPIPIQ
                     RDLLGKKIGDQKSYYEEIKEVVTYRPTHHKLNAGRLHFFIYPTNFAIREYQLDIVRKS
                     LFQNVLCAIPTGMGKTFIASAVMLNFFNWSMEGKIIFTAPTRPLVAQQIKACLGITGI
                     PHDQTAILLDKSRKNREQIWDEKRVFFTTPQVVENDLKRGVLDPKSIICLVVDEAHRA
                     TGSYAYTNIVQFIGRFNTSIRILALTATPGANLEAVQEVVKNLCISKIETRTEESLDL
                     ARYMKPRHQKKVEIDLIGYIEDIIEKLGIAIKPVLEQAVELGIYEECKPSQINAFKAM
                     QQSQKIVANPGIPEGIKWRNFFILQLLNHVGQMLKRVKIYGIRTFYSYFNDKYKEFTV
                     KYDLGKSKNKTAAEFYYNPILKSVINQCEELLRTPKFISHGKLKYMQDELDVFFKYGK
                     SDSRVIIFTELRESALEIVKFIDEQSDPHIKPHIFIGQSKGKEGFDEVSFIRKNGSKG
                     RKKADRFKRLEEYKTVDEERKEKKKQEQLERGARRTGSSEEAQLNGMTQKQQKQVIQD
                     FKDGQYNVLVCTSIGEEGLDIGEVDLIICYDTTGSPIKNIQRMGRTGRKRAGEIVLLF
                     SGNESSKFEQAMKDYYNLQRLISQDLLHLKKSDRIVPKEIDPICRKEFITVNEEDHQL
                     TNMDNTDDVIRYATQCMLGKKTNAKIKLKKDSINKEKRFFMPDNVNTGIVTAANLVEK
                     VKIEDKSEKKLSKDFPTLDNLQYDSMEFSSPSRSDMGDFFEKDSKSVCLDDHQNSRNL
                     QGVLLKETEKMDAFPDKNKDHPLENISLVGSVSLGEKIDSDELRHSSPPALKKRRLTA
                     KPDGTKNNTSSIIRTNAISPEYPVRNQTEECDGLLTPEERKVFLSNYSASETVSIDTI
                     PTFQKGTTYSTIPHSTRNEALLKLFQHLNENSEAIVIQMNRQRCIARGLQSGAVSFEE
                     DVHVIAKEKGLLSKPLQNSQGTDEFETIPSLGCVDLEELDEILGSESDF"
     gene            complement(<496862..>500872)
                     /locus_tag="HG535_0F02510"
                     /db_xref="GeneID:59237499"
     mRNA            complement(<496862..>500872)
                     /locus_tag="HG535_0F02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289571.1"
                     /db_xref="GeneID:59237499"
     CDS             complement(496862..500872)
                     /locus_tag="HG535_0F02510"
                     /inference="similar to AA sequence:RefSeq:NP_010924.1"
                     /note="similar to Saccharomyces cerevisiae SEC3 (YER008C);
                     ancestral locus Anc_7.154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145466.1"
                     /db_xref="GeneID:59237499"
                     /translation="MKNSKSPFKRFSHSREGSTDEHNSFFHKHSVSGSSTHMNDVNHS
                     RNASASGVPPVSGMKASHKRNTSTSSRASQNSNFLAEQYERDRKAIIDCCFSAHDNKS
                     KGFTSSYITHVRIIEDSKSPSSRPPSNSKLENKKKRVLILSCKTGNYNEIQLHKGRES
                     SEGTFQIGRTWDLKELTKVERDTEINEGFILTMGKKYYWETNSAKERTVFLKSLINSF
                     MQAFDGHVPELINWDLSSFYLDEKSYQRAVIRSSHSMSRTAAATSMTTSTTPSTATNE
                     SQYMRQNKSPQKDHRKGPSVDQEGPTSKQSAMSLNKSPYSNSPTIIEVNKRFNNSRIS
                     KETPESPSKDFDNFVQKVDATAIPVPSVVTPSASSTATSFSSKTSQAPDQYVRKITSL
                     NKGNVDSDKSSRKDYNDSEESHSSLTKNNYNLLENLNNVLSSNDVLLETAAKVPQDSF
                     INAKESNADQNMQYSVAKVESLEVYADGETASAFDVDEDLNATIPEDTMNDNSAKSRE
                     KIYHNRHENTYEEAHEDTYEDANEDTNEDTYEDTYEDTNELSFEKGDEIRYSRALDSE
                     SSHIYHEVSTIQEEASGRFTEKEVQDRSQKSSPEYSDVKQLPKKSWDIDDEEMLEILT
                     DINWDVDDDAEKLIEKLDIKMAEAEYSFNKGLLSLEKLGPSLVPFEENVDKECNKMNP
                     ILSLFLMEMGNVADDIEYVESQKNGLQVESANKKQLWDTLTELMNTVSLDDETLSQLL
                     NCPVSEKNLNKMEAQLVVLFKALKAISGERDENGYNLGEMRALKQRRETYEKVTKIFL
                     ERLVNEMEGKFKNISFGELSEDHLMSFLTRLLGYSSLTLFCKDISPSSYNDLIEKWNA
                     SISLVYKKMANSIIQNLKKSNYSLSAAEHHVTANQPGWRELLMNNDRKEQAEECDVPN
                     QEIILQLSEPIETLGKWCIFYQNFIDTFFHISSKLDFEQYIHQFNDPRLRITSLEGVK
                     TLQSDRGSASREFQLVSRIFQPIMTQMSSYVIDVSKSDKSLAPALMVFLEQKMKNLES
                     SNAEFLNAVLSRLFVQVKQLWLEHIDEEVVYIQRININFSSRIIFPVVLGFTLLINNS
                     KELIGYFQKRLKIQKDAPFEAIQCFDEACRKLGSAIAALMEEKSNTKNTVITSTPMTT
                     SNTSNLDRTITLLMNSDWLFEILNNLNAKGLFDSTIQAAKKMFDKEKDAYAVHLIEAA
                     MPKLTSFVNGAMNLVGNASGAQAADPSHWAAYSKNNLDNILASYSSKEIQVLVERLHD
                     HMESHFANEPSDSTREAICDKLWSCLQGHTVSVYLKLYTLIERHYKGTYVKFTKNDII
                     TAFESFKRVRPVKYNT"
     gene            <501263..>501640
                     /locus_tag="HG535_0F02520"
                     /db_xref="GeneID:59237500"
     mRNA            <501263..>501640
                     /locus_tag="HG535_0F02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289572.1"
                     /db_xref="GeneID:59237500"
     CDS             501263..501640
                     /locus_tag="HG535_0F02520"
                     /inference="similar to AA sequence:RefSeq:NP_010925.1"
                     /note="similar to Saccharomyces cerevisiae NTF2 (YER009W);
                     ancestral locus Anc_7.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145467.1"
                     /db_xref="GeneID:59237500"
                     /translation="MSLDFNALAQQFTEFYYNQFDNDRSQLGNLYRNESMLTFETSQL
                     QGSKDIVEKLVSLPFQRVTHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQV
                     FHLIPEGNSYYVFNDIFRLNYSA"
     gene            <501969..>503825
                     /locus_tag="HG535_0F02530"
                     /db_xref="GeneID:59237501"
     mRNA            <501969..>503825
                     /locus_tag="HG535_0F02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289573.1"
                     /db_xref="GeneID:59237501"
     CDS             501969..503825
                     /locus_tag="HG535_0F02530"
                     /inference="similar to AA sequence:RefSeq:NP_012268.3"
                     /note="similar to Saccharomyces cerevisiae YIR003W;
                     ancestral locus Anc_7.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145468.1"
                     /db_xref="GeneID:59237501"
                     /translation="MSTEQVPKIPNRPVRRRKTSEEIVPGSVETPSVVGTENSRVADE
                     TDSSIPGVPLHRPLKSQTAPDFPLIQSGQPPHEFKTEEGTGEEKTSSAPPTSAENTEK
                     VDTTEGLDDIAEGTSEQLRELQNLISRHGIIKRERPAGSNQAPEASADREYSEDPITG
                     ISKDSTASDLGLSGNLLSKASEGPVDKLSTPFAESRDDLSEYGIEAETASDTKPTRGQ
                     SAEVHVDAYPGILEEQEKEVQTEPAIPARPKKINKGMEKGKSGFVPEMRAPSTNLIPT
                     EETSSQQAQECGKNQPPIAEQKTGQSNPDNENQGEVPITKLNTDSTDSLSETVTVKKR
                     AAPPVPKKPSSRIAAFQEMLQKQQQEEIQQHSIPAKTNTSTQPEEPEITLKRPSQQVH
                     SLASNDKAKFAQNLNGIFALPGMTPQGNLPASLSQKLKQTSVKEEGLTSKDKSLSDIR
                     HNRSKGPRGRKLPTNISKIEKISTQDSNNEIEVFNTWSIVYTKERKTRMKPQDITSSR
                     REIPHHLADNLQGLISAGIQERRPSLSETQINELPLLRSEGGPMTNNAASFAVDESPK
                     SSHIDDYVSPDQHTKLSEELSLNQDDSTQEEPVKPVMISDEKETEASEETTD"
     gene            <504114..>505355
                     /locus_tag="HG535_0F02540"
                     /db_xref="GeneID:59237502"
     mRNA            <504114..>505355
                     /locus_tag="HG535_0F02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289574.1"
                     /db_xref="GeneID:59237502"
     CDS             504114..505355
                     /locus_tag="HG535_0F02540"
                     /inference="similar to AA sequence:RefSeq:NP_012269.1"
                     /note="similar to Saccharomyces cerevisiae DJP1 (YIR004W);
                     ancestral locus Anc_7.157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145469.1"
                     /db_xref="GeneID:59237502"
                     /translation="MVFSTEYYDILGIAPSATAVEIKKAYRKKSIEEHPDKNRQDPNA
                     TEKFQAISEAYQVLSNNDLRTNYDKYGKEKAIPQGGFEDAAEQFSVIFGGEAFEPYIG
                     ELTLLKNLQRQEELHAAEEAEKEKANSQDGKTDGKNVKVNQETGGTVSDEMLKLNIDG
                     GKQDVEAPKKSKLEAFEEELKVEKEKNVDVLAKKLVERLSILTESVYDADCKNSFEKK
                     FEEEGNLLKMESFGLDILHAIGDVYCERARIFLAASKPLGFGGFFQSMKASGGVFMDT
                     LRTVSAAIDAQSTMKELEKMKEVSESMGIKLDKHGNEISKPTPEELAVQEQLLMGKVL
                     SAAWYGSKYEIMSTLRLVCDKVLGDTGVDKETRLKRGETLLLLGKVFQRSYRTKVEQE
                     EAQIFEQLVAEATKKKRHSSK"
     gene            complement(<505727..>507097)
                     /locus_tag="HG535_0F02550"
                     /db_xref="GeneID:59237503"
     mRNA            complement(<505727..>507097)
                     /locus_tag="HG535_0F02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289575.1"
                     /db_xref="GeneID:59237503"
     CDS             complement(505727..507097)
                     /locus_tag="HG535_0F02550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145470.1"
                     /db_xref="GeneID:59237503"
                     /translation="MADIASDGATLLSYTSISNIFPVQSNDLENAHSASSCGTKCPIK
                     DDKTQKRSSFFKNKNGIKQGLKRKLWKKNEISNPKISTDDEESTSADGDSVFETSSIY
                     SDTESCTHKLRFWLNYEMSELSSKKCENFDMGLSTTFPTIPNPYATCHQIMDPLQDEA
                     HFPGSNEKENKRLTEALSGQHSEVLTKSLSGMPDVPQNQSKSQQRVEVQAECKTRCFE
                     SNKEREQERTQIQKEPDIIIYKRVRRHRIRFWRNKYLPEDSYKGNITELRISRITARI
                     LEARERATKIAFEAAIFARRRNTRKAIIYSCAVAAACFARVKHIDKTPGASHGSLATE
                     YMKASEEVAKASLTSRFYNKDYHKLRAKFNEHFQYKNNTDYFRAIVPIPVEDLDKNSG
                     AYQMYKRMQRIPRPPVLDNTVLQFHLDRLKKKDREFEIRYLKFLKETGMTRIEISIQK
                     KPLLSP"
     gene            <507955..>508579
                     /locus_tag="HG535_0F02560"
                     /db_xref="GeneID:59237504"
     mRNA            join(<507955..507965,508045..>508579)
                     /locus_tag="HG535_0F02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289576.1"
                     /db_xref="GeneID:59237504"
     CDS             join(507955..507965,508045..508579)
                     /locus_tag="HG535_0F02560"
                     /inference="similar to AA sequence:RefSeq:NP_010923.3"
                     /note="similar to Saccharomyces cerevisiae TMA20 (YER007C-
                     A); ancestral locus Anc_7.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145471.1"
                     /db_xref="GeneID:59237504"
                     /translation="MFRKFTKEDVHSRSKVKSSMQRTLKAKLVRQYPKLEDVIDELIP
                     KKSQIELIKCEDKIQLYTVDGEVFFFQKFDELIPSLKLVHKFPDAYPTVQVDRGAIKF
                     VLSGANIMCPGLTSAGAKLPPAPGYENDTIVVINAENKVSAMAVGKLMMSTEEIKSIN
                     KGHGVEMIHHLDDPLWNFTVE"
     gene            complement(<508647..>510131)
                     /locus_tag="HG535_0F02570"
                     /db_xref="GeneID:59237505"
     mRNA            complement(<508647..>510131)
                     /locus_tag="HG535_0F02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289577.1"
                     /db_xref="GeneID:59237505"
     CDS             complement(508647..510131)
                     /locus_tag="HG535_0F02570"
                     /inference="similar to AA sequence:RefSeq:NP_010922.1"
                     /note="similar to Saccharomyces cerevisiae PAC2 (YER007W);
                     ancestral locus Anc_7.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145472.1"
                     /db_xref="GeneID:59237505"
                     /translation="MMNYKVGDRLKIEGNFCTIRFVGVFPKWPSSTTYGVEWDNCNRG
                     KNCGVYEGKTYFKTASRFGGSFIKESALSKKVHTSVTFWQAIVNRYMSTSEWDIFYLG
                     SKKIEAVGIEKLNEKNKKLKSFTKMSLADHLICDALMDDGEMQLVKENLINLTELDLS
                     YNLLSNIDYLCQIISHLTNLQTIDLSGNRFVGRIPHNASYLFTQVKSLSLVDCGLDNE
                     QLRNLFMIFPSIVKLDISKNALLDIEDEKLVFPKSMKELDFNYNKLKHLSQNLFGPNI
                     EILNMSHNEIEFVEVGFSLCLKNIDLSYNRINCWEAVDQLNANFPQLYSLRVNKNPLL
                     WKDDISSFYEVIGRLNNIKIVNGSFLSDELRYEAELFFVSKLRDGETSLNKSLKRWEL
                     LSHRYRITPTSMVPMKTGLDQVLLEVSLVDQDKHKTEHLTVLSSYSVRYLKCICCKKL
                     NMNMFRIKIYHGVSSEVVDELDRDFYTLSHFNINDGDTIYLKTK"
     gene            complement(<510330..>511904)
                     /locus_tag="HG535_0F02580"
                     /db_xref="GeneID:59237506"
     mRNA            complement(<510330..>511904)
                     /locus_tag="HG535_0F02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289578.1"
                     /db_xref="GeneID:59237506"
     CDS             complement(510330..511904)
                     /locus_tag="HG535_0F02580"
                     /inference="similar to AA sequence:RefSeq:NP_010921.1"
                     /note="similar to Saccharomyces cerevisiae NUG1 (YER006W);
                     ancestral locus Anc_7.150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145473.1"
                     /db_xref="GeneID:59237506"
                     /translation="MGTRKRTSKRTSTRMREGIKKKAAAQRRKEKKIAKKDPTWKSRV
                     KKDPGIPANFPYKSRILEEIEVAKLKAQEQKELAKQQRLEAKQRLLEQGDGITDDGGE
                     ISEEDDANGLAALVESAQQAAKEYDNEGDDDIANEDLDIVNYEIDFYNHDDSTEQGES
                     ELDKSRKAYDKIFKTVVDASDVILYVLDARDPEGTRSRKIEQAVLQSQGKRLILILNK
                     VDLIPPYVLEQWLNVLKSSFPTIPLRSAPGATTSTSFNKKLTQTVTANALLEALKTYS
                     TNSNLKRSIVVGVIGYPNVGKSSVINALLSRRGGTSKACPVGNQAGVTTTMREVKVDN
                     KLKILDSPGICFPSESKKMPKVEKEAELALLSALPPKYIIDPYPSILMLVKRLSKSEE
                     MTNSFKKLYDLPAIPANDADTFTKHFLIHVARKRGRLSKGGIPNLASAGISVLNDWRD
                     GKILGWVLPKASKVLSDSQPSGSAIGNGVSSAPKKVEDTSIVTEWSKEFDLDGLFSSL
                     DDAISAEKEQDIVDHN"
     gene            complement(<513928..>515838)
                     /locus_tag="HG535_0F02590"
                     /db_xref="GeneID:59237507"
     mRNA            complement(<513928..>515838)
                     /locus_tag="HG535_0F02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289579.1"
                     /db_xref="GeneID:59237507"
     CDS             complement(513928..515838)
                     /locus_tag="HG535_0F02590"
                     /inference="similar to AA sequence:RefSeq:NP_010920.3"
                     /note="similar to Saccharomyces cerevisiae YND1 (YER005W);
                     ancestral locus Anc_7.149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145474.1"
                     /db_xref="GeneID:59237507"
                     /translation="MGEVERNCYGVVIDAGSSGSRIYVYKWEDPTFLLQHTDDQQLLH
                     SVPKIFQNKDWTYKVTPGLSSFKSRPKKAFSKHIKLLLEFASEIIPEEKLHSTPVFIQ
                     ATAGMRLLRKKERDDIIKSLCHGIKHSTAFLLENCESQIQVIDGEIEGLYGWLSLNYL
                     YGHFNSYEVSRQDHFTFGFMDMGGASTQIAFAPSDQAEVSKHSDDIASLSLRSINGDI
                     QEWNVFVSTWLGFGANEARRRYLVQLINSLPENSNNYHGDDYSRTEITDPCVPNGCKT
                     KFKYDGQEFKIYGSGNYEQCSKSIYPLLLKNMPCRDKPCLFNGVHAPQIDYYRDKFIG
                     TSEYWYTANDLFKLGGNYNFEEFSSHVKEFCRMDWETIKSNSEDGLYNSISVDLLIDS
                     CFKANWILNVLHEGFNLPRVGIDNIESPKDGNTHPLFQSADSVQENELSWTLGKILLY
                     ACGSIKAGIAGTTVGVKPSENSLLAHNFLPGSLREVRRDKDLSAGIFGFVIILLAIMI
                     WLKSRGKPSKHGWYKVVNVMKMKLRKFRHLASVPDPQSELELGSFDSNVTNEIFDENK
                     EGCKYRSKSMFNLPAEAIKDTKYPIRSMKTPSSPSSPIISTLPFPNNSKLVRPAFSLA
                     DFSKFKDAKFND"
     gene            complement(<516005..>516682)
                     /locus_tag="HG535_0F02600"
                     /db_xref="GeneID:59237508"
     mRNA            complement(<516005..>516682)
                     /locus_tag="HG535_0F02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289580.1"
                     /db_xref="GeneID:59237508"
     CDS             complement(516005..516682)
                     /locus_tag="HG535_0F02600"
                     /inference="similar to AA sequence:RefSeq:NP_010919.1"
                     /note="similar to Saccharomyces cerevisiae YER004W;
                     ancestral locus Anc_7.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145475.1"
                     /db_xref="GeneID:59237508"
                     /translation="MNAIVLGATGLCGRSLLKNCESSGQFSKVYTLGRRSLPFDSTSQ
                     QLVEKDSKKWCDIYPDDNIKIFFSGLGTTRGEAAGFDNQYRIDHDLNLEVAKVAKQKG
                     CSTIVIVSSSGANENSYFPYLKMKGEIERDIIALDFDRTIILRPGALLGNRSSDKGLL
                     NNIAVKVTGLFYRTRLEKCVGYPVYGDEVGKVGVHLALEKSIAIADKKVRIVESSEIL
                     KIANKIN"
     gene            <517631..>518995
                     /locus_tag="HG535_0F02610"
                     /db_xref="GeneID:59237509"
     mRNA            join(<517631..517661,517737..>518995)
                     /locus_tag="HG535_0F02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289581.1"
                     /db_xref="GeneID:59237509"
     CDS             join(517631..517661,517737..518995)
                     /locus_tag="HG535_0F02610"
                     /inference="similar to AA sequence:RefSeq:NP_010918.1"
                     /note="similar to Saccharomyces cerevisiae PMI40
                     (YER003C); ancestral locus Anc_7.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145476.1"
                     /db_xref="GeneID:59237509"
                     /translation="MTDKLFRLDAGYQQYDWGKIGSASAVAQYVAHSDPSVKIEKDKP
                     YAELWMGTHTNVPSYRHGDKKSLRDVIASEPDKMLGKGIVKKFGSKTELPFLFKVLSI
                     EKVLSIQAHPDKALGKILRAQDPKNYPDDNHKPEMAIAITDFEGLCGFKPLDEISDEL
                     KRVPELRALVGDETSEKFIQNAKPDAVTGSADDDQNKKLLQAVFDKVMNASEKDVTDN
                     AHLLVKRARDHPEDFNKSDSASLIIRLNEQFPYDIGLFCGCLLLNHCKLNAGEAMFLR
                     AKDPHAYINGDIIECMAASDNVVRAGFTPKFKDVKNLVEMLTYAYDPVEEQKMKPEDF
                     ERSSGAGESVCFNPPIQEFSIIQTTFTKGIGKRHFEPLAGPSIIITTKGAGDITSGVI
                     KLKAESGFVFFVAANTAIDLEAHDQDFVTYRAFVEPN"
     gene            complement(<519079..>519813)
                     /locus_tag="HG535_0F02620"
                     /db_xref="GeneID:59237510"
     mRNA            complement(<519079..>519813)
                     /locus_tag="HG535_0F02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289582.1"
                     /db_xref="GeneID:59237510"
     CDS             complement(519079..519813)
                     /locus_tag="HG535_0F02620"
                     /inference="similar to AA sequence:RefSeq:NP_010917.3"
                     /note="similar to Saccharomyces cerevisiae NOP16
                     (YER002W); ancestral locus Anc_7.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145477.1"
                     /db_xref="GeneID:59237510"
                     /translation="MTSVRKRKMRKSSLGKATRRTKDKQRKVNIRSNSIIAANWDHSL
                     TMSQNYKKLGLRSKLQKPAGGQETDLKNVVKKAPSIYPSFDQETDDEDQELETKNSSE
                     EEEKVNESELNSDGDFLAGKIPEGEARIQRDDSGNVVKVVYGTMKAFDIDQDVSEIKA
                     QLERDGKESKTEVIKLLEEIANRPVVTKGREQSEREVEWLERLYRKHGDNYKRMFFDK
                     ELNIYQQSEADLRRRVLKWKKLHNIN"
     gene            <520374..>521258
                     /locus_tag="HG535_0F02630"
                     /db_xref="GeneID:59237511"
     mRNA            <520374..>521258
                     /locus_tag="HG535_0F02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289583.1"
                     /db_xref="GeneID:59237511"
     CDS             520374..521258
                     /locus_tag="HG535_0F02630"
                     /inference="similar to AA sequence:RefSeq:NP_012266.1"
                     /note="similar to Saccharomyces cerevisiae SGN1 (YIR001C);
                     ancestral locus Anc_7.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145478.1"
                     /db_xref="GeneID:59237511"
                     /translation="MNSQNDGKHGARPTDDEHNILDTADETTDEERGHVDVLSQEVKK
                     LSVNDPRVSVNRNAAFTDSSSENTVPQIQRPSVTDTTAIHDSKRLTKEERYILQVETD
                     SRSIFVGNITSDATPEIIEEHFHTCGTPKRITLLYDKNTGVPKGYAYVEFEDQLSRER
                     ALVYNGSEMKGRTLNVYKKRTNLPAYQRSFPNYKSKFYSQQQWNLPYNGGFQQLQDIP
                     YYHMPYQFSPYNQGSEARHRNRKVNYKGNRKANTYNKVDGNHNNGGNQEAVPLVQHTL
                     SNRSENVEKQSEEIVSNH"
     gene            <521736..>522434
                     /locus_tag="HG535_0F02640"
                     /db_xref="GeneID:59237512"
     mRNA            <521736..>522434
                     /locus_tag="HG535_0F02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289584.1"
                     /db_xref="GeneID:59237512"
     CDS             521736..522434
                     /locus_tag="HG535_0F02640"
                     /inference="similar to AA sequence:RefSeq:NP_010915.1"
                     /note="similar to Saccharomyces cerevisiae YEL001C;
                     ancestral locus Anc_7.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145479.1"
                     /db_xref="GeneID:59237512"
                     /translation="MLAIQLLCSFFLSFFLVNATAIEETIASFSDKNTSDDHVDFTES
                     SQEKPQHVDIDVTYDILEKPELKFDSPVEFAAEEYATFNFTLKNNEEVNITVVGISGH
                     VISNPEGYQVANISERAVGPYEVPVNGTLNFQTAVQLILPEGSFYVAPLVAVVQDQKP
                     MRLGIRPLSIFVSPPPMSFFNPAFISVQVILALLIAVLVVPLMNYFKTDSKKAKAVKP
                     TSVDESWLPETYKK"
     gene            complement(<522523..>524085)
                     /locus_tag="HG535_0F02650"
                     /db_xref="GeneID:59237513"
     mRNA            complement(<522523..>524085)
                     /locus_tag="HG535_0F02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289585.1"
                     /db_xref="GeneID:59237513"
     CDS             complement(522523..524085)
                     /locus_tag="HG535_0F02650"
                     /inference="similar to AA sequence:RefSeq:NP_012265.3"
                     /note="similar to Saccharomyces cerevisiae YIL001W;
                     ancestral locus Anc_7.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145480.1"
                     /db_xref="GeneID:59237513"
                     /translation="MSKNFADLCYACRVGDTDNVDRLISTGVNLNAVDQFDNSPLFLA
                     SLCGHETVVKLLLSRGAVCDRDRYEGARCIYGALTDSIRDILLRYDISKAVDVNQPFT
                     MHISSLIKDDFFLDTCDLSWSFHDNIRAIECLQLHKFILASRCAQLNLGLMSNWTGRH
                     NFELPKGCSMKEMKILVKFIYLLPVLHEIDYEQYSSLIALSREWGMELLAEFLNKAQH
                     ILDPSEKSMFMATFQYKFMELAREQLCTFVNDAILKSSIILNSHEELDQGQNIILKEC
                     LAFPDVLLMVKNLKDEQRVFPCHLAILSRAHYFKLMFTLPFLERTLYKSQKKSKDSGN
                     SSPLPLISLPSCDFEVAVIIIRYLYYDSSEIPWYNAIDVLLMADMLMEDRLKSMAAVV
                     LTQSKELLKCCSIFDILSVAWETRMERLEHFVAKVIAQKIRKYSNDPALKEAILQSSK
                     RISARQETDTIELVDDIRFYLLEKYAFELEDIEVLSSEQDLGLLKSSGILEYQQDMSV
                     IENILDALSLQA"
     gene            <524307..>527129
                     /locus_tag="HG535_0F02660"
                     /db_xref="GeneID:59237514"
     mRNA            <524307..>527129
                     /locus_tag="HG535_0F02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289586.1"
                     /db_xref="GeneID:59237514"
     CDS             524307..527129
                     /locus_tag="HG535_0F02660"
                     /inference="similar to AA sequence:RefSeq:NP_012264.3"
                     /note="similar to Saccharomyces cerevisiae INP51
                     (YIL002C); ancestral locus Anc_7.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145481.1"
                     /db_xref="GeneID:59237514"
                     /translation="MKLFVGKNPRSIVISSCGYHLSFQRVLVPVGQRQEQQQAQNIKT
                     PTLSIRVIGDDEIIDSQKYTEVKSRIFHGLLGLLSIHGNLYIGVISGIQKVGFPRWKA
                     ENSSIVSSENVYKVLDVDFHSLDSEVFDHLFIEMSEQNHDRLIHEHPCGSLKKLFSDG
                     TFFFSRDFDISNVLKNHGLAHSLDYTIDNQDLNYIWNANLISEIVNWRSRLSVDERHL
                     ADGEFFTFLMRGFYKTVAINSEVSPATITLISRISAENKQDSLELEGIDEDGKVSSFV
                     ETEIIVTTETLIFSYTQISGNAPLFWEVVDSQLLYGHKLKLTKSTEHNQAAFDRHFDN
                     LASKYGVVSIVNLVKSRSESQEALASAYKNCAEIKGLKITNVEYNMTKTPNKLLYLLK
                     QDIYEFGAFAYDIKKGIYVGKQTGVLRISSFNSIERSTIVEQLVSREVLELAGKEASM
                     DVTITFVQVHDKLWSENIYWLGRTYSKYYKSPGKYRKVYGKLFGSRIKLYDPLHSTII
                     RYLKQKKASYTFEKDITIFAGTFNVSGKIPPEDIKDWICPKGSSNCKPPPDLYAIGLE
                     EVVELTPGHMLSTDPYIKQYWEKKVLSVINTLYLDKKYGCVWSSQLGGVLLMLFISET
                     EHQKVKHIEGDMKKTGFGGMTSNKGAVAVSFKYSATRFCLLVSHLAAGLENVEQRHND
                     FKTIVKNIRFSRRLRIKDHDAIIWMGDFNYRILMTNDEVRKLITAQEFSKLFEKDQLN
                     QQMIAGEAFPYYHEMEIDFPPTYKFDPGTTTYDTSEKMRIPAWTDRILSRGSVLKQTE
                     YGCAQNLLFSDHRPVYAIFQARVTVLDEIKKAALSAEIYKKISNKLSNMNDEEKLTLL
                     NDGSLILDPESVVFADTDNSGILMKHRGRLPPPSSDQKKWWIGDGKQVNVILDVDTEK
                     LVLNPMRNVNPFFEEQEGVPLYVPKS"
     gene            complement(<527260..>527502)
                     /locus_tag="HG535_0F02670"
                     /db_xref="GeneID:59237515"
     mRNA            complement(<527260..>527502)
                     /locus_tag="HG535_0F02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289587.1"
                     /db_xref="GeneID:59237515"
     CDS             complement(527260..527502)
                     /locus_tag="HG535_0F02670"
                     /inference="similar to AA sequence:RefSeq:NP_878098.1"
                     /note="similar to Saccharomyces cerevisiae YIL002W-A;
                     ancestral locus Anc_7.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145482.1"
                     /db_xref="GeneID:59237515"
                     /translation="MKADIQELEGFSTVELARLYQGLQEGEQTADDMEKRLDLMEKKM
                     AELLEQVEGMQQLEVRQDSDSRDNQIEKDMERTDDI"
     gene            <527755..>529041
                     /locus_tag="HG535_0F02680"
                     /db_xref="GeneID:59237516"
     mRNA            <527755..>529041
                     /locus_tag="HG535_0F02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289588.1"
                     /db_xref="GeneID:59237516"
     CDS             527755..529041
                     /locus_tag="HG535_0F02680"
                     /inference="similar to AA sequence:RefSeq:NP_010914.3"
                     /note="similar to Saccharomyces cerevisiae WBP1 (YEL002C);
                     ancestral locus Anc_7.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145483.1"
                     /db_xref="GeneID:59237516"
                     /translation="MLSIFTILCLSLCFFSNALSIHGSKTLVVFDDRLTQLDEFSYLF
                     DSLKERSYELEYLSVANDSGEIELYDGETPLYNNLMIFPIKGKVLNRKLTVDSLLNFY
                     NNDGNIFVITSPDGVAEPARMFLNELGIYPSPKDHVVVDYFQEVPSSLVISTSGIESK
                     DIFEDIVNDSIIIENSSAALLDNRDQIIPFIAAPRTSFTEGKGKESWTTGSQGFLAAG
                     FQSLKNSRVAWIGSDEFLKNENQNSNGKFIQGVVKWNFKEKNVIKITESVHSHADGTP
                     YELLPYKIKDSVRYDVGISEWDGEKWVPFLATDLQFELKMIDPYYRLPLIPLNVDEST
                     QYYSTGNFSLPDHHGVFTFQIDYKRPGFSFISTSDVKAVRHLAHDEYLRSWDITNSRV
                     YLTTVFVLIFVWVLFVIFFISTTPVNKTMEIHKKTN"
     gene            complement(<529156..>529553)
                     /locus_tag="HG535_0F02690"
                     /db_xref="GeneID:59237517"
     mRNA            complement(join(<529156..529472,529535..>529553))
                     /locus_tag="HG535_0F02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289589.1"
                     /db_xref="GeneID:59237517"
     CDS             complement(join(529156..529472,529535..529553))
                     /locus_tag="HG535_0F02690"
                     /inference="similar to AA sequence:RefSeq:NP_010913.2"
                     /note="similar to Saccharomyces cerevisiae GIM4 (YEL003W);
                     ancestral locus Anc_7.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145484.1"
                     /db_xref="GeneID:59237517"
                     /translation="MDQVSNSFQIKYNEYKQILEEMQNKIIELGHDKDEHEIVLETLN
                     SSESGRKCYRMVGGALVESDVKTTVPILQTKKDKLTVTISSMKAELIKTAQEFEKWKK
                     DNKIQVVTQ"
     gene            complement(<529702..>530727)
                     /locus_tag="HG535_0F02700"
                     /db_xref="GeneID:59237518"
     mRNA            complement(<529702..>530727)
                     /locus_tag="HG535_0F02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289590.1"
                     /db_xref="GeneID:59237518"
     CDS             complement(529702..530727)
                     /locus_tag="HG535_0F02700"
                     /inference="similar to AA sequence:RefSeq:NP_010912.1"
                     /note="similar to Saccharomyces cerevisiae YEA4 (YEL004W);
                     ancestral locus Anc_7.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145485.1"
                     /db_xref="GeneID:59237518"
                     /translation="MFQSALFSVFTVFGGCCSNVLTLESIVSTHELPIGNTLTLFQFL
                     LVTIEGLYSFGDFKRGFPFLKPMQIPLKVYVVSVLLFFVSSITNNSVFNYGISVPLHI
                     VFRSSGIVITMLMSWLFNNKRYSRLQVFSGLLLTIGTIITSVFQDGNVSCGNRQPFSD
                     LKRDQMVFRLKFLKGIALLTLSSVSSSSLSIYTERAYQKYGKHWRENLFYTHALSLPL
                     FLIQYRQLLKQLFVLKESDKKTILTIYNVPLTLDKKRLLLANIFSQRVCIKGVNILAS
                     KTNALTLSVVLLIRKFLSLLLSLYIFSSELSLTSYVGIALVFTGALVYAIAPNIESSN
                     ATHKKEN"
     gene            <530921..>531769
                     /locus_tag="HG535_0F02710"
                     /db_xref="GeneID:59237519"
     mRNA            <530921..>531769
                     /locus_tag="HG535_0F02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289591.1"
                     /db_xref="GeneID:59237519"
     CDS             530921..531769
                     /locus_tag="HG535_0F02710"
                     /inference="similar to AA sequence:RefSeq:NP_010911.3"
                     /note="similar to Saccharomyces cerevisiae VAB2 (YEL005C);
                     ancestral locus Anc_7.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145486.1"
                     /db_xref="GeneID:59237519"
                     /translation="MRKRARYSFVSVANENAYKELRQLNRLPSNKRLVQNSIFYAVNK
                     ELLQVKEGVRAVYDVIAKDTELEDEQMNNVEIQLKKSLKKVRRIYKKTQEYRSENEKY
                     EASDLIDSAAIGLNSLDETARRLEVTIDRIVDKMTQIDATFPEKNRLLSEEIFNQHHY
                     PLFFEHMRVKCPQVLKKRPLGNEFYSRALTSEGPFFCSPNTNANDPSLRSEDEQIAES
                     IEETISRYRRTKTKEHGTSFASKFDAFIPPTLREASLPVISTTFETVSTKSFDPSLSY
                     ETDDVK"
     gene            complement(<531824..>532675)
                     /locus_tag="HG535_0F02720"
                     /db_xref="GeneID:59237520"
     mRNA            complement(<531824..>532675)
                     /locus_tag="HG535_0F02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289592.1"
                     /db_xref="GeneID:59237520"
     CDS             complement(531824..532675)
                     /locus_tag="HG535_0F02720"
                     /inference="similar to AA sequence:RefSeq:NP_012263.1"
                     /note="similar to Saccharomyces cerevisiae CFD1 (YIL003W);
                     ancestral locus Anc_7.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145487.1"
                     /db_xref="GeneID:59237520"
                     /translation="MEAKEGLPTVSLDKVKHIILILSGKGGVGKSSVTTQTALTLFSM
                     GYKVGVLDIDLTGPSLPRMFGLEKESILQSARGWVPVAMKSPEDTNISGSLSVISLGF
                     LLDNRGNSVVWRGPKKAAMIKQFISDVCWGELDYLLIDTPPGTSDEHISIAEQLKWAN
                     PDGAIIVTTPQSVATADVKKEINFCKKVELNILGIIENMSGFVCPHCSECTNIFSSGG
                     GEKLAAEFSVPYLGNIPIDPKFVELIENQHSYETSLTDLYKESALFEVFKPIITKVLN
                     EKIQSRA"
     gene            <532963..>533481
                     /locus_tag="HG535_0F02730"
                     /db_xref="GeneID:59237521"
     mRNA            join(<532963..532973,533046..>533481)
                     /locus_tag="HG535_0F02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289593.1"
                     /db_xref="GeneID:59237521"
     CDS             join(532963..532973,533046..533481)
                     /locus_tag="HG535_0F02730"
                     /inference="similar to AA sequence:RefSeq:NP_012262.3"
                     /note="similar to Saccharomyces cerevisiae BET1 (YIL004C);
                     ancestral locus Anc_7.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145488.1"
                     /db_xref="GeneID:59237521"
                     /translation="MNAGYVDNTLHQRDTNRTRLFAVASELNPEANKNTDYVSPYVSK
                     SSKKGMSYSQNSLAQLESQSDEQVGLMGQKLQALKSLSLKMGEEIRGSNQTIDTLGDT
                     FQNTASKLKKTFGNMMTMARNSKINIKTWLLIFLLVGLLFFWVWIT"
     gene            complement(<533648..>535750)
                     /locus_tag="HG535_0F02740"
                     /db_xref="GeneID:59237522"
     mRNA            complement(<533648..>535750)
                     /locus_tag="HG535_0F02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289594.1"
                     /db_xref="GeneID:59237522"
     CDS             complement(533648..535750)
                     /locus_tag="HG535_0F02740"
                     /inference="similar to AA sequence:RefSeq:NP_012261.1"
                     /note="similar to Saccharomyces cerevisiae EPS1 (YIL005W);
                     ancestral locus Anc_7.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145489.1"
                     /db_xref="GeneID:59237522"
                     /translation="MTPTTYSTMWVLWILTMMLPRFVHGFESYDATMVEFPAPLTESD
                     FNPKAGFQVIEFFSPYCPHCKSLAPIWKDSWETFYEEGRRQNISLLQVDCVESGDLCK
                     SEKIMGFPSIRLYGPNGFIESFPKYRTMSKDNILDFARQAVDNPDDMEDQQIGSLSEL
                     VTAEKFANLLAGKGQQPYLLSFWPAKNARSADGNIDFKNCDECDTFQKGWKTLSVKLA
                     ALDISTGHLNCESSAAICTNLGFSSLVKITNHRVDRIPKVALVVPEKTTNNFFTYDGP
                     FSTKMSVYEDFAKRTYFNSRIMTISSEEIVEITQKEYKLSGTHEKKPQKLHLVYSYNR
                     ETAVPEDLQFLQSLVDPVSKISNAYLYITEEDLTPVVVQSFESMYEMINYNTSEPEKR
                     LKEEYIDFNIMPDNPNFFIFRDGDKIPHTFQGYSTTELRNTDTIMDWVREYSLPMVNE
                     VTPDNFAQILAFNSEMYDGVAIILINTIETELTNNSNEHLDKLRVGYYDYEHVRMGKM
                     IEDVSVKRERRLKKANRLKEKGYKKSTILEAAREEILHEDNKKVIISFLDISKYSSIL
                     NKLGVTHVLSEDDIGKVILYDKYTKSYHKKDIFGNDFIAEPYTIRETLSSVFLSQKPA
                     RLSRIAERLFGPLFCESLKNFDSLVGVSGYAIFIVLILGCLKGIKICRRKRIGKRYKA
                     KRDVIGLLGKNGNKKSLD"
     gene            complement(<535939..>537060)
                     /locus_tag="HG535_0F02750"
                     /db_xref="GeneID:59237523"
     mRNA            complement(<535939..>537060)
                     /locus_tag="HG535_0F02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289595.1"
                     /db_xref="GeneID:59237523"
     CDS             complement(535939..537060)
                     /locus_tag="HG535_0F02750"
                     /inference="similar to AA sequence:RefSeq:NP_010910.1"
                     /note="similar to Saccharomyces cerevisiae YEA6 (YEL006W)
                     and YIA6 (YIL006W); ancestral locus Anc_7.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145490.1"
                     /db_xref="GeneID:59237523"
                     /translation="MTNDEIFSDCPDYRPSSEVHEGFLVPDGISPLSSSDVIEPMRKV
                     ASLPDDSLHNKQRARSNGGLFSTHLTDTKITALSGALSGFISGIVVCPLDVAKTRLQA
                     QGLQSSGENKYYHGLVGTFRTIVRDEGVKGLYKGLVPIIMGYFPTWMIYFSFYEVCKD
                     FYPRIFPHWDFASYSCSAITAGAVSTIVTNPIWVIKTRLMLQTHVSHHPTHYKGTFDA
                     FRKIYKQEGFKSFYAGLVPSFLGLLHVAIHFPVYEKLKVAFNCYNLKDNETTKRQDQT
                     LDLKKLIMASCVSKMTASLITYPHEILRTRMQLKSDLPNSVQHRLIPLIRATFHSEGF
                     RGFYSGFTTNLVRTVPASAIALVSFEYVRNHLTNINEAK"
     gene            complement(<537860..>539785)
                     /locus_tag="HG535_0F02760"
                     /db_xref="GeneID:59237524"
     mRNA            complement(<537860..>539785)
                     /locus_tag="HG535_0F02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289596.1"
                     /db_xref="GeneID:59237524"
     CDS             complement(537860..539785)
                     /locus_tag="HG535_0F02760"
                     /inference="similar to AA sequence:RefSeq:NP_010909.1"
                     /note="similar to Saccharomyces cerevisiae YEL007W;
                     ancestral locus Anc_7.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145491.1"
                     /db_xref="GeneID:59237524"
                     /translation="MDIEPTFKGYIEDENDALLILQATLDGSLKHIPRRPYEIERPYL
                     ITSGSIFIFIEEVSGIKRWTDGVSWSPSRISGKFLIYRELDKSIGHQPSSLNSNSNSS
                     LKKTESSESPTLSLTPRIKLPPILATPVSTGSSFSSNVSPKSSSPPTIAAATTSSSSS
                     SSPTQSATKMIGYISGGNSNGKYTGFIKKTMSVKLRNSQKNSIETLHMVSYYNLDDLS
                     KNSLVRPSNSDFFKKIRPCRELSIAMENTALGNSNKSLSTFQMSLNSNNSSNNNINKT
                     NNSNSPLFPAQKLKVNAINKNNIEYLTSTSNSNAVNSNTAGSTISVDYNATRQQNDPQ
                     SLPFVKNRSFHSIFQNDENIPTSLPTPNSNSNSNLNPSNPNETHFQRIGPASKPLTYQ
                     PNNTPQQPQAGAPPTYYDSGNQSHSYYQPIDSNPSSNLNSISNSNSNPNPNPNLHGNS
                     VQFYPINARLPYYQTASKIVPYSNTTTAGNNNYQIQGLSNNTNVNITGLANGNELGMM
                     VSPSLAHSYANFSNYTSQPTSLPNINYHQPPQIQQQAIHQQQSMPFYQHHMALHPLPV
                     QTHTYSQPHPIGPSPSLQFSSPSMNASPFLRHPTSTGNSSAIYNHASAGGNTKPFLMS
                     INSSGKSIESPNTVLPQ"
     gene            <542682..>543545
                     /locus_tag="HG535_0F02770"
                     /db_xref="GeneID:59237525"
     mRNA            <542682..>543545
                     /locus_tag="HG535_0F02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289597.1"
                     /db_xref="GeneID:59237525"
     CDS             542682..543545
                     /locus_tag="HG535_0F02770"
                     /inference="similar to AA sequence:RefSeq:NP_010907.3"
                     /note="similar to Saccharomyces cerevisiae GCN4 (YEL009C);
                     ancestral locus Anc_7.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145492.1"
                     /db_xref="GeneID:59237525"
                     /translation="MFNSSSIMQAQSLFTHNLISDIESSSNAAGVGASVPGDVGAMAQ
                     VYQPVLGELVFGKFIKDEDANGGVVDEDDSPLLLDDSTPCTATSSLESAVDEFFFKSE
                     NPTPMFEFEDPTPSGQWTSLFDDNITITQKDVQMATDLGVEIDENVDKNHEERQKSQE
                     SLVIPKSSFLPTPVIEEDKLFKSPSTTQSSSIGTNGGVKSNKISKKIDHLGVVSYNRK
                     NRSVPLSPVIAESDDPTATKRARNTEAARRSRARKLMRMTQLEDKVEELLTKNSQLEE
                     EIKRLTSLLNR"
     gene            <543736..>544392
                     /locus_tag="HG535_0F02780"
                     /db_xref="GeneID:59237526"
     mRNA            <543736..>544392
                     /locus_tag="HG535_0F02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289598.1"
                     /db_xref="GeneID:59237526"
     CDS             543736..544392
                     /locus_tag="HG535_0F02780"
                     /inference="similar to AA sequence:RefSeq:NP_012259.3"
                     /note="similar to Saccharomyces cerevisiae NAS2 (YIL007C);
                     ancestral locus Anc_7.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145493.1"
                     /db_xref="GeneID:59237526"
                     /translation="MNEQPLHSQLSNLNIDPTIHERIKKLPDLTINEIDLLKTEIESE
                     LHKNFSILKEQNLTMESPLVTSDGFPDPNIDVLQIRIVKRNINMLRNDLNNVITTCAL
                     KLNRHFGKDKNQNQQESLRKGENFDHIIPFAQIYDVIEGGPIFIAGCLSGDELVLIGN
                     LNAGTYLNLNNISNYILQNENKKVTIRIRRDKKLLDMILIPTRQWNGQGLLGCKLKLL
                     "
     gene            complement(<544412..>544708)
                     /locus_tag="HG535_0F02790"
                     /db_xref="GeneID:59237527"
     mRNA            complement(<544412..>544708)
                     /locus_tag="HG535_0F02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289599.1"
                     /db_xref="GeneID:59237527"
     CDS             complement(544412..544708)
                     /locus_tag="HG535_0F02790"
                     /inference="similar to AA sequence:RefSeq:NP_012258.3"
                     /note="similar to Saccharomyces cerevisiae URM1 (YIL008W);
                     ancestral locus Anc_7.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145494.1"
                     /db_xref="GeneID:59237527"
                     /translation="MVKVKVEFMGGLDVIFNKQRMHQVLIDGGEVTIKDLIDYIVAEM
                     ISNKNDIGVFVENGTIRPGILTLINDADWELEGGEEYVLEDGDIISFTSTLHGG"
     gene            545634..545705
                     /locus_tag="HG535_0Ftrna8R"
                     /db_xref="GeneID:59237905"
     tRNA            545634..545705
                     /locus_tag="HG535_0Ftrna8R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:59237905"
     gene            546587..546687
                     /locus_tag="HG535_0Ftrna4W"
                     /db_xref="GeneID:59237891"
     tRNA            join(546587..546623,546651..546687)
                     /locus_tag="HG535_0Ftrna4W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:59237891"
     gene            complement(<547022..>548734)
                     /locus_tag="HG535_0F02800"
                     /db_xref="GeneID:59237528"
     mRNA            complement(<547022..>548734)
                     /locus_tag="HG535_0F02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289600.1"
                     /db_xref="GeneID:59237528"
     CDS             complement(547022..548734)
                     /locus_tag="HG535_0F02800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145495.1"
                     /db_xref="GeneID:59237528"
                     /translation="MSSADHSAVSTPVQPDTVQPTYSNNSGASTPVLNEPLDKLKESQ
                     VSPGDWEEKDASLPVRPFSDYITVCLLCLCVAFGGFMFGWDTGTISGFINQTDFLRRF
                     GSTNSEGVRYLSQVRTGLVVSIFNIGCALGGIILSKLGDVYGRKFGLSAVVGIYIIGI
                     IIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLIGESAPKHLRGPLVSCYQLMITAG
                     IFLGYCTNYGTRNYSNSVQWRVPLGLGFAWSLFMLGGLTRVPESPRYLCEVGKVEEAK
                     RSLAISNKVSVDDPSLLAELDIIMSGVEAEKLAGSASWGELFSTKTKVFQRLLMGILI
                     QALQQLTGNNYFFYYGTSIFGSVGLEDSFQTSIIIGVINFASTFGALYTVEHFGRRLC
                     LLWGAATMMACMVIYASVGVTRLHPNGMDAPTSQGAGNCMICFTMFYIFCYALTWAPI
                     AWVVTAEVFPLRVKSKCMSLASASNWLWGFLISFFTPFITGAINFYYGYVFVGCLCFS
                     FFYVFFFIPESKGLTLEEINEMWLEGVLPWKSADWVPAAKRGAGYDAEELKHDDKPWY
                     KRMI"
     gene            complement(<550268..>552217)
                     /locus_tag="HG535_0F02810"
                     /db_xref="GeneID:59237529"
     mRNA            complement(<550268..>552217)
                     /locus_tag="HG535_0F02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289601.1"
                     /db_xref="GeneID:59237529"
     CDS             complement(550268..552217)
                     /locus_tag="HG535_0F02810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145496.1"
                     /db_xref="GeneID:59237529"
                     /translation="MKKWDNMDRACDSCRLKKLKCSKTRPKCAKCLKNGWECCYSPKT
                     RRSPLTRVHLTEVESRLDGLEQLFYELFPGVDLEKNLKGGGATKKLKELSQRITLVNE
                     DGEELFNEFEASTVIPYFDSSAQEQKWIMDSNSGGKSIPPDSLPKDPLLGFDWNERKN
                     TLTGNDGAGFLNTEANNRGYYGQGSSSASLKSVGFDMTLFSSQSPSYSPASISDPSLL
                     GSTHAIAKFIESYFINFHPYCPLVNHDRFMRQHNASPDQMEPRLFNQWQVLFNIVLAI
                     GAWGIAGESTDIDLFYYNNAKSHLSRIAFEVGSLRLVISFYLLSRYTEWRQKPNSSYA
                     YHGQALRMAISLGLHKELSPTVNNTGVKEQRRRIWCCLYLQEYHLALVQGRPLSYLFS
                     RDEMSISYPSSMNDNEHWTTEPSIYLGCVGRARMLDQFSKLWYGKNKQSRNAINCLKL
                     CDSLETTFKEMPKFMQADISSLVLSSFLQEYPWLSYMRYSLSWQHLWLRIYALRELSV
                     NSEANSEGENNNTTYQRCRILLVDAAQKTIASITNFINNNSLTPFFAWNCTFYLFNAA
                     LVPLTSLITQPSSNERHRWIFQLKSVVKALEILSTYKISSCKRYIQTIDQLCGSMLLV
                     SPDDMSQTSELIDTPLSDRSATTGF"
     gene            complement(<552936..>555038)
                     /locus_tag="HG535_0F02820"
                     /db_xref="GeneID:59237530"
     mRNA            complement(<552936..>555038)
                     /locus_tag="HG535_0F02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289602.1"
                     /db_xref="GeneID:59237530"
     CDS             complement(552936..555038)
                     /locus_tag="HG535_0F02820"
                     /inference="similar to AA sequence:RefSeq:NP_009575.1"
                     /note="similar to Saccharomyces cerevisiae GAL10
                     (YBR019C); ancestral locus Anc_3.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145497.1"
                     /db_xref="GeneID:59237530"
                     /translation="MTQSEKTSKKYVLVTGGAGYIGSHTVAELIENGYECVVVDNLCN
                     SSYESVARLQLLTDHYIPFCEVDLCDREGLAKVFEEYNIDSVIHFAGLKAVGESTQIP
                     LRYFHNNILGTLVLLELMEQYNVSKLVFSSSATVYGDATRFPNMIPIPEECPLGPTNP
                     YGHTKFTIEKILNDLYLSNKSMWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLPYMA
                     QVAVGRREKLYVFGDDYETRDGTPIRDYIHVVDLAKGHIAALKYLDHNASEGICREWN
                     LGSGTGSTVFEVHRAFCNASGKDIPYEVTGRRAGDVVNLTAKPDRAERELKWHTELDV
                     GMACSDLWKWATGNPYGYQLKGVEAKFGEEVNDYESRFITIGSGRRFEATLANVGATL
                     VDLKVDGQSVVLGYPEGKDYYCKDTCYVGATIGRYANRIAKGTFSLEDGVHKLTVNNA
                     GNSNHSSVSSFHLKKFMGPLVRCPSEDVFTAEFLLLDDHSETNEFPGDLHVSVKYTLN
                     VAEKTLDIGYQAQLLNGESTPINMTNHTYFNLNKVHNEDSFRGTEIKAVSNKSVDVDS
                     TGIPTGKIVDREIATFNSVKPTVLRKDGPAYDYAFIVEENKNLKGTDSTRDNELVSVV
                     TATNPESGISIEVLTTEPSFQLYTGDFLCAGFAPRSGFAVEPGRYVDAVNQKEWKDTV
                     ILKRGEVYGSRIQYKFKE"
     gene            complement(<555216..>555701)
                     /locus_tag="HG535_0F02830"
                     /db_xref="GeneID:59237531"
     mRNA            complement(<555216..>555701)
                     /locus_tag="HG535_0F02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289603.1"
                     /db_xref="GeneID:59237531"
     CDS             complement(555216..555701)
                     /locus_tag="HG535_0F02830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145498.1"
                     /db_xref="GeneID:59237531"
                     /translation="MNQERNTVVRKNWPKTDYGKEIVASTSTTQRNATSTTDCGGSWC
                     GGGGGLATPGSETAHKAVLCSMITSINAPEHYRKQLHSFSGAYTSPNDNSMACFLFAG
                     GFQRCVRRNSSRIQARSTDFRKTAEFNNPVGALWTEGTWKKKECPEFRNAKMRWDPTM
                     E"
     gene            <555985..>557550
                     /locus_tag="HG535_0F02840"
                     /db_xref="GeneID:59237532"
     mRNA            <555985..>557550
                     /locus_tag="HG535_0F02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289604.1"
                     /db_xref="GeneID:59237532"
     CDS             555985..557550
                     /locus_tag="HG535_0F02840"
                     /inference="similar to AA sequence:RefSeq:NP_009576.1"
                     /note="similar to Saccharomyces cerevisiae GAL1 (YBR020W)
                     and GAL3 (YDR009W); ancestral locus Anc_3.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145499.1"
                     /db_xref="GeneID:59237532"
                     /translation="MSVPVLKVSSSSGLSQASIDKCLSIESKFAKAFGAKPDFISRSP
                     GRVNLIGEHIDYCDFSVLPMAIDVDMLCAVKVVKSSGKISLSNDDSRFGNRDIELPKD
                     GSFVAIDPSVSDWSNYFKCGLHVAHSYLKQVAPDRFEKAPLTGLEVFCQGNVPTGGGL
                     SSSAAFICATALAVVRANMGAGYSMSQQDLTKITVVAEHYLGVNNGGMDQAASVCGKD
                     DHALYVEFKPELKATAFKFPKLKSHEIKFVIANTLVVANKYETAPTNYNLRVVEVTIA
                     ANVLAAKYGVSLKNPHKISGDEDTAKGNLRDFMNAYFAKYQNATAPWDGGIDTGIEYL
                     TAMLKLVEETLGSKPEGFTVHEAATALNISDEEFAREYLSIFPVRFDTLKLYQRAKHV
                     YSEALRVLRALRLMTSSTQFSSDDEFFEQFGALMNESQESCDKLYNCSCPETDQICTI
                     ALANGAFGSRLTGAGFGGSTVSLVHGSDVEKVKKALIDKFYKVKYPNITKEQLDEAII
                     VSKPTAGSCLYEL"
     gene            complement(<557955..>559049)
                     /locus_tag="HG535_0F02850"
                     /db_xref="GeneID:59237533"
     mRNA            complement(<557955..>559049)
                     /locus_tag="HG535_0F02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289605.1"
                     /db_xref="GeneID:59237533"
     CDS             complement(557955..559049)
                     /locus_tag="HG535_0F02850"
                     /inference="similar to AA sequence:RefSeq:NP_009574.1"
                     /note="similar to Saccharomyces cerevisiae GAL7 (YBR018C);
                     ancestral locus Anc_3.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145500.1"
                     /db_xref="GeneID:59237533"
                     /translation="MTAEAFDFDDHSHRRYNPLTDSWVLVSPHRAKRPWLGQQEAPTK
                     NDAPEYDEKCYLCPGNKRATGGVNPVYENTYIFQNDFAAVKLDQPSLPKSTGNSLKER
                     LCKAESVRGNCFVICFSPKHNLTIPQMTVPELVKVVEAWQTLYTNLAKDAVTEGKPYK
                     YLQIFENKGTAMGCSNLHPHGQAWCLEAIPSEVSKELKSFKKYKSQYGTDLLGDYVAL
                     ELEERSRLVLENDTFIVVVPYWAVWPFETMIVSKKKIASVDKFNDAQKKDLASIMKGL
                     TTKYDNLFETSFPYSMGLHQAPLNAVGEELDNSWYHMHFYPPLLRSATVRKFLVGFEL
                     LGEPQRDLTAEQAADRLRKLDGEVHYLEKL"
     gene            complement(<560403..>562127)
                     /locus_tag="HG535_0F02860"
                     /db_xref="GeneID:59237534"
     mRNA            complement(<560403..>562127)
                     /locus_tag="HG535_0F02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289606.1"
                     /db_xref="GeneID:59237534"
     CDS             complement(560403..562127)
                     /locus_tag="HG535_0F02860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145501.1"
                     /db_xref="GeneID:59237534"
                     /translation="MMNSYTVEKVPTKPFQDQKPGTSGLRKKTKVFSSTPHYTENFIQ
                     SVLDAIPGGCKGAILVVGGDGRYYNDVVLNIIASISAANGVRQLIIGQNGILSTPAAS
                     HIIRTYQDKEGRKVTGGIILTASHNPGGPDADLGIKYNLANGGPAPEVVTNKMWEISK
                     KLTSYNIIKNFPKIDLKTIGQRNYVDLSVEIIDSTKSYVEFLKTIFDFALIKQFIHAQ
                     RKTSNWKLLFDGLNGVTGPYGRAIFVDEFGLPETEVLQNCTPKPDFGGIHPDPNLTYA
                     RTLVDRVDREKIQFGAASDGDGDRNMIYGYGPAFVSPGDSLAIIAEYASGIPYFAKQG
                     IYGLARSFPTSSAIDRVAAAKGLNCYEVPTGWKFFCDLFDAKKLSICGEESFGTGSNH
                     VREKDGMWAVIAWLNILALYNKRHPEREASIKTIQNEFWATYGRTFFTRYDFEHVVPE
                     KANDIVSVVQKLATSPAAKGSKFLASDSLTITDAGDFEYTDLNGAISSHQGLYFKLSN
                     GTRIVLRISGTGSSDATIRLYLEKYTDDKNEYHKTAEEYLKPMINAAIECFNIEKILG
                     TKEPTVKT"
     gene            563584..563655
                     /locus_tag="HG535_0Ftrna6D"
                     /db_xref="GeneID:59237896"
     tRNA            563584..563655
                     /locus_tag="HG535_0Ftrna6D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:59237896"
     gene            <563777..>564347
                     /locus_tag="HG535_0F02870"
                     /db_xref="GeneID:59237535"
     mRNA            join(<563777..564058,564060..>564347)
                     /locus_tag="HG535_0F02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289607.1"
                     /db_xref="GeneID:59237535"
     CDS             join(563777..564058,564060..564347)
                     /locus_tag="HG535_0F02870"
                     /inference="similar to AA sequence:RefSeq:NP_012256.1"
                     /ribosomal_slippage
                     /note="ribosomal frameshifting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145502.1"
                     /db_xref="GeneID:59237535"
                     /translation="MPRVRLPSSSEQRDAILLQSWLYSRLRMASPKISDTMMPTYSFI
                     PSLSVEDMRNPQLSSAVLCTPCHFVKITKFYRVHNYRVFASVRDNTHQILVVFTPKCV
                     SNFERRYHSRITSHVVNSLIIVGDCSLHYWPPSKIQDNFDIGHNNCAFSEAREANKSL
                     PILIINQMGRFEMDQVEPLALCPFVYGKL"
     gene            <564578..>565921
                     /locus_tag="HG535_0F02880"
                     /db_xref="GeneID:59237536"
     mRNA            <564578..>565921
                     /locus_tag="HG535_0F02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289608.1"
                     /db_xref="GeneID:59237536"
     CDS             564578..565921
                     /locus_tag="HG535_0F02880"
                     /inference="similar to AA sequence:RefSeq:NP_015064.1"
                     /note="similar to Saccharomyces cerevisiae APM1 (YPL259C);
                     ancestral locus Anc_7.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145503.1"
                     /db_xref="GeneID:59237536"
                     /translation="MASGVYFCDIKGKPILSRRYRDDISISAIDNFAPLLFELEEESS
                     VIPPCLSHRDVQYMFIQHEDLYVVAISTSLQTNAAQIFTFLHKLVAVLGDYLKTVEEE
                     SVRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQKSFKLVKAVKKVKAVARPPTTL
                     TNSVSWRAEGITYKKNEAFLDMVESVNMLMTHQGQVLRSEIIGQVKVKSRLSGMPDLK
                     LGINDRGIFSKITSDVVNDGEPSSITSGKKKLNVELEDLKFHQCVRLSKFENEKIITF
                     IPPDGDFELMSYRLTTPVKPLIWCDVNVQVHSQSRIEIHCRAKAQIKKKTIANNVEIL
                     IPVPDDADTPSFKYSHGSIKWVPEKSAILWKIRSFSGGKEYSMAAQMGLPSISGNEKP
                     KFKRPVQVKFQIPYFTTSGINVRYLKITEPKLQYKSYPWVRYITQSGDDYTIRLN"
     gene            complement(<566551..>567246)
                     /locus_tag="HG535_0F02890"
                     /db_xref="GeneID:59237537"
     mRNA            complement(<566551..>567246)
                     /locus_tag="HG535_0F02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289609.1"
                     /db_xref="GeneID:59237537"
     CDS             complement(566551..567246)
                     /locus_tag="HG535_0F02890"
                     /inference="similar to AA sequence:RefSeq:NP_012255.3"
                     /note="similar to Saccharomyces cerevisiae DOT5 (YIL010W);
                     ancestral locus Anc_7.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145504.1"
                     /db_xref="GeneID:59237537"
                     /translation="MSELRRSARVASNKRGSPADEPASHQTKKSKTTSVAPDGEKKVD
                     KIAEAKMEDAEPETKEENAEPKMKPRSSPSESKSKELIEGDEIPDLTLQNQDGGEISL
                     KKLAEENRIIIIFAYPKASTPGCTRQACGFRDNYEDLKEHAAVFGLSTDNPKSQKNFQ
                     TKQKLPFGLLCDPKRLLIGSLGAKKTPQAGTIRSHWIFVDGKLKSKNIKVSPEFSVEE
                     GKKQILELAKELE"
     gene            complement(<567753..>569516)
                     /locus_tag="HG535_0F02900"
                     /db_xref="GeneID:59237538"
     mRNA            complement(<567753..>569516)
                     /locus_tag="HG535_0F02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289610.1"
                     /db_xref="GeneID:59237538"
     CDS             complement(567753..569516)
                     /locus_tag="HG535_0F02900"
                     /inference="similar to AA sequence:RefSeq:NP_015063.1"
                     /note="similar to Saccharomyces cerevisiae YPL260W;
                     ancestral locus Anc_7.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145505.1"
                     /db_xref="GeneID:59237538"
                     /translation="MVTPLAESWSNPNQHPQEVPQEEEDILQYLLGVRNRLGQLKQNR
                     RQYLNSKDVQETYQEVLTKVRKLDEIRKNSHKSPSNSATTLIHSNELHNRVDSVLDDV
                     FQLLSLCFLTVGLKNSAPATYASLSTVQSLLEHLNESNVFTQHDLRPIKERLTEISKI
                     VEQSSYSSVTNEINDSLPESDRKFYEELNKNKIEQDLLLRAKLKHCLDEYNSTESKVE
                     EIDPSLTSIMEKLFEIRRGLLSLAASSKGAGVNSLSQEKELEEKNLVPQEIVNAKLAQ
                     LTKDLTELESHRDENGKFISLETNEVEQKGQSVLNGLLDNCHDLINDLSHQKNGGIEL
                     DAKLQPIYEKLIDIKTSLENLLVTRRWTLRETDLFTFQKQLGEIDNLRVNGKFPTESG
                     DSKGQSILLYLLRRSYAIIYKLLESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNN
                     GRELYPYQMKLASLDNLRTDGKFYDIDGNIPEGQGTLNALLAECFDILHEMKIEAQER
                     AESESAEHSEANQDDDQDDANDNSAETEDTNAEQQPVAKYLDGHNQYSDEEEDDEADD
                     ESENSYVDEDTDNEALTPREQ"
     gene            complement(<570858..>572006)
                     /locus_tag="HG535_0F02910"
                     /db_xref="GeneID:59237539"
     mRNA            complement(<570858..>572006)
                     /locus_tag="HG535_0F02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289611.1"
                     /db_xref="GeneID:59237539"
     CDS             complement(570858..572006)
                     /locus_tag="HG535_0F02910"
                     /inference="similar to AA sequence:RefSeq:NP_014650.1"
                     /note="similar to Saccharomyces cerevisiae SLG1 (YOR008C);
                     ancestral locus Anc_7.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145506.1"
                     /db_xref="GeneID:59237539"
                     /translation="MVSVRVINCNSNFRVLLSLLIIIGLLISQVNGYSELGCFGSLPS
                     SFTLRNTYEYQTSSYCSGQCNGYQYFALSQHNQCYCGNDDPTSEATSDSCNASCFGYP
                     REMCGGDDSFSVYTSDDVSSGSSSSSGSATSSDSSTPSSSTTSSQSSTQPSSSALPPS
                     SASSSSTPPPSSSSSPTSSPPPSSSSSSPPSSSTEVPRTTTQETSSSPPISVAYSTST
                     NTESGSVVYVTNTITQSATASQSSTNNLNDANNRNDPGGHRKKANIGAIVGGVVGGVG
                     GAAVIAAIVLLIIRHLNKRREQERMEKEYQEAIKPVEYADKPMHGASSSLSINNEHSS
                     GSFDDERKNAPANNPFDDSRRISNGTVAMNFNAPVNQKILTVVNPDED"
     gene            572530..572601
                     /locus_tag="HG535_0Ftrna8E"
                     /db_xref="GeneID:59237902"
     tRNA            572530..572601
                     /locus_tag="HG535_0Ftrna8E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:59237902"
     gene            <572724..>574940
                     /locus_tag="HG535_0F02920"
                     /db_xref="GeneID:59237540"
     mRNA            <572724..>574940
                     /locus_tag="HG535_0F02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289612.1"
                     /db_xref="GeneID:59237540"
     CDS             572724..574940
                     /locus_tag="HG535_0F02920"
                     /inference="similar to AA sequence:RefSeq:NP_012272.3"
                     /note="similar to Saccharomyces cerevisiae YIR007W;
                     ancestral locus Anc_7.172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145507.1"
                     /db_xref="GeneID:59237540"
                     /translation="MLPRIVISSNSEFTDEDGNTIVLRGVNFDPVVKIPSSPYEPTYQ
                     AIDDLKQHLQKTSDVSFIGHPISLKDVAEHITRLKSLGYNCIRVPFTWESIEHRGPGE
                     YDYDYMDYLIELFLKIQEIGGMYIYLDPHQDVWSRFCGGSGAPLWTLYCAGFNPMYFR
                     ETEASILHNYYDNVENPSSYPKMLWPTNYYRLACQTMFTLFFAGNEFAPKCCLNGVNI
                     QDYLQDKFIECVMTFCARIKQKTPQLFEQNCIIGLESINEPNRGFLGDKNLGVISTER
                     NLKRGTTPTGFQSFVLGEGFATLVDEYDITIFGPAKKGTKQVEPEGKSCWLSQNDRDE
                     IDSLYGWNRDANWIAGQCIWRLHGVWEISSKDGSPTLIKSDYFAFTKDGKNRELNHEY
                     FINHHFIDYYRKYYERFRAIDNNLLIFLQPPVFQPPPKLKDSELLDGRTVYACHFYDG
                     LSLMFKTWNRKFNVDTLGIVRGRYLNPVFSVVLGEQKIRKCLRRQLKEMKEEVKSALD
                     IPVFFTEIGMPFDMDDKKAYENKDYSSQISALDALQYALEGENISYSLWCYCSKNSHR
                     WGDQWNNEDFSIWSSDDKTHDHVKDIYAPDTDVSKFIPLISNTEIESQPCVSKDLLDL
                     NGFRALEAILRPFPVKIHGKFVNSEFDLISKTYTLEIGAKSDSDLKPDSATHIFLPRI
                     HFPLKDVAIRSSSGRFSFDSEYQVLKWYHAAGTQNITISLIDDSSSHEISPDCIIS"
     gene            complement(<574989..>576242)
                     /locus_tag="HG535_0F02930"
                     /db_xref="GeneID:59237541"
     mRNA            complement(<574989..>576242)
                     /locus_tag="HG535_0F02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289613.1"
                     /db_xref="GeneID:59237541"
     CDS             complement(574989..576242)
                     /locus_tag="HG535_0F02930"
                     /inference="similar to AA sequence:RefSeq:NP_012273.1"
                     /note="similar to Saccharomyces cerevisiae PRI1 (YIR008C);
                     ancestral locus Anc_7.171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145508.1"
                     /db_xref="GeneID:59237541"
                     /translation="MTEDQITGVVAKKEQPSTPSSSDMQFYYQYLYPYKSIFQWLNHS
                     PKPGRDMINREFALKFRSGAYKRYVSFSSVQEFKSQIEKANPDRFEIGAVFNRPPKER
                     DTILKTELQALEKELVFDIDMDDYDVYRTCCSGAQVCDKCWKFIGLAMKVMNVTLTDD
                     FGYNDFMWVFSGRRGAHCWVSDKRARVLGDIHRRNVIDYLNVVKDRKGDKRLNLKRPL
                     HPHLVRSLEILKPHFAAIILDEQNPWEDDLRAFDTLLGGLHDKQLIEALKVHWTKNSG
                     RSSREKWNDIDVIASKEIKSNKKNEFAIRLRECKEDLVMATLYPKLDIEVSKLTSHLL
                     KSPFCVHPNSGKVSVPIDETFRLEDAPRLIDLQIEMERNNNNVEKTSLQPFIENFQRY
                     TNQLMKQELGSIKRERVEEQDALDF"
     gene            <576908..>577498
                     /locus_tag="HG535_0F02940"
                     /db_xref="GeneID:59237542"
     mRNA            <576908..>577498
                     /locus_tag="HG535_0F02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289614.1"
                     /db_xref="GeneID:59237542"
     CDS             576908..577498
                     /locus_tag="HG535_0F02940"
                     /inference="similar to AA sequence:RefSeq:NP_010928.1"
                     /note="similar to Saccharomyces cerevisiae PRE1 (YER012W);
                     ancestral locus Anc_7.162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145509.1"
                     /db_xref="GeneID:59237542"
                     /translation="MDIILGIRVQDSVILATSKAVTRGISILKDSDDKTRQLSPHTLM
                     SFTGESGDTVQFAEYIQANMQLYSIREAYELSPQAVSSFVRQELAKSIRSRKPYQVNV
                     LIGGYNAKTEKPELYQIDYLGTKVELPYAAHGYAGFYTFSLLDRHYRPDMNEEEGYSL
                     LKQCIQELNKRMPMDFKGVIVKVVDKNGVRQLDDIE"
     gene            <577745..>581167
                     /locus_tag="HG535_0F02950"
                     /db_xref="GeneID:59237543"
     mRNA            <577745..>581167
                     /locus_tag="HG535_0F02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289615.1"
                     /db_xref="GeneID:59237543"
     CDS             577745..581167
                     /locus_tag="HG535_0F02950"
                     /inference="similar to AA sequence:RefSeq:NP_010929.3"
                     /note="similar to Saccharomyces cerevisiae PRP22
                     (YER013W); ancestral locus Anc_7.163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145510.1"
                     /db_xref="GeneID:59237543"
                     /translation="MSHIDPELLRIIGTDDNTVLDFLSNIKKSSGDVNDFKERIDKLD
                     VILTPEDAKTAYLLLPVEKDSKEFDPRSEVSCLLKQSLGIDDYVVVDFILNKAKECKR
                     SDKFAENLDELGCGINKELAEQIFSILGTSPGESTKAKSLQHMTVGESTAHGLTLPNK
                     KIKWEELSDTKDLLPSDNLKQQLLDPAPVMGKTYEGTVKNVASFGCFVQICGTEEKNC
                     TGLVHISALSDTRVRNPNDIVQVGQKVFVKVVKLQMNGKVSLSMKNINQLTGEEEGSG
                     ANNTPIGIRGRSSKAQEVVTERRPLTSPERWEIRQLIASGAASVEEYPELNHKSSDET
                     NSYTDGQKEEGKDNSLMEDLEVELNLDDEPKFLRGQLDNGPKKYEPPKIVRVPKGSMN
                     RVAMNGSNLMKEHRENKMLRKKEIEQQIRKKQAMGELGDNPEDRKVDLSDLRQQLVIT
                     AWERNRMREPIAFGRKTSMPISSQRKSLPVYQMKDALMKAVRENQFLIIVGETGSGKT
                     TQITQYLNDEGFSDGGIIGCTQPRRVAAVSVSKRVAEEIGCKLGDEVGYTIRFEDMTS
                     AKTRIKYMTDGMLQREALLDPTMSKYSVIMLDEAHERTVATDVLFALLKQAAKKRPDL
                     KVIVTSATLDSAKFSEYFCGCPVINIPGKTFPVEVLYSQTPQMDYIESALDTVVEIHV
                     NEGPGDILVFLTGQDEIDSCCEVLYQRVKTLGDSIGELLILPVYSALPSEIQSKIFEP
                     TPEGSRKVVFATNIAETSITINGIYYVIDPGFAKVNTFNPRVGMEQLVVSPISQAQAN
                     QRKGRAGRTGPGKCYRLYTESAFYNEMLPNTIPEIQRQNLSLTILMLKAMGINDLIHF
                     EFMDPPPKNLLMKALEELFNLQALDDDGLLTKLGMRMSQFPMEPTLARALLASVTNNC
                     SEDIIIVISMLSVQNVFYRPKGKEQEADNKKARFHHPYGDHLTLLNVYKRWQQANCTE
                     QFCTLNFLQSRHLKRARDVRNQLMAIFSRFKLPIVSCHGDPSIIRETLVSGFFFNAAK
                     RDSQVGYKTLTGGTAVGIHPSSSLYGKEYEYVMYHSLVLTSREYMSQVTAIDPKWLIK
                     AAPHFYKITDEESQSRKKAKIVPLHNRYSKDQNSWKLSSIRQSREKALGIKR"
     gene            <581413..>583029
                     /locus_tag="HG535_0F02960"
                     /db_xref="GeneID:59237544"
     mRNA            <581413..>583029
                     /locus_tag="HG535_0F02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289616.1"
                     /db_xref="GeneID:59237544"
     CDS             581413..583029
                     /locus_tag="HG535_0F02960"
                     /inference="similar to AA sequence:RefSeq:NP_010930.1"
                     /note="similar to Saccharomyces cerevisiae HEM14
                     (YER014W); ancestral locus Anc_7.164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145511.1"
                     /db_xref="GeneID:59237544"
                     /translation="MLSPLTKLPNNAKVAVIGSGVSGLMFTYYLGKLRPDVTINIFES
                     AKRSGGWINSWQTTDQNGKPIMLERGPRTLRGVSDGTVLIMDTLKDLNQQNIIKCVEK
                     NSEANRKFLLDTNNKLVQVPSSIVSFAKFMINPLSKGLFTGMLGEWFRKPSPSIKNDE
                     SVASFIGRRFGNDYIGKNILSAIFHGIYADDINELSAKRTLRDLYALEEKYGSIFKGS
                     WETAQEGKKNKTTGITKSDLSACLKEYQQVFGKKESDLIGLSNNLKKYPMLGLKGGLE
                     EFPKIVRKALEKLPNVNIILGKDATKIVYEKSNDTVSISLGSGEVANGFNHCRITTNP
                     SKMSLLVKSANEKLSQDLDTVKSNTVLLVNYYLPGRDIIEKNLHGFGYLVPKSNNNPQ
                     KLLGVIFDSIIEKNFKPFEGTYSHPNSGPVQEYTKLTAMLGGHFLNQWSECTTPSKDI
                     VIKAVKEALMSHLSVSEKDLDAGLWQYTVAERCLPHFFVGYDAWQSSTEQELLNTYAA
                     KVSTGGMGFSKGPGVPDVIVDSFQDAMKLK"
     gene            <583240..>583602
                     /locus_tag="HG535_0F02970"
                     /db_xref="GeneID:59237545"
     mRNA            <583240..>583602
                     /locus_tag="HG535_0F02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289617.1"
                     /db_xref="GeneID:59237545"
     CDS             583240..583602
                     /locus_tag="HG535_0F02970"
                     /inference="similar to AA sequence:RefSeq:NP_012274.1"
                     /note="similar to Saccharomyces cerevisiae MSL1 (YIR009W);
                     ancestral locus Anc_7.165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145512.1"
                     /db_xref="GeneID:59237545"
                     /translation="MAEQPVRKKRKVSEKTTGVSGSEPKAKPNPDQLPKRTLYLNNLG
                     DHIGSNKLRTNLYLLFSIYGEVIKITVNTRRLRGQAFVTMRTIDESNLALISLNNEPF
                     FGKPLEISFSNNDTTRLD"
     gene            <583878..>586103
                     /locus_tag="HG535_0F02980"
                     /db_xref="GeneID:59237546"
     mRNA            <583878..>586103
                     /locus_tag="HG535_0F02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289618.1"
                     /db_xref="GeneID:59237546"
     CDS             583878..586103
                     /locus_tag="HG535_0F02980"
                     /inference="similar to AA sequence:RefSeq:NP_010931.3"
                     /note="similar to Saccharomyces cerevisiae FAA2 (YER015W);
                     ancestral locus Anc_7.166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145513.1"
                     /db_xref="GeneID:59237546"
                     /translation="MTSQCSVSHLVETDSRYEGLKQKLIGLEQGSDEYIKRLIFECPL
                     SLHPDFKAYLERQGVAIEGTKREGYSAVYRSSLSPNSLITCLDEKLQTLYDHFMFSVR
                     MWPKNECLGKRPYDPATKTWAERYEFQNYEQVAKRIHNIGSGFLSLVNVKRGKRLGSN
                     DFIVAILSHNMEQWVLSDLACQAYGLTNTALYESLGPETSEYIMNLTESPLLIFAKQN
                     MYKVIELLPKLKYMNTLVCMEELDEKELKLLNDSILPIKVNSLGEKISLFSLQQVEDA
                     GRLNEIPISPPKSDDVYTISFTSGTTGIPKGVVTTQRQLTAGVAFVFATSKIPKHKRA
                     AQLRYMCFLPLAHILQRMLTVYSLSRGIGIGFLHKPDPLVMVEDMRLLKADFATLVPR
                     ILTRFEAGIKSSLEKSSLQNSVATNFLDAKQHRLLENGGPDKSLLNTYVFHRVLIEKI
                     RDSLGMNNCDFIIMGSAPISPETLIFLRSALDMGMRQGYGMTEAFGGIAVSESYEKDP
                     GTCGPISSSVECRLRSVPEMGYDANDLKGEIQVRGAQVFQAYFKRPDETAKVIDSEGW
                     FSTGDIGSIDSVGRISIIDRVKNFFKLSQGEYIAPEKVESLYSASSPQLTQIFVHGDS
                     LQSYLVGIVGIDVQKTRRHLASNFPEVGHMNDKRFVEAMNKSKDLRKCFLSMINKNTP
                     HLQGFEKLHNIYVDIDPFKVEDDTMTPTLKIKRLNATKHFKSKFSELYEEGSLIKVDK
                     L"
     gene            <586751..>587689
                     /locus_tag="HG535_0F02990"
                     /db_xref="GeneID:59237547"
     mRNA            <586751..>587689
                     /locus_tag="HG535_0F02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289619.1"
                     /db_xref="GeneID:59237547"
     CDS             586751..587689
                     /locus_tag="HG535_0F02990"
                     /inference="similar to AA sequence:RefSeq:NP_010932.1"
                     /note="similar to Saccharomyces cerevisiae BIM1 (YER016W);
                     ancestral locus Anc_7.167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145514.1"
                     /db_xref="GeneID:59237547"
                     /translation="MSGIGESRTELINWLNGLLHLNYKKIEECGSGAAYCQIMDSIYG
                     DIPMHRVKFDGTAEYEFQTNFKVLQGSFAKHHIEKTVYVEKLIRCRFQDNLEFLQWLK
                     KYWVQNKDESFYDPEARRKHRPINSGHPTPGGTSINISKRSTSGSSIGFGSNGTASNS
                     LGSRSSSYGLSRRVPSDQLVKLQDDLSQATLRITSLNKEIGTYKEAMNIMERERDFYF
                     GKLRDIEILVQSTQDLIKEGIYNAGGGDLSKVLNKVQQILYATEDGFEVNQEDGQMLD
                     QETAVQDDNQRSVRAFRRETAQDVPAHNLITDEETF"
     gene            complement(<587859..>590213)
                     /locus_tag="HG535_0F03000"
                     /db_xref="GeneID:59237548"
     mRNA            complement(<587859..>590213)
                     /locus_tag="HG535_0F03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289620.1"
                     /db_xref="GeneID:59237548"
     CDS             complement(587859..590213)
                     /locus_tag="HG535_0F03000"
                     /inference="similar to AA sequence:RefSeq:NP_010933.1"
                     /note="similar to Saccharomyces cerevisiae AFG3 (YER017C);
                     ancestral locus Anc_7.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145515.1"
                     /db_xref="GeneID:59237548"
                     /translation="MSNVVGSRRPIGAMMCFTSRAVRSVFTRSYQVCPRPNVYKKGHV
                     REHRRLLHFSFNPNFKNTHINLSSQDEKKPQHNKDNKSEGNGGKKENGEENEKNSDKK
                     RKNGEQEFKSLSEYFRSKEFAKTMYLTVGSIVLFNLITSSDKPAGADLQPLTFQDFKT
                     KYLEKGLVKRLYVVNKFLVEAELTPQVDHDGNARQSGFLGSGPPVVAFTIGSVDIFEE
                     QMEDIQDKLKITPEDRIPITYVQRASIFQYLFPFLPTIILLGGLYFITRKVGGGANGA
                     GGGGGPFGGMFGVNKSKAKLFNKETDIKVSFKDVAGCNEAKQEIMEFVHFLKNPAKYT
                     ALGAKIPRGAILSGPPGTGKTLLAKATAGEAGVPFLSVSGSEFVEMFVGVGASRVRDL
                     FEQARKMAPSIIFVDEIDAIGKERGKGGAMGGANDEREATLNQLLVEMDGFSTSDQVV
                     VLAGTNRPDVLDPALMRPGRFDRHIQIDAPDVEGRKAIYLVHLRKLNLDKILTKSDRE
                     REELAGKLAALTPGFAGADIANACNEAALIAARNNAPCIELYHFEQAIERVIAGLEKK
                     SRVLSPEEKKTVAYHEAGHAVCGWYLKYADPLLKVSIIPRGQGALGYAQYLPPDQYLI
                     SEEQFQHRMIMALGGRVSEEIHFPSVTSGAHDDFKKVTQMASAMVCSLGMSPKIGCIS
                     YDQGDVSFQVNKPFSEVTANNIDSEVKRIVGDAHAKCEKLLTDNLEKVDKVAKELLSK
                     EAITREDMIRLLGPRPFPERNEAFEKYLDPKNINNGENTSPATN"
     gene            complement(<590510..>591058)
                     /locus_tag="HG535_0F03010"
                     /db_xref="GeneID:59237549"
     mRNA            complement(<590510..>591058)
                     /locus_tag="HG535_0F03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289621.1"
                     /db_xref="GeneID:59237549"
     CDS             complement(590510..591058)
                     /locus_tag="HG535_0F03010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145516.1"
                     /db_xref="GeneID:59237549"
                     /translation="MRDTLHWERTRNRKGESRTDSSLHINLDRTHAYNQPQGDLYRCC
                     TNFLFSREQTHQQGEYAGNCKEHGSQLGRCGFPTRIPVPNSLQLFDIDYIHDANCIPP
                     FLHFNPVTQNCVTEKSTAHASSNTNSSSVLSREFLCNSASTVEMRNIYASMDNYCENQ
                     YRCKETFFSPRRGSINNIDEVI"
     gene            <591747..>592673
                     /locus_tag="HG535_0F03020"
                     /db_xref="GeneID:59237550"
     mRNA            <591747..>592673
                     /locus_tag="HG535_0F03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289622.1"
                     /db_xref="GeneID:59237550"
     CDS             591747..592673
                     /locus_tag="HG535_0F03020"
                     /inference="similar to AA sequence:RefSeq:NP_009810.3"
                     /note="similar to Saccharomyces cerevisiae MRPS5
                     (YBR251W); ancestral locus Anc_7.170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145517.1"
                     /db_xref="GeneID:59237550"
                     /translation="MLRRQFSTSIRLLQHYDDALLSKYYPKELLKSIKLAQEVIPSNT
                     QFNVSRNVEFASSYMDDFSKLDSYWDYKPGMPHIHSQEDDLIRNAIYDWSKVQQPLPG
                     NGHQLPPGVSLPSADGRSSKTLDVARGLQKQTGVDVNYITRKLVMKPLIMKRVSNQTG
                     KGKIASFYALVVVGDRNGMVGLGEGKSRDEMSKAISKAHWDAIRNLKEIPRYENRTIY
                     ADIDFRYHGVKLHLRSAKPGFGLRVNHVIFEICECAGIKDLSGKVYKSRNDMNIAKGT
                     VEALVGAQKTLEEIALGRGKKIVDVRNIYYSG"
     gene            <593035..>593496
                     /locus_tag="HG535_0F03030"
                     /db_xref="GeneID:59237551"
     mRNA            <593035..>593496
                     /locus_tag="HG535_0F03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289623.1"
                     /db_xref="GeneID:59237551"
     CDS             593035..593496
                     /locus_tag="HG535_0F03030"
                     /inference="similar to AA sequence:RefSeq:NP_009811.3"
                     /note="similar to Saccharomyces cerevisiae DUT1 (YBR252W);
                     ancestral locus Anc_7.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145518.1"
                     /db_xref="GeneID:59237551"
                     /translation="MTEQKPKTQKLANSLKVQLRSPDATAPTKGSKTAAGYDIYASKA
                     EIIPAQGQGLVSTDVSFTVPVGTYGRIAPRSGLAVKHGIQTGAGVVDRDYTGEVKVIL
                     FNHSQKAFEIKKGDRIAQLILERIVDDAEVVIVESLEDTDRGAGGFGSTGK"
     gene            <593704..>594051
                     /locus_tag="HG535_0F03040"
                     /db_xref="GeneID:59237552"
     mRNA            <593704..>594051
                     /locus_tag="HG535_0F03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289624.1"
                     /db_xref="GeneID:59237552"
     CDS             593704..594051
                     /locus_tag="HG535_0F03040"
                     /inference="similar to AA sequence:RefSeq:NP_009812.1"
                     /note="similar to Saccharomyces cerevisiae SRB6 (YBR253W);
                     ancestral locus Anc_7.174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145519.1"
                     /db_xref="GeneID:59237552"
                     /translation="MSNQALFEKLDQTSELLSAKLIELIKLSAIEQQNNDPADTPASE
                     LSIATNGVTLVNNQTMQLIKGVKDLLVLTRSIREKWLLNQIPEDQMNQESEVDTEHLR
                     ELLDKCMSEIVGE"
     gene            <594237..>595946
                     /locus_tag="HG535_0F03050"
                     /db_xref="GeneID:59237553"
     mRNA            <594237..>595946
                     /locus_tag="HG535_0F03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289625.1"
                     /db_xref="GeneID:59237553"
     CDS             594237..595946
                     /locus_tag="HG535_0F03050"
                     /inference="similar to AA sequence:RefSeq:NP_012275.3"
                     /note="similar to Saccharomyces cerevisiae DSN1 (YIR010W);
                     ancestral locus Anc_7.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145520.1"
                     /db_xref="GeneID:59237553"
                     /translation="MMSGEGSRSGSKTPPRKRTYPLKMETIPMSSSYSELKDAGIGEM
                     GYSGEAMSKSHQNRHTEEEDYAPIDQNVSSYEADDDFKFKRHKTKPMNGVPSLGERLD
                     NLQDMKNAKWVDNFNSSMPMNSQQRSKPDIRPPSMPPSQANQYSQTSQIQQQPAYMPY
                     MYYYPMPTPGHPLMSYMGSPVHPSQLNGTQYMNSSVSMLPNTSLQPFMPPPPVPNHKG
                     EQNSAPQLLPPPSLYPYNFLQQQQQHQQQQQYAQKAKNKSQSSGFNRGRRLSMLASQE
                     DHNMIVSPHKDVPEEDFYRHVGNTSFGRGLQIRQLFNWCVIRSLRKMGNQENEEQAKS
                     EMKEGAYVNPKKIAIVIIEEFVNDLRKGAVNIDWEEEESGSGEEFSDAEDTELRNLFD
                     DDDDDDEVNNNGLNNKNNALKKNSSKKSRNKKNTTKRRNRIANSKNVANEKNLESLQG
                     RIDAIEREIVDWTRVLNDCEVDTEWKQLSKKSTAPPEKTQPLHEEPSIEDIRENITEK
                     MNKLYIHSHLLNSGSEALSQLTGVKLDKLSRKFVPTVHDQNANARSNTQTLLKGLSKS
                     LLE"
     gene            complement(<596045..>596575)
                     /locus_tag="HG535_0F03060"
                     /db_xref="GeneID:59237554"
     mRNA            complement(<596045..>596575)
                     /locus_tag="HG535_0F03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289626.1"
                     /db_xref="GeneID:59237554"
     CDS             complement(596045..596575)
                     /locus_tag="HG535_0F03060"
                     /inference="similar to AA sequence:RefSeq:NP_009813.1"
                     /note="similar to Saccharomyces cerevisiae TRS20
                     (YBR254C); ancestral locus Anc_7.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145521.1"
                     /db_xref="GeneID:59237554"
                     /translation="MPQYFAILGKSDNPVYEAEFTTQQGQQGQLQKGFPQHLKELNPF
                     IMHASLDIIEDLQWKLNSNVQHGTNNSGFGSFLRSKNVNVTDNCYLGKVDHFYGLAIT
                     AYLTFSGMKFVMIHGNLDKNSTQVDDNAVKSFYQEVHELYIKTLMNPFYKINDPITSA
                     AFDTRVRSLARKYLNK"
     gene            <597730..>599559
                     /locus_tag="HG535_0F03070"
                     /db_xref="GeneID:59237555"
     mRNA            <597730..>599559
                     /locus_tag="HG535_0F03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289627.1"
                     /db_xref="GeneID:59237555"
     CDS             597730..599559
                     /locus_tag="HG535_0F03070"
                     /inference="similar to AA sequence:RefSeq:NP_009814.3"
                     /note="similar to Saccharomyces cerevisiae YBR255W;
                     ancestral locus Anc_7.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145522.1"
                     /db_xref="GeneID:59237555"
                     /translation="MIATDSTSDITANSDGKSDGESDDKPNFPEVKPSRIKFVTKILV
                     DSKYGLMDDLNYTRGFPEHHDSTITEETAPAFKGKEYKKKTENPVPVIAFSRNARIKA
                     DRVRIYLDYYYSLLERYINIESPEHHHEGVEGVYNPLQIIRNRALRKKYSEQPPRELF
                     IQRSPVIAIKHFSRKPKQKKPWYVTISERSSDLTWRTSHWDELVRPDGYIWFPKGSGS
                     NSTSHKEPARHRRPRIGRMYSADSELSANSPYSAQGLTSSSPEIGKSVKGSPSHSSIP
                     KHIERAMTRPENGDHKIVSEEIEKSRPNRFEQIIGKKSKRWSRSPHLRQKSQGSVDKL
                     VLPLSTPGMSKYSSRTPTHSRRSSSSFIPTSHSAYMTPTEDFSTQRSTLLSALPIEHV
                     RKRSIDQTEEEQIEDVQDLLGNGEFADSTDMLNEGFSMPQTDEQLENYWRSSKYILAT
                     LQTMQHRRITHNIVRKRGIAKRDKFQCDQNLDDIFFKTSEVLSTYDKELNKALKKGNS
                     LASKMLNDYSMRVETLISTSDRILSDINTTLTLKLKLFQEDADKFGTLKGMQSQRFTR
                     ALYRILEYAIVSVLWSVWLVVSIIKWIKYSILLAFKIILWMLW"
     gene            complement(<599689..>600127)
                     /locus_tag="HG535_0F03080"
                     /db_xref="GeneID:59237556"
     mRNA            complement(join(<599689..599988,600065..>600127))
                     /locus_tag="HG535_0F03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289628.1"
                     /db_xref="GeneID:59237556"
     CDS             complement(join(599689..599988,600065..600127))
                     /locus_tag="HG535_0F03080"
                     /inference="similar to AA sequence:RefSeq:NP_116328.4"
                     /note="similar to Saccharomyces cerevisiae YBR255C-A;
                     ancestral locus Anc_7.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145523.1"
                     /db_xref="GeneID:59237556"
                     /translation="MGGQVQPVHYDPATVKQLTKEIAVASCIGAAQGAMVSIVSSLLL
                     SRFSTVFRNVRNQVKVFYHCSWISMGAVFQADKQLLKFQSKYYETELKRRERILDEAA
                     DRGIFLEEESVVSSTTSQ"
     gene            complement(<601322..>602317)
                     /locus_tag="HG535_0F03090"
                     /db_xref="GeneID:59237557"
     mRNA            complement(<601322..>602317)
                     /locus_tag="HG535_0F03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289629.1"
                     /db_xref="GeneID:59237557"
     CDS             complement(601322..602317)
                     /locus_tag="HG535_0F03090"
                     /inference="similar to AA sequence:RefSeq:NP_012276.1"
                     /note="similar to Saccharomyces cerevisiae STS1 (YIR011C);
                     ancestral locus Anc_7.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145524.1"
                     /db_xref="GeneID:59237557"
                     /translation="MNAEDCNEQTNTLAGYSAGFAWGFKSGSGTSTVQQMGGQHPVTS
                     LVEDGNQHKYRCKRKYSSGRDNQEDMGRNVKHMANRGKHTILKRKANLSSNIQGQPLP
                     IQRGLELMNKEQLQNALLDIMKACPQTQQLMNSKLLECNFSTEKCQDLLKIKLEQLYQ
                     SIPYSRSSEMNKLNDYAFVRMKPYILEFLNCLVDCILDQIPPRVENVLSSMKFLDLCT
                     DMVANLPRFELTSNNYYYDKCLEQLSYIWCTLIEHIARDVFLTLNGESVICGWISKLE
                     IYNELSNGILSRPLQLFKSLNSVDSNPLHKNTANTGSTTTPFHSPTNNSRLANDQ"
     gene            <602798..>604111
                     /locus_tag="HG535_0F03100"
                     /db_xref="GeneID:59237558"
     mRNA            <602798..>604111
                     /locus_tag="HG535_0F03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289630.1"
                     /db_xref="GeneID:59237558"
     CDS             602798..604111
                     /locus_tag="HG535_0F03100"
                     /inference="similar to AA sequence:RefSeq:NP_012277.1"
                     /note="similar to Saccharomyces cerevisiae SQT1 (YIR012W);
                     ancestral locus Anc_7.180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145525.1"
                     /db_xref="GeneID:59237558"
                     /translation="MSGLEADQELSRDDAALQDEFIDNNEVEQEVVEDDTASIPMDED
                     DVENDATPGIDVGDGETIEIDVSNNSVTYFDKHSDSVFTVFQHPTLPLICSGGGDNLA
                     YLWTSHSQPPKFAGTLNGHTESVIAGGFSCDGKFLVTGDMTGKVLIYISQSGGTKWKK
                     VSEIQEVEEIIWLKCHPTIPGVFAFGAIDGSVWCFQINPDGSLDQLMTQLSHQLECTA
                     GEFISTEQGENILELVTCSSDSSIIGWNCYTSQTLFKITQDQIRGTNAPWVSISSAPS
                     SLTNGNASVVACGSNNGVLAIINCNSGSVLHLSAVIQLKPEQDELDASIESIAWSQSF
                     PLLALGLVCGEILLYDTTSWKVRHRFLLEDSVTKLLFDDHDLFVSCINGKVYQFDART
                     GQEKFVCTGHNMGVLDFVLTKKNDGPRRIITAGDEGVSLIFEVPN"
     gene            complement(<604217..>604930)
                     /locus_tag="HG535_0F03110"
                     /db_xref="GeneID:59237559"
     mRNA            complement(<604217..>604930)
                     /locus_tag="HG535_0F03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289631.1"
                     /db_xref="GeneID:59237559"
     CDS             complement(604217..604930)
                     /locus_tag="HG535_0F03110"
                     /inference="similar to AA sequence:RefSeq:NP_009815.1"
                     /note="similar to Saccharomyces cerevisiae RIB5 (YBR256C);
                     ancestral locus Anc_7.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145526.1"
                     /db_xref="GeneID:59237559"
                     /translation="MFTGIVEHIGTVLGYQAFDDTASGGNGVSITIGNAKPILLDCHI
                     GDSIAVNGVCLTVTEFNEDTFKVGISPETIKRTNVASWQQGAKVNLERAVSQDVRFGG
                     HYVQGHVDTVATIESRKSEGNSIIFGFKLRDPQLEKYIVEKGFICIDGTSLTVTDVLS
                     DGTFFISMIKHTQENVIMPFKKTNEEVNIEVDLTGKVIEKQIQVTLDNQIKNEDSPLN
                     KLVGKIIEEKLEKYLNGRT"
     gene            complement(<605117..>607078)
                     /locus_tag="HG535_0F03120"
                     /db_xref="GeneID:59237560"
     mRNA            complement(<605117..>607078)
                     /locus_tag="HG535_0F03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289632.1"
                     /db_xref="GeneID:59237560"
     CDS             complement(605117..607078)
                     /locus_tag="HG535_0F03120"
                     /inference="similar to AA sequence:RefSeq:NP_012249.1"
                     /note="similar to Saccharomyces cerevisiae BAR1 (YIL015W);
                     ancestral locus Anc_7.182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145527.1"
                     /db_xref="GeneID:59237560"
                     /translation="MAFPVSFLSLYLMTWYISSHVRAFPTGVITPANKLDSLEIPITR
                     VENPFRNALRKRSGSGLEIDLRYEQDLFYAATLDIGTPVQEITVLFDTGSSDMWVMSS
                     VNPYCLPEKGTATYSNKSYNGGEISPSIDCQLSGTYDANVSSSIQKLDIGRFYTNYSD
                     GSFADGYWCRERLVLNGRDISNLQFGVADVASTPAGGVLGIGFQSLESVRGYSDAPGD
                     FYPNFPQVLKNEGLINTVAYSLHLNSNSGSIVFGATDRTKFAGDMYTFPMVNQYPNIV
                     DKPATLAITLQGLGIRSAKKCKQKTVTTTKTAALLDSGTSLMSAPQNILQDMASFVNA
                     FYSEKDQIYMLKCPPSDDDTEFHFDFGDLTIKVPLSNLILQPPQNGYCGFGVLPGDES
                     FTLGQVFLSSAYVVYDLDHYQISLAQARANSQISEGQVEQIPENGNIRDAIRASAMPW
                     SSTEPFSVTSDIFEGNVLHCTSRQSANFTTSSNLYQSKPTSPNNARYPLARSTASSFS
                     VIESAPLSRSVRASGTYSSMISLATTIAASVFDKSQDTTSGVSSMSLHTIGAPEASIK
                     SASSLSITSSGISALPISSSTNASPNSNPGKEVNTNATKSHSKRSTFKPAKKSTTSQQ
                     HITDRSILVTTATKIIHLTTTVTAKFCTL"
     gene            complement(<607403..>607906)
                     /locus_tag="HG535_0F03130"
                     /db_xref="GeneID:59237561"
     mRNA            complement(<607403..>607906)
                     /locus_tag="HG535_0F03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289633.1"
                     /db_xref="GeneID:59237561"
     CDS             complement(607403..607906)
                     /locus_tag="HG535_0F03130"
                     /inference="similar to AA sequence:RefSeq:NP_012248.1"
                     /note="similar to Saccharomyces cerevisiae SNL1 (YIL016W);
                     ancestral locus Anc_7.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145528.1"
                     /db_xref="GeneID:59237561"
                     /translation="MEWASSYYRANIKPLVETYVLDNDNGVLSNALLLTGASAIVVSA
                     MLWRSAGLSAKKTEKKKTKKQSKQEQNKVHSLSFEEQIESVWLRFNNEYKNGVDQLFE
                     SFDKNDEKKIYQRNYYNEMLLKLLIELDGIDLANLQGERKIKLKERRKAVIKEIQTYL
                     RKLDKLR"
     gene            <608500..>611181
                     /locus_tag="HG535_0F03140"
                     /db_xref="GeneID:59237562"
     mRNA            <608500..>611181
                     /locus_tag="HG535_0F03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289634.1"
                     /db_xref="GeneID:59237562"
     CDS             608500..611181
                     /locus_tag="HG535_0F03140"
                     /inference="similar to AA sequence:RefSeq:NP_012247.3"
                     /note="similar to Saccharomyces cerevisiae VID28
                     (YIL017C); ancestral locus Anc_7.184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145529.1"
                     /db_xref="GeneID:59237562"
                     /translation="MPASMRYEELQKLINILIGDQLAKVDLLTNSDTKILAELLDFGA
                     SSSLQDMKLDILFILLNLEETIRNQLGELYISTVEKVYEKSSFLLNFAQNDPFKNYKY
                     MRLINLCVEYCPLINYPHFNEIQANLVKMLRTLAYEREMYDNVSYLKTVIEMFKFLLH
                     FESANRISIELSSPLEDMLLTIVDKYALNLNFKYTTCSKTSKSSSVSVKYSLLENEIS
                     ETNACIPNPVHVKNSLDSSLLSLALTLYPSAYHSQSLYTRNNKSLWDNVDFNFFIASL
                     LKSSDITLRCAVLTYLICPYLEQENKWQDKKWLQLYLPYLVDTLNFSNIPWWFDPFEN
                     LILLIDLYHKHEPLNNPVITFLTKTNVMYGLLTLFAQCLSLKTQSRSSMNCTTKFIRL
                     CASFAAYDELYRTLLLEQKFLLHHLEFGLESHLKLLKQFLAYRDKIIELEGPGVLNLP
                     PIYDKETVMAWLLLLKSFSRSVSALRTSLKSNKLAELLLELLRVTYDITQDCDFAGND
                     FLKAEIDIMGVNLGCICNFVVEFSNLQSFMLKNGIVKITGEILNDPLFNSKRRWKTSR
                     YNDSFDRDSIDSVKTNALWVLRHLMYNCQNSEKLELLSEVPMSTILEFINDPSWSVQE
                     QCFQLIRNLTCNSRKVVNILLENFQNIDYKNDRNTGSGSKLVTGSTYLFEYLARKMLL
                     LNPSDSIQKKTLEGVLYIIVNLAAVNENKKELVIEQAEILSIIRDILSESPQNLGHYS
                     NDSKLKLACLWVLNNLLWDSTISRYTHYSLEGYAPSPHEEGPKQGNSTWVYGNSNAPT
                     HSNAEEFEDESEYDSDTKDDDNDSENVEEEFVHGPGVGADSAIHTNRATVERCKKLVD
                     MGIYDLVKQNKDEDSLSVREKAKTLQYHMDLLLKGSI"
     gene            <611460..>614567
                     /locus_tag="HG535_0F03150"
                     /db_xref="GeneID:59237563"
     mRNA            <611460..>614567
                     /locus_tag="HG535_0F03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289635.1"
                     /db_xref="GeneID:59237563"
     CDS             611460..614567
                     /locus_tag="HG535_0F03150"
                     /inference="similar to AA sequence:RefSeq:NP_116686.3"
                     /note="similar to Saccharomyces cerevisiae MET10
                     (YFR030W); ancestral locus Anc_7.185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145530.1"
                     /db_xref="GeneID:59237563"
                     /translation="MSMYSTNPFGVPSDPKKLPSYATPVSSISSVLYNNLKTIFTYKT
                     FSEPDLLDSCLKQWSSRGVNSVFFRELDVRTGAGLAPLGFSHGSSAVTGIVAPGYALP
                     YFVNSFHETTSPKDKFVFSVSSLNYDEESGAIVSDYVTPLQAASRLNFTVVTPVSASE
                     VQAVTLLSLAIARFSRSKAAVNLYEGSYAKSVAEIREKISQDGLFDKLEKALPLTASF
                     EDVLDKFNEFTNLKLHNFQYTGASDAETVFVTYGSLESQLFHDALVGNDSKSALIAVR
                     VPLPFDLERFVAQIPSTARKIVVIGQSLDGNSATYLRSQVSAALFYHRRRNVSVSEYI
                     YQTNFVWSPTAVEQVISTFIPEFVSSTINATSKGFTFWASDKSSVVDLSSRLVHALSL
                     VDGQTITLRSIFDNIANAGTFQSQFTTGPVSENLTISNIDNADVAFVENVALLDTLDV
                     TATVKNNGTILVISRKSLKELDQLKGETYVKDLGINEKFFVSAAEKNIKVVIIDAHSI
                     GDKEETKGHTLSFVSQAVFWKYAFGYDVAESVRRIWSSAGPDIELLAAVLSDIITTAF
                     EDGVKEVPSGALKSIVEDFSKKESTDTECLPIYVTETSFTPNQSKIEEIAEVETGKIS
                     DVTRKLVFKEAYGVENVLRPDLPVKNFVVKVKENRRVTPSDYDRYIFHIEFDISGAGL
                     KYGIGEALGVHARNNVDMVTEFLRSYGLDENQTVLVPNKDDSNLLESRTVLQAFTDNL
                     DIFGKPPKKFYESLVEFATNEDEKLALENLISPAGSVDLKRYQDVEYYTYADIFEKFP
                     SARPSVEHLVSMIAPLKRREYSIASSQKVHENEVHLLIVVVDWVDAKGRKRFGQASKF
                     LSELQVGSEVVVSVKPSVMKLPPNPKQPVIMSGLGTGLAPFKAIVEEKMWQKEQGHEI
                     GEVYLFLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQPEKIYIQDRIKEALVQ
                     LKPAMIDKVGSFYLCGPTWPVPDITHALQEIISADAAEKGVKVDLNAAIEDLKEASRY
                     ILEVY"
     gene            complement(<614618..>618130)
                     /locus_tag="HG535_0F03160"
                     /db_xref="GeneID:59237564"
     mRNA            complement(<614618..>618130)
                     /locus_tag="HG535_0F03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289636.1"
                     /db_xref="GeneID:59237564"
     CDS             complement(614618..618130)
                     /locus_tag="HG535_0F03160"
                     /inference="similar to AA sequence:RefSeq:NP_116687.1"
                     /note="similar to Saccharomyces cerevisiae SMC2 (YFR031C);
                     ancestral locus Anc_7.186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145531.1"
                     /db_xref="GeneID:59237564"
                     /translation="MKIEELIIDGFKSYATRTVISDWDPQFNSITGLNGSGKSNILDA
                     ICFVLGISSMATVRASSLQDLIYKRGQAGITKASVTIVFDNSDKSNCPIGFTNSPKIS
                     VTRQIVLGGTSKYLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE
                     ILSLIEEAAGTKMFEDRKEKAERTMAKKEGKLQENRTLLKEEIEPKLEKLRNEKRIFL
                     DFQETQTDLEKTERIVNAFDYYYMNNRSKNLKDTLEMSNIRSKELGEMIEKINNELVS
                     LNQDMKDTKAAQQREVNKDGKLAQFEQKKSDLLSEISRKKASLAICMENFDDTKQKLN
                     YLETSKNENEVKLSTRTQDFKQVEKEYKELSGTLNDLKEAHKGKEELLSTLETGISSS
                     GTTAGGYNEQLISAKQLRNEAEIAIKKLKMKIDHLQKEHAANQPKLTDAIKENEFNLQ
                     RVKEYQQECDALSNELSKSGYNPRLVEELKANESRIKQEIYALNNESAYLERRVANVD
                     FSYSKPYASFDCNSVKGVAAQLFDLPENNYESATALQVCAGGRLFNVVVDNEKTASEL
                     LEKGRLRKRVTIIPLNRIFARTLNNDVLRLARQIAPEKVELALNLIAYDSGVSKAMQF
                     IFGSSLICKDADTAKRVTFHPQIRVRSITSDGDVYDPEGTLSGGSRNNKNSILIDIQK
                     YNTAKKRITELESKLEAIQRELTEQEDVLQKSKNLQNSLNMATHKVTLARRNAENNKG
                     IQFIKRDEGIVKEIEGCEKEIERKAAFVIEREAQIDTIQKDIKEFSSDKGLKLKQLKQ
                     EIEKLAVKIKFLEEETELKYDRHQTLQLETEQFAADIASEEESKKSLFDSVQAHETEK
                     LHIEKDLKCLEESFKINEAHLIEEERRLVEINEELKELNEIIKQKSESRSKCELELQT
                     LKNDSNKSKSITESLEQKMSHLLSSHDWLEDHAVVASIVQQNDGLDLQQYRQRVCHLQ
                     EKFQDMRRKVNPNIMSMIENVEKKEFALKTMIKTIEKDKVKIQETIEKLNEYKKETLI
                     KTWKKVTKDFGSVFADLLPNSFAKLVPLEGKEVTEGLEVKVKLGNLWKDSLVELSGGQ
                     RSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGAQFIVVSLKE
                     GMFTNANRIFRTRFQDGTSVVSVM"
     gene            complement(<618492..>619584)
                     /locus_tag="HG535_0F03170"
                     /db_xref="GeneID:59237565"
     mRNA            complement(join(<618492..619252,619581..>619584))
                     /locus_tag="HG535_0F03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289637.1"
                     /db_xref="GeneID:59237565"
     CDS             complement(join(618492..619252,619581..619584))
                     /locus_tag="HG535_0F03170"
                     /inference="similar to AA sequence:RefSeq:NP_012246.1"
                     /note="similar to Saccharomyces cerevisiae RPL2A (YFR031C-
                     A) and RPL2B (YIL018W); ancestral locus Anc_7.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145532.1"
                     /db_xref="GeneID:59237565"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLREGAAKLRTLDYAERHGYIRGV
                     VKQIIHDAGRGAPLAKVVFRDPYRYKLREEIFIANEGLHTGQFIYAGKKASLNVGNVL
                     PLGSLPEGTIVSNVEEKPGDRGALARASGNYVIIIGHNPDENKTRVRLPSGSKKIISS
                     DARGVVGVVAGGGRVDKPLLKAGRAFHKYKVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVSGQKAGLIAARRTGLLRGSQKTQD"
     gene            complement(<620281..>621381)
                     /locus_tag="HG535_0F03180"
                     /db_xref="GeneID:59237566"
     mRNA            complement(<620281..>621381)
                     /locus_tag="HG535_0F03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289638.1"
                     /db_xref="GeneID:59237566"
     CDS             complement(620281..621381)
                     /locus_tag="HG535_0F03180"
                     /inference="similar to AA sequence:RefSeq:NP_116689.1"
                     /note="similar to Saccharomyces cerevisiae YFR032C;
                     ancestral locus Anc_7.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145533.1"
                     /db_xref="GeneID:59237566"
                     /translation="MPNNQSYQITKERVYGSLDIKMSSSSIEITRLYISNLNFSTTEA
                     ELSDYLRQYSVVSVLIPSQTIRGFRSNQVRPLGIAYAEFESSELLKRAIDQLNGKEFK
                     GRDLKLKPYVPYSPEHVTRKMSKSKTLCKLRHLKKHYKIEPAVEPAAEITTEPSCEEP
                     DPLVQEEVVQELNAEVHESAAEIEGQNNEPAEEPEAELSEDTVYLGYLPKGCTDVELR
                     EHFKEFKPQEIWIFRTRSTKSRHLRFRRHFIAALVRLKTPEKMNTVIERTDRKKLMGK
                     KQIVKPAITKKIHEMKRMAAEKKNMEESNCVVFEVEDIREPGEPSEPSGSNASDEANQ
                     PEGNTEQSEIQGSSEGTTAHIVPEKKADAIHS"
     gene            complement(<621656..>621844)
                     /locus_tag="HG535_0F03190"
                     /db_xref="GeneID:59237567"
     mRNA            complement(<621656..>621844)
                     /locus_tag="HG535_0F03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289639.1"
                     /db_xref="GeneID:59237567"
     CDS             complement(621656..621844)
                     /locus_tag="HG535_0F03190"
                     /inference="similar to AA sequence:RefSeq:NP_116690.3"
                     /note="similar to Saccharomyces cerevisiae RPL29 (YFR032C-
                     A); ancestral locus Anc_7.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145534.1"
                     /db_xref="GeneID:59237567"
                     /translation="MSKSKNHTAHNQTRKAHRNGIKKPKTHKYPSLKGVDPKFRRNHR
                     HALHGTARVLAAERKAKA"
     gene            <621953..>622423
                     /locus_tag="HG535_0F03200"
                     /db_xref="GeneID:59237568"
     mRNA            <621953..>622423
                     /locus_tag="HG535_0F03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289640.1"
                     /db_xref="GeneID:59237568"
     CDS             621953..622423
                     /locus_tag="HG535_0F03200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145535.1"
                     /db_xref="GeneID:59237568"
                     /translation="MYRVFAPRVLATDLIVSELFPCELPSYKWSLSSWPHRYLSYIEE
                     CYTTGHSSLSRLSLVIVSVTYFYLRLLTLLLKSATETHNMYNIPLLTVTELKSSLCER
                     TSFHQTISFPDRIARQQEMKKKEYCLSVRTSNPALNRPNTSSSTSSLRSFSHIA"
     gene            complement(<623006..>623485)
                     /locus_tag="HG535_0F03210"
                     /db_xref="GeneID:59237569"
     mRNA            complement(join(<623006..623314,623402..>623485))
                     /locus_tag="HG535_0F03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289641.1"
                     /db_xref="GeneID:59237569"
     CDS             complement(join(623006..623314,623402..623485))
                     /locus_tag="HG535_0F03210"
                     /inference="similar to AA sequence:RefSeq:NP_116691.3"
                     /note="similar to Saccharomyces cerevisiae QCR6 (YFR033C);
                     ancestral locus Anc_7.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145536.1"
                     /db_xref="GeneID:59237569"
                     /translation="MISSITDLLAELKDTIVPTVAKAEDDIEETEAGDDEGEDEDEDD
                     NEDEDEDDEDEEATDQLDTLKEECQNTPEGKTLVHHLQECSERVLKASQEPGYEEQEH
                     KEDCVEEFFHLQHYLDSCAAPRLFNQLK"
     gene            complement(<623839..>625695)
                     /locus_tag="HG535_0F03220"
                     /db_xref="GeneID:59237570"
     mRNA            complement(<623839..>625695)
                     /locus_tag="HG535_0F03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289642.1"
                     /db_xref="GeneID:59237570"
     CDS             complement(623839..625695)
                     /locus_tag="HG535_0F03220"
                     /inference="similar to AA sequence:RefSeq:NP_116692.1"
                     /note="similar to Saccharomyces cerevisiae PHO4 (YFR034C);
                     ancestral locus Anc_7.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145537.1"
                     /db_xref="GeneID:59237570"
                     /translation="MAYAGESEPMYYEGHEAPLRYDSDGRGQEHGNEEQHQEDHAIGI
                     AQSSRSILDQVDDFLNDHQNEREHTAEGEIKDGLPSSHSQSTTWMPSGMQVDLDHLSE
                     TLFTHPHANEHNDDHDMELSMGLDLDKEKNGSHHSHSLAHGPAVRPHHIRPDLVASPM
                     VSPMITATETHLQIDTPFLGHSNGHIPSGYGQDGGHGLAHGSDHLYSLPNGGNQWKPK
                     TLASQSQFSPLSSPALTAIDNAQRINFALPESTLSSASMRKKTTRSNKRRTPSNSTNS
                     SSSSSTTKVAKNSPRLSANPSSSSKRHSKASPITSNANGNSWDDLIFRLPESSIEVDH
                     HNIANNVTTDGETPQSSSGRMSSSPESRMTPATLMNYPKVILPSNTISASRIDHSMSP
                     HDFTKNNIGEYSTNANSNDSNKSYTNDRNSNNSSNNDGDNNNNNNNNNNSNNNNEENH
                     NHTHKHHSNPNSSNANSNNSSLNGAHVIRATESPVIKPKPSIPLSRNGSKVKVIDEQP
                     TPSTSTIAQTMVAPEKQRRTSRSKRKASVSSSINGGGGSSDDGDQLKKEVHKAAEQGR
                     RNRLNVALNDLDSLLPLNLKESITIPSKATTVELACSFIRQLLEAEKNSSTS"
     gene            complement(<626516..>627475)
                     /locus_tag="HG535_0F03230"
                     /db_xref="GeneID:59237571"
     mRNA            complement(<626516..>627475)
                     /locus_tag="HG535_0F03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289643.1"
                     /db_xref="GeneID:59237571"
     CDS             complement(626516..627475)
                     /locus_tag="HG535_0F03230"
                     /inference="similar to AA sequence:RefSeq:NP_012245.1"
                     /note="similar to Saccharomyces cerevisiae FAF1 (YIL019W);
                     ancestral locus Anc_7.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145538.1"
                     /db_xref="GeneID:59237571"
                     /translation="MDTTEEGYSKMLELQRLAFEKQFGTLESLGYEDKTKTETETELQ
                     SNRSSTSGSDASSDEDDEEDEKYYTDTDDASEAGPDSEDDAQQHVKQPRVIKFNGPSD
                     TYVPPTRHEIKQLRTGRPLKTHPDENAHKRKTENPSGNASDEEDNEAENLKNDLELQR
                     FLKESHLLNAFDSNSYDDDTIVGKARSRTLEMRLKTISATNGRHQKLNKLEKVPINIR
                     KGMINKHMKKIAQHEQEARDGGVVLSHIKKGEFRKIDATYKNDIERRIGTTIKKQHHS
                     DRKNRQRGLKINTVGQSTRNGLIISKHDIERINGGSNHKKSRR"
     gene            <627655..>628440
                     /locus_tag="HG535_0F03240"
                     /db_xref="GeneID:59237572"
     mRNA            <627655..>628440
                     /locus_tag="HG535_0F03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289644.1"
                     /db_xref="GeneID:59237572"
     CDS             627655..628440
                     /locus_tag="HG535_0F03240"
                     /inference="similar to AA sequence:RefSeq:NP_012244.3"
                     /note="similar to Saccharomyces cerevisiae HIS6 (YIL020C);
                     ancestral locus Anc_7.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145539.1"
                     /db_xref="GeneID:59237572"
                     /translation="MTRFVACIDLHNGQVKQIVGGTLTDDRDDSLKTNFVSEHSSEFY
                     SKLYKENNVIGSHVIKLGPNNDEAALRALRESPFFLQIGGGINDSNCLEWLQYASKVI
                     VTSWLFTQDGQFQLSKLIKISKICGKDRLVVDLSCRRTKDNEWVVAMNKWQKLTDLNL
                     NATTFQILSEYADEFLIHAADVEGLCKGIDKDLVTNLYQWTRDLPQNIKIVYAGGAKS
                     VSDLSLVNELSKGKVDLTYGSSLDIFGGNLVKFDDCCKWNENH"
     gene            complement(<628487..>629425)
                     /locus_tag="HG535_0F03250"
                     /db_xref="GeneID:59237573"
     mRNA            complement(<628487..>629425)
                     /locus_tag="HG535_0F03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289645.1"
                     /db_xref="GeneID:59237573"
     CDS             complement(628487..629425)
                     /locus_tag="HG535_0F03250"
                     /inference="similar to AA sequence:RefSeq:NP_012243.3"
                     /note="similar to Saccharomyces cerevisiae RPB3 (YIL021W);
                     ancestral locus Anc_7.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145540.1"
                     /db_xref="GeneID:59237573"
                     /translation="MSEEGPQVKIREATKDNVDFILSNVDMALANSLRRVIIAEIPTL
                     AIDSVEIEANTTVLADEFIAHRLGLIPLQSLDIDQLEYCRDCFCEDHCDKCSVVLTLQ
                     AIGESESTTNIYAKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELTLKCIAK
                     KGITKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDIMKEWPPSKNSEYEDPPNKGDP
                     FDYKAKANTFYMNVENVGSITTDQVVLRGIDTLQKKVASVLLALTQMDQDRVNYASGN
                     NENTITGINDGDTIMNGTQDQNPYGNGDSNGYDDSW"
     gene            <629654..>630013
                     /locus_tag="HG535_0F03260"
                     /db_xref="GeneID:59237574"
     mRNA            <629654..>630013
                     /locus_tag="HG535_0F03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289646.1"
                     /db_xref="GeneID:59237574"
     CDS             629654..630013
                     /locus_tag="HG535_0F03260"
                     /note="similar to Saccharomyces cerevisiae ADL119W
                     (Scer_YGOB_ADL119W); ancestral locus Anc_7.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145541.1"
                     /db_xref="GeneID:59237574"
                     /translation="MNMNYPVPDTRFEQTFKRALVREAERERASQWKKMGLQDPKAIS
                     QLQKVKPPTVSKLVVCKVIFRDVFFMPFVQGIIWTTALIALKPWLGLVVKNGRKIGSK
                     VYRMVLGTDLLKVPRNV"
     gene            complement(<630218..>631501)
                     /locus_tag="HG535_0F03270"
                     /db_xref="GeneID:59237575"
     mRNA            complement(<630218..>631501)
                     /locus_tag="HG535_0F03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289647.1"
                     /db_xref="GeneID:59237575"
     CDS             complement(630218..631501)
                     /locus_tag="HG535_0F03270"
                     /inference="similar to AA sequence:RefSeq:NP_012242.1"
                     /note="similar to Saccharomyces cerevisiae TIM44
                     (YIL022W); ancestral locus Anc_7.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145542.1"
                     /db_xref="GeneID:59237575"
                     /translation="MQGRAIRQNKSTMIIFGRAIQESVPVGAYRVPFSTCTRSLQGQR
                     SPIDIFRDTFKKEWKKSQELQDNIRTLQDASGRLGESEAYKKAREAYARAQKGSTIVG
                     KTLKKTGETMETIATKAWESDIGKNTRKAATVAAKKIDESFEPVRQTKIYKDVSEVID
                     DGDSSRYGGFITKEQRRLKRERDLASGKRTRAVKSNEDAGTALVATNIEAKESFGKRV
                     EDFKEKTLLGRAIQRLKSAFWDESGNPFIVFLRKITGKIGGFFAETEAARVLGQFKLM
                     DSTFNNEGFTQHLRNYIIPEVLEAYVKGDQKILKKWFSEAPFNVYSAQQKVFRDQQLF
                     ADGRILDIRGVEIVSAKMLPPQDLPVLVVGCRAQEIHLYRKAKTGEVAAGHESNILMS
                     SYAMVFTRDPEQIDDEETEGWKILEFVRGGSRQFT"
     gene            <632045..>635332
                     /locus_tag="HG535_0F03280"
                     /db_xref="GeneID:59237576"
     mRNA            <632045..>635332
                     /locus_tag="HG535_0F03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289648.1"
                     /db_xref="GeneID:59237576"
     CDS             632045..635332
                     /locus_tag="HG535_0F03280"
                     /inference="similar to AA sequence:RefSeq:NP_012233.1"
                     /note="similar to Saccharomyces cerevisiae ULP2 (YIL031W);
                     ancestral locus Anc_7.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145543.1"
                     /db_xref="GeneID:59237576"
                     /translation="MASKRRKINGFLPIDKLAGDVANTTSSLDGGTERGQHDHGNRTV
                     SKRYKEYRRTPKVVEQLKHISAEDFLPLANRSADLQPSDLENDSIQNSSDSARNGNQA
                     TTRHASAKNSIQEVKNDEFTKEDELEAIQGDSEDEGFESLEGTPPLKRTVKIGNGLLS
                     SSPFDIWKNNSNLVVTKFNLSGVLNTIDVRKKIEEKSQCLLKFINDASGPRVTFTHRN
                     FDIKNAQVDFRKDCESVIFDKDYSCIGMVFKEFRFIDMDNKLKIGRVQTKLMAWSNNT
                     TVKSNKIHKIKNILSNINNFKLRVVDDKKSLIKTLDEIAIREYKNKVIMANNSTNEAF
                     EKLRNKRHFWEKSEFQSLGVQNRLLIGKLSPSSSLSGQKIRIPTLSDSSEESSPRRPQ
                     QNTISGINPLNFYSKPTEKVDAGLGSTPSYSTLRKSPRTRSETPNLVQGTLWDLDNEK
                     NLEVPETLDPALSHKFPDGASYMITNQDFKCLYNHDWINDSILDFFTKFYAEKSIQED
                     VISRGDIHLMSSFFYTKLVSDPSDYYGNVKKWVANSDLFRKKYIVVPINMNFHWFGCI
                     ITGLDLILEFFQNSDGKVDKTKLSNENRIENDNYREHDSEGPLRIKNALNSSDTNKKA
                     VSLTEDEEVTLSTPIITILTFDSLRQTHTREIDPIKEFLIAYAKDKYEIKLDKALIKM
                     KTCAVPQQPNMSDCGVHVILNNMKFFENPRKTIEVWRSTKTRSKSSGKVVNEYFERNR
                     RDSARKFLREVVWDLHAEQLKIMKQNGNYPAKYANCFEKVGQSGDNEDDGDLEIIEDT
                     EDYKKALAKAVIPETGRGNENLTKGSSELPDSPQKVNDVAASSLDEPKKISPAQARPT
                     DERSTIRALEGEPVDTISSESYSLERPPIGNVSLESPRNFLESSPIRKGGRHTASDST
                     SPYFGDSSLKSRAETFDTESLSSTKVLIANDCLMDENQKDTKSGSPLLSDLNSLKRQE
                     PDQDEDRVSATIDLLLSPCRQKKYILSGIERDDDVNLLGTLKSQSSLTRVKRDVGGEP
                     NKSIDLRNAEESTAGLNRWKYSEQKPSKPYLAATESDRLSFVSGMADSKHDIQTIYSD
                     DDMKEVR"
     gene            complement(<635474..>639388)
                     /locus_tag="HG535_0F03290"
                     /db_xref="GeneID:59237577"
     mRNA            complement(<635474..>639388)
                     /locus_tag="HG535_0F03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289649.1"
                     /db_xref="GeneID:59237577"
     CDS             complement(635474..639388)
                     /locus_tag="HG535_0F03290"
                     /inference="similar to AA sequence:RefSeq:NP_012234.3"
                     /note="similar to Saccharomyces cerevisiae SSM4 (YIL030C);
                     ancestral locus Anc_7.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145544.1"
                     /db_xref="GeneID:59237577"
                     /translation="MDSRAEELLTGIQGDASTYDDVPAGASCRICRGEHTTENPLFHP
                     CKCKGSIKYIHESCLMEWIASKNIDITKSGTVVNCDICHYPINFKTKYAENMPERIPM
                     SLLLKRSCISHFFRLKEIITIVLAAVLFLIGVPLTWNFFGKLYTFILDRELPYRDDFL
                     KSIIFGFSSAPIKEDIESSNILLQMVLNYRFSILQIIMVVILHISLYFQYDMIVRESV
                     FSKMVFHKIGPQYTKEELIKIQLKERFPMMDDETIENVAKIMKGREEIRNLAQQENNH
                     NNNPDNADNEEESDDEQENANQNEEQPGTENTNAFADEAVNESQHESNAGLDSSSILA
                     EQDSATESESESEVEEQIEDIRPLDAFVHHRAQNELDELLDQNLQAAADHPAAGPEHI
                     PVQPAAQVLPQAPEPIPAPRIVDEEIVNDIGDANNQIPQAPIIINLKLKLMNVIAYYI
                     IAVVLIAVYLSASYLLPTFTGFGLLKCYAGLVKILLSGLFQLCYLLHLPRFYATSLTK
                     IPQMNVLDSMVKENIIASCVKIYQSYNTNAMKSSVILRSVPALVSYTTTISLINISSE
                     LICKGFGRENGMKNRSRRFIFQILFAIKCTFKVFILFFIELAAFPVLTGLMLDFSLFC
                     PILRPGEIFWAPRLCEDWPPSIFFLYWGVGTLYMYWFARYIGMIRKHIIRPGVLFFIR
                     SPDDPNIKILHDSLIHPMSIQISRLCLSMFIYAVFIIVGFGFHTRFLFPVLMKSKMLT
                     IQNGFLHHFGVDSMNPKWEISVYPWPFYIAKQVIESTSSVKLYIRKYWTRVFDVSSRK
                     LRLSSFMLNNDIPTERGCILYRNWFYRSFARRKAQWSNSELYTSPKTASRAAQLFKEN
                     KAVHAYFIPDGILMRVPSSDIISRTYVQTLFVPVTKDDKLLKPLDLQAIEEKNTRNAG
                     EFGYLDEQNTEYDGYSIVYTPPNFRSRYILLLVFVWLFASLLVLTTTFASQFTFTLIA
                     AILVFPAYIFAYVLANVFLVKSPSKKHYEVFYNGYITVIRSNFQHLDIFFVCFGAIAL
                     ALMLERYHQLSMSRIKLEEHIVPVAIDGEEFEVENLHNERVDNHSENQIESWGTILKH
                     VLNRDEIKVVLYLTIMVIMVWLNSLGVIVNMEQLYFIQGYFFHDTFKGYRGVFNGFWN
                     PSSLQTNACFTLLSIHFIYTQGLNFAANRNRSFFPLFRYLLKESLRKLKFMLYTTMPI
                     IVSWLACSTLEYLFHRERYTTFGAPLVFLWRYRLKSEFDHIEWTFPQHLCYLSVTAIL
                     ATFAISHLVKFVKKWFGDATQNVKDEVYAQGRSLENFTNDNF"
     gene            complement(639966..640038)
                     /locus_tag="HG535_0Ftrna13K"
                     /db_xref="GeneID:59237885"
     tRNA            complement(639966..640038)
                     /locus_tag="HG535_0Ftrna13K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59237885"
     gene            <640873..>641250
                     /locus_tag="HG535_0F03300"
                     /db_xref="GeneID:59237578"
     mRNA            <640873..>641250
                     /locus_tag="HG535_0F03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289650.1"
                     /db_xref="GeneID:59237578"
     CDS             640873..641250
                     /locus_tag="HG535_0F03300"
                     /inference="similar to AA sequence:RefSeq:NP_116694.1"
                     /note="similar to Saccharomyces cerevisiae CDC26
                     (YFR036W); ancestral locus Anc_7.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145545.1"
                     /db_xref="GeneID:59237578"
                     /translation="MLRRAATTVKLGQEDVADLIAELEEEKLQLRIQSQKKNLVRSGT
                     AANMTSASSKTLGEDLEPGSSEDNSVQISPLNGKRSEVDQIEVGPPTASLSWSNRHIR
                     NHDRDRENGRYGEENPFYRDDVV"
     gene            complement(<641300..>641701)
                     /locus_tag="HG535_0F03310"
                     /db_xref="GeneID:59237579"
     mRNA            complement(<641300..>641701)
                     /locus_tag="HG535_0F03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289651.1"
                     /db_xref="GeneID:59237579"
     CDS             complement(641300..641701)
                     /locus_tag="HG535_0F03310"
                     /inference="similar to AA sequence:RefSeq:NP_012237.1"
                     /note="similar to Saccharomyces cerevisiae KRE27
                     (YIL027C); ancestral locus Anc_7.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145546.1"
                     /db_xref="GeneID:59237579"
                     /translation="MRLLSKLLLSLSVILLGHSGFSSHEFRQLLKNTSREMPSSMLRH
                     IPVDIQYEAIVGLVLFVLSTFLSFEKITYYPLQGGRELLQLNQYLQDIDMSKANNVNN
                     LTGKDPFGAITYTPNFIDIHKKRKHVATGAL"
     gene            complement(<641872..>645096)
                     /locus_tag="HG535_0F03320"
                     /db_xref="GeneID:59237580"
     mRNA            complement(<641872..>645096)
                     /locus_tag="HG535_0F03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289652.1"
                     /db_xref="GeneID:59237580"
     CDS             complement(641872..645096)
                     /locus_tag="HG535_0F03320"
                     /inference="similar to AA sequence:RefSeq:NP_012238.1"
                     /note="similar to Saccharomyces cerevisiae IRR1 (YIL026C);
                     ancestral locus Anc_7.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145547.1"
                     /db_xref="GeneID:59237580"
                     /translation="MSQVRRSSRIHSRSIEERDTEEGRVGEVQTDGETTVQGILSDES
                     DNEANDDDSEYEEPSQRKKRKINSKSGDRAVKKAKNSANERSNRMNVKANSRKDKEEL
                     ERISKDFEATELFEILATSEDYSVDELLRDWLGTYIENRDQFLQEFINLLLCCTGAIA
                     RVENHDVHSNESSNETIGEVQLMFQRQHIHEFHLLISKKNKKRSKYQPLYENFVEFMS
                     RLMESANELQLLYCESTEVDGLISTSPLVLDLLTWLSALSVCKLRALRYVSTLTLYLF
                     QDFLTEHVVDLERNYLSKLSKQLAVEQRKKRSNTKTIEKLESAIEEVQSSKMVTQNII
                     DNIIKVCFVHRFKDVDDTLRCMSMIHLSTWIRNYPEYFLKVTFLKYFGWLLSDSSAEV
                     RMHVLRVLPQIITRDHNKAVDNSAIRQFFERFKERLLEIASKDENLEVRMNAVNVLIE
                     VVTLGYLEEHENLQITSLIFDDNQIKVTSYSKHSRLLGSLAKFFSQVVIERCEEFTKN
                     HDIIDETIYGIRAASAIKIGILASLLNQSLLINFQKEEGLDSEAKIAALYQASEFLYP
                     YFSSLLQDLCQLLSYDGEYDHPDLLDNSENIHENDESYLKLLLPNDSNNIILYVTTLN
                     GLCCGGVNMKNQPKLKVAKIILPQLDILFSQLPLHSSNVLSSVMRIFNLFTFEDWIQS
                     GHEKSIVHIAKRIVRAFIETRLSSKPTDTKFKAFSETIQVIHSMNLIELDELWLNQIT
                     HLKIQLSKYLDEYMALPRGATNVNERIDTLYTMFINKLGLLGKTYPIEFDNALLSKLL
                     IDHISKIPDQINQYEQDIIELINFKLLTLLITCQLQKWTDIFEKATSTESIPHVPLPV
                     LQSIAKILSVMNSTLLELHGKAEMSSSRFLLTWQLVNSFIDNVVALNVIELRLPEVAR
                     SWTRAFKEIFPPYLPSETQFVISQVFLYLESLFAKEINVPLDRFAEEEVYFNDIKEDV
                     FGDESERQLLVFLLKLKGLSRLGLLGDEEYSRIKLNKGKLGPLYESIVDDTFFQEGKK
                     TERQLKNHLQPAQKLLSINEESAAEEMYSDVDMLQNDPIVDSEI"
     gene            complement(<645603..>646250)
                     /locus_tag="HG535_0F03330"
                     /db_xref="GeneID:59237581"
     mRNA            complement(<645603..>646250)
                     /locus_tag="HG535_0F03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289653.1"
                     /db_xref="GeneID:59237581"
     CDS             complement(645603..646250)
                     /locus_tag="HG535_0F03330"
                     /inference="similar to AA sequence:RefSeq:NP_012240.3"
                     /note="similar to Saccharomyces cerevisiae YIL024C;
                     ancestral locus Anc_7.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145548.1"
                     /db_xref="GeneID:59237581"
                     /translation="MSNILLVIPSDVICSCSSPTDKIVITGEFDNWQHSDYILEYDGK
                     EGYKVEIPRLTGRERALFKFLVNDNRWITLSYFETLTDEQGFINNVLNYHDYDGLDDV
                     TINSSTQDENEQQEKLLSYSTEVTDAKYMSPELFSHGKLEANSSSNNPVGSNDYVNIS
                     SHGELSSIEDLEFEPYESDLEETIQYDSKVSFSTNQKPLDGLVSMVKKARTYWHT"
     gene            complement(<646971..>648152)
                     /locus_tag="HG535_0F03340"
                     /db_xref="GeneID:59237582"
     mRNA            complement(<646971..>648152)
                     /locus_tag="HG535_0F03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289654.1"
                     /db_xref="GeneID:59237582"
     CDS             complement(646971..648152)
                     /locus_tag="HG535_0F03340"
                     /inference="similar to AA sequence:RefSeq:NP_012241.1"
                     /note="similar to Saccharomyces cerevisiae YKE4 (YIL023C);
                     ancestral locus Anc_7.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145549.1"
                     /db_xref="GeneID:59237582"
                     /translation="MIMNYLMLSVSIPFVVGHTHGHSHSLEDKGVLGAAIHFFQDFVF
                     PFDARYNSLLATLIIQLLPCLIIYFVPGMRALSMGNNLIGPLNLLVSFAMGTLLGDIF
                     LHLLPEVFSSIEFHDHETAHLELIRMSAAVCGGFMIFFVLEKTMRVLLIGAGSEVSLV
                     NHTHSHSHLPSDLDNNRHNEEVFEYSHGYENDSSSSAGGSARQRKKERSSEKSPKLET
                     SQIHKPGVSVYLNIVSGFIHNITDGVALASSFYSSKNVGVSTTIAIMFHEIPHELGDF
                     AILVANGFTFSQAFKSQIINSIGSLTGTAIGCALNEITTSEQNHWDKLSESIYFFSKL
                     PGLRLPLTTGGFIYIVTMGVVPQMLQTTSQNRSQELKKWLLQFIFICIGFMLMASLAT
                     N"
     gene            complement(<648344..>650170)
                     /locus_tag="HG535_0F03350"
                     /db_xref="GeneID:59237583"
     mRNA            complement(<648344..>650170)
                     /locus_tag="HG535_0F03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289655.1"
                     /db_xref="GeneID:59237583"
     CDS             complement(648344..650170)
                     /locus_tag="HG535_0F03350"
                     /inference="similar to AA sequence:RefSeq:NP_116695.3"
                     /note="similar to Saccharomyces cerevisiae RSC8 (YFR037C);
                     ancestral locus Anc_7.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145550.1"
                     /db_xref="GeneID:59237583"
                     /translation="MEEQQATNVDSGVAEFGASGSAPPLLPHLQQQQLQQLETPNVNY
                     EQQAQKLEDKALRFLAKQAHPVIVPSFASWFEFSEVHEIEKRSIPDFFDDSSRFKTPK
                     AYKDARNFMINTYRLSPYEYLTMTAVRRNIAMDVASIVKIHAFLEKWGLINYQIDPRS
                     KPSLIGPSFTGHFQVILDTPQGLKPFVPSKLVGEQDEGVTKDQTGQETPAGQDVKESP
                     QPSVPPEQAVPQESHEVGQGTNGADTASAESNSTQPKEEESNSLENNKNQVQDSAKEP
                     IFVKPEQFPVNLSLRKSIYDSTQDFNALQSRDKNSRQIRKTFICHTSGNEAVSVHYHN
                     LRARDANLSSRCFQEGHFGANFQSSDFIRLENEVQTGKRQWSDQELLLLLEGIEMYED
                     QWEKIVHHVGGQKTIEECVEKFLSLPIEDQYINDIVGNLRTKVSTKSNDNQGGIDTVS
                     AVDAAIKALLNGLHKEVLDESIPESSRKISDKYLQETQVVTQELVNLTSRKMDLKFEK
                     LDKLEIALQNEKSKYVEESEKLLNDRISLSKQVNEINADLSNLNISKKLVLVSEQVDS
                     GIKLVEEEEREEKKKDQLQKKSDQEVEALSHTEPQMYKPWSL"
     gene            <650584..>653142
                     /locus_tag="HG535_0F03360"
                     /db_xref="GeneID:59237584"
     mRNA            <650584..>653142
                     /locus_tag="HG535_0F03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289656.1"
                     /db_xref="GeneID:59237584"
     CDS             650584..653142
                     /locus_tag="HG535_0F03360"
                     /inference="similar to AA sequence:RefSeq:NP_116696.2"
                     /note="similar to Saccharomyces cerevisiae YFR038W;
                     ancestral locus Anc_7.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145551.1"
                     /db_xref="GeneID:59237584"
                     /translation="MTAESRRRALRKGNEKVDYGEKEESDLDSESVVSESRNSSGSDD
                     LKDGGSDIEEVWLHDDLDGNEDVALDSDDDETDLKEEDKKLNDLLEQSRLKLKQERQN
                     DDKDSDDDDSDKDENMDSRSVSLKLKKLNEFVTQSRVYSGVIADTLFERSKQRQREVE
                     AQIEAEKKKMTAEPPKKKTKTRSIVDFFKPKTKEEAQPSALLEDSIIAEQQPSLLKNC
                     ILKPYQLDGLNWLITLYENGLNGILADDMGLGKTIQSIALLAFIYEMDTKGPFLIAVP
                     LSTIDNWVNEFSRFAPDIPKLKYYHQGGARERIKLMNKFFREHKSTGVVITSYEMIIR
                     DSNEIMSRSWKFLIVDEGHRLKNINCKLIQELKRVNTRNKLLLTGTPLQNNLAELWAL
                     LNFIMPDIFSDFEIFNKWFDFRDLDLQNNSAKLNKIINDELEKNLISNLHTILKPFLL
                     RRLKKVVLSGILPPKREYIVNCPLTPIQRKFYNMGLTGNLKKTILKEMIKSFFTLNTE
                     YIGTVSNKSIRNFINYKLKESNNDIVNLEDRDDTNKRMEKVYQTHMHKEFCNIKLQNM
                     IMQLRQIVDSTYLFYFPFLQPKDLTLEQLLNTSGKLKMLQTLVIPLCENGHKVLIFSQ
                     FVRMLDLIEDWCDLNSLKTLRIDGSVDNETRKEHIDELNSSNSKCDIFLLSTRAAGLG
                     INLIGADTVVLFDSDWNPQVDLQAMDRCHRIGQDKPVIVYRLCCDNTVEHVILTRAAN
                     KRRLEKLVIQMGQFSTLKKLALNEGSFLQQKKGAAARTSNKDIIQELSRLLVTGESSI
                     GFASKDSDQTNHDEQPLTEQELLELMDRSPSAYDPERTVELPHVCLFETTAGEL"
     gene            <653541..>654974
                     /locus_tag="HG535_0F03370"
                     /db_xref="GeneID:59237585"
     mRNA            <653541..>654974
                     /locus_tag="HG535_0F03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289657.1"
                     /db_xref="GeneID:59237585"
     CDS             653541..654974
                     /locus_tag="HG535_0F03370"
                     /inference="similar to AA sequence:RefSeq:NP_012231.1"
                     /note="similar to Saccharomyces cerevisiae BCY1 (YIL033C);
                     ancestral locus Anc_7.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145552.1"
                     /db_xref="GeneID:59237585"
                     /translation="MPLAADQQVEYDLYQKEVERQSPADILQFSANYFNKRLEQQRYF
                     TKQQESFASSRGIDLFSKPSRHESVVAASSSFGAKGVEDKDVQFKLPFVDQDPHAPRD
                     EHITSPASMGMSGGNALKEEDSTSVSGIGSGSGTGSGASSGADLGSGLFKGNFNVGKE
                     ASGRVKSPLDPHSGKHSSDRKNIVNHQPLPLRFNAERRTSVSGETFQPDNLDDWTPEH
                     YSEKTQEQLTRLAKSIGKNFLFSKLDPDSKTLVINSLEEKNIKAGTQIIRQGDEGDYF
                     YVVEEGTVEFFVDNKKISSSGPGSSFGELALMYNHPRVATVMASTDCILWALDRITFR
                     KILLGSSFKKRLMYDELLKIIPILTSLTTYDRAKLADALDTEYYEPGQVIIKQGDRGE
                     NFYLIEYGECDVSKAGEGIVAHLKAHDYFGEVALLNDLPRQATVTARTKTKVATLGKS
                     GFQRLLGPVVDVLKLNDPTKKSHESTK"
     gene            complement(<655205..>655651)
                     /locus_tag="HG535_0F03380"
                     /db_xref="GeneID:59237586"
     mRNA            complement(<655205..>655651)
                     /locus_tag="HG535_0F03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289658.1"
                     /db_xref="GeneID:59237586"
     CDS             complement(655205..655651)
                     /locus_tag="HG535_0F03380"
                     /inference="similar to AA sequence:RefSeq:NP_010962.1"
                     /note="similar to Saccharomyces cerevisiae ERG28
                     (YER044C); ancestral locus Anc_7.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145553.1"
                     /db_xref="GeneID:59237586"
                     /translation="MLSFQEVLNATQAKLATMPPGNLPKWLLFISVVSVFNSIQTYVS
                     GLELTRRVYENKPSQTTSLSARTFGTWTFVSCVIRFYGAFYLNEPHIYQLTFISYLIA
                     IGHFGSELLIFRTCKLGKGFMGPLVVASTSLIWMYTQKEFYTGLPW"
     gene            <656207..>657046
                     /locus_tag="HG535_0F03390"
                     /db_xref="GeneID:59237587"
     mRNA            <656207..>657046
                     /locus_tag="HG535_0F03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289659.1"
                     /db_xref="GeneID:59237587"
     CDS             656207..657046
                     /locus_tag="HG535_0F03390"
                     /inference="similar to AA sequence:RefSeq:NP_012230.3"
                     /note="similar to Saccharomyces cerevisiae CAP2 (YIL034C);
                     ancestral locus Anc_7.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145554.1"
                     /db_xref="GeneID:59237587"
                     /translation="MSTEQAYDAALDLLRRLDPRKLKEHVQNLIQLEPSLAEDLLSSV
                     DTPLIVKRDPKASQREYLCCDYNRDIDSHRSPWSNEYFPELSAEDVQESPFPSKNLRQ
                     LEILANDSFDIYRDLYYEGGVSSVYLWELDDEELSDDFAGVVLFKNGDKTSNAWDSIH
                     VLEAVREGTDVTYRITTTVILHLDNGKQMTLSGNLSRQTEKTLAVPPSSSTSVEQVHV
                     AHITNLGTIIEDVESQMRTMLESVYFEKTRDIFHHTRNSTSGNEEMSSDVHQELMKGL
                     QSL"
     gene            <657374..>658513
                     /locus_tag="HG535_0F03400"
                     /db_xref="GeneID:59237588"
     mRNA            <657374..>658513
                     /locus_tag="HG535_0F03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289660.1"
                     /db_xref="GeneID:59237588"
     CDS             657374..658513
                     /locus_tag="HG535_0F03400"
                     /inference="similar to AA sequence:RefSeq:NP_012229.1"
                     /note="similar to Saccharomyces cerevisiae CKA1 (YIL035C);
                     ancestral locus Anc_7.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145555.1"
                     /db_xref="GeneID:59237588"
                     /translation="MKCKKWSESRVYTNANQLRSQEYWDYENTTIEWSTNNKLYEIET
                     KVGRGKYSEVFQGVQLSNRRSIVIKMLKPVKKKKIKREIKILSNLSNESDPPTLREFD
                     EAEYYTNRKESVMAFKRSYLYDLPHNGHENIVQLLDVIRDPISKTPALVFEHVNNVDF
                     RVLYPKFSDFDMRYYTFELLKALDYCHSMGIMHRDVKPHNVMIDHKQRKLRLIDWGLA
                     EFYHKNMEYNVRVASRFFKGPELLVDYRMYDYSLDIWSFGTMLASMVFQKEPFFHGSS
                     NTDQLVKIVRVLGSDDFEKYLAKYDIVLPREFHDMDQYIRRPWHRFINDSNRHLCDND
                     DIIDLLDNLLRYDHQERLTAREAMGHPWFEPIRKGESKAQIDHDS"
     gene            complement(<658575..>659757)
                     /locus_tag="HG535_0F03410"
                     /db_xref="GeneID:59237589"
     mRNA            complement(join(<658575..659639,659698..>659757))
                     /locus_tag="HG535_0F03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289661.1"
                     /db_xref="GeneID:59237589"
     CDS             complement(join(658575..659639,659698..659757))
                     /locus_tag="HG535_0F03410"
                     /inference="similar to AA sequence:RefSeq:NP_010963.1"
                     /note="similar to Saccharomyces cerevisiae MEI4 (YER044C-
                     A); ancestral locus Anc_7.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145556.1"
                     /db_xref="GeneID:59237589"
                     /translation="MVEKDRCKMDNDHSEVDWIICFAIIKRNNPTIFSRESNSRSSIV
                     IGDIGIPDKLSNLRLNRSLVAHLDIVYRYTQNIEKLRDNLDIMKSLSDDIKYVDITRW
                     FLPNYKNILTILSLKGSIGEPHKVQRLFHCFQLLIASFCCFQADALQLSSKLILETLI
                     SRFVSQDLIVCKQKSSRIVQQYLRTDEAVFDLSSTRMQCKIHCETLISIMNLNLRVVG
                     SSVSHKNGTRCGMQFFLIISRICFVIESLTHCLINQLSSTPDKSLTDGLAYREQYCIR
                     ERTFDFQYTNNILFVLRERTSKVKERLELLKGIISELLKVLNHLDWFQLDDYVKQYPI
                     HSETMIKRRLYIQITLLIAADLNLISEFRLIRWPTWSKPS"
     gene            complement(<659971..>661350)
                     /locus_tag="HG535_0F03420"
                     /db_xref="GeneID:59237590"
     mRNA            complement(<659971..>661350)
                     /locus_tag="HG535_0F03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289662.1"
                     /db_xref="GeneID:59237590"
     CDS             complement(659971..661350)
                     /locus_tag="HG535_0F03420"
                     /inference="similar to AA sequence:RefSeq:NP_010964.3"
                     /note="similar to Saccharomyces cerevisiae ACA1 (YER045C)
                     and CST6 (YIL036W); ancestral locus Anc_7.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145557.1"
                     /db_xref="GeneID:59237590"
                     /translation="MENEYSPLHTTSFPGVDVGVSTAGVANLQPDGQSLQGSTTGFVQ
                     GMRQASPRSQSVQPASSYFGDGINAAQFSPLAEGGGTHANKWVPNGNAIAHANTYSSA
                     AGAGHHVDFNSNTNGTKNNLASASFSNSNSHTINDPSTQEYLSPFFQPFGIDVTHFPL
                     TNPPIFQSSLTSLDEPVKRRRISISNGQINQLSEDLETLENLYNTQPPPLPPRFDHQP
                     MQTQIPSQIQNQSQAQTQRHVQRQTQRQDPQPNLAENALRQQAKFQQFESVNNSVPQA
                     HIQANPDDEIAAKSISGSASSTTWENSNGNSLHCSDVLSQQRSSQQVAVDVSPAPVKR
                     SSSSSSNSSYNNRMSDPIPGTNAWKRARLLERNRMAASKCRQRKKVAQLQLQKDFGVI
                     SAENKVMKRKLDYYEKLVAKFKRFSEAHLRKCSGSDDSLDIIEEMLMIDSGIKEVDDS
                     GLIVKLEDN"
     gene            <662064..>662780
                     /locus_tag="HG535_0F03430"
                     /db_xref="GeneID:59237591"
     mRNA            <662064..>662780
                     /locus_tag="HG535_0F03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289663.1"
                     /db_xref="GeneID:59237591"
     CDS             662064..662780
                     /locus_tag="HG535_0F03430"
                     /inference="similar to AA sequence:RefSeq:NP_010965.1"
                     /note="similar to Saccharomyces cerevisiae SPO73
                     (YER046W); ancestral locus Anc_7.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145558.1"
                     /db_xref="GeneID:59237591"
                     /translation="MGLGSSFIKRIAESLPEDTIVENERGITLFGMPMFSPKLLIPQV
                     DPTHWQLINVKESTVRNVGERSVLSRGEFYPLTANCNQTEKWYVLMDFGDSIDMDDQG
                     WLYSWVFSSARWKSKHGFVRRRIWVRRPEQMQGCSAFSSISSAEGSGSLSLPESQTNI
                     DPVKRYLLSAREQLIMGLMRQSLDRHRFELLDSSLKNGAIDKAALEDSVFVDKISRCF
                     EFKTSKERFLHIWLPTVLEF"
     gene            <662906..>664639
                     /locus_tag="HG535_0F03440"
                     /db_xref="GeneID:59237592"
     mRNA            <662906..>664639
                     /locus_tag="HG535_0F03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289664.1"
                     /db_xref="GeneID:59237592"
     CDS             662906..664639
                     /locus_tag="HG535_0F03440"
                     /inference="similar to AA sequence:RefSeq:NP_012227.3"
                     /note="similar to Saccharomyces cerevisiae PRM2 (YIL037C);
                     ancestral locus Anc_7.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145559.1"
                     /db_xref="GeneID:59237592"
                     /translation="MKLFPSLSLPQRLVICIFNPIIVFIFASLLLTIWSDYVMIDLTV
                     TKIEGGGVDSVSASSTALVTTTATVTTTTTTTAVSTASQSSFATYYFDRDALEHVAQE
                     YIEMRIKWVNATLSASYSSQLSQWQHSLDMWNVSLIKAINDKREIYQNLLAYNQSIFN
                     ALYEKSKQINETWSLFSQTALSLEDTQQVFNNLSVNYWFATSIFSNVSQQLQVLNSFD
                     CNSKIPVIGFMPIDLNFDKSKQLDTSVTSFTNTLVNSLRENKYEAPRKRGNNLEASNT
                     SLKKRSRYFSIICLIMYFVSIGTLCIYEWLIFRIENSLFNSHMMEILDTITAEETRGI
                     TLQQWVRKQTNKLCYTLTNPLLYRVANSIGSGLNESDSRWKYLSYYILWTLSNGKYLW
                     ILLFYTINHWQITSSLVSHQVSSAQGNFRREVTSPLTDSRLSLMKSTLEICSDFTFDV
                     DKTIDDTLKVHFIASLDQQVDVINSQMTELSHDPTIAALSQWQNLSYSSPHDFEVNGN
                     EFSYSVMTQALNSDSSKFVATHLSKRNTSNFNSSISETAWNKVYKWAVLLLIILLVLH
                     FIIGLVFSVTI"
     gene            <664996..>667443
                     /locus_tag="HG535_0F03450"
                     /db_xref="GeneID:59237593"
     mRNA            <664996..>667443
                     /locus_tag="HG535_0F03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289665.1"
                     /db_xref="GeneID:59237593"
     CDS             664996..667443
                     /locus_tag="HG535_0F03450"
                     /inference="similar to AA sequence:RefSeq:NP_012226.3"
                     /note="similar to Saccharomyces cerevisiae NOT3 (YIL038C);
                     ancestral locus Anc_7.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145560.1"
                     /db_xref="GeneID:59237593"
                     /translation="MAHRKLQQEIDRVFKKINEGLEIFDTYYERHENCTNNPSQKDKL
                     ESDLKREVKKLQRLREQIKSWQSSPDIKDKDSLLDFRRSVEIAMEKYKAVEKASKEKA
                     YSNISLKKSDNMDPQEKERRDVSEYLSNTIDELERQYEGLQVEIDKLIILNKKKKTAS
                     QANEEKKDQLKNLQMRYRWHQQQMELALRLLANEELNPDHVKEIQEDINYYVESNQEP
                     DFVEDETIYDTLDLQSNEAIAHEVAQYFASQQAEDNNGDDDSASKDASKTSKKELRRL
                     EREAKKAAKAASKGSESDSFVIPNSYSASISAKEPETLELLQSQSPSPSPGPQTADSS
                     KTGSTPSTVPNTAKSPNGSSLTSLKHGLSATSHSTTNELLAGHTHIHQTLNGITTTST
                     LKPATVPARPAGEIKWAVAASQGIEKDKKMINASSNTNTSAPATSGTNSAAGLSNVST
                     RSNSATNTPRLSTPSLETTSLAEHLEKSSGLTNPNASTSLTAAAVLAAGAAAVNMNNK
                     AIHKNASPYRPPETLHNRDEHYSLNTTPSLQKRVEDEPELIDDYESEWTDDELEEEPV
                     PEQLTELESETRKLATEQFRKESIKDYEMLLLPGGIQEFIMGVELFNRGLEPLDGKLG
                     GYRRSHDACTIPRFGGVPLGVNPPAPLDAFRSTQQWDVTRCSLRSVVRSSDLTEAEKY
                     QAILERFRSLEMFTLFYNYYFAVTPLEQHIASIILAERHWKVSKTSTLWFLRQGDAKF
                     TNGICEVADYKVFKLDDWTVADKLNFKLDYAFLKEPPVIPTVEKESMVETDGSDVLSH
                     GQQLLQQLKQGKVGTSA"
     gene            complement(<667651..>668844)
                     /locus_tag="HG535_0F03460"
                     /db_xref="GeneID:59237594"
     mRNA            complement(<667651..>668844)
                     /locus_tag="HG535_0F03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289666.1"
                     /db_xref="GeneID:59237594"
     CDS             complement(667651..668844)
                     /locus_tag="HG535_0F03460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145561.1"
                     /db_xref="GeneID:59237594"
                     /translation="MPVVLTPLEGRNFGAKVTLPEGCNDPSELSEVDFKTLYEGLHKH
                     LVLVIPAMENLSPKSQWKLTTLFDSTCDRTGAAYGHGKEFRHDKSVLRKDGTSVPSQP
                     QVQVLGQGFWQAGHEGLGDVNLRHPVHFDFHRDPLTDEEAHEKNMTRFYRWHIDSALY
                     GLSPPVCTTLLGIHVPPSTKKQKIVYDDGDELEVNQGATAFVSGATAFDLLSPEDQEK
                     ALGATVVYAPHPYIFISPAKATSDGLTMVSEKKEMPLDELPPWEESKIKRLPLVWTNP
                     VTKKHHLQVHGCCIYQLKFADGTVLDLEDARNAVHKMMRPAIASKYVYAHNWEAGDLA
                     IFFNRGVWHSVTGQFSPGEKRLMHQCNIASGQDPFTLTDRSGLGVAAESEVVPKGLNK
                     EQILA"
     gene            complement(<669392..>672058)
                     /locus_tag="HG535_0F03470"
                     /db_xref="GeneID:59237595"
     mRNA            complement(<669392..>672058)
                     /locus_tag="HG535_0F03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289667.1"
                     /db_xref="GeneID:59237595"
     CDS             complement(669392..672058)
                     /locus_tag="HG535_0F03470"
                     /inference="similar to AA sequence:RefSeq:NP_010966.1"
                     /note="similar to Saccharomyces cerevisiae SAP1 (YER047C);
                     ancestral locus Anc_7.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145562.1"
                     /db_xref="GeneID:59237595"
                     /translation="MESSGNYHLLSKFTRLRKRPQQPLTDLTELYGKIANETIFYLKL
                     EDQKNYKGALQGWKALNTDVMYRLTVIEHEYPNVQSYTREELNIKSGLRELYNKSLDH
                     LERVKALYQEDEVRTKSATSTTRTSSKHTVTAPDSRKSSFNRRPPMFRESATPLSSRK
                     MATTLRDPKLKSLRAYNQPSTNDFRSSGSKVQSRNKVNFTPSKPLIKANQVRKDDQNQ
                     FEDFDDNIDLIVLAQESEGEEDGEEDGEDRQRDQYKVTSPLSDQFEFDVEDYYGSLMD
                     ESGSGDDDYALNDLEENTTNLSINSSPLDVKTNISAPELPVIKSSEVPTPTFANIIKN
                     RPPIPSAAPPSLPHQTPSSAGIPLFSESKPSKNTSRAATIKSEVDKSFVLHNPTSVSS
                     DNVISKKTKPVSKTIPGLRLKATKSTSALAPKQAIVPSLPTKAKVASSYEKRPQVATE
                     AAKLVLGTKPEQVRRVLPKKNSLTSSTSTFKKTQSRSTVGSRPSTARPKKDLGSSAHI
                     KSVQVGGNGKANSMNSLISNESSSHSKGQTREKSAPPPEVPLAEDKRQEPEFNGSQLK
                     EVLENEIIESLQGVDKTAAKQIFAEIVVRGDEVHWDDIAGLESAKSSLKEAVVYPFLR
                     PDLFRGLREPVRGMLLFGPPGTGKTMLARAVATESHSTFFSISASSLTSKYLGESEKL
                     VRALFAVAKKLSPSIVFVDEIDSIMGSRDNEGENESSRRIKNEFLIQWSSLSSAAAGN
                     THSNADGDDDERVLVLAATNLPWSIDEAARRRFVRRQYIPLPEPETRSAQLKRLLSYQ
                     KHTMANEDFLELLNLTDGFSGSDLTSLAKDAAMGPLRELGDKLLLTPTELVRPITLDD
                     FKSSLNYIKPSVSQEGLQKYEDWASKFGSSGV"
     gene            complement(<672320..>673765)
                     /locus_tag="HG535_0F03480"
                     /db_xref="GeneID:59237596"
     mRNA            complement(<672320..>673765)
                     /locus_tag="HG535_0F03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289668.1"
                     /db_xref="GeneID:59237596"
     CDS             complement(672320..673765)
                     /locus_tag="HG535_0F03480"
                     /inference="similar to AA sequence:RefSeq:NP_012225.1"
                     /note="similar to Saccharomyces cerevisiae YIL039W;
                     ancestral locus Anc_7.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145563.1"
                     /db_xref="GeneID:59237596"
                     /translation="MVSKSIFKKIAIFGTFLAIVTNIYTATYPSVHPSKCSWKCTQND
                     DDIAVDLLSSWEKVVYYSKRYLFDVKEQLLPGKPDEETTKNDDPADIHLMAFGDPQIK
                     GIFSNTPYITRLDIFGNDFFLGHIASTMRRRLHPSHIAVMGDLFSSQWIGDSEFYNRT
                     SRYMSRIFGRDISSLEQIKSEHHDKDGQYQVDWESWGKKLDKIRATEKPWDLGFHHEN
                     VYSWDPQNEDSLFINITGNHDIGYSGDVTYQHLSRFHELFGSDNYWIEYDTDTDHPWR
                     IVVLDSLLLEGPGLQNEFIDVTWEFLYQLFERRFKGSTVLLTHVPLYKEEGICSDGPE
                     TRFYPEVYEPEPYKSKLLRSHNHLSEEVTKRVLNLIFDNNKPGIILTGHDHVGCETYY
                     NKNSTSGDWKASKKIESPGELLSVQEITVKAMMGEFHGNTGLVTGHFNKKTGLWEWYF
                     SLCPFTIQHVWWISKVSALLTGLLWSIYILL"
     gene            complement(<674115..>675281)
                     /locus_tag="HG535_0F03490"
                     /db_xref="GeneID:59237597"
     mRNA            complement(<674115..>675281)
                     /locus_tag="HG535_0F03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289669.1"
                     /db_xref="GeneID:59237597"
     CDS             complement(674115..675281)
                     /locus_tag="HG535_0F03490"
                     /inference="similar to AA sequence:RefSeq:NP_010967.3"
                     /note="similar to Saccharomyces cerevisiae CAJ1 (YER048C);
                     ancestral locus Anc_7.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145564.1"
                     /db_xref="GeneID:59237597"
                     /translation="MVKDTEYYDVLGIEPTATALEIKKAYRKKAMLTHPDKHPNDPDA
                     ASKFQAVGEAYQVLSDPSLRSRYDQFGKDDAVPQQGFEDASEYFSAIFGGDGFKDWIG
                     EFTMLEGLNEVDAETEPVKTENGEQSSSTELAGAGSVASKNDEAKLDKKLSKAQKEKM
                     YEMEKKRREEIKIQVNELAKKLNGRLQSYILASKDNRLDEFTSKLDQEIEEMKLESFG
                     LELLHCLAKCYKTKANNFILSKKTHGISKLYTGVRDNARNAKSVYSLLSTGMDAYKAM
                     EQMNETNLDEMEEYERAKFESMMAGKALGVMWAMSKYELESKLKEVCNQILNDNTVPT
                     KERLLKAKGLLLMADKFSKAKRSPEEAEEARVFEELILGEQQKEKEKKKKRSRI"
     gene            complement(<675609..>676040)
                     /locus_tag="HG535_0F03500"
                     /db_xref="GeneID:59237598"
     mRNA            complement(<675609..>676040)
                     /locus_tag="HG535_0F03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289670.1"
                     /db_xref="GeneID:59237598"
     CDS             complement(675609..676040)
                     /locus_tag="HG535_0F03500"
                     /inference="similar to AA sequence:RefSeq:NP_012224.1"
                     /note="similar to Saccharomyces cerevisiae APQ12
                     (YIL040W); ancestral locus Anc_7.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145565.1"
                     /db_xref="GeneID:59237598"
                     /translation="MVEAQEHPEQKLEQYIAFFLTKLIRFIQIVIPLIAKFSKEHPNV
                     FLTVSIVLIIYTSWRLICNLATILKRMLFVTLSLFIIFLFLRGFDQVVFKDMPLLYSL
                     IKQNRDLEIVFSRWTSYLSKSSADHSTAVVSYLSSKLRELF"
     gene            677631..677702
                     /locus_tag="HG535_0Ftrna5Q"
                     /db_xref="GeneID:59237894"
     tRNA            677631..677702
                     /locus_tag="HG535_0Ftrna5Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:59237894"
     gene            <678123..>678752
                     /locus_tag="HG535_0F03510"
                     /db_xref="GeneID:59237599"
     mRNA            <678123..>678752
                     /locus_tag="HG535_0F03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289671.1"
                     /db_xref="GeneID:59237599"
     CDS             678123..678752
                     /locus_tag="HG535_0F03510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145566.1"
                     /db_xref="GeneID:59237599"
                     /translation="MLFGLIQKSKKEDMATTSAAASFLKSIATRRTIYALKPELPSNV
                     TLDDVEATVQEVIKHTPTSFNSQVNRAIILTGEAHKKVWDQVVNSIPDDSGKRRPTSA
                     RDEAYGSVIFFTDDLVTEKLQAGFPAWAAAFPQFADHSSGAAQIDTWTAFTEMGLGAH
                     LQHYNGYIKAALPADVPTQWSIHAQLVFGVPAAPAGAKEFGKNEVKVYK"
     gene            <679135..>679428
                     /locus_tag="HG535_0F03520"
                     /db_xref="GeneID:59237600"
     mRNA            <679135..>679428
                     /locus_tag="HG535_0F03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289672.1"
                     /db_xref="GeneID:59237600"
     CDS             679135..679428
                     /locus_tag="HG535_0F03520"
                     /inference="similar to AA sequence:RefSeq:NP_010968.1"
                     /note="similar to Saccharomyces cerevisiae ISD11 (YER048W-
                     A); ancestral locus Anc_7.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145567.1"
                     /db_xref="GeneID:59237600"
                     /translation="MPAVSPSRRQVLRLYKQLIKNANQFNDYNFREYFLRRARNTFKE
                     NKSVQDAAKLQSLFAEGQRDLGILKRQSIISQMYTFDKLVVEPLHKHGFKPST"
     gene            <679889..>681814
                     /locus_tag="HG535_0F03530"
                     /db_xref="GeneID:59237601"
     mRNA            <679889..>681814
                     /locus_tag="HG535_0F03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289673.1"
                     /db_xref="GeneID:59237601"
     CDS             679889..681814
                     /locus_tag="HG535_0F03530"
                     /inference="similar to AA sequence:RefSeq:NP_010969.1"
                     /note="similar to Saccharomyces cerevisiae TPA1 (YER049W);
                     ancestral locus Anc_7.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145568.1"
                     /db_xref="GeneID:59237601"
                     /translation="MKRQNSNSGKNTLKQPLLEEDKVKSLFNAKLWDDDYRRGLKEEI
                     ANSKPYNWGTIPELVSDDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLAGLDWN
                     DLSRLPNLYKLRQILYSEIYRDFIAYVTDSGKLSGQKADMSINTYTKGCHLLTHDDVI
                     GSRRISFILYLPDPDRTWKSHYGGGLRLFDSIVSNVPCSDSCAKLVPQFNQIAFFKVK
                     PGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEDGHIPGEEEKWVQTNTSTLAQLESNVL
                     QDYEFPKFERDILPYHQVKHFEKVLAQDKVEDMSNNFTVENGIKELTPISAISDEKIL
                     NEQELNYLRRYLSEQYLTEDGIAKLQSDFLENSSLQIDDFLNEKKSTLLQKLIKQNEL
                     ENDCPYKAKDVQTPWKTAIPPHKWRYLYIDGKSLENFQTETDILENLNREELPNFELL
                     KQTLDKSKNSTEIELMDLVEFFKSTIYKKYLALITALCPLSEQVLIRRFRPGKDFTLA
                     TKCQLNKILENVDGFVDAVLEGTLCITPFDGWESGEVGGYELYMADNDEEDDENVSKK
                     SQLDKDVEDASVYRTDDSGDSVLLNSSASWNTFNLVLRDESVLEFVKYISWSAKSSRW
                     DIKMQWDVKSTEQESEN"
     gene            complement(<681974..>682948)
                     /locus_tag="HG535_0F03540"
                     /db_xref="GeneID:59237602"
     mRNA            complement(<681974..>682948)
                     /locus_tag="HG535_0F03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289674.1"
                     /db_xref="GeneID:59237602"
     CDS             complement(681974..682948)
                     /locus_tag="HG535_0F03540"
                     /inference="similar to AA sequence:RefSeq:NP_012223.3"
                     /note="similar to Saccharomyces cerevisiae GVP36
                     (YIL041W); ancestral locus Anc_7.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145569.1"
                     /db_xref="GeneID:59237602"
                     /translation="MSTFNNFTDSLNKRFQELSTVVSQKTQEISGDIPSLAQSTQRFV
                     QEKLGQVTDISQLPQEYLELERKVDTIKLIYEHFLHITSVYENESYDYPKYVTESIND
                     FSKIVTSKVKELSHASSASEAQNILITPGPLKDPRTLNYALSKVSLISSEYLNQIGDH
                     TDAQLGSVLLKYSDVQAKIAQARLQQDTLIQTKFNKCLRESLENDLKRVQKVRKDVEY
                     KRIQYDVARTNLSQAKPEKEASLRVQMETLEDQFAQATEDATVVMQEVISQSNFSKEI
                     QDLASAQLAYHSASSKVLEDFVSGLEHQSETSNKPVDAVEENDKEEEK"
     gene            <683513..>684802
                     /locus_tag="HG535_0F03550"
                     /db_xref="GeneID:59237603"
     mRNA            <683513..>684802
                     /locus_tag="HG535_0F03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289675.1"
                     /db_xref="GeneID:59237603"
     CDS             683513..684802
                     /locus_tag="HG535_0F03550"
                     /inference="similar to AA sequence:RefSeq:NP_012222.1"
                     /note="similar to Saccharomyces cerevisiae PKP1 (YIL042C);
                     ancestral locus Anc_7.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145570.1"
                     /db_xref="GeneID:59237603"
                     /translation="MYRCFTSTGRGKIGGRVLPLHTRLFYQLNKKCLKETALQRQRCA
                     RFRSSSNTTSNNNNKADDELIAMAFEKHYKIRSNIELLIQDYARKPIQPVTFDFLTKY
                     RPPLKDTEMYMLSIKTINLLLSYTCRQLDAIQALPYIVVLNPNIEISNSLYLRTLETL
                     LSIDYPYGIQNRSAMARMLTQFLDEHQDTLVTLSRGFQEVMEFYPKESVFKFLNQHLR
                     DRIAMKLLARHYLSLLDQSKRKGPENMIGALHKNLKISDLIRQVSEYVNDLCFVKYDH
                     TVPVSILSGDDVSFPCIPTHLEYVLTEILKNSSRAHIEGSTADSDLTEKPIEITVVRC
                     DNELQIRIRDFGGGIPPNVEDKMFDYSYSTVTEKTNDTGAEAYMIPGEDINNVSGMGF
                     GLPMCRAYLEMSSGSLEIQSLWGWGTDVYIKLTGPPL"
     gene            complement(<684878..>685375)
                     /locus_tag="HG535_0F03560"
                     /db_xref="GeneID:59237604"
     mRNA            complement(<684878..>685375)
                     /locus_tag="HG535_0F03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289676.1"
                     /db_xref="GeneID:59237604"
     CDS             complement(684878..685375)
                     /locus_tag="HG535_0F03560"
                     /inference="similar to AA sequence:RefSeq:NP_010970.4"
                     /note="similar to Saccharomyces cerevisiae RSM18
                     (YER050C); ancestral locus Anc_7.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145571.1"
                     /db_xref="GeneID:59237604"
                     /translation="MLTRLMLPIKQAKSLNCSTIRFISQVRLTPNMKTSVDVGNTNAI
                     EGNKRVDARFMKKFPRSSTYDPFDFSLARLHLEKKFGSTKQSKNDMFDKYGINPLDLY
                     TSPEVLSQFMSSTGKILHRDVTGLSAKNQRRLSKSIRRAQAIGLLSKTHKDVSFLPTR
                     TSGKL"
     gene            <686651..>687868
                     /locus_tag="HG535_0F03570"
                     /db_xref="GeneID:59237605"
     mRNA            <686651..>687868
                     /locus_tag="HG535_0F03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289677.1"
                     /db_xref="GeneID:59237605"
     CDS             686651..687868
                     /locus_tag="HG535_0F03570"
                     /inference="similar to AA sequence:RefSeq:NP_010971.1"
                     /note="similar to Saccharomyces cerevisiae JHD1 (YER051W);
                     ancestral locus Anc_7.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145572.1"
                     /db_xref="GeneID:59237605"
                     /translation="MSKRDFSPSHQVAGEPIAKKRSGLRNKQPIDYIALNEGDDKKLK
                     HVHPHTEAFLACFERYENTKSVLDSKSFNQNFASVDKPIKILDPENSGMVIPSPKDLG
                     FSDHDRSLTVDDITKALGEDYPVDVMDIQTQQNERWSMSQWNDYFSKTTPEERDRVRN
                     VISLEVSHVNRLKIERPKGVEENDLVNILWDFVGIEDTKPKVTRYILMSAANSYTDFH
                     LDFAGTSVYYNLISGNKKFILFPPTESNLQKYSSWCTDPNQNIIFLGDILTDGTAMEL
                     NGGDLFMIPSGFIHAVYTPQDSLIIGGNFLTVRNVDTQLDVVAVERLTKVPKRFTFPH
                     FDLVMGKCCEWVLSRSTDKNVKLEKMTPAIMKKSMEALIRYMEKPQIKYKPVNYSSKR
                     ILIKELKLYLDKW"
     gene            <688039..>688884
                     /locus_tag="HG535_0F03580"
                     /db_xref="GeneID:59237606"
     mRNA            <688039..>688884
                     /locus_tag="HG535_0F03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289678.1"
                     /db_xref="GeneID:59237606"
     CDS             688039..688884
                     /locus_tag="HG535_0F03580"
                     /inference="similar to AA sequence:RefSeq:NP_012221.2"
                     /note="similar to Saccharomyces cerevisiae CBR1 (YIL043C);
                     ancestral locus Anc_7.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145573.1"
                     /db_xref="GeneID:59237606"
                     /translation="MPDYRILTAIIVLVISSLLALRLKSSEKKREVLKPDEFQEFPLI
                     LKTALSHNTALYRFGLPETEDVLGLPIGQHISIKAIIDGKEVVRSYTPTSLDTDAKGF
                     FELLVKTYELGNISKYIGELNIGDKMQVRGPKGFYQYSPNTYKHIGMVAGGTGISPMY
                     QIIKAIAAHSSDKTKVSLVYGNVTEEDILLKAELDRIVESNPTQFKVFYLLDKPDEGW
                     TGGVGYVTEDIMREHLPNGKDKDVQLLVCGPRPMVSFVKKTSISLSYDKSKPVSKMGD
                     QVFIF"
     gene            complement(<689024..>690583)
                     /locus_tag="HG535_0F03590"
                     /db_xref="GeneID:59237607"
     mRNA            complement(<689024..>690583)
                     /locus_tag="HG535_0F03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289679.1"
                     /db_xref="GeneID:59237607"
     CDS             complement(689024..690583)
                     /locus_tag="HG535_0F03590"
                     /inference="similar to AA sequence:RefSeq:NP_010972.1"
                     /note="similar to Saccharomyces cerevisiae HOM3 (YER052C);
                     ancestral locus Anc_7.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145574.1"
                     /db_xref="GeneID:59237607"
                     /translation="MEYNMQTNWVVQKFGGTSVGKFPTDIVDDIIKFYTEENNNSVAV
                     VCSARSSYTKAEGTTSRLLRCCDLASQESDYTQIIEAVRQDHVQNAEAYIQNPVLQTK
                     LVTDTNKELDMVSKYLEASKILGEVSPRTMDLVMACGEKLSCLFIATLCNDRGCKAKF
                     VDLTHIIPSDFTATTLDSSFYALMVSALRKTLQPFVSSREKIVPVFTGFFGLVPMGLL
                     NGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVSQARLLDSVTPEEAAEL
                     TYYGSEVIHPFTMEQVIRAKIPIRIKNVQNPKGDGTIIYPDDVAKKGEATPPHPPEAL
                     SSSFFEKKRRGATAITTKNDIIVLNIHSNKKTLSHGFLAQIFTILDRYKLVVDLISTS
                     EVHVSMALPIPDSDALKSLRLAVEKLKPLGKVDLIKKMAIVSLVGKQMKQYIGIAGTM
                     FSTLAANGINIEMISQGANEINISCVIEEVDSIKALQSIHAKLLEDNKSKNSFEHAIN
                     ERLEQIKNLDL"
     gene            complement(<691037..>691696)
                     /locus_tag="HG535_0F03600"
                     /db_xref="GeneID:59237608"
     mRNA            complement(<691037..>691696)
                     /locus_tag="HG535_0F03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289680.1"
                     /db_xref="GeneID:59237608"
     CDS             complement(691037..691696)
                     /locus_tag="HG535_0F03600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145575.1"
                     /db_xref="GeneID:59237608"
                     /translation="MVTSEANCHEDDCECKSLDNFPTFSPEQVRKHDKAWDCWMIVHG
                     RVYDIGPILSSHPGGSQILLKYAGMDATYQFDDVGHSMESLLYDMPQGSFKGYVVGTI
                     KKGRNPTRDSKYAVTKAEKGDDAESLSGAGDYITQTDSIIMGRGQSLDGYLLWNKVYS
                     LFLILTILFCLFALMYMKVYQHMTSTNNSTTSKRDNTFASFTSYQEQVSDTDGIPDWA
                     Y"
     gene            <693425..>694252
                     /locus_tag="HG535_0F03610"
                     /db_xref="GeneID:59237609"
     mRNA            <693425..>694252
                     /locus_tag="HG535_0F03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289681.1"
                     /db_xref="GeneID:59237609"
     CDS             693425..694252
                     /locus_tag="HG535_0F03610"
                     /inference="similar to AA sequence:RefSeq:NP_012220.3"
                     /note="similar to Saccharomyces cerevisiae AGE2 (YIL044C);
                     ancestral locus Anc_7.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145576.1"
                     /db_xref="GeneID:59237609"
                     /translation="MTTSPPVKKALAGLLRDPANNTCADCKAASHPRWASWSLGVFIC
                     IRCAGLHRSLGTHISKVKSVDLDAWKEEELVNLVKMCNNRIANDYYEAKLPESMRKPI
                     TDANQLQSFVKNKYEKKKWISTGEQPNGKSEAAEDIKPQLSSTESLLADFEEVQPKLQ
                     KTSSSTSSVTSTSTSSMLNLRLSSMAKNRIDQQNNRDSNRPDLKKSILSLYSKPKDNN
                     VTKNSFYQSSNSTGASLPISNSIGTTNGSNNSNANKTENNLSISSLDENELFKNVWT"
     gene            complement(<694348..>695268)
                     /locus_tag="HG535_0F03620"
                     /db_xref="GeneID:59237610"
     mRNA            complement(<694348..>695268)
                     /locus_tag="HG535_0F03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289682.1"
                     /db_xref="GeneID:59237610"
     CDS             complement(694348..695268)
                     /locus_tag="HG535_0F03620"
                     /inference="similar to AA sequence:RefSeq:NP_010973.3"
                     /note="similar to Saccharomyces cerevisiae PIC2 (YER053C);
                     ancestral locus Anc_7.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145577.1"
                     /db_xref="GeneID:59237610"
                     /translation="MSEKSNDRGIQLYTKEFYAACTLGGIVACGPTHSSVTPLDLVKC
                     RLQVDPTLYKSNLDGWKTIIRKEGFSKIFTGFGATAIGYSLQGAGKYGGYEFFKHFYS
                     NSVLGPELSSKYTTGVYLMASATAEFIADIMLCPFEAIKVRQQTTVPPFCNNVFQGLS
                     KIYTLEGLQGFYKGIVPLWCRQIPYTMCKFTSFEKIVQLIYSKLPKPKSEMTTLQQIS
                     VSFTGGYLAGILCAIVSHPADVMVSKINNDRKSGESMVGASKRIYQKIGFGGLWNGLM
                     VRIVMIGTLTSFQWLIYDSFKVKVGLPTTG"
     gene            complement(<695862..>696014)
                     /locus_tag="HG535_0F03630"
                     /db_xref="GeneID:59237611"
     mRNA            complement(<695862..>696014)
                     /locus_tag="HG535_0F03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289683.1"
                     /db_xref="GeneID:59237611"
     CDS             complement(695862..696014)
                     /locus_tag="HG535_0F03630"
                     /inference="similar to AA sequence:RefSeq:NP_061492.1"
                     /note="similar to Saccharomyces cerevisiae YER053C-A;
                     ancestral locus Anc_7.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145578.1"
                     /db_xref="GeneID:59237611"
                     /translation="MLLAMLQFNRQSELKDFDLFLSIFAFIFLVYFTFHKTVMNKYKS
                     DVPYLQ"
     gene            complement(<696693..>698186)
                     /locus_tag="HG535_0F03640"
                     /db_xref="GeneID:59237612"
     mRNA            complement(<696693..>698186)
                     /locus_tag="HG535_0F03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289684.1"
                     /db_xref="GeneID:59237612"
     CDS             complement(696693..698186)
                     /locus_tag="HG535_0F03640"
                     /inference="similar to AA sequence:RefSeq:NP_010974.1"
                     /note="similar to Saccharomyces cerevisiae GIP2 (YER054C)
                     and PIG2 (YIL045W); ancestral locus Anc_7.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145579.1"
                     /db_xref="GeneID:59237612"
                     /translation="MYVKVGGNADGNKGLLSKRDNKTGVPEDELRSHEDVTKSASSLM
                     MRRLNKNEDLSASLNSLAFLHKPQRVKTLNSSLYPDEEIIRNTNINKNLNNGSTDKKV
                     IDDEAEAEVSPTSSYKLARVNDLLINRGGDENMFPIPPVYKKSGELVKSSLKRRSKSL
                     PTSPHVNSEHKNFTALRPGGRLQRSKSVHFDQKTPIKYFREDESPIDVSTKENERTEE
                     ISFRHKPVGYLFGGNDDDDDDDDDDEGASFNDTNLLAMRIDSINLGTATRTGNTISRP
                     PSHVKDRSLRKSKRFSAMARDIPKRESSNKHENSGTSKYVGNSNNNHSCSNNNRVVGL
                     YNENFPILSNKNPKSLKLNIFINLSQDKKCFLQEITLYGARDQHTYPSKKTQTRMIAG
                     RVLVKNIFFDKKVVVRYTWDHWRTSHDVECVYVSDGDGILPGTNMDIFNFIIDDVNKQ
                     DSRAKLEFCIHYVTRNDYQRREFWDSNNGKNYKIDCITDGFTNPFSD"
     gene            complement(<698666..>700465)
                     /locus_tag="HG535_0F03650"
                     /db_xref="GeneID:59237613"
     mRNA            complement(<698666..>700465)
                     /locus_tag="HG535_0F03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289685.1"
                     /db_xref="GeneID:59237613"
     CDS             complement(698666..700465)
                     /locus_tag="HG535_0F03650"
                     /inference="similar to AA sequence:RefSeq:NP_012218.1"
                     /note="similar to Saccharomyces cerevisiae MET30
                     (YIL046W); ancestral locus Anc_7.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145580.1"
                     /db_xref="GeneID:59237613"
                     /translation="MMGSNSNSDNSGSSTYSSNSSDEMIEHIRKKHNRDEDQKDNAKK
                     RQKGSTVSLPQFNLQKFCYRHNPDIQSPENNTACHKQDLKRFQEVNQKISQLPVKEQS
                     VVHHTISTFTKSNDKIRKLILDGLLTASCFPQLSYIATQVQNMIKIDFISVLPREVSL
                     KILCYLDCQSLCNAAKVCRRWQVMADGDRVWHHMCQQHIDRKCPNCGWGLPLLHMKRA
                     REPQSTCCNNGQSTGKKPVKTPWKVIYRDRFKVESNWRRGHCSIQEFKGHMDGVLALH
                     FNSRLLFTGSYDSTVAIWDLCSGSLIRRLSGHTDGVKALYFDGQKLITGSLDKTIRVW
                     NYMTGECISTYRGHTDSILSVDSYRKIIVSGSADTTVKVWHVESRTCYSLRGHTEWVN
                     CVKLHPKSFLCFSCSDDTTIRMWDIRTNSCLRVFEGHVGQVQKVLPLVIIDIENLVVD
                     EPVEDPEAQHQDQEVEPADDILKENLPYPTHILSCSLDNTIKLWDIKTGKCIRTQFGH
                     VEGVWDIAADNFRIVSGSHDGKVKVWDLQSGKCIHTFQGKCLQQNENQSTDNTNCTYK
                     VSPIACVGIGDSEFFTGDEMGFVKRFRFDTDET"
     gene            complement(<700816..>701709)
                     /locus_tag="HG535_0F03660"
                     /db_xref="GeneID:59237614"
     mRNA            complement(<700816..>701709)
                     /locus_tag="HG535_0F03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289686.1"
                     /db_xref="GeneID:59237614"
     CDS             complement(700816..701709)
                     /locus_tag="HG535_0F03660"
                     /inference="similar to AA sequence:RefSeq:NP_010975.3"
                     /note="similar to Saccharomyces cerevisiae HIS1 (YER055C);
                     ancestral locus Anc_7.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145581.1"
                     /db_xref="GeneID:59237614"
                     /translation="MDLVNHLSDRLLFAIPKKGRLYEKAVSILHGADIKFHRSSRLDI
                     ALSTSLPIALIFLPAADIPVFVGEGNCDLGITGVDQVRESDVDVDLPIDLQFGSCKLQ
                     VQVPVMGAYKDPKQLIGKTIVSSFTNLASKYFADLEGVPVEKMTTKVKYVGGSVEASC
                     ALGIADAIVDLVESGETMRAAGLTEIATVLDTSAYLIESKNTKSDPELIETIKSRIEG
                     VMTAQKYVYCNYNAPESILPDLLPITPGRRAPTISKINDEGWVAVSAMIERKKKGVTM
                     DELKRKGAEDIMVFEISNCRV"
     gene            <702374..>704962
                     /locus_tag="HG535_0F03670"
                     /db_xref="GeneID:59237615"
     mRNA            <702374..>704962
                     /locus_tag="HG535_0F03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289687.1"
                     /db_xref="GeneID:59237615"
     CDS             702374..704962
                     /locus_tag="HG535_0F03670"
                     /inference="similar to AA sequence:RefSeq:NP_012217.3"
                     /note="similar to Saccharomyces cerevisiae SYG1 (YIL047C);
                     ancestral locus Anc_7.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145582.1"
                     /db_xref="GeneID:59237615"
                     /translation="MKFGDHINESAVPEWSDKYINYKLGKKKLKQYAKRLEEEANEEE
                     FTLYGNASGPVFYNGTNDESAISDESELRQVNTQYGRQDKVYTSLQETFKTDFVTNWL
                     IGSELAKCDEFYLWLLEKSRKKYSVLKEQLRIYHLHENHESFLDGEPIIAQQNGSSGS
                     YGSIKNFPKNPKIMGFTRRLKKILSSNDLLPSWPTGLSNIKGNLKSSHTGTETFGGIA
                     MAVTVHQAERMLSEALLEFYQYLQLVKTYRDLNVTGFRKMVKKFDKACHTSEVSEFMD
                     YARDTSPLFKHVDANIQLLAQRMKQTGTAQASAKLKAINEDDDPIMWWETKITEWYTK
                     DLTNSDSAQKRHNQRLKKLSIQYTLNEQMIHRNNRAIAQMFFSGIGLGTSGAFICYTL
                     YLAFFSKFNSVLHQILFPLWSGWYMVLLAALLFLGNCFIWHRTGINYRFIMLGEMHAK
                     NGTQLFNNDFATSAISLRLYFLTFFVIACSVCALMSFHWCVLEPYGLVYLGIVLFLFF
                     CPNRVFPYFDKMVDSRIWLVKTAIRLMLSGLYPVEFGDFFLGDIICSLTYSMSDIAMF
                     FCVCSSTPNSLCGSSKSKAFGVLSCLPNYWRMMQCFRRFGDSGDWFPHLLNAIKYLIG
                     VGYYASLAAYRISGNIDSTRTPFIIISTTNAAITAAWDICIDWSLFQPSSKNWLLRDD
                     LYLAGKRNWKTGQYAFGRVLFYYFAMVWDVLIRFQWIVYALAPQTIQQSAITSFVLAV
                     TEILRRFVWVILRVENEHVANVHLFKVTGESPLPYPVSEKSDMVTADKRNVSSSSLSL
                     YHGNLEEPSTAFKSYLRRNSSALFTLAKSVPWAHTTDFQRPRLFSFGANAVHDSESDS
                     ETESVN"
     gene            complement(<705078..>708518)
                     /locus_tag="HG535_0F03680"
                     /db_xref="GeneID:59237616"
     mRNA            complement(<705078..>708518)
                     /locus_tag="HG535_0F03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289688.1"
                     /db_xref="GeneID:59237616"
     CDS             complement(705078..708518)
                     /locus_tag="HG535_0F03680"
                     /inference="similar to AA sequence:RefSeq:NP_012216.1"
                     /note="similar to Saccharomyces cerevisiae NEO1 (YIL048W);
                     ancestral locus Anc_7.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145583.1"
                     /db_xref="GeneID:59237616"
                     /translation="MSFSPRPGTNIENKSKSPLQKVRTRDSFDLQFDDSLEEALDNFQ
                     IFSSNQNKNTDNDRQNRNSQESFEMRTIDENTQSNENLRKSSISGRRPSRNDPWDAPS
                     PNEHNSGLSVHHGGFLNILWSNGRSLLNSPYRLTKGGSSSSIELNENHVEREIHPSTT
                     PTFDRNKYPTNEISNAKYNAVTFIPTLLYEQFKFFFNLYFLAVALSQIIPALRIGYLS
                     SYIVPLAFVLTVTMVKEAMDDIQRRRRDKESNNELYQIINRSQLVRSKDLKVGDLIKI
                     YKGSRIPADAVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNIAQDDLLSKISI
                     TASAPEKSIDKFLGKVTYKESSSHPLTIDNTLWANTVLASSGHCIACVVYTGKDTRQA
                     MNTTTPKVKTGLLELEINSISKVLCASVFILSISLVAFAGFQNPDWYIDVMRYLILFS
                     TIIPVSLRVNLDLAKSVYAYQIEHDHTIPETVVRTSTIPEDLGRIEYLLSDKTGTLTQ
                     NDMELRKIHLGTVSYSGETVDIVTDYIQSLVISKGQAGNAQPSTARRDISTRVCDLII
                     TLALCHNVTPTFEDEEITYQAASPDEIAIVKFTELVGLSLFKRDRHSVTLLHEHSGKL
                     LNYEILQVFPFNSDTKRMGIIVHDQIKDEYWFLEKGADTVMSSIVEPNDWLEEETGNM
                     AREGLRTLVIGRKKLSLKIYDQFRKKYDEASLSMLNRDEQMSSVVSEFLENNLELLGL
                     TGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTISKV
                     GKPDGALEQLEYLQVNRNSCLIIDGESLNTYMLYFKKEFFEITINLQAVVACRCTPQQ
                     KADVALAIRELTSKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSVTQFC
                     HLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSICSRFEPIALYEGWLMVGY
                     ATCYTMAPVFSLTLDHDIDESLTKIYPELYKDLTEGKSLSYKTFFVWVALSLFQGIVI
                     QGSSQYFTSVNPIDFNKMVAISFTSLVLNELIMVALEINTWNKTMIITELVTLGLYIV
                     SIPFLSDYFDLSYIVKLLFFGELLFILSISVLPVWAAKAIHRKLHPPSYAKVQEFTTP
                     "
     gene            complement(<708886..>709650)
                     /locus_tag="HG535_0F03690"
                     /db_xref="GeneID:59237617"
     mRNA            complement(<708886..>709650)
                     /locus_tag="HG535_0F03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289689.1"
                     /db_xref="GeneID:59237617"
     CDS             complement(708886..709650)
                     /locus_tag="HG535_0F03690"
                     /inference="similar to AA sequence:RefSeq:NP_012215.1"
                     /note="similar to Saccharomyces cerevisiae DFG10
                     (YIL049W); ancestral locus Anc_7.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145584.1"
                     /db_xref="GeneID:59237617"
                     /translation="MEVGNALQYLLIGYKISFIAGLLCLVIAKCFLPEFLQYGKTLSA
                     RAEERDGRLISLSGLVYLTMPKSSFSHFYYLSSALSIITLTTYPRSSLTWLILLHSLR
                     RLYETKYVSKYAAHSRMNWSHYVVGLWFYASLHLILNAKLASNSIPVSLNPVATLIFL
                     MASIEQYKNHHILSNLTKYSLPEKGMFTIVCCPHYLDEILIYVSLVVYNREFAWPLIW
                     VALTLTTSALETQKYYNAKFKDTNRIPSYAIVPYVV"
     gene            complement(<709991..>711604)
                     /locus_tag="HG535_0F03700"
                     /db_xref="GeneID:59237618"
     mRNA            complement(<709991..>711604)
                     /locus_tag="HG535_0F03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289690.1"
                     /db_xref="GeneID:59237618"
     CDS             complement(709991..711604)
                     /locus_tag="HG535_0F03700"
                     /inference="similar to AA sequence:RefSeq:NP_010976.1"
                     /note="similar to Saccharomyces cerevisiae FCY2 (YER056C);
                     ancestral locus Anc_7.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145585.1"
                     /db_xref="GeneID:59237618"
                     /translation="MSGKEAYEIHDLEGNVDRSQSSSEHVGSTNSEKKNPYVDVEDQE
                     YEDEQYASGVAEKSRLGWCRRAVATLLDKAETKGVEPVTDEEKTDISPWGPASMWFSA
                     NMVIAAYSLGALGPLVFSLNFGTSVLTIVFFNLLGLVSVAFFSIFGAEFGLRQMVLSR
                     FLLGNLTARAFAFINVIACVGWGVVNTIVSAQLLHMINSGGNQCPPWAGCLIIIGATV
                     LITFFGIRIIHAYERWSWVPNFAVFLVIIARLAKNGSFQNGEWTSGPSTAGGVLSFGS
                     AIFGFASGWTTYASDYTVYMKKEANKYKIFFTFVLCLAFPLFFCMILGAASAMGTFNN
                     TTYADYYNNYSIGGLTYAILVPDSLHGFGQFCCVLLALSTVANNIPNMYSVALSAQAT
                     WEPLAKIPRVVWTLAANGATLGISIAAYYKFENFMENFMNSIGYYLAIYISIALSEHF
                     IYRKGFKGYDIDQWNRWDLLPIGIAGCSALFVAGFGVALGMSQTYWTGEIGRLIGDFG
                     GDIGFELGAGFAFIVYNVLRPLEIKYMGR"
     gene            complement(<712487..>713139)
                     /locus_tag="HG535_0F03710"
                     /db_xref="GeneID:59237619"
     mRNA            complement(join(<712487..712821,713103..>713139))
                     /locus_tag="HG535_0F03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289691.1"
                     /db_xref="GeneID:59237619"
     CDS             complement(join(712487..712821,713103..713139))
                     /locus_tag="HG535_0F03710"
                     /inference="similar to AA sequence:RefSeq:NP_012212.1"
                     /note="similar to Saccharomyces cerevisiae RPL34A
                     (YER056C- A) and RPL34B (YIL052C); ancestral locus
                     Anc_7.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145586.1"
                     /db_xref="GeneID:59237619"
                     /translation="MAQRVTYRRRNPYNTRSNKIKTVKTPGGILRAQHVKKLAKRPRC
                     GDTGVPLQGIASLRSRQYATISKTKKTVSRAYGGKLSANSVKERIVRAFLIEEQKVVK
                     RVVKEQTEAAKKDASKKSKKN"
     gene            complement(<713871..>714302)
                     /locus_tag="HG535_0F03720"
                     /db_xref="GeneID:59237620"
     mRNA            complement(<713871..>714302)
                     /locus_tag="HG535_0F03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289692.1"
                     /db_xref="GeneID:59237620"
     CDS             complement(713871..714302)
                     /locus_tag="HG535_0F03720"
                     /inference="similar to AA sequence:RefSeq:NP_010978.3"
                     /note="similar to Saccharomyces cerevisiae HMF1 (YER057C)
                     and MMF1 (YIL051C); ancestral locus Anc_7.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145587.1"
                     /db_xref="GeneID:59237620"
                     /translation="MFVRSGLIKLPFQRAMTTLTPVATKNAPPAAASYSQAMKANNLV
                     FVSGQIPYTPDNKPVEGSIADKAEQVFKNVSAILEASNSSFEKVVKVNVFLADIKSFA
                     EFNTVYAKYFSVHKPARSCVAAAALPLNVDLEMEVIAAEND"
     gene            <714594..>714941
                     /locus_tag="HG535_0F03730"
                     /db_xref="GeneID:59237621"
     mRNA            <714594..>714941
                     /locus_tag="HG535_0F03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289693.1"
                     /db_xref="GeneID:59237621"
     CDS             714594..714941
                     /locus_tag="HG535_0F03730"
                     /inference="similar to AA sequence:RefSeq:NP_010979.1"
                     /note="similar to Saccharomyces cerevisiae PET117
                     (YER058W); ancestral locus Anc_7.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145588.1"
                     /db_xref="GeneID:59237621"
                     /translation="MSRASKITFGLSCLLTGSTVVGVHLVQNMERETLHQGPIKDAKR
                     VAEKNQRKLELSQQQVQQPDAAGSDPEKNRQKMLNKSEHQLQQELRKKYESIQPLSGE
                     IVTKGGEAVNNSK"
     gene            <715463..>716869
                     /locus_tag="HG535_0F03740"
                     /db_xref="GeneID:59237622"
     mRNA            <715463..>716869
                     /locus_tag="HG535_0F03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289694.1"
                     /db_xref="GeneID:59237622"
     CDS             715463..716869
                     /locus_tag="HG535_0F03740"
                     /inference="similar to AA sequence:RefSeq:NP_010980.1"
                     /note="similar to Saccharomyces cerevisiae PCL6 (YER059W)
                     and PCL7 (YIL050W); ancestral locus Anc_7.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145589.1"
                     /db_xref="GeneID:59237622"
                     /translation="MYTMSSPSSMSGLAVTHSNSILPTPIPRSVPCVAQQQQHHQRQV
                     SGDLSGQHLDDNMSSDDTESSALASFGVPSAAEGAQAKPLSRMISSSRIITTEETVSS
                     SLSSNSPQRNLSMTSHGQPPPIMSGTIAMGHESDDNDTMIDANNREVTTGDLSLVRPS
                     NHRYSENNGPMVAITREESIKNERELETEDEPDRSWLGKKKLLLDDDNNNNNDENDNN
                     NKGAADSCEIENDDETTCASFDIATFPTLELLEMLTALLDKIVKSNDHLATLNGETNV
                     GNENIHLNSNNVDSLESILSFRGKHVPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDR
                     ISRKCNANHGGDSPHFQHSSSVQQQEQEQPQHSQQQQQAFVMDSHNIHRLLIAGVTVS
                     TKFFSDFFYSNSRYARVGGISLQELNHLELQFLVLCDFELLVSTNELQRYADLLYKFW
                     TCSTEVENQQKPNVSMAT"
     gene            complement(<716916..>718256)
                     /locus_tag="HG535_0F03750"
                     /db_xref="GeneID:59237623"
     mRNA            complement(<716916..>718256)
                     /locus_tag="HG535_0F03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289695.1"
                     /db_xref="GeneID:59237623"
     CDS             complement(716916..718256)
                     /locus_tag="HG535_0F03750"
                     /inference="similar to AA sequence:RefSeq:NP_010983.2"
                     /note="similar to Saccharomyces cerevisiae CEM1 (YER061C);
                     ancestral locus Anc_7.242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145590.1"
                     /db_xref="GeneID:59237623"
                     /translation="MSRRVVVTGLGCITPLGTTLKQSWSNLLASKSGVVPITSLPNYK
                     SDYEQFANSVPPTVVVGKIPELQEQVGLVTDQDARRVSDFTKLAILASHEALSHADLL
                     EKRSGDEVSIDQSKANLYRFGCVIGTGIASIQDFYSTSVSFHNDRKRVNPVFVPKILT
                     NMAAGNVSIKFNLKGVSHCASTACATGNNSIGDAFNFIRLGMADVCLAGASESCIHPL
                     SLAGFIRTKSITVDDGVSRPFDAKRSGFVLGEGAGMLVLESLENAERRGADILAEIVG
                     YGLSSDAFHITSPCSDGNGAMRAIQMALDMGKVNTEQIGYVNAHATSTVLGDRAESIA
                     IKSALLPGPRSGLDGNLLFVSSNKGAIGHLLGAAGAVESIFTIMSLKDEIMPHTLNLE
                     NISGAKGDNYEKDFSGITFIKDKPIVNPNLEYALCNSFGFGGVNTSLLFKKWVK"
     gene            complement(<720548..>721300)
                     /locus_tag="HG535_0F03760"
                     /db_xref="GeneID:59237624"
     mRNA            complement(<720548..>721300)
                     /locus_tag="HG535_0F03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289696.1"
                     /db_xref="GeneID:59237624"
     CDS             complement(720548..721300)
                     /locus_tag="HG535_0F03760"
                     /inference="similar to AA sequence:RefSeq:NP_010984.3"
                     /note="similar to Saccharomyces cerevisiae HOR2 (YER062C)
                     and RHR2 (YIL053W); ancestral locus Anc_7.243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145591.1"
                     /db_xref="GeneID:59237624"
                     /translation="MPLTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYF
                     DAEHVINISHGWRTYDAIAKFAPDYADEDYVTKLEGEIPEKYGKHSIEVPGAVKLCND
                     LNKLPKEKWAVATSGTRDMARKWFDILGIRRPKYFITANDVTQGKPFPEPYIKGRDGL
                     GFPINKEDPSKSKVIVFEDAPAGIAAGKAAGCKIVGIATTFDLQFLIDKGCDIIVKNH
                     ESIQVGAYDAQTDEVEFIFNDYLYAKDDLLKW"
     gene            <723207..>723860
                     /locus_tag="HG535_0F03770"
                     /db_xref="GeneID:59237625"
     mRNA            <723207..>723860
                     /locus_tag="HG535_0F03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289697.1"
                     /db_xref="GeneID:59237625"
     CDS             723207..723860
                     /locus_tag="HG535_0F03770"
                     /inference="similar to AA sequence:RefSeq:NP_010985.1"
                     /note="similar to Saccharomyces cerevisiae THO1 (YER063W);
                     ancestral locus Anc_7.244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145592.1"
                     /db_xref="GeneID:59237625"
                     /translation="MTDYNTLTVAQLKEQLKEKDLPVQGLKSELVQRLQESDQAQSNG
                     SESEKASTQDEAPAVETEEKQSAEPAIQLTSETSAEAAPESAPESVPEPASETVPETV
                     PETVPETIQSSETRPEESAESAKLSEEEMKKLALETLNKKLHRSKKFGQDPSQIDALN
                     KMITRVEKFGLDLKSSLAVELGLAKNLVELSKPKPPQKSKNKNMNRKKFRSNKFNSR"
     gene            <724003..>725616
                     /locus_tag="HG535_0F03780"
                     /db_xref="GeneID:59237626"
     mRNA            <724003..>725616
                     /locus_tag="HG535_0F03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289698.1"
                     /db_xref="GeneID:59237626"
     CDS             724003..725616
                     /locus_tag="HG535_0F03780"
                     /inference="similar to AA sequence:RefSeq:NP_012209.1"
                     /note="similar to Saccharomyces cerevisiae YIL055C;
                     ancestral locus Anc_7.245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145593.1"
                     /db_xref="GeneID:59237626"
                     /translation="MECNIEFIMPILFPNLVTVYHSSDATSVSSFDNQDWYLIPNVMN
                     SHFNSVMDSRPIVLRIDNLPPGKNWKQIKYLIGGIIHHSSVLKVKLLPLMTSLVPPFI
                     SFQSCIVTLKSSLDEDSLNDLLMELNTYQWDYYNLYAYTLPIPAPPPPPPLSPPLNQI
                     ISSDFESSTDNEHSSNESTPNTAKKTFLYPMPPPGALQGGLPNVLPNGIPSVIAAGMP
                     AMSPAPMMNPQQLAANASMPPQPMMNLPTQRRPYYQPAVLTFNQRSSFGPLPNNMRMK
                     NNSLSAYSYYPQNNRAMATGQSESFKSFSKQVNGNLSGASSSRGLKQIFNERSFRKQM
                     TGRGMFQLQIENFPPYLKMETLISLNEQQEVQLREKGPKIIATSQPDLFGRLRWTILK
                     DYIKSRCPKLLNLQEKLKSQSETSQDGVATNNTREFYVGVYEDDEVQVQLNIISQDDT
                     QDKVGKKDTTAVEGPTTDEEKDIQKNIVNAVIYKAIVGFNDKELYDTCFENLRDQEYS
                     LGYKLKVSRLSPFEENKNGGTGNSDNTGN"
     gene            complement(<725839..>727836)
                     /locus_tag="HG535_0F03790"
                     /db_xref="GeneID:59237627"
     mRNA            complement(<725839..>727836)
                     /locus_tag="HG535_0F03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289699.1"
                     /db_xref="GeneID:59237627"
     CDS             complement(725839..727836)
                     /locus_tag="HG535_0F03790"
                     /inference="similar to AA sequence:RefSeq:NP_010986.1"
                     /note="similar to Saccharomyces cerevisiae YER064C and
                     VHR1 (YIL056W); ancestral locus Anc_7.246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145594.1"
                     /db_xref="GeneID:59237627"
                     /translation="MAGYKVSKSSGSHSCSGTTRKIREQLNFNDEKKWKKFSNRRLEL
                     IDKFGLSERKASEQDDNIRQIATILRTEFGYSLSAAGEFEKLVTAAVQSVRRNRKRSK
                     KRLPDNSSGTATTTNTGSSEDEFMAKDDSPLQRQISMTPIAPDLHSNMQSLNFPATSL
                     PSIQPKSIQPSSRVQTTTPAPSAPGPTAGSPAVPEASGAPVAAASSVPSGSALAGTSH
                     PSYHMPTQQRYADVIKAVIADVVNNVVTLTDQSQKDRSSSTNLTEFAMSINDNHLLSF
                     GLHNKPSITGQNQSKSSASDIPFFLREKLLVIIQRSRTCFDMAHSQGSIDLHSNLEIL
                     GEMAVRSSIAFVIERFFSNLMPSSMEYLTSKTSSLESLASLSINVFGPASKRSLSHLP
                     PAVQTKLLFLVIGGLIKDFGFDPCLYPLSEIVHHLVMHQYPSVTKSSVLAQKNGPNSD
                     ASQRITVLSSLSMKPQLANEDVNKKVVIKFKGREQAFTFHLLSNGPPTVNEILENCKS
                     LFQIISQTKQLSLCHNNSIVRDDVELAKLFNSFSNQNIVLEVKEAQRDPSDLNDGLKI
                     LSDASLQIKQEIPNGQSHKNSTSSLDAFDKIISRIGKFPKNADASLQQSFPPSNMPAS
                     TSHQANKEELPSLPSVVMNGARNNFFFQDNNLPQSVFQPLL"
     gene            complement(<728661..>730349)
                     /locus_tag="HG535_0F03800"
                     /db_xref="GeneID:59237628"
     mRNA            complement(<728661..>730349)
                     /locus_tag="HG535_0F03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289700.1"
                     /db_xref="GeneID:59237628"
     CDS             complement(728661..730349)
                     /locus_tag="HG535_0F03800"
                     /inference="similar to AA sequence:RefSeq:NP_010987.3"
                     /note="similar to Saccharomyces cerevisiae ICL1 (YER065C);
                     ancestral locus Anc_7.247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145595.1"
                     /db_xref="GeneID:59237628"
                     /translation="MTMPVTTLDTTTSSNFQVLQNELNAAAVEIEKWWSQPRWKGTKR
                     IYTAKDIAARRGTFPPVEYPSSVMAKKLYRVLEQHHKDRTVAKTFGALDPVHISQMAK
                     YLDTIYVSGWQCSSTASSSNEPGPDLADYPMDTVPNKVDHLFKAQLFHDRKQLEARAK
                     ARSQEELDAMGAPIDYLTPIVADGDAGHGGLTAVFKLTKMFIERGAAGIHMEDQTSTN
                     KKCGHMAGRCVIPVQEHINRLSTVRMCADIMHSDLVLVARTDSEAATLISSTIDTRDH
                     YFIVGATNSAMEDESFAETMDKAILSGKSAEELAHIEKDWCERADLKLFHEAFADEVN
                     RLPKISEKEKQKIIDLFSSKIGPLTETSHRDAKKLAKELLGHDIYFNWDLPRVREGLY
                     RYQGGTQCSIMRARAFAPFADLVWMESNYPDYQQAVDFSKGVKAEYPDKMLAYNLSPS
                     FNWTKAMSIDDQETFIDRLGNLGYSWQFITLAGLHTTALAISNFSRDFAQDGMKAYAQ
                     NVQKQEMENDVDILKHQKWSGAEYIDSLLKLAQGGISATAAMGKGVTEDQFRAH"
     gene            complement(730753..730834)
                     /locus_tag="HG535_0Ftrna13S"
                     /db_xref="GeneID:59237886"
     tRNA            complement(730753..730834)
                     /locus_tag="HG535_0Ftrna13S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCA"
                     /db_xref="GeneID:59237886"
     gene            <731452..>731928
                     /locus_tag="HG535_0F03810"
                     /db_xref="GeneID:59237629"
     mRNA            <731452..>731928
                     /locus_tag="HG535_0F03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289701.1"
                     /db_xref="GeneID:59237629"
     CDS             731452..731928
                     /locus_tag="HG535_0F03810"
                     /inference="similar to AA sequence:RefSeq:NP_010990.1"
                     /note="similar to Saccharomyces cerevisiae YER067W and
                     YIL057C; ancestral locus Anc_7.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145596.1"
                     /db_xref="GeneID:59237629"
                     /translation="MTKKNKGPKVTTITTKEGEALKVFEDLKDFETFIKQETEDNDFD
                     DLHCRLKYYPPFVLHEAHDDPEKISDTANCHSKKFVRHLHQHVEKHLLKDLKEAIQTP
                     SLKFSEKSKQETFDKIVWHYGDNAEYHNKKFHINLDVTCTHDSALVDIDYKTMPII"
     gene            <732680..>734572
                     /locus_tag="HG535_0F03820"
                     /db_xref="GeneID:59237630"
     mRNA            <732680..>734572
                     /locus_tag="HG535_0F03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289702.1"
                     /db_xref="GeneID:59237630"
     CDS             732680..734572
                     /locus_tag="HG535_0F03820"
                     /inference="similar to AA sequence:RefSeq:NP_010991.3"
                     /note="similar to Saccharomyces cerevisiae MOT2 (YER068W);
                     ancestral locus Anc_7.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145597.1"
                     /db_xref="GeneID:59237630"
                     /translation="MTTNPHVHENLKAIQKALSNYDMSFLSDDEEDFCPLCLEPMDIT
                     DKNFKPCPCGYQICQFCYNNIRQNEELNGRCPACRRKYDDESVEYVVLTSEELKMERE
                     KQSRKEWERKQRDKERKEYENANRKHLAGMRVIQKNLVYVVGINPPVPYEEVAPLLKS
                     DKYFGQYGKISKIVVNKKTPHSNNDHYHSNATFTGYGVYITFSKKEDAAKCIAQVDGT
                     YMDGRLVKAAYGTTKYCSSYLRGLTCPNPNCMFLHEPGEEADSFNRRELSNKQQPSQQ
                     VTSHQQQQSQSQIQAQAQAQSQAQSQTQQATTRTHLASTIYKNTSNTVPTATGNFSGT
                     PSPALIKTQLHHQDHHMNGTGSSTPILTPATIPAGSNPWGLSQSANQVSVSKNASTHN
                     LPTLTDALNHQQSNIANNSIHNNQNNNNNIVSSNAQTEQLANRKKQHSAREKRCIDPY
                     DALSGAVKFLDDRIASLSNYQTRSLSLRPDLIDDATFNKYPSLFSWDNIEISQESDQI
                     LTEKLIDMLAINPVDHTASVVSFFQNANVGAFPQSIPQQPVPQHSQPQSHLQQQQAQQ
                     RPLNVNTPPPPGIFSTQQIPIQMQQQQQQQQQQQQQASADNRQSINSTDFLNQLISGR
                     RVAAGN"
     gene            <734771..>735682
                     /locus_tag="HG535_0F03830"
                     /db_xref="GeneID:59237631"
     mRNA            <734771..>735682
                     /locus_tag="HG535_0F03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289703.1"
                     /db_xref="GeneID:59237631"
     CDS             734771..735682
                     /locus_tag="HG535_0F03830"
                     /inference="similar to AA sequence:RefSeq:NP_012203.1"
                     /note="similar to Saccharomyces cerevisiae SNP1 (YIL061C);
                     ancestral locus Anc_7.250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145598.1"
                     /db_xref="GeneID:59237631"
                     /translation="MNHNISKFPPDVSKLFKARPPLQYKRQVDYPLEKRQTNPHITGV
                     SHLLGSQLNEYRNRFSEGSSNEHIKEYEKAVTSKINELRSLDEKLKNWEPNNDPNIKH
                     TDPYRTIFVGRLSYEVNEVELQKEFIKFGEIEKVRVVRDKITNKSRGYAFVVFTNPQS
                     SKLACKEIGVHRGLEIGGRTCIVDIERGRTVKYFKPRRLGGGLGGRGYTKMYRKSDRP
                     FRRPVMERDPVILPNPKTFPTRPVYTGPSRFSRSPASTQTASSMPSNRYGANAGQEVP
                     PVQTSYRSRNARAQESNKVQKTEEPDY"
     gene            <735986..>738595
                     /locus_tag="HG535_0F03840"
                     /db_xref="GeneID:59237632"
     mRNA            <735986..>738595
                     /locus_tag="HG535_0F03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289704.1"
                     /db_xref="GeneID:59237632"
     CDS             735986..738595
                     /locus_tag="HG535_0F03840"
                     /inference="similar to AA sequence:RefSeq:NP_010992.1"
                     /note="similar to Saccharomyces cerevisiae ARG5,6
                     (YER069W); ancestral locus Anc_7.251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145599.1"
                     /db_xref="GeneID:59237632"
                     /translation="MPSARLLVSTGALKHSRLQQIKNVLAKAAAAGNGNSSGSVLAAG
                     KVAPSVTFTRKKVGYSKRYMSSSNGVGTLATRSTVIQLLNNISSKREVEQYLKYFTSV
                     SQQQFAVIKVGGAIISDNLQELASCLAFLYHVGLYPIVLHGTGPQVNGRLEAQGVEPD
                     YIDGIRITDERTMAVVRQCFLEQNLKLVTALEQLGVRARPITSGVFTANYLDKEKYQL
                     VGDITGVTKDPIEASIKAGALPILTSLAETPSGQMLNVNADVAAGELARIFEPLKIVY
                     LNEKGGIINGETGEKISVINLDEEYEALMQQSWVKYGTKLKIREIKELLDFLPRSSSV
                     AIINVQDLQKELFTDSGAGTMIRRGYKLTKRSSLSEFPSPDILRQALQRDADIISGKL
                     AVATYLRELEQANFTTYADEPLDALAIIKKEGKIPRLDKFLCTEYAWLNNVTDNVFSA
                     LSRDFPALQWIVNEDDPNIAWHFDKSQGSYLRSGKVLFWYGIEDLNTVSEIIREFTKE
                     VGYPAGSASESGVFSSGSASRSYSTRSAPKPTGSNTSPGRVALIGARGYTGKNLISLI
                     DNHPFLNVAHVSSRELKGQSLHYYKKSNIVYESLQIEDIKGLESKGDVDFWVMALPNK
                     VCEPFVEAIESVHGKSKIIDLSADHRFVPETEWTYGLPELNDRSKIAAAKKIANPGCY
                     ATGSQLSIAPLTEFITGLPTVFGVSGYSGAGTKPSPKNDPKFLSNNLIPYSLTDHIHE
                     REISSRIGQPVAFIPHVGQWFQGISLTVSIPIKKGSLTAEDTKKIYEEFFKSEELVHI
                     GDDIPLVKDISGTHGVVIGGFKVNDAQDRVVVCATIDNLLKGAATQCLQNINLAMGYG
                     EYEGIPKDKILKR"
     gene            <738900..>739361
                     /locus_tag="HG535_0F03850"
                     /db_xref="GeneID:59237633"
     mRNA            <738900..>739361
                     /locus_tag="HG535_0F03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289705.1"
                     /db_xref="GeneID:59237633"
     CDS             738900..739361
                     /locus_tag="HG535_0F03850"
                     /inference="similar to AA sequence:RefSeq:NP_012202.1"
                     /note="similar to Saccharomyces cerevisiae ARC15
                     (YIL062C); ancestral locus Anc_7.252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145600.1"
                     /db_xref="GeneID:59237633"
                     /translation="MEDWRRIDIDSFDPNSGRLTNDDLIPPYAHHVTLQELQPKIAQL
                     RSLATSGDMSSATKLATEDPPYSADANTKAVYFQAVLEALTQVRQADIATIVKQLSPQ
                     QQDVLVKYLYKGMSLPEGQRQGGILLAWFEKLTQSSGVNPIVHFLSDRRTV"
     gene            <739582..>740661
                     /locus_tag="HG535_0F03860"
                     /db_xref="GeneID:59237634"
     mRNA            <739582..>740661
                     /locus_tag="HG535_0F03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289706.1"
                     /db_xref="GeneID:59237634"
     CDS             739582..740661
                     /locus_tag="HG535_0F03860"
                     /inference="similar to AA sequence:RefSeq:NP_012201.1"
                     /note="similar to Saccharomyces cerevisiae YRB2 (YIL063C);
                     ancestral locus Anc_7.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145601.1"
                     /db_xref="GeneID:59237634"
                     /translation="MNNTSFVMPDTEQSSNKQQEKSSGSSVSNATNEEWPGTNKRPRE
                     DKDEGHEDSKRNTRENLNSAENSNRPEKSKDNENREQEEKSTTKKIRLEGSKAETGKT
                     DVIETAGKKEQNGTDNESKSDAEKPKFVFGSGTAFSSGFGSFKKSDTDNGESSKAEMP
                     SKPFAFGSGFSFGSGFGVLKKKADADNEKKDTDEEKKSKAVEAKEMSDKSNVALKGTI
                     EESVKPSVEQTPIKLQKQEIKSGEESEETIYQVNAKLYQLSDFEEGWKERGVGAIKVN
                     QNSNTEKARLIMRSRGILKVILNLPLIKGIKIQRGFPGSLQSEKFVRVISVNDNKAPV
                     QYAFKTGKEETASELYDSMVKLAPQ"
     gene            complement(<740743..>741429)
                     /locus_tag="HG535_0F03870"
                     /db_xref="GeneID:59237635"
     mRNA            complement(<740743..>741429)
                     /locus_tag="HG535_0F03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289707.1"
                     /db_xref="GeneID:59237635"
     CDS             complement(740743..741429)
                     /locus_tag="HG535_0F03870"
                     /inference="similar to AA sequence:RefSeq:NP_012200.1"
                     /note="similar to Saccharomyces cerevisiae YIL064W;
                     ancestral locus Anc_7.254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145602.1"
                     /db_xref="GeneID:59237635"
                     /translation="MADTTRLNISKLGTKTYWDDFYALERANFNQNPDDTGECWFDDN
                     DAERRMVDFLLDNVGEQLIDMKSSMIDLGTGNGHLLFELCENGFSGPMLGVDYSSESV
                     AFAHSVSKVRQFDAFARFEAADIFQADWCPGKFDIVLDKGTLDAIALSGLQFENHKTV
                     FDCYSEVIEKILNKNGVFLITSCNFSEDELVRLIQTKNLVKWKSIKYPSFEFGGVKGT
                     AICSVAFFKR"
     gene            <741634..>742101
                     /locus_tag="HG535_0F03880"
                     /db_xref="GeneID:59237636"
     mRNA            <741634..>742101
                     /locus_tag="HG535_0F03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289708.1"
                     /db_xref="GeneID:59237636"
     CDS             741634..742101
                     /locus_tag="HG535_0F03880"
                     /inference="similar to AA sequence:RefSeq:NP_012199.3"
                     /note="similar to Saccharomyces cerevisiae FIS1 (YIL065C);
                     ancestral locus Anc_7.255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145603.1"
                     /db_xref="GeneID:59237636"
                     /translation="MAKFNFLPTLQDAFEPLLPQQVEILRQQVLSEGGDSASIQSRFN
                     YAWGLIKSNDVNDQRLGVKLLSDIYKESSTRRRECLYYLGIGCYKLGEYTMAKRYVDT
                     LHEHEPNNKQACALKSMIEDKIQKETVKGLALATGFIAGTAAIAAVLFRNRKR"
     gene            <742619..>745264
                     /locus_tag="HG535_0F03890"
                     /db_xref="GeneID:59237637"
     mRNA            <742619..>745264
                     /locus_tag="HG535_0F03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289709.1"
                     /db_xref="GeneID:59237637"
     CDS             742619..745264
                     /locus_tag="HG535_0F03890"
                     /inference="similar to AA sequence:RefSeq:NP_010993.1"
                     /note="similar to Saccharomyces cerevisiae RNR1 (YER070W)
                     and RNR3 (YIL066C); ancestral locus Anc_7.256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145604.1"
                     /db_xref="GeneID:59237637"
                     /translation="MFVYKRDGHKEPVRFDKITARISRLCYGLDPAHIDAVKITQRII
                     SGVYEGVTTVELDNLAAETCAYMTTVHPDYATLAARIAISNLHKQTTKQFSQVVSDLF
                     HYVNPKNGVHSPMISNEVYDIIMENKDELNSAIVYDRDFQFNYFGFKTLERSYLLRIN
                     GEVAERPQHLIMRVAVGIHGSDIKSAIETYNLMSLRYFIHASPTLFNAGTPHPQMSSC
                     FLVAMKDDSIEGIYDTLKECAMISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGLIPMI
                     RVFNNTARYVDQGGNKRPGAFALYLEPWHADIFDFVDIRKNHGKEEIRARDLFPALWI
                     PDLFMKRVQENGDWTLFSPSEAPGLADVYGDEFEALYVRYVSEGRGRKTIKAQKLWYA
                     ILEAQTETGTPFMLYKDACNEKSNQKNLGTIKSSNLCCEIVEYSAPDETAVCNLASIA
                     LPSCVQVSENGKTQWYNFAKLHEIAKVITRNLNKVIDRNYYPVIEAKNSNMRHRPIAL
                     GVNGLADVFMLLRIPFESPEAKELNMHIFETIYHASLEASCELAEKDGPYQSYQGSPV
                     SQGVLQYDMWNTKPSDLWDWDTLKQQIKKHGIRNSLLMAPMPTASTSQILGYNECFEP
                     FTSNMYSRRVLSGEFQIVNPYLLRDLVDLGIWDESMKQHIITDNGSIQNLPNIPQEIK
                     DLYKTVWEISQKHIIEMAADRAAFIDQSHSLNIHIRAPTMGKLTSMHFYGWKKGLKTG
                     MYYLRTQAASAAIQFTIDKSVAELAGQNAVDMSQLQRPKYVPHKVNLEDGSLMPVDAT
                     VKETSPTPSTSSSISNSIASLKIQDSQPVTPIASKPQSDVSGGKTNKELSEGGKGEAN
                     EFDIYNSKVIACAIDNPESCTMCSG"
     gene            complement(<745627..>747126)
                     /locus_tag="HG535_0F03900"
                     /db_xref="GeneID:59237638"
     mRNA            complement(<745627..>747126)
                     /locus_tag="HG535_0F03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289710.1"
                     /db_xref="GeneID:59237638"
     CDS             complement(745627..747126)
                     /locus_tag="HG535_0F03900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145605.1"
                     /db_xref="GeneID:59237638"
                     /translation="MTVLQMSKDFSHLYSIQTKTLKPSPLEVFMPLFYDPKIVFLGSG
                     LPMSQYFPWKHIHSVCPRPPFLDGVGAVPSGREADTCTIMIPKDEATPAGDTQDIVLA
                     RALQYGFGEGPPEILNFVQKHTEMIHDIKYADWDILLTIGNTAAWDLTLRVFCNRGDS
                     ILAEKYSYSPPLCNAEGQGLNIIPVPMDEYGLVPTKLKAILENWNPKKAMPKLLYTIP
                     MGQNPTGVSLPEKRKKEIYEIAQAYDFLIVEDDPYYFFQMDPYVEKPSERSDRSFGSR
                     NDFISSLARSFLSFDTDGRVIRLESCSKTLGPGIRLGWIVGSKGILENMERLSEITVL
                     SPSGISLSIVAGTLNRWGQHGYLDWLIGLRREYTKKRDGALDACREYLPNESWVEIIP
                     PAAGMFFSIIIDASAHPDFRRKFHSKCNDVEQYLYQEFIAEGTLVFPSQFFEVGEKTD
                     FSFQYAVDCKSEPHKIFFRGTYAAVSIEETREGIKRLGRVLKREFYALD"
     gene            748901..748972
                     /locus_tag="HG535_0Ftrna7D"
                     /db_xref="GeneID:59237898"
     tRNA            748901..748972
                     /locus_tag="HG535_0Ftrna7D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:59237898"
     gene            complement(<749620..>754945)
                     /locus_tag="HG535_0F03920"
                     /db_xref="GeneID:59237639"
     mRNA            complement(join(<749620..753636,753638..>754945))
                     /locus_tag="HG535_0F03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289711.1"
                     /db_xref="GeneID:59237639"
     CDS             complement(join(749620..753636,753638..754945))
                     /locus_tag="HG535_0F03920"
                     /ribosomal_slippage
                     /note="Ty-like element, ribosomal frameshifting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145606.1"
                     /db_xref="GeneID:59237639"
                     /translation="MSNQVTIDNAEENILYKYGSAAKVPFSMSREAEDSLFTSREKSN
                     SSEISNNGTDPNLSDSQRDFPSLQPSIPASVDNKQEGSPKSSAYDAGYQHTGSTQGYT
                     YPYPWPSPYPPIAPPMVPPMGNGMFNWNMNADGIKYIPATSYETFMYQQKLLNDQFKQ
                     YRKFYDQRSEDDTTSESAKESNNEQVLPDLDEISNPSEFPRWMRSFKRFLEDNKLGDI
                     IPDRLNESERDATKSEKAFIINSFKTYVKETAYPKSVKDAIKRGHDLFRIILCHVSED
                     SNLRSAIWRELTTISYDGSEDSYYYTSRVKELYSQLKATNSNIPEDIICEYLLKNLHG
                     QYAKIRENHYLEYDLNTIAGISKCVLRTYDRLIKNKKHTSETSPSVTNRHCYKCSSEG
                     HFAPQCPNVKDKLPKPSINSRKEKKSYHRKGIHKIGLTRDTELLGILQNSKKKRPSMT
                     KTPQTGELVEDNQHLLIDSGAAISVIRDPGLLHNINKHPNIGIADAQDREIPISVSGD
                     LQLSFPGTSIIHTEAVASTVPHVDILSLHELQKNGITVDFNNSQVTNNKGKMVARIKK
                     IGPYYWIPAKYIHKPHKKLNVMNVQKQPLFPMEFIHRLLGHVNIKTLRDSIKQGMLTN
                     LSMDDIDWSGYSNFQCEDCVSGKSKKHKHLVGSRLTYQKSYQPFEFLHTDIFGPVPHM
                     PTSSPSYFMAFTDEATRFRWVFGLWNKEAETVTSKFRELVNMVKTQFNTKVRSFQMDR
                     GSEYTNKTIRNFFKEYGIIPCYTSVGDSKANGVAERLNYTLLDDCRTLLRSSNLPLHL
                     WFYAVQFSTLMRNSLITSSVGTSSRAKAGLTGLDVSTILPFGQRVMVNNPPKNKLRPR
                     GIVGFALTPSAESHGYLIYIPSKHTVTDTTNYLIIRGDPHDRTDDADAVIAPLLDQLE
                     ARQDGEFDNNMSTHSGGMEMDVSIHSGGTIHQRPVSPTPTADNLSTSSGGNDPIQTGT
                     TDTTEVIPEYIPEGNNDVLGPDIHDDPPEHTNDDPPEHTSDEIADNIEEHGSNMINED
                     PRINLQSANHAVTYDNTESDDQPTQNEPTSNPINDPANDHPSSAIIDNTKTPDPIPDT
                     VSRRTINNDIDPSSAIASTVGIQASAYNDVAPTTEDERTTSSTSTAELDPLPSEEDSP
                     VPESTTVATPDSETPESISNVGGNDQSPEVNAKSLEERKNRIFQYRNGDIPRVKPPST
                     KRKSSLALGEIEDRTQRKRPKRHILYVNAVHSNPTPHVKPSLSYYEAIVNNDDKNDAK
                     GYNEAYMKEYDQLIKMKTWDPNKPINEKTIPRQQIINSMFIFNTKRDGRKKCRFVARG
                     DQQKAGTYKEDLKANTVHHYALMTSLNIALDKKMFITQLDISSAYLYAELEEDLYIRA
                     PPHMKLKGKAFKLNKSLYGLKQSGANWYKMIGSYLTNSCNMTELTGWPCVFKDENECF
                     VCLFVDDMIVLSKDIKAANKLVKTLKKKFETKVIHDGKLDENNMATYDILGLEIEYTF
                     GKKMTIGMENSLTEKLPHLGFDIEKDNKKFLVPGTPGEHIHKDNLVVEEDDYKEKVKQ
                     MQKAIGLLSYVGYKYRFDILYYVNILAQHTLYPSEQVEKLTKQLLNFVWQSKHKKLIW
                     HANKHTKTNRITAITDASFANEEGFRSQLGHYYCLNGKVIGGRSSSEKLRVISSTEAE
                     IYAVSESVPMLQGLACLVKQIDPSSSLRSKILTDSKPTISIVEDQSEDSRAFRNRFFG
                     TRAFRLRDEARRNDLKFEYIKTEDNYADILTKPTSIAIFKKLTHSWVK"
     gene            <755598..>757706
                     /locus_tag="HG535_0F03930"
                     /db_xref="GeneID:59237640"
     mRNA            <755598..>757706
                     /locus_tag="HG535_0F03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289712.1"
                     /db_xref="GeneID:59237640"
     CDS             755598..757706
                     /locus_tag="HG535_0F03930"
                     /inference="similar to AA sequence:RefSeq:NP_013244.1"
                     /note="similar to Saccharomyces cerevisiae YLR143W;
                     ancestral locus Anc_8.349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145607.1"
                     /db_xref="GeneID:59237640"
                     /translation="MKFVALVSGGKDSCFNILHCLKQGHELAALANLHPIDTSEQELD
                     SFMFQTVGHDIVAYYDRCTGLPLFRQPIRPNSSKNVELNYTCTENDEIEDLFKLLSDV
                     KEKMPDIEGVSVGAILSSYQRTRVEDVCARLNLTALSYLWQRDQLELMKEMCLMSKQD
                     STSDHAKMDARIIKVAAVGLDQTSLNQSLPQMLPKLKRLNEIYDVHICGEGGEFETLV
                     VDAPFFSEGSLNVVSHLPNIAHSKDGVFSTQLEIEFNERKNDLYLEEYLKELPTPPML
                     NEKWMDLLQHLKELKTLPNDLGINTLDLSTTKPSISAEVSVAQLKDVLYISNIRARDV
                     SMNVQEQADDVFLQLSSILETKKIAPSQGLYCSLIISDMSHFAQINNVYSQFFSVKKY
                     GPLPPARACVGSTCLGAGFLLQLSVIFDATESYAGPGSTIVSNRKKDGLHVQGRSYWA
                     PCNIGPYSQAIWSFKDPNKVAYVSGQIALDPPTMEMLEKDANLQTVVSLRHFDTLKNT
                     INAERQLLLTCYTVDNDVVPSIIGTWSLYCGEMADVSEHWTDKQPDSIKSLIIVIVSE
                     IPRKALCEWTGVSCKDLVYEDEESYVDELQEEGVAECSKFIFANKPQAARELHEVVVT
                     NSRGKRYFITGFADSLNELLIILKSIIIEYKVTLYYNPRSLQKNKIPLDISSKIEWYP
                     VLHVYDNKGTSRMFGFHVMA"
     gene            <757861..>759414
                     /locus_tag="HG535_0F03940"
                     /db_xref="GeneID:59237641"
     mRNA            <757861..>759414
                     /locus_tag="HG535_0F03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289713.1"
                     /db_xref="GeneID:59237641"
     CDS             757861..759414
                     /locus_tag="HG535_0F03940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145608.1"
                     /db_xref="GeneID:59237641"
                     /translation="MSSEPFDYFEEARKLIAFANRVCMGERVTQEDKITDPHGKHTNV
                     EDEAFKSEYLKNADSLQQITTIKKSKSPWPYQERTGMNLLSPQQKVEVPQQPTTEKQA
                     GNGFLQNSDFVKFSDSDEESEEIDIQSTVVNNGNTGNSKTEPVSESYRHMQDVRKTKN
                     PAQKPSATSHKMTESDSAMRSELQQENRQGDSLLVQNKKNDDYLSQEQGKKCENLVTE
                     NFRKLDTHLAQDDRIRRDFGQKVSIDKSFISSSQSKNLRTQQEKEKRLLESAKNSSNI
                     VFTLLGEPSVNEGQRKRSKAASWSSLPPPASPPLPPPPPPYPVPFVDLTDSQYQNQNA
                     EQNIVVPVQSAQTMGNSPPNNIDDALSTNRSKSWSINSNQKIAFPANNNIFALAPNQC
                     HNNLRSEQQVIRGQWCHQTGSVPSQSSSFGYQQISPQNISIRPTSTNNRMESLPNKRK
                     QSNNIPKNKIANLHSNHVTRNNQRSTATGSFKNDSRNVSKNIRKKKTPKSLKRINGMV
                     KKHDLEDHY"
     gene            complement(<759613..>761727)
                     /locus_tag="HG535_0F03950"
                     /db_xref="GeneID:59237642"
     mRNA            complement(<759613..>761727)
                     /locus_tag="HG535_0F03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289714.1"
                     /db_xref="GeneID:59237642"
     CDS             complement(759613..761727)
                     /locus_tag="HG535_0F03950"
                     /inference="similar to AA sequence:RefSeq:NP_010448.1"
                     /note="similar to Saccharomyces cerevisiae SEC1 (YDR164C);
                     ancestral locus Anc_8.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145609.1"
                     /db_xref="GeneID:59237642"
                     /translation="MSDLIELQKNHLLSIIGEIQTEHNVKFLIIDAEVERLLSYLFVT
                     PQELLSYVTAVDRIDSPKRKGQPSVEAIYLLAPTKLNINCMDVDFCNRPPKYKRCHVR
                     FLPEPAPHVAEFFKTKRYVVQYLASVKEIPLAFIPKESQFFLTMGIDKPMQSFFNKQC
                     ADLITKNMKRTINSLLNLCIVTGEYPIIRYSEPSPNQIELAPATILAKKLAFEFQEVL
                     DNYAREHEDFPPPSTRPRSIFLIADRTLDFISPIVHDFHYQAMAYDLVPELDTGTDVY
                     HYKAENEKGEEEEKTTKLLDNLDPDWVDLKHQHIMDASTYLEGKIKEMIAKNPLLVDR
                     SNVKTTTDLLSVVAHLKDFDEERRRLILHRKLIDQCFHINNERKLAEYAEIEQNLAGF
                     GFDIDGEKCKHITDSFLVVLASKSLHVTDKIRYIIIYALYRGGIVETDFSKLLSFIGV
                     ETEHEHFSHFMLLFRNFNELGFKLIKDEPRNKPFKKEWLHDTVVKDPNVFVTSRFISA
                     VGNILSKLITNPLLLSEEVFPYTKDKPIELLEGEVQEISSGTNSSTSLRNPRHKAAWT
                     KNSSSSKKTPRQRFFYYILGGISYAEVREAYEQSELKKRDVFIGSDGIITPLAFLKSV
                     ENLTAQRASLNLKDDQKEVEKVPQYLYESVAPIAQPVSHVHIRSQNAPPISAPVTNAA
                     AKEPQKEKKRGKFSRFLKSREK"
     gene            complement(<762135..>764426)
                     /locus_tag="HG535_0F03960"
                     /db_xref="GeneID:59237643"
     mRNA            complement(<762135..>764426)
                     /locus_tag="HG535_0F03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289715.1"
                     /db_xref="GeneID:59237643"
     CDS             complement(762135..764426)
                     /locus_tag="HG535_0F03960"
                     /inference="similar to AA sequence:RefSeq:NP_013245.1"
                     /note="similar to Saccharomyces cerevisiae ACF2 (YLR144C);
                     ancestral locus Anc_8.352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145610.1"
                     /db_xref="GeneID:59237643"
                     /translation="MTYNRSRMPMPGGQQYGEPPAYQESLSNPPPVPPRLGLRNPPSL
                     PPRVPIVRELDIATRNMSNVKIDGNVNFDDVFRPDPPPDIFKASNHELNLPRNVDNKE
                     MPVETNKFYGNMMVGSQTNPVWTHPYSLWWAKDSPHMGIAVAHIQASQRVFGPGSPPQ
                     YFFNPIGIKSLVFSSTDYTTADDFSLGFASLTHMSAQVFLRKNNDQYIRFPLVQGMGL
                     ITAIYHNLVPKLCTAVGIKSFQKVTSGNEQIKYKLLLENNVVWLLYVIVPGGCNIEIT
                     MQDANTLVGSASLDQCTMQIVANDAKDIDIAAGCYPIHCELDCSTEGDIGKYQFRYLT
                     EGKSVCGKTLMFAFPHHVSNFTDEMHSQPIVCQLDSTIKGVMNSYLTDSFEMKVSIPK
                     SLGFSPFTTISGKGNGVRYSSDVLEAVKKAASSEVNLDVSTESNLDSMYFSGKILAKY
                     AWILYCCQYIIKEKDLVDCLLPKLKSAISRFADNHQVLPLKYDKTWGGIISSGTSSQD
                     FGNSFYNDHHFHYSYHVIAAAIITKVDHDAGDNAWLLQNRAWVEALIRDYANPSEKDR
                     FFPVFRSFDWFNGHSFAKGLFESGDGKDQESSSEDVNASYALKLWGLATENQPLIDIA
                     DIQLGILRTSVNMYFLYSDDNTVMPSAFIRNKVSGILFENKIDHTTYFGNELQYIQMI
                     HAIPITPASSFVRTPKFVEEEWREKLSPIVNDIKDGWQGIIMLNAALFDPRISFNYFN
                     TPEVFLDNGQSLTWSLAYSGAFL"
     gene            <764810..>765457
                     /locus_tag="HG535_0F03970"
                     /db_xref="GeneID:59237644"
     mRNA            <764810..>765457
                     /locus_tag="HG535_0F03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289716.1"
                     /db_xref="GeneID:59237644"
     CDS             764810..765457
                     /locus_tag="HG535_0F03970"
                     /inference="similar to AA sequence:RefSeq:NP_013246.1"
                     /note="similar to Saccharomyces cerevisiae RMP1 (YLR145W);
                     ancestral locus Anc_8.353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145611.1"
                     /db_xref="GeneID:59237644"
                     /translation="MDATNDPDSHAHRGQYLKLLQEFRLLHLLYHRNKNQHRVAHWWR
                     YINILKRNCSEVLEVIQKKVIDKEFDFAKLYQIINKFKKKILPKIYYEFNGIIALGQF
                     VTLGVILVCLLSRVYAIYKDIYAIYSGNFERISCQSIDNSARKKEEDLDRELKIMESL
                     ADEELGEEITNIASVSEDQLTHINIQPSPHVERQKIKKKKSKKKKAKSVIDGIFG"
     gene            complement(<765521..>766423)
                     /locus_tag="HG535_0F03980"
                     /db_xref="GeneID:59237645"
     mRNA            complement(<765521..>766423)
                     /locus_tag="HG535_0F03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289717.1"
                     /db_xref="GeneID:59237645"
     CDS             complement(765521..766423)
                     /locus_tag="HG535_0F03980"
                     /inference="similar to AA sequence:RefSeq:NP_013247.1"
                     /note="similar to Saccharomyces cerevisiae SPE4 (YLR146C);
                     ancestral locus Anc_8.354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145612.1"
                     /db_xref="GeneID:59237645"
                     /translation="MEVQHARIKNGWFTEVSDAHFPGQGFSLRVEKVLHHSQSAFQDI
                     LVFKSTDFGNVLVLDGIVQCTERDEFAYQEMITHIPIYAHKNPKKVLVIGGGDGGVIR
                     EVVKHSCVESATLVEIDKTVIELSQRYLPEMSCSISDPKVNLQFCDGFQFLRNIGSSD
                     LDAKYDVIITDSSDPDGPAEAFFQKEYFQLLNNALREDGIVIMQASENVWLNINYLGE
                     LIQTAKSVFSNTGYCYTTVPSYTSGQLGLIVCSNEKDLRLDVAHRLPTSEEQQKMKYY
                     NPKIHHASFILPTWADRILNTRQA"
     gene            <766856..>768157
                     /locus_tag="HG535_0F03990"
                     /db_xref="GeneID:59237646"
     mRNA            <766856..>768157
                     /locus_tag="HG535_0F03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289718.1"
                     /db_xref="GeneID:59237646"
     CDS             766856..768157
                     /locus_tag="HG535_0F03990"
                     /inference="similar to AA sequence:RefSeq:NP_010449.1"
                     /note="similar to Saccharomyces cerevisiae TRM82
                     (YDR165W); ancestral locus Anc_8.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145613.1"
                     /db_xref="GeneID:59237646"
                     /translation="MNVIHPFQAVVSNASGNQIYVVSKSTILAYKYDGKEYRLIGKWV
                     DEVEGNHNHAPTESKNAKSPSQAKKMRSNGGKSSKKYTSDPLFPIITSQIRKLRLSSD
                     ESKLIACTDSDKSIIILRILLEGEYEDNCLKLTKRQPFPKRPNALTITDREKLIIADK
                     FGDVYEMDAYKDDVQEIKEPILGHVSMLTDILFVRDLQGNKYIITSDRDEHIKISHYP
                     QCYVVDKWLFGHKQFISSLCNPIWKSQWLFSAGGDECVFAWDWINGEKLAEFNYEKLI
                     QPHLSAAHLASERFQNESNDIIEYAVSTIVSLHTLPFVAFFVEATNILIILEVCPNTG
                     VLSLKETLELPYSIVSLSESHDELEVTCDNRSAGSDHFVEFITHNKQNNCFEIDTQRS
                     DSFNRAVALTLKDEESVNVGSDDIYPLYNMISLKKHGEHYS"
     gene            <768335..>768640
                     /locus_tag="HG535_0F04000"
                     /db_xref="GeneID:59237647"
     mRNA            <768335..>768640
                     /locus_tag="HG535_0F04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289719.1"
                     /db_xref="GeneID:59237647"
     CDS             768335..768640
                     /locus_tag="HG535_0F04000"
                     /inference="similar to AA sequence:RefSeq:NP_001032582.1"
                     /note="similar to Saccharomyces cerevisiae YLR146W-A;
                     ancestral locus Anc_8.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145614.1"
                     /db_xref="GeneID:59237647"
                     /translation="MSNLLPTNETESSQISEHATEDDKRQQDLSYDSRNLSTKSLGVP
                     EADASLTSMIKSSQSLQQEINGIFAQLNDLNRQVRIDIDDFCNIGMRNSTTLNNVQN"
     gene            complement(<768711..>771515)
                     /locus_tag="HG535_0F04010"
                     /db_xref="GeneID:59237648"
     mRNA            complement(<768711..>771515)
                     /locus_tag="HG535_0F04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289720.1"
                     /db_xref="GeneID:59237648"
     CDS             complement(768711..771515)
                     /locus_tag="HG535_0F04010"
                     /inference="similar to AA sequence:RefSeq:NP_010450.3"
                     /note="similar to Saccharomyces cerevisiae SEC5 (YDR166C);
                     ancestral locus Anc_8.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145615.1"
                     /db_xref="GeneID:59237648"
                     /translation="MNSFDINDEKLLDCYNLKTLDPSESWEQDSSLLINLDRWQDISP
                     NEDNSYDILKDLLIQQQNTNALETALSLNDASLNHVRDPLNNERMLPLLDKLGISEHT
                     RLKYLINSKTFDVKAFLRDVHNTDSFEDLSYSLDILDKTLQEQSQDLNELVQANFTKY
                     VRIKNRLDQIYEQFSEKSNSFTDGDDTKQLDVDRLGERVDESIRVTTLKLKPLLKSSQ
                     KLKSYEFTKKFIEENKDYFNLPHILRTLLDKNDYPNLMFEYSGAKDIHSKLKDEYTVK
                     NSSDENNTEQVPKIIAKIWVEVEKIIDNYRQHTWRSLITPTKDEAQQNFLPLISKLLD
                     LNVKESPIMAWIRTRLDHFEAQLNEISSQMLPKIIQSQRKIIQNGIDSNDDSNSAIVD
                     GVDLSHYLYINQLSQGSESSNQFATLSGIQTLTDSTLIVETWLIFLKYLKSLEDVCMK
                     FIEVWEHVQNFLTGAYQTSLLNDKKKDDILIGSDAMKNHKGSLQLEEAQVNEIRSRGE
                     HFVSLLYSKLLAFFKPSQDELLQGKLLEEENGSSSNVYKETGSPSDYGFVPLRANGLS
                     CLRYLPKMIEPLLKYITELAQLGISSKILDSSKRVASIITDRCIGAIASTKLRDISNF
                     YKLEDWTVYETVKGTESSFTEYGVTQFPEIVLSYQESSIRVVRDLLFAFERLPAFNGI
                     SVVGYPSRQALTAVELQQLISMEAILEAVLKNAAKDKYNPRNSHTVLTLTNLQYIREV
                     TFPQILQVFDDAFEWNLKGKNLELFSLLFKMESSIFGNYLSDLKVNIRDVLEVKFNEV
                     QWATYSSNSFRAGDYTIDVLMLLVTIHSECFRIGPQLIHRILREAQIFISKFLFESFK
                     PFIGNLPSDGLLQATVDLQFFQRVLGRLLEKDTEVTLTACLQNCFQNNIERMQRCIKE
                     TEPIVSANLARTSIQFAAFK"
     gene            complement(<771758..>772126)
                     /locus_tag="HG535_0F04020"
                     /db_xref="GeneID:59237649"
     mRNA            complement(<771758..>772126)
                     /locus_tag="HG535_0F04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289721.1"
                     /db_xref="GeneID:59237649"
     CDS             complement(771758..772126)
                     /locus_tag="HG535_0F04020"
                     /inference="similar to AA sequence:RefSeq:NP_013248.1"
                     /note="similar to Saccharomyces cerevisiae SMD3 (YLR147C);
                     ancestral locus Anc_8.358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145616.1"
                     /db_xref="GeneID:59237649"
                     /translation="MSRKSELQHLIKNNRKYYNGSVMSGIPVKLLNEAQGHIVSLELT
                     TGETYRGKLVESEDNMNVQLRDVTVTGTDSKVTGMDHVFVRGSHIRFFVVPDMLKNAP
                     MFKTGPQYRPSPPIRGPRKR"
     gene            <772240..>775020
                     /locus_tag="HG535_0F04030"
                     /db_xref="GeneID:59237650"
     mRNA            <772240..>775020
                     /locus_tag="HG535_0F04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289722.1"
                     /db_xref="GeneID:59237650"
     CDS             772240..775020
                     /locus_tag="HG535_0F04030"
                     /inference="similar to AA sequence:RefSeq:NP_013249.1"
                     /note="similar to Saccharomyces cerevisiae PEP3 (YLR148W);
                     ancestral locus Anc_8.359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145617.1"
                     /db_xref="GeneID:59237650"
                     /translation="MEVEIEHVQLEFIKEIENNISAMKVGGNTLCFALKVGLLFLIDL
                     EKPSEVFKFQIPLMMASNNAEKLLAMWMHPNGKKLFIKTNFAKYYLCDVELIKQQKEE
                     QGKVNGRSNGIYTMKKFLKKNYDVRCVTWIDENTFLCGTTDGNILHVNTVTKDGKPKV
                     DAEVSSVYQLSSSIDGIFLGKESCCIIASGNKIMYWKKLDLSRNAVAELPTETEEFEH
                     LHKDVGKKFDSHNQTFAWITQTGIVFGDVTRSAKVLGNAKVVLSVELPDSKHNIRDLI
                     LTDFHIIILRGWTVTVISQLNNDVVYEESIWSQNGERMLGLAADYHADPSTFWCFTSS
                     NIYEIILHKEAQAVWKLLCEQGEYNAALALKGLSKWEREMIYYHKGCNLLDNKGDRIE
                     AAKSLGLSSSSTVSSIALRLMDTDDSVASLQVFLIQKLNNADATNRVQKILLSSWIVW
                     NYMKQLNDVDEKINAERNAEELKHWTEEKENVIGQFRDFLKHHLDCLDKETVYQIIAE
                     QNRKKELLFFANLIDDYEYVLSYWIRQENWYEALRVLLNMQDPESVYKYASVLLVNSP
                     EATIHTWMRIEGIQPVELISSLLTYFTNFQKQAELGDTNSENFALKYLLWYIEEHNYD
                     ASILYNSALYMIITQCRTDQDDETNELKTIQFLDKYRKQYDNDFILRLSVRYRKIKVS
                     IYLYTQMSLFEDAVTLALENGMIDSAKLVLKDKNLEDNFKLRRALWLQISKSMLYKEE
                     NANDIKHTIKAIITESNNTLEIRDLLPMFDTFTTVANLKDELIRSLEKHGKSMSQISD
                     QIRHSLQMKKEIAKDIELFRERYTLLKPGSFCASCKQVLQTRKFIVFPCGHAFHTDCL
                     IKAILDSKDYNLKSKIENFQRRLSKDRNSVSAQELESIISTKCVLCSDINISNIDGPV
                     YIDQKIAEKWNV"
     gene            <775278..>775895
                     /locus_tag="HG535_0F04040"
                     /db_xref="GeneID:59237651"
     mRNA            <775278..>775895
                     /locus_tag="HG535_0F04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289723.1"
                     /db_xref="GeneID:59237651"
     CDS             775278..775895
                     /locus_tag="HG535_0F04040"
                     /inference="similar to AA sequence:RefSeq:NP_010451.3"
                     /note="similar to Saccharomyces cerevisiae TAF10
                     (YDR167W); ancestral locus Anc_8.360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145618.1"
                     /db_xref="GeneID:59237651"
                     /translation="MTDGEIEPSQGENIDFDEGIDEFDDNQEGPVDNEALFGTGEQND
                     SQASQNENADNKSSKPFVIPEFTRKDKTLNDILDIVEDNPPIIPDGVIDYYLTKNGFN
                     CADVRVKRLLALATQKFVSDIAADAYEYSRIRSSVAVNNANNGQARARQLMQGQQQPG
                     QQQISQQQQQQNEKTNASKVVLTVNDLSSAVAEYGLNISRPDFYR"
     gene            <776195..>777667
                     /locus_tag="HG535_0F04050"
                     /db_xref="GeneID:59237652"
     mRNA            <776195..>777667
                     /locus_tag="HG535_0F04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289724.1"
                     /db_xref="GeneID:59237652"
     CDS             776195..777667
                     /locus_tag="HG535_0F04050"
                     /inference="similar to AA sequence:RefSeq:NP_010452.1"
                     /note="similar to Saccharomyces cerevisiae CDC37
                     (YDR168W); ancestral locus Anc_8.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145619.1"
                     /db_xref="GeneID:59237652"
                     /translation="MPIDYSKWDKIELSDDSDVEVHPNVDKRSFIKWKQQSIHETRMK
                     RSQDIKNLEVQVHMYACLNKRVDKLLANVSDEELGTKESISKYLNGNFDKTEKSEGEN
                     VDPDIPSYNEMVEDLFEQLQKDAEKQGRNLKDGSVLRELALEHRKKIDKVTVEAKTKL
                     EELYREKSAHISSDDISTGFDSGFLNKNKEDAKLESTMKEIAANNGAANSTVALPLPP
                     MQFIEYEDVMKLAPETETFGSISSSDYKKSQSYLLDNMPIISEQQKDALMMKAFEYQM
                     SNDEKSAYRVIHQSELLAYIREIYDMKKIGVLKGNEMTEVINVFFKRVIFGNNIAGKQ
                     SFLQSVQAKFDHVKKRVKIMEQEQEAEEQGVETIQLKSLDESNELEVNLPDFDSSDPN
                     EMKRVAAFKKLPPKMQDAVSTKNLDTVNEVFAETPIKEAEEYLELFGEADIIGVKALL
                     ENEEDFNQLKSEYQKENILEELSIGEQDNGEQVNTTDTVD"
     gene            complement(<777777..>779915)
                     /locus_tag="HG535_0F04060"
                     /db_xref="GeneID:59237653"
     mRNA            complement(<777777..>779915)
                     /locus_tag="HG535_0F04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289725.1"
                     /db_xref="GeneID:59237653"
     CDS             complement(777777..779915)
                     /locus_tag="HG535_0F04060"
                     /inference="similar to AA sequence:RefSeq:NP_013250.1"
                     /note="similar to Saccharomyces cerevisiae YLR149C;
                     ancestral locus Anc_8.362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145620.1"
                     /db_xref="GeneID:59237653"
                     /translation="MTIDGNHSSNDEVEDENLNTGSDKVFQNYMMPGLELYDAKVSIN
                     HWQLRDCIKHSSTDPGKLYYIYDHQIRSLDTGQASQSNTRSKKLNSSKIRRNSFNVAR
                     KNSSGLTSVKGNLNLPSKKTVEFNFKPRSFTECNGLVACGGLIGPDDKGFPTNWSRLS
                     NDTNDGEPLPPPAEPVKLTNNNVLSDHSNYSNPSIWKGIISLCHKDTGIPSSVIVGQF
                     INNCVTLSSRTNQEYDLYSCNNDGHLYQCSINNRGVELVRRYSDLKFALNNAAISHDS
                     KTLIVSGDSNKFAIYRQNELAGQFLLSYDNQPDWGSSVVRSKRIPRFALPDGSGFVDH
                     IYEAPNGDHGFYSCFSENDLQFATLFQNGVCLVYDVRNMETPLTEITSTRPHSHNGAF
                     RVCKFSYGLDDLLFISEHQGRVHVVDTRNFMNHQVILVPDKLKSETEELITTNMNDMS
                     NNSTDTRRRNIPFISAVSRVSSSSSVSSYAIGSRRRHSNPTPPPSLNNEPWLTSATSI
                     PLRYLEPQVVPYPKAVNKLTNNTASFQQHLNDDQNEDTSLSTTVLRRRSSYRVRRFST
                     SSNMCEDTGEMDPAILDSPNSEHSYPRVDNYNYQEQRTGIFVRDARIRTPSNATFEED
                     ELLDAHVNVNSGSPGQLNNRLYFSSNDYAVNSLANYSNADFTEENNISGIDWIEDRCG
                     SSLVIGTDYGIMKWNINSWARRSFSSYDFC"
     gene            complement(<780565..>782115)
                     /locus_tag="HG535_0F04070"
                     /db_xref="GeneID:59237654"
     mRNA            complement(<780565..>782115)
                     /locus_tag="HG535_0F04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289726.1"
                     /db_xref="GeneID:59237654"
     CDS             complement(780565..782115)
                     /locus_tag="HG535_0F04070"
                     /inference="similar to AA sequence:RefSeq:NP_010453.1"
                     /note="similar to Saccharomyces cerevisiae STB3 (YDR169C);
                     ancestral locus Anc_8.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145621.1"
                     /db_xref="GeneID:59237654"
                     /translation="MDYHSDGSPPLDTKTTVSGIMTKPISTSSPAGLAAAQMVTPGKL
                     SSLLLERGPLAIRHITQTLGAEIPSFKDLSSSKQRRLIMSAMESGDKDSQVVFAKIGW
                     GQWSAKIVDAATFSEERDATNIANAKVKDIVSQESQRRRSSSSTVGARRPQLYNKSSS
                     NNSAVKKPLASAVNSDVVYIDENAVASEDEDENDHIHGREDRRHRMTGVDDEEEDEAE
                     EDDEEDDNDNDENEFLMNPIKREDLFSFRRRKSSVVFADSSPEDLEHELLAQRVRPLL
                     KKNRNRRSSSKIRTSSISKNNTAATTTVHLDLPQTDVSNPITRKNSSSKIDLEQLSNS
                     ISEPTSRRESRMSFSKESSIRSTLLSHRNYHWLPAGSSPRLTYQKNSSQVPPLLTNQS
                     QNKNTLIPENSITAKQSAKTKNSQSTHFSQSQISHAPHSDTDEEDWAAIGAAKLRNNS
                     VAPKMETLATSPNGFVKPNVPDANNIPPLDNSLPPAALNDTTDTKNSSNSPNDDNNAA
                     FLLMSLKS"
     misc_feature    join(783502..783555,783654..783671)
                     /note="Short protein (HG535_0F04080, QLG73896.1) was
                     converted to a misc_feature."
     gene            complement(<784498..>785463)
                     /locus_tag="HG535_0F04090"
                     /db_xref="GeneID:59237655"
     mRNA            complement(<784498..>785463)
                     /locus_tag="HG535_0F04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289727.1"
                     /db_xref="GeneID:59237655"
     CDS             complement(784498..785463)
                     /locus_tag="HG535_0F04090"
                     /inference="similar to AA sequence:RefSeq:NP_013252.1"
                     /note="similar to Saccharomyces cerevisiae PCD1 (YLR151C);
                     ancestral locus Anc_8.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145622.1"
                     /db_xref="GeneID:59237655"
                     /translation="MLRTNELLNNIREFKYSSLLPLSLSWPSKRRSAVLVLLFIGHRG
                     ELRVLLTKRSRALRAFSGHVSLPGGKADNDLETFEQVARREAEEEIGLPQGSKELHEK
                     FGMQIENICNEIPCYLSRTFLSVKPVVYFLHNETNPMESLNASKFFGKLNPGETSSIF
                     SVPLSDMVYHLFQNRSGSDYKPEYTNHSEISVKWGGLKWPIRHYLYPRENINDVAWLN
                     EIADGSSGSDSSEVTASRDLWGLTAKILYDLSLIANKLIQSDNSTQLIGHEDLIYGLK
                     EFGGQLKTSRSDWEINMIGGARGYRYDNVIPKYYMDKLQKISTKY"
     gene            complement(<785811..>787862)
                     /locus_tag="HG535_0F04100"
                     /db_xref="GeneID:59237656"
     mRNA            complement(<785811..>787862)
                     /locus_tag="HG535_0F04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289728.1"
                     /db_xref="GeneID:59237656"
     CDS             complement(785811..787862)
                     /locus_tag="HG535_0F04100"
                     /inference="similar to AA sequence:RefSeq:NP_013254.1"
                     /note="similar to Saccharomyces cerevisiae ACS2 (YLR153C);
                     ancestral locus Anc_8.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145623.1"
                     /db_xref="GeneID:59237656"
                     /translation="MTVKEHKVVHEAHNVKGRTPPKHFYDKQPGNGYVTDMKHYREMY
                     DQSINDPETFFGQKAKEFLHWDRQFSQVKSGSLENGDAAWFLNGELNASYNCVDRHAF
                     ADPSKPALIYEADDEKDNRIITFGELLRQVSEVAGVLKSWGVKKGDTVAVYLPMIPEA
                     VVAMLAIARLGAIHSVVFAGFSSGSLKDRVVDAGSKVVITCDEGKRGGKTVHTKKIVD
                     EGLNGVDQVSHILVFKRTGTEGIKMKAGRDFWWHEEAAKNRGYLPPVPVNSEDPLFLL
                     YTSGSTGSPKGVVHSTGGYLLGAALTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGP
                     LVLGTATIIFESTPAYPDYGRYWRIIERHKATHFYVAPTALRLIKRVGESEIAKYDTS
                     SLRVLGSVGEPIAPDLWDWYHEKVGKNSCVICDTFWQTESGSHLIAPLAGAIDTKPGS
                     ATVPFFGIDACIIDPVTGIEIQGNDVEGVLAVKSTWPSMARSVWNNHHRYIETYLKPY
                     PGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTAEIEASLVNHEGVSESAVVGI
                     SDELTGQAVIAFVSLKNGYVQEKVPDGDSEHITPQNIRRELILQVRGEIGPFAAPKTV
                     ILIRDLPKTRSGKIMRRILRKIASNEADQLGDLSTLANADVVPAVISATEDQFFAEKK
                     K"
     gene            complement(<788749..>794355)
                     /locus_tag="HG535_0F04110"
                     /db_xref="GeneID:59237657"
     mRNA            complement(<788749..>794355)
                     /locus_tag="HG535_0F04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289729.1"
                     /db_xref="GeneID:59237657"
     CDS             complement(788749..794355)
                     /locus_tag="HG535_0F04110"
                     /inference="similar to AA sequence:RefSeq:NP_010454.3"
                     /note="similar to Saccharomyces cerevisiae SEC7 (YDR170C);
                     ancestral locus Anc_8.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145624.1"
                     /db_xref="GeneID:59237657"
                     /translation="MSNEEDAQQESVVSIAPTSEASLSERTDEEPLEQEQQTVAPAEP
                     LAPTETTETQSVDIDHTLPHPEIPAATNISNVKSSIVLIKSTLQAIVDEKDIKKFPNV
                     QKIVERVIIRLESSDLQSVNSIAIFEALRSSCRTKSTRIQLKSLDCLSKLFSFRALDE
                     AILVNPPDSMASNDQNQEDSTTGITPPPKQKLIDAAIDTISECFEGEGTDEKIELQIV
                     RALSSCILVEDANSVCHGAALLKAIRTIYNIFIFSLSGSNQGIAQATLTQIVSAVFDR
                     IDLQEAQSSHLKNQHSSFSSIDVSSPASITANANGNSTNSASTENPSSQAPLTLKNMD
                     VLNDEDDKFVEENQKNGSPITKQELFIKDAFLVFRAMAKISAKPLDTELDMRSHAVRS
                     KLLSLHIIHSIIKDHIEVFLSRSTFLPGKERLTLLDSIRQYLCLLLSRNAASSISPVY
                     EITLEIMWLVISNLRAEFKREIPVFFTEIYFPISDLKTSTPHQKRYFLSIVQRLCNDP
                     RTLIEFYLNYDCNQGMPNIMEMMVDYLTRLALTRAEITQSQRAYYKEQLNKPLATYNI
                     GQVPLLSVSSISSSVDTNQTALPFPLEFALKMTSLDCIVSVLRSLSSWAHRSLNPSLS
                     HSNNINRSRSGSSFTRNRRSSSVFEANSNMTNGFNDEVGSIQDEDDPTQFENLKHQKT
                     ELTACIRLFNTRPKKAIPELIKKNFLKDDSPESIAKWLIVTDGLDLAAVGDYLGEGDE
                     RNVAVMHAFVDQFDFTRLSIVDALRNFLQKFRLPGEGQKIDRFMLKFAERFVDQNPGV
                     FSKADTAYVLSYSLIMLNTDLHSSQIKNKMTLQEFLENNAGIDNGKDLPEDFMVGLFN
                     EIANNEIKLQSEQHQALLSDDQNLVPSQGSQSAFNFFSSRDIVREAYMQVSKEISSKT
                     ELVFKNLNKSRNKSDVDIFHAASHVEHVKSIFDTLWMSFLAALTPPFKEYDDIETTNK
                     CLDGLKISIKISATFGIEYAEKSFIGALVQFCNLQNLEEIKVKNVNAVIVLLEVALSE
                     GNFIRDSWRDILYVISQVERLQLISKGIDRDSVPDVSQARLANHRVSFESSRSASTSF
                     FDKWTKRSSLTEIAQEKYYNQTLPPEITKFISSSELVVLMDNIFTQSSKLSGNAIIDF
                     IKALTDVSLDEIESSQDATTPRMFSLQKMIDVCYYNMDRIKVEWTPIWAVMGTAFNKI
                     ATNSNLAVVFFAIDSLRQLSMRFLDIEELSGFEFQHDFLKPFEYIVQNSGSSEVQEMI
                     LECFRNFILTKSSKIKSGWKPMLESLQYTAQSNVESIVYKTYSLASNDIVASHFESVF
                     SQEGAFGELVSVFKEITKSKESQKLSLHSLEALKKITQKIAEISFAHKDEKSKEKLAV
                     MLRGKDIFQDIWFPMLFCFNDTIMTADDLEVRSRALNYMFDALVAYGGEFDDEFWSKI
                     CTKLLFPIFGVLSKHWEVNQFNSHDDLTVWLSTTLIQALRNLIALFTHYFESLNSMLD
                     GFLGLLVSCICQENDTIARIGRSCLQQLILQNVTKFNATHWKDIGDVFEKLFDLTTAT
                     ELFEYDPLHKGRKTSVSQEPIADNATAPDGLNLEETVQRAHEEESSEDVGNQMSAENE
                     EGTTTNGKQQQQQQHLQHLNPNMNTKARPQGSHSVISSNGNSRSAKRLAQTKSSEDLR
                     RRITVKNSIVVKCVLHLLMIELLSELFENEEFARSIPYTQSIEITDLLEKSYEFARDF
                     NEDYQLRTRLVEARVVDKIPNLLKQETSAAAVLINVLFKLYLNDEEKKAELGERLTRV
                     CHSVVLGYVALDDRTMERSINSWRPVIVEILQGYYEFDDEDFKKYCSLMYNLVLQILD
                     KSVPTELRHAIKIFLSRVGELYFVPS"
     gene            <795278..>796642
                     /locus_tag="HG535_0F04120"
                     /db_xref="GeneID:59237658"
     mRNA            <795278..>796642
                     /locus_tag="HG535_0F04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289730.1"
                     /db_xref="GeneID:59237658"
     CDS             795278..796642
                     /locus_tag="HG535_0F04120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145625.1"
                     /db_xref="GeneID:59237658"
                     /translation="MYPVDIETMPSSCGHNHGHHEAPVAASEPVKQVSLSKSSPLDTI
                     TLTTYPEDSTPIALSWGESSPEERGPIVASRDREGLVKHNAIGAHSGSYCVYHALAIG
                     SKQLKKDHVADYTNAQPAFSVPEQKTWYNKEDIIAMDPFGHLTPVLYDEVSKSENVEV
                     RPTIAITKAHMQLFELKDAVEQGRLKVDGKVVINKNGDLNVSKIAVEPVWYLPGVAKR
                     FGITEDELRTSLFEDTNGMYPELVTRPDIKVFLPPIGGLTVYIFGDPKFVSDPSKKLA
                     LRIHDECNGSDVFGSDICTCRPYLTFGIEEAVKEAQNGGSGVCIYFRKEGRALGEVTK
                     YLVYNARKRGGDTAAEYFHRTECIAGVRDMRFQQLMPDILKWLGITKIDRMLSMSNMK
                     HDAIVEQGIPILERIPLPDELIPPDSRVEIDAKINSGYFTNGKVMTTEELKNVRGREW
                     HDVL"
     gene            <797004..>800216
                     /locus_tag="HG535_0F04130"
                     /db_xref="GeneID:59237659"
     mRNA            <797004..>800216
                     /locus_tag="HG535_0F04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289731.1"
                     /db_xref="GeneID:59237659"
     CDS             797004..800216
                     /locus_tag="HG535_0F04130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145626.1"
                     /db_xref="GeneID:59237659"
                     /translation="MPKFQCLTCGETLDAEAMMKHLSATRHKTIADAYSEEEISCEEC
                     QNTNVHQLRIIRLGGEDMSLLCNSCFQKEYTDSEKPSTSYTLSNGSFLKYWNMYINVR
                     DCACNNCGNESRLNVNEKKKVLCDKCLQLLPKEQAEKFISESSGRFLYVFLGIRETMS
                     SNTSRKKGGRKIGRRGTENARAKSRQPRERKPLTVHQQIAKTAYENKKQNSTIESDSS
                     ISLRSFKGVKADISGKSYGSHKKSVPTRKGKQESAGHSSTTSRSKPPKKDMPNGSTSN
                     SPPNINKRSATKKVIGRYQGNPDNSRKPNVKKQSGNSRNAENGSTKVVPSRDLKKGSR
                     AKDTIPKRATIPDSKESVARKNKELNNKSDKIGTKKTGKNENFVNEIIIEHRKKKENS
                     SKELESKVEVIEEGEVLKEYTGYSTQLNYPDLDSYFNKLSYALFLEQKVDDGTDFIED
                     FKIIWHSGAGANFFVVTMPSPSVSNSELSKLISPELLKLGRLPFTKRQPLILVSNDET
                     KIWYAYVKEAELKKNMIQVLLELYPWNKDKLPTNRPSDDFKILPCSAQTNRIFFAMTR
                     IKNQKFIDLILGQKPVKQLFFRNSLRFTSDIFNESQKSAIQHVLNNGVTILQGPPGTG
                     KTSTIEEIILQLIKNFHSFPILCVAASNIAIDNIAEKFVNNRPDIKILRIVSDSKESQ
                     YNAEHPLGKICLHNIVREQLPPDIKENLIKLRTGRSRDVSKNQYNKLLTCQNDISDRH
                     VLQAQILFTTNIAAGGRQLKALKELPVVIMDESTQSSEAATLVPLSLPGIRTFVFVGD
                     QKQLSSFSNIPQLKMSLFERVLSNGCYTKPHMLDTQYRMHPKISEFPILEFYDGKLKD
                     GVNAEQKKWPGINYPLFFYQCNEGPESKVFSNRSGMRGFTYTNSFESKEILKIVYKLV
                     LDKGVKNEQIGIITPYSAQRDHLSELFVKDPVINPKKIAMEQEIDEADSLEGGFGGSK
                     GPKKNAINIINGLFVSTIDSFQGHEKNFIIFSCVRNNKENKIGFVSDKRRMNVALTRA
                     KNGLIIVGNKCVLAAGDPLWNKYIHFLDQKKFIFNSLDVY"
     gene            complement(800317..800388)
                     /locus_tag="HG535_0Ftrna6Q"
                     /db_xref="GeneID:59237897"
     tRNA            complement(800317..800388)
                     /locus_tag="HG535_0Ftrna6Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:59237897"
     gene            <802401..>803585
                     /locus_tag="HG535_0F04140"
                     /db_xref="GeneID:59237660"
     mRNA            <802401..>803585
                     /locus_tag="HG535_0F04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289732.1"
                     /db_xref="GeneID:59237660"
     CDS             802401..803585
                     /locus_tag="HG535_0F04140"
                     /inference="similar to AA sequence:RefSeq:NP_010456.1"
                     /note="similar to Saccharomyces cerevisiae HSP42
                     (YDR171W); ancestral locus Anc_8.369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145627.1"
                     /db_xref="GeneID:59237660"
                     /translation="MSFYQPSLSLYDVLNALAGQAQAPDRNAMFLQEQQEQQQRAQLE
                     ARARAQAQSYAQLHAPGGARRRYPTHEPDTGVPASYYYGAASNPHYYRPLYYYTGEDD
                     SDDNDDLESDETVPQYTKTPFYYHSRVPNYVPESSIEGNDLQKLLSNLFGFAAPASSE
                     AANVPKSENEAPEARQSTIERASDPQEKAAVENSKNATSNPEKKEDAGRDVQDASAAE
                     TEPRHGITPLSSAKKHSFLHQQVRSPVPDPLQVSKPETRLDLPFSPEVNVYDCADAYI
                     LVAALPGATSKDFRVDYHPSSHELIIRGDVEDKLDVGEKSLKINELKYGAFQRTLKFP
                     VLPRIKDEEIKATYKNGLLQVKVPKLIDGSEKPAPKKRIVIEDIPDEELEFEEDPNPV
                     QE"
     gene            <803884..>805959
                     /locus_tag="HG535_0F04150"
                     /db_xref="GeneID:59237661"
     mRNA            <803884..>805959
                     /locus_tag="HG535_0F04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289733.1"
                     /db_xref="GeneID:59237661"
     CDS             803884..805959
                     /locus_tag="HG535_0F04150"
                     /inference="similar to AA sequence:RefSeq:NP_010457.3"
                     /note="similar to Saccharomyces cerevisiae SUP35
                     (YDR172W); ancestral locus Anc_8.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145628.1"
                     /db_xref="GeneID:59237661"
                     /translation="MSDPNQTNNQQQEGSQQNYQNYQQYYQNYGQQPNQQAYQGYQGY
                     QGQQGQQGQQGYQGSQAFKPQQQHQQYQQLDAQNYGGYQQGYQAGYQQSFQPGYQQGY
                     QAQQAYVPQQGRGGYKNFQPRSAQSFQPQQSQGMTLDDFQKQKQQTTTKPKKTLKLVS
                     SSGIKLANATKNVDAKVEASDKETNDKKESTQEQAPAEQEKAKSQEVSDAKSVAKKQD
                     DLPKVEKLKISEEAPSQTNVSSADALIKEQEDEVDEEVVNDMFGGKDHISLIFMGHVD
                     AGKSTMGGNILYLTGSVDKRTVEKYEREAKDAGRQGWYLSWVMDTNKEERSDGKTIEV
                     GKAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYETGFEKGGQT
                     REHALLAKTQGVNKMVVVINKMDDPTVGWSQERYDQCVKNITNFLKAIGYNIKEDVIF
                     MPVSGFSGAGLKERVDPKDCPWYKGPSLLEYLDSMNHLDRRVNAPFMLPIAAKMRDMG
                     TIVEGKIESGHIKKGHSTLLMPNKSTVEIQNIYNETENEVDMAICGEQVKLRIKGVEE
                     EDISAGFVLTSPKNPIKNVTRFVAQVAIVELKSIMSAGYSCVMHVHTAIEEVHITRLL
                     HKLEKGTNRKSKKPPAFAKKGMKIIAVLETEEPVCVETYEDYPQLGRFTLRDQGTTIA
                     IGKIVKILD"
     gene            complement(<806056..>807096)
                     /locus_tag="HG535_0F04160"
                     /db_xref="GeneID:59237662"
     mRNA            complement(<806056..>807096)
                     /locus_tag="HG535_0F04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289734.1"
                     /db_xref="GeneID:59237662"
     CDS             complement(806056..807096)
                     /locus_tag="HG535_0F04160"
                     /inference="similar to AA sequence:RefSeq:NP_010458.3"
                     /note="similar to Saccharomyces cerevisiae ARG82
                     (YDR173C); ancestral locus Anc_8.371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145629.1"
                     /db_xref="GeneID:59237662"
                     /translation="MGEFKLLRHKAAGHEGTLTDKDEVLVFKVLTQQELDFYQVVQEK
                     SLRESDAADAADGDLPLSAWLPTFLGVLDESLQERGPGDSTAILSDSQTTPKSGGRKL
                     LVLENLLYGYSQPNVLDVKLGKILFDEHASEEKRQRLSEVSRTTTSGSSGFRICGMHM
                     QANELTKEIDEVHFEETDTGNIFINKNFGRSRTVDNIEGAFNLFFANDRLSEKRIKQL
                     KEIFLQRIQLLYNTLLDEEVRMVSASLLFIYEGDPNRWDTLEDHDPILRSDFIEYSED
                     NESVEGEYEGKNRDYKGEEDSNDSMPENTSLSTLALIDFAHSKFVPGEGYDENVVDAV
                     ENLMKLFDNLNL"
     gene            <807828..>808650
                     /locus_tag="HG535_0F04170"
                     /db_xref="GeneID:59237663"
     mRNA            join(<807828..807872,807943..>808650)
                     /locus_tag="HG535_0F04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289735.1"
                     /db_xref="GeneID:59237663"
     CDS             join(807828..807872,807943..808650)
                     /locus_tag="HG535_0F04170"
                     /inference="similar to AA sequence:RefSeq:NP_010459.1"
                     /note="similar to Saccharomyces cerevisiae HMO1 (YDR174W);
                     ancestral locus Anc_8.372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145630.1"
                     /db_xref="GeneID:59237663"
                     /translation="MTSDPSIRLKSAKDSLVSSLFELSKSANQTAACIVDFYNAIGND
                     EEEKIEAFTTLTEALQKLTSATNQLHGISGELVNPAEDEKDVAGLIAPVEVKPPARKK
                     VERDPNAPKKPLTVFFAYSAFVRQELRDARQRAGLPPLSSTEITQEISKKWKGLSDEE
                     KEKWKQAYNVELGHYQLEKQKYLEAKKNGTLPLIMGPNHAPVPIPFSLQHEEPFEARP
                     EKRIYDDHTSSSEKKKKKKKKDKKKESSSSHL"
     gene            complement(<808810..>809817)
                     /locus_tag="HG535_0F04180"
                     /db_xref="GeneID:59237664"
     mRNA            complement(<808810..>809817)
                     /locus_tag="HG535_0F04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289736.1"
                     /db_xref="GeneID:59237664"
     CDS             complement(808810..809817)
                     /locus_tag="HG535_0F04180"
                     /inference="similar to AA sequence:RefSeq:NP_010460.1"
                     /note="similar to Saccharomyces cerevisiae RSM24
                     (YDR175C); ancestral locus Anc_8.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145631.1"
                     /db_xref="GeneID:59237664"
                     /translation="MKNTQDRDSFEGGPQEIEVPQLKFISCLMMKRFLSLPVRHLNSS
                     GAIKTVPASQIAKTSVISTTLYLEPSKWRGLPAEKIFQLFRERTVKLGAQYKPCQEEL
                     DALLSTSEETGVLKRDIKKIYYGGEKAAADIVGSSLADEYNPLTFKFDELPSQAQDLV
                     AQHREQRFYNRLAAYELPLLAQYRQPYKRADPESHPLEYRFTTYLGEEHPNARKVSLQ
                     VKTTELALNNKERHKFQVLARTRYDSETDIFKMSSDKFPEAAQNTRYLNDVFQKLLKE
                     AKDMTDDFSDISLDKRHTIAKNLRKKKHHYEFPEEWKRPEDAPREKINVIEELSKTYQ
                     V"
     gene            <810015..>812120
                     /locus_tag="HG535_0F04190"
                     /db_xref="GeneID:59237665"
     mRNA            <810015..>812120
                     /locus_tag="HG535_0F04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289737.1"
                     /db_xref="GeneID:59237665"
     CDS             810015..812120
                     /locus_tag="HG535_0F04190"
                     /inference="similar to AA sequence:RefSeq:NP_010461.3"
                     /note="similar to Saccharomyces cerevisiae NGG1 (YDR176W);
                     ancestral locus Anc_8.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145632.1"
                     /db_xref="GeneID:59237665"
                     /translation="MPQKIARRGKGPRDQAHREENVVEPPSKLLSSILKTLNLTFERD
                     IGMLNGKNVRNILNKSALLDLQSQLERLRSSVEAIANSDQQTIETLRKIRDGQRDLAQ
                     KEEKSNAKEENNDVVPHYLSQKNSIADTSESNATPVAAANDTNTKDEQEHLAPSSNDE
                     GESKDQPPISKRKRRSFHNDEDEDDIFDEVNDVKENTEEITTKKKLKTDSQDGADIDK
                     MENDPSVKNPKSEFVVSQTLPLAAAALGLFNEKGLKNTGEDYLKKKYDVASYPTDNLK
                     DLLPGEPPDMDFSHPKPTNQIQFNTFLSSVESIFRELNDDDIKFLKNKYIMPLNLQVD
                     KTYDPEITPYIVPKLGPLYAETWLKEDNHQNMANISPPPLNDPTSILPRKNASEINDA
                     TLETEDISCGPFVSRLLSAIMRDEGKPERNSDNGNNGSNGDHSVEVKEENAQSLPKNP
                     APDDAAIHDTSVSVETANTPMSEIDEPSKNLYRGTTSSLPNPQLWKFNSVNIDYPTFE
                     ERLKRELKFVGIYINLPKDENNPNGDDPDWLTGREDDEISAELRELQNSLKQVTTKNQ
                     KRKAALVSLVERRLAWQEYSSILDDLDKQVDQAYIKRIRVPKKRKKHHTSGSSMVVNS
                     TSSQAAQQKAANSSLKALLDKRQRWISKIGPLFDRPEIMKRMPKESVFKDIDQEEEEE
                     ETDVFGQNGNGEKDELTDT"
     gene            <812477..>813127
                     /locus_tag="HG535_0F04200"
                     /db_xref="GeneID:59237666"
     mRNA            <812477..>813127
                     /locus_tag="HG535_0F04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289738.1"
                     /db_xref="GeneID:59237666"
     CDS             812477..813127
                     /locus_tag="HG535_0F04200"
                     /inference="similar to AA sequence:RefSeq:NP_010462.3"
                     /note="similar to Saccharomyces cerevisiae UBC1 (YDR177W);
                     ancestral locus Anc_8.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145633.1"
                     /db_xref="GeneID:59237666"
                     /translation="MSRAKRIMKELLAVKDDPAANIKLEFVNESDIEHLKGSFQGPPG
                     TPYEGGIFLVDIEVPMEYPFKPPKMKFDTKVYHPNISSVTGAICLDILKNAWSPVITL
                     KSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTAALWTKLYAVANGSTVGQKQ
                     VDEAQLYGIDPNVVEEFESQGFEKEKVIDALRRLGIKSLDPTDNATVNKIVEELLK"
     gene            complement(<813214..>814599)
                     /locus_tag="HG535_0F04210"
                     /db_xref="GeneID:59237667"
     mRNA            complement(<813214..>814599)
                     /locus_tag="HG535_0F04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289739.1"
                     /db_xref="GeneID:59237667"
     CDS             complement(813214..814599)
                     /locus_tag="HG535_0F04210"
                     /inference="similar to AA sequence:RefSeq:NP_013264.1"
                     /note="similar to Saccharomyces cerevisiae MAS1 (YLR163C);
                     ancestral locus Anc_8.376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145634.1"
                     /db_xref="GeneID:59237667"
                     /translation="MLRRAVLGLGTKRFLSKARNDIPVTRTSVLANGLTVASESMPEM
                     SSATVGIFVDAGSRAENAQNNGTAHFLEHLAFKGTQNRTQTGIELEIENIGSHLNAYT
                     SRENTVYYAKSLEEDIPKAVDILSDILTRSVLDPKAIERERDVIIRESEEVDKMYDEV
                     VFDHLHEIAYKGQPLGRTILGPIKNIKSITRKNLKDYISRNYRGDRMVLAGAGAVDHE
                     KLVQYAQKYFGHIPKAEFPVPLGSPRGPLPVFNRGERLIQENTLPTTHIAIALEGVSW
                     SAPDYFVALAAQAIVGNWDRALGTGTNSPSTLAVEASNNGTLANSYMSFSTSYADTGL
                     WGMYIVLDSAQHDARKIIDAITREWRRIMSGNISDGEVNRSKAQLKAALLLSLDGSTA
                     IVEDMGRQIVTTGKRLSPEEVFEKVDKITKEDIVMWANYRLKDKPISIAALGNMTTVP
                     SVAYIEKGLNL"
     gene            <815161..>815667
                     /locus_tag="HG535_0F04220"
                     /db_xref="GeneID:59237668"
     mRNA            <815161..>815667
                     /locus_tag="HG535_0F04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289740.1"
                     /db_xref="GeneID:59237668"
     CDS             815161..815667
                     /locus_tag="HG535_0F04220"
                     /inference="similar to AA sequence:RefSeq:NP_010463.1"
                     /note="similar to Saccharomyces cerevisiae SDH4 (YDR178W)
                     and YLR164W; ancestral locus Anc_8.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145635.1"
                     /db_xref="GeneID:59237668"
                     /translation="MFSKSLLRCSLNRAAFHSSSKRSLTIPFLSTLPQKPGGVTGTPN
                     DAYVPPPPDKLHGSVHWDFERVLAVAMVPLVTLPLATGGSFMTVADSLLASVLLGHVY
                     VGFQSCIIDYIPKRVYGKNFNYAMYLLTLGSLISAIGIYKLETEENGLVGVVTNLWTS
                     KKEEEKQK"
     gene            complement(<815851..>816354)
                     /locus_tag="HG535_0F04230"
                     /db_xref="GeneID:59237669"
     mRNA            complement(<815851..>816354)
                     /locus_tag="HG535_0F04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289741.1"
                     /db_xref="GeneID:59237669"
     CDS             complement(815851..816354)
                     /locus_tag="HG535_0F04230"
                     /inference="similar to AA sequence:RefSeq:NP_010464.1"
                     /note="similar to Saccharomyces cerevisiae CSN9 (YDR179C);
                     ancestral locus Anc_8.378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145636.1"
                     /db_xref="GeneID:59237669"
                     /translation="MLSEELKSVLEDPNIFHYQHLWLKEDNAEQRDVLELFAFGSFND
                     LNSHSQLASRLTELMLMKLRKQTIISLSESYREVSYDMIRKSCQMNDSHDIEVMLIQL
                     RDILQIRLDSVKETVTFTQCHNCRDVYTHERDLRVVNEGNIVTKDKLLKNLNSWKRKL
                     LDDILSV"
     gene            <816519..>817895
                     /locus_tag="HG535_0F04240"
                     /db_xref="GeneID:59237670"
     mRNA            <816519..>817895
                     /locus_tag="HG535_0F04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289742.1"
                     /db_xref="GeneID:59237670"
     CDS             816519..817895
                     /locus_tag="HG535_0F04240"
                     /inference="similar to AA sequence:RefSeq:NP_010465.4"
                     /note="similar to Saccharomyces cerevisiae YDR179W-A;
                     ancestral locus Anc_8.379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145637.1"
                     /db_xref="GeneID:59237670"
                     /translation="MSAILYNTSSSLVPKFQRHDLLKHSKESSNVQPISRSSTLLSPR
                     DRDYHLQQAGEYSSNVPFHSNAIKNSTVYLKELCCSIYPDKMNNEIWKIDNSADLACH
                     ALFALVLKNFISSWYGTKIPTSDEQFLSQLFLTLQDALLRIKTWKIDYESLIADDIPI
                     LLSNHIRSMRKAMMNENVLDRYCELINYPKDYYPMAITHVIKRELENGSLLQASFLDS
                     FFDILLFEKLTDKIIEPYYIIKAISTISRGILSRHFAAKKRQNKWSISAIPRFYRVLK
                     KFVQNLLHLGRGDGFRVKNSLPLTYRYIFTFISNDILKLPARRPYLCTVGKTLQLWGS
                     KSKTLDGVFHRLFSGALEDFLINQHRMEKLFLSLRQMLFPNDNRLGPATIILTGEAFE
                     KLKVECSDSLWAVIKLYRIDLWLGLKKCDTKEWVDVLCKDKRCNKVLIFKMLDCTLAH
                     LLTLDSTD"
     gene            complement(<818119..>818859)
                     /locus_tag="HG535_0F04250"
                     /db_xref="GeneID:59237671"
     mRNA            complement(<818119..>818859)
                     /locus_tag="HG535_0F04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289743.1"
                     /db_xref="GeneID:59237671"
     CDS             complement(818119..818859)
                     /locus_tag="HG535_0F04250"
                     /inference="similar to AA sequence:RefSeq:NP_013266.1"
                     /note="similar to Saccharomyces cerevisiae PUS5 (YLR165C);
                     ancestral locus Anc_8.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145638.1"
                     /db_xref="GeneID:59237671"
                     /translation="MASIKSLPIFYECSNYFIVNKPYGMFSQPGDLNAWFRHYPHRHR
                     PPVVLDQLIQERGSSDKFASEWRTVHRLDACVTGGMLIARNKNAAIQFSKNLRKGGYK
                     GFKLTRRYVALVNGKIAEKYLPDEGLISCLGMTSKYKRFDENCMVLELVTGGKRQIRR
                     HMSEAVGTPILNDAKFGGLQIVEANPEQIALHSASIHTMIGLQTRKHLIPMIYNNNGV
                     LWDSKYLHKDGTFIEEIRKVLLEEWNSI"
     gene            <819147..>823589
                     /locus_tag="HG535_0F04260"
                     /db_xref="GeneID:59237672"
     mRNA            <819147..>823589
                     /locus_tag="HG535_0F04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289744.1"
                     /db_xref="GeneID:59237672"
     CDS             819147..823589
                     /locus_tag="HG535_0F04260"
                     /inference="similar to AA sequence:RefSeq:NP_010466.3"
                     /note="similar to Saccharomyces cerevisiae SCC2 (YDR180W);
                     ancestral locus Anc_8.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145639.1"
                     /db_xref="GeneID:59237672"
                     /translation="MSKYPGENTNLPKNILESLSNVGLNHLVPKDGLSAMIDSPLIAS
                     LVRSSDLDTITSSTMGTVQTTGIPLDTIAHINQEKLVFKRPKALSHNGNTEGQKKSLF
                     DGLSSIAKSCLDLTNCEVESEDIRSLPVENNQSSVKRKYLEEKKPGPDTCLDLGSFTA
                     NKRSHVGSTVTVNNLELGAQYISNLHGLVECINEGPATSMSKIETWIPVGDNIYVLSE
                     KFLTTLQMTLKNIVAIPNSWNKVEVEILVKLLEVLVENIKISSAFERQRSNDVLSSVS
                     HLSCTAIFIILQSENNDRRLLKDEYVLAPTNFINEAFENLKEKAKDCGTVKDQLISLC
                     GSISSFSGFLKKRPSIDEGLMTRIVYSICNMLMSNDFESSANLQVQTYKENIRSISTE
                     ILVTVFSLFPDQREFIIEELVTNIERLPTKRTQRRLKKIDSETYVTDFTFTIISMLEL
                     LNSYESCRSISKNDENFIDLLEEKYKKSNHYLEYYTNRISETILHKCIHSFAKHRHSL
                     ENYIQDLIALLPYPTWSLSQYLLSGIMKKLLLVLNSSNQQSANIETVVLQMVGSVGAS
                     IFDIKCKTLPNQGSNSIQLCNYPDLLPQYLNSFQECLNFTVLNSSRRSATEILWHQRL
                     GVLLSLWGYTKEEKEENTKVGQLIMEKIASSFEISELSNYTDKRNCNFGDIQYHYNSV
                     LHTLELLNLYEAYLKTVLCLLGSEKIKVRSTAIKCLSMLASRDQNILSSPRVKNTIEK
                     ALSESSASVIDAILDLIGTGSSSVEFYKQINMNYDHESISVRKHVLRMNKKIYDDSRD
                     REIKVFVASKILLKIEDEEDAIIEMAKSVLLEKWILPIASEESSEVQVEICKDVISVM
                     SGVSNVNEKGAQHFEWFLNFFLLNKAMHTPARYNSIIRCLNQLTNILVQYIVDVQETD
                     SKSREQEGARTDYLNLLAKFSDCYVSFITKDHIIALYPYLHSDFSSDLHYYILLVFKN
                     TVENLGSFKPKFLYELETTLLSRLPRMNVKEIDQAMPLIWHVSNKRGDISRLTRACSS
                     CFQHLNPYIKQANMHTVIAVEGKLQRLLYLATGFARFCNFGGKSQKPQFVNDDESVYA
                     YVAKCLLVLSREGIPHLIRRMAIKNLSQLCCAHPKLFNSKLVLELLDKELEEGQMDVK
                     LVILESLYDFFTLEERKSIKKVGVKSSVSSNKALKAKVLHERKAETVNDGICSALVTR
                     FLKSVLQICLLEDIRSSLVAVRLLKLVLQYGYTNPSHCIPTIIALVGSTNAYMSFVAE
                     EIMNEVFQRYETMVFAGISQGIKLCLEYSKTLEKEFFYKNNTFLYKVKTIVDSGKKYS
                     SKFFKTVLRVLKIHFDHIMGTQCDMETKDAIIFLVSNLCTFQTITQHEIVLLLWEIDL
                     ASEQFREAITDTLVENSKKKADDSLINVATVEKCLREVRSYLILLYGIKPESMVNVQE
                     DFELKNKELTVQNSEMSFIPNLIAMTSDPMIEEKLTEYDNHSNA"
     gene            complement(<823612..>824808)
                     /locus_tag="HG535_0F04270"
                     /db_xref="GeneID:59237673"
     mRNA            complement(<823612..>824808)
                     /locus_tag="HG535_0F04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289745.1"
                     /db_xref="GeneID:59237673"
     CDS             complement(823612..824808)
                     /locus_tag="HG535_0F04270"
                     /inference="similar to AA sequence:RefSeq:NP_010467.1"
                     /note="similar to Saccharomyces cerevisiae SAS4 (YDR181C);
                     ancestral locus Anc_8.382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145640.1"
                     /db_xref="GeneID:59237673"
                     /translation="MARTSNVIRSLRSTNAVKNLEEKYDFDVDEFKIAPTKSLKIISR
                     GLPKSAKTPLDDSLTTQGNEEVDALDGLEDTTRSITNMILEIEDHQLNQQNAKDREDS
                     LPDDIFQGFHKKMLKQENRMLETELMQGENEAERLHLLYEKLDLATWLTTLRKITVIT
                     DLDDDNEISRKKEQTQKYIKSVLEKFEIMKTRCNVLARNYKTGKLDPSRDWPKLYKKI
                     DRKLLINYRSSSDEDEEDMDVEDIKQHRRQKRRKQFRGSLIIQLTATPKAPLTKYAIV
                     AEPLIPPYVIRVSKEERKRWNRSMESAPAKFEYYAQLPNQIAVAKRKFSMPLYLKADK
                     IMAQGEPSMCLESQNDSHLRLPVKRISIKVNSRNLESLPKKLSPPSLLPTVHTPPMRR
                     KRRRQE"
     gene            <825031..>826458
                     /locus_tag="HG535_0F04280"
                     /db_xref="GeneID:59237674"
     mRNA            <825031..>826458
                     /locus_tag="HG535_0F04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289746.1"
                     /db_xref="GeneID:59237674"
     CDS             825031..826458
                     /locus_tag="HG535_0F04280"
                     /inference="similar to AA sequence:RefSeq:NP_010468.1"
                     /note="similar to Saccharomyces cerevisiae CDC1 (YDR182W);
                     ancestral locus Anc_8.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145641.1"
                     /db_xref="GeneID:59237674"
                     /translation="MKFRTRVKEKLPLYKEDDALHTASPRKKGATRPKWKFYWRHLFM
                     LLCMWIMLINYYERTVVKRVIKRCEWSKWEKWPSDVNSHRVGLFADPQIMDAHSYPNR
                     PWIINYFTRVILDTYHKKNWKYVQYLLEPDTNFFLGDLFDGGREWADEEWLGEYVRFN
                     EIFPKVPSSRTIMSIPGNHDIGFGNTIREESLDRFSTYFGEPSSFYDIGNHTFVLLDT
                     ISLSDEANPDVSAVPKSFLNDFATGDHPLPKILLSHVPLYRNPEQQKCGNLRESKKNF
                     PLQQGEQYQTVIDLELSQEVLSMVTPVILFSGDDHDYCHITHSYHSDGITKSAEEITV
                     KSCAMNMGIERPAIQLLSLHNPLEDSSRSSTTSFETDICYLPDPYKPLTMYALMLLFT
                     IGWLVYMCIFPKSFNKLVANKMGRGHSKSVSALPLPVSSKSSVQSASSVYTVQETPKS
                     GNVLLNAAILSIMVLCVFSYYYASI"
     gene            complement(<826544..>829057)
                     /locus_tag="HG535_0F04290"
                     /db_xref="GeneID:59237675"
     mRNA            complement(<826544..>829057)
                     /locus_tag="HG535_0F04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289747.1"
                     /db_xref="GeneID:59237675"
     CDS             complement(826544..829057)
                     /locus_tag="HG535_0F04290"
                     /inference="similar to AA sequence:RefSeq:NP_013267.1"
                     /note="similar to Saccharomyces cerevisiae SEC10
                     (YLR166C); ancestral locus Anc_8.384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145642.1"
                     /db_xref="GeneID:59237675"
                     /translation="MNSIYELDSKWRKLLTSNNFLGGLTVNEFVEQLSRDHSIKGRSG
                     SNAPKTAFESLDPKPYIRTFEFILKELNSLSGESSERKHQLAEQVSHQEIEHAQSVIA
                     LSANLKHMMGRYDQLDHQLTSVNQVVSPLGEKLEIAIRKKKAYIKSVELITQYHEFYA
                     NGGSSYLETLRLSSNWLKKTQAAILVKNLLVLAFKVETSSIKRTVEVAKLIEEYSEVM
                     EKNLLESFNNAYRDNNFTQLNEIALILNQFNGGVNVIHSFINQHAYFIDSDQVHRDET
                     TDIFLDEDFKQRLIDPSLHGVVFEKSMVQLLNDVERVVKNESKVVKRVFEERAPQVIQ
                     LFMQRIFAQKIEAKIDHLLAASQSLSNLAYVRMLHALYSLLGQFIKDLSEFFQLLEID
                     VDNVLTASLEQSYSELFSKYLYDRTKYFDVEKKSLETILFEKTANFNMKYERSTRSRA
                     LANRLTSSLENGLEINGLATTSSSKLSQLNSFFKSHIDKDRLGINRVNSLNRSNTLSN
                     RDPNQSVISNQETADLSSTDDDGFNLQNADAMLKCVVESIARVMELASSKAGNYSFEL
                     LEVMLIGIVSSYVDTALEAAYSESSKSDVAKPQVIQLGFLRYISLSTDILSLTSASVK
                     AIFLPLLNNSPAIKSKIVVITNNQITRCELLINITLEEVCRVILTKFSNCLAKQKKKD
                     FSPKSQELLDHDTLPAVEIVGMLNSLYSQVTLYLKGENLVSFLEKIGEGLYSLLLDHY
                     MKFQVSSAGGIIVTKDIIGYQTAIESWGIAALNEAFSTLRELANLFTVQSDLLDSLTK
                     EGQLAEVSRDIISAYVSNREDFSQDSFIAGVRMNLKQHI"
     gene            <829246..>829938
                     /locus_tag="HG535_0F04300"
                     /db_xref="GeneID:59237676"
     mRNA            <829246..>829938
                     /locus_tag="HG535_0F04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289748.1"
                     /db_xref="GeneID:59237676"
     CDS             829246..829938
                     /locus_tag="HG535_0F04300"
                     /inference="similar to AA sequence:RefSeq:NP_010469.3"
                     /note="similar to Saccharomyces cerevisiae PLP1 (YDR183W);
                     ancestral locus Anc_8.385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145643.1"
                     /db_xref="GeneID:59237676"
                     /translation="MSDPIQQYNSRLIDDLDSTHENGRQEEEDQTHLSEILDDLENDG
                     NNDPFLQLYREKRMQEISDHFKLVEKNVREKNYGRLQELDGESQLLSLSSKCPKLVVH
                     FMVEKFSKCQYMNDKLEILARKYLTTKFVKISVENCPFLVEKLKIKVLPFLMGYKEGQ
                     ERFRSIGFAKLGNDPNGFPTTKLENLLERAGLVSLQPKHEDGTESRRTRESDGPQYAR
                     YSDSDAGSELDI"
     gene            <830329..>830787
                     /locus_tag="HG535_0F04310"
                     /db_xref="GeneID:59237677"
     mRNA            <830329..>830787
                     /locus_tag="HG535_0F04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289749.1"
                     /db_xref="GeneID:59237677"
     CDS             830329..830787
                     /locus_tag="HG535_0F04310"
                     /inference="similar to AA sequence:RefSeq:NP_013268.1"
                     /note="similar to Saccharomyces cerevisiae RPS31
                     (YLR167W); ancestral locus Anc_8.386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145644.1"
                     /db_xref="GeneID:59237677"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIRHKHKNVKMAI
                     LGYYNVDSEGKVTKLRRECQRCGAGVFLANHSGRYYCGKCHSVYTFKTEA"
     gene            complement(<830970..>831782)
                     /locus_tag="HG535_0F04320"
                     /db_xref="GeneID:59237678"
     mRNA            complement(<830970..>831782)
                     /locus_tag="HG535_0F04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289750.1"
                     /db_xref="GeneID:59237678"
     CDS             complement(830970..831782)
                     /locus_tag="HG535_0F04320"
                     /inference="similar to AA sequence:RefSeq:NP_010470.1"
                     /note="similar to Saccharomyces cerevisiae ATC1 (YDR184C);
                     ancestral locus Anc_8.387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145645.1"
                     /db_xref="GeneID:59237678"
                     /translation="MSANEGSENTDLEKTLHHLLTTDTHQEQEQEQEQEQEPEQEQDQ
                     DQDQDQDQEQDQDPEKEQQLEKEGQIHNVADTDPEDFDVKYPEIDNEDIQCSDIGILD
                     SDIMQGKHLTLESLLESGDSMMFDLDDTPKKRLSNEIDVDQDFEASNKRKKLDTAAYE
                     QLLSPASLSPLSTDGNTNTNNNSILSKIAEVKSVDSYTNDFTIEQIKEMKKRIINTHK
                     LFLNFNLLKDSYSKTCVEFKKVLNILKDSEIHRSHLLKENQELTLKLDALTK"
     gene            complement(<832113..>832820)
                     /locus_tag="HG535_0F04330"
                     /db_xref="GeneID:59237679"
     mRNA            complement(<832113..>832820)
                     /locus_tag="HG535_0F04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289751.1"
                     /db_xref="GeneID:59237679"
     CDS             complement(832113..832820)
                     /locus_tag="HG535_0F04330"
                     /inference="similar to AA sequence:RefSeq:NP_010471.1"
                     /note="similar to Saccharomyces cerevisiae YDR185C and
                     YLR168C; ancestral locus Anc_8.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145646.1"
                     /db_xref="GeneID:59237679"
                     /translation="MRLFKNSYSFEYPWDQVTAANWKKYPNEVSTHVIAVDVLKRELI
                     DNGQKLVSERLITVKQGVPKWIMMAMGGTNVSYVREVSVVDLANRSLTLRSCNMSYSN
                     ILKVYETVKYNPHPEDPVNKTLFEQEAQITAYGAFTKICNKMEEWSVQRFHDNALKGK
                     KGFDSVLEVFDKHWVQREKYVDDLGNSIVGKVADTVEDIKTTAEEMLKETEMKSNSIL
                     TRHYDSIKNAFKRNENM"
     gene            complement(<833111..>834280)
                     /locus_tag="HG535_0F04340"
                     /db_xref="GeneID:59237680"
     mRNA            complement(<833111..>834280)
                     /locus_tag="HG535_0F04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289752.1"
                     /db_xref="GeneID:59237680"
     CDS             complement(833111..834280)
                     /locus_tag="HG535_0F04340"
                     /inference="similar to AA sequence:RefSeq:NP_013347.1"
                     /note="similar to Saccharomyces cerevisiae ERF2 (YLR246W);
                     ancestral locus Anc_8.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145647.1"
                     /db_xref="GeneID:59237680"
                     /translation="MVLSSHRSRRQHLHGEEGGDGGLSLSRRNIENEVSGTSSRKEAW
                     TKTFYKWLITIDGDVDISSDRGYRRIPEVTNYAFFCGGRLRTVKHTRHLSVLVGMLIA
                     APMVLFSVFEANELWNTAYGYKPMVFFFYYFWAMGFSFFIRTATSDPGVLPKNIHLSQ
                     GSNPGQIPQEYRNIIHLPTPDTEKNPNSKIELKYCVACRIWRPPRASHCSTCGVCVEV
                     HDHHCIWVNNCIGKRNYRYFIIFISGLVLAAVFLIANTIIHISRHNGRASEIPVTILL
                     LTYGTVFIWYPVILLLYHIAMAGTQQTTREFLKRVEMTNPVFAKITTNEDNPFDTGSF
                     LRNLGGLMLQCRGLSYVNTREKNEPGDWRYIKVPQPHTFERVNFSTTLYPPPLPA"
     gene            <834997..>836133
                     /locus_tag="HG535_0F04350"
                     /db_xref="GeneID:59237681"
     mRNA            <834997..>836133
                     /locus_tag="HG535_0F04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289753.1"
                     /db_xref="GeneID:59237681"
     CDS             834997..836133
                     /locus_tag="HG535_0F04350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145648.1"
                     /db_xref="GeneID:59237681"
                     /translation="MEVLRRPNHSSRLVMEKQDPIDCDLGTTSIPKKVFKSRLTFFCY
                     AAVRSRGFHILLLLLAFLSVSLFFLVDDLKSNPAKQFIYFMGLVVGVSVGALLVLCYR
                     VQRIKHLVSHNLTIFMEIVETVFEPGHGIGPERWDVVACEMNRELYEIGLWKTPYCFF
                     EGLDLEKLYRYLVLKPQFEQNLDQFDVLEKGHGQTSSYQQALDEQFSSWVEVSDTSIE
                     DSERKLPRDSCWSKFTWTVHKMIKLQKQSILVQVVCLLNFFSLVQLIAFFIVMMLLYK
                     GIQEFQFFQDTPMLTSKRLRFLATITSVAPGTNLDRWDVIAKRMNSYLRENTRSCDCF
                     YDGKDCLKFFENNFKPLTSKKGMSTEMATYELVPFVLKAGEVCY"
     gene            complement(<836540..>838936)
                     /locus_tag="HG535_0F04360"
                     /db_xref="GeneID:59237682"
     mRNA            complement(<836540..>838936)
                     /locus_tag="HG535_0F04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289754.1"
                     /db_xref="GeneID:59237682"
     CDS             complement(836540..838936)
                     /locus_tag="HG535_0F04360"
                     /inference="similar to AA sequence:RefSeq:NP_010472.3"
                     /note="similar to Saccharomyces cerevisiae YDR186C;
                     ancestral locus Anc_8.390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145649.1"
                     /db_xref="GeneID:59237682"
                     /translation="MWSAVKDGGASHTGKAQKEAVQKMCEHERAPFEPKVRVQRHNSL
                     FIIDYSEIPPQGDSIKTSLTKQKASAITNFKVYIYIDIPTIDYYMDELSDYKLSRFNK
                     KFKLHLLRESIYKCFTNGNGQFWEDLISLNDQLKICTISISSSGSLRYVETVKFLMET
                     CYESLMEYITAGKLEIKFRLEVSPTSHKWFLTFLDKRLISNEIIEFIQTGSYLEFSEN
                     ASTPFKEYYAQLNSKFTSKHEISGSLESIVIITNLTGVKALLTILSDRPLTSYILQDS
                     IDALHDNGLTTKPSKDNNTDASEEETHLKRESSSLLSFQNSLVTSNKDKSVRIRSLSL
                     NRKLHKSQGFTSDDLMIHKTTSRDISTSNTACAKQTSLDTRNASNFRGESQVNSGTSN
                     INDEQFVSRGDEGDFENIAREGDEEDEEDEEDDEEDDEDDKEKGNDSDDGISFSVPSK
                     LSRSGSSFDVRDSERPASRRGRFRSLSLMDPALHGPFKERGSSLSLEPTEDEPSSFEE
                     SKVSNIYVHDGEFEDITSSRKGKKKLNKNLLSRQNSANGLIPPEFYSRISSPSTSASS
                     SNSSLQNLNMAPGTFSKWLGPSESSKDTSPSLENNTNKLFEKKLIDKSYEEHRRQTSI
                     NLFSTLMGGLNSNSDKNPLALNFKSNKVIPPEIQILDEEDLLMSGYHNGNGNFTAEET
                     SEDEIRSISTVVGDDNVFGVLDSASSNNLNRKSTGERSLSNSSSKAFAATVDLNLQLY
                     GSNSDDHENKENNQEESVDNGMLRDRPKVKYKKAIQLDLYGDDDLGNMGGWILGGNAR
                     "
     gene            <840434..>840898
                     /locus_tag="HG535_0F04370"
                     /db_xref="GeneID:59237683"
     mRNA            <840434..>840898
                     /locus_tag="HG535_0F04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289755.1"
                     /db_xref="GeneID:59237683"
     CDS             840434..840898
                     /locus_tag="HG535_0F04370"
                     /inference="similar to AA sequence:RefSeq:NP_013346.1"
                     /note="similar to Saccharomyces cerevisiae CDD1 (YLR245C);
                     ancestral locus Anc_8.391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145650.1"
                     /db_xref="GeneID:59237683"
                     /translation="MYRENKNVVVPGVTPEQFKELREKALEARNLSYSPYSNFRVGCC
                     LLTEDGTFVNGANVENASYGGAICAERTTIVKLITSLNNPSKRRQWRCLAISGDSMDT
                     CITPCGICRQFIREFAPLSLPIVMFNGDGTKCLMKTLEELLPLSFGPDDLIH"
     gene            <841120..>842244
                     /locus_tag="HG535_0F04380"
                     /db_xref="GeneID:59237684"
     mRNA            <841120..>842244
                     /locus_tag="HG535_0F04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289756.1"
                     /db_xref="GeneID:59237684"
     CDS             841120..842244
                     /locus_tag="HG535_0F04380"
                     /inference="similar to AA sequence:RefSeq:NP_013345.1"
                     /note="similar to Saccharomyces cerevisiae MAP1 (YLR244C);
                     ancestral locus Anc_8.392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145651.1"
                     /db_xref="GeneID:59237684"
                     /translation="MSEVNQEKKYCAGLQCGKETDSNLKCPVCLKVGIDSSFCDESCY
                     KDNYKSHKSIHPSEDDKSYDPFPKYKYTGNLRASYPLTPKRPIPEHIEKPDWADNGMP
                     IREQRNDRLNKIPVYTKEEIKKIRKACMLGREVLDIASAAVIPGVTTDKLDEIVHNAT
                     IERNAYPSPLNYYNFPKSLCTSVNEVICHGVPDKTVLKEGDIVNLDVSLYFQGFHADL
                     NETFYVGEKVSKEAINTTETARECLKNAIKLCKPGATFHELGDCIEKHATDNKCSVVR
                     TYCGHGVGKYFHCAPSIPHYAKNRTPGVMKQGMVFTIEPMINEGSYKDATWPDDWTAV
                     TRDGKLSAQFEHTLLVTDSGVEILTARNKKSPGGPRQRTK"
     gene            <843173..>844816
                     /locus_tag="HG535_0F04390"
                     /db_xref="GeneID:59237685"
     mRNA            <843173..>844816
                     /locus_tag="HG535_0F04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289757.1"
                     /db_xref="GeneID:59237685"
     CDS             843173..844816
                     /locus_tag="HG535_0F04390"
                     /inference="similar to AA sequence:RefSeq:NP_010474.3"
                     /note="similar to Saccharomyces cerevisiae CCT6 (YDR188W);
                     ancestral locus Anc_8.393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145652.1"
                     /db_xref="GeneID:59237685"
                     /translation="MSLQLLNPKAESLRRDAALKVNVTSAEGLQSVLETNLGPKGTLK
                     MLVDGAGNIKLTKDGKVLLTEMQIQSPTAVLIARAAAAQDEITGDGTTTVVCLVGELL
                     KQAYRFIQEGVHPRVITDGFDIARKETLEFLNEYRISKNGEQELDREFLLQVARSSLS
                     TKVEPELTEILSPIVTDAVLNVQNEETDSLDLHMVEIMQMQRLSPKDTTFIRGLVLDH
                     GGRHPDMPNRVENAYVLILNVSLENEKTEVNSSFFYSSADQRDKLAASERKFVDDKLK
                     KIIDLKNEVCGLNSNKGFVIINQKGIDPMCLDVLAKNGILALRRAKRRNMERLQLVTS
                     GEAQNSVEDLSPSVLGFSSLIYEESIGEEKFTYVTANKNSKSCTILIKGSTNYALNQT
                     KDAVRDGLRAVANVLRDKMVIPGAGAFFIAAARHLRTCNQNKLGATGKTKTGLDAFAE
                     ALLVVPKTLVKNSGFDALDVLAMCEDELNEADEEGERRYVGVDLKIGDTCDPTIEGIW
                     DSYRVIRNAVNGASGIASNLLLCDELLRAGRSTLKEGAQ"
     gene            <845083..>847044
                     /locus_tag="HG535_0F04400"
                     /db_xref="GeneID:59237686"
     mRNA            join(<845083..845092,845171..>847044)
                     /locus_tag="HG535_0F04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289758.1"
                     /db_xref="GeneID:59237686"
     CDS             join(845083..845092,845171..847044)
                     /locus_tag="HG535_0F04400"
                     /inference="similar to AA sequence:RefSeq:NP_010475.1"
                     /note="similar to Saccharomyces cerevisiae SLY1 (YDR189W);
                     ancestral locus Anc_8.394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145653.1"
                     /db_xref="GeneID:59237686"
                     /translation="MQKNAILKMLFLNKDNVDPNLDETFNEEDLQWKALVMDVKSTAI
                     VSSVLRVNNLLKAGVTVHSLIQQARAPLPDVPVVYFVTPNQENINLIVQDIKEDKYAN
                     YYVNLTSSLSRDLLEDFAQQVCSTARSDRIKQVFDQYLDFIVTEPELFSLDLPRSYTV
                     LNNPSSTEEIITQLCDHVATGLFNVVMTTLSIPIIRAPKGGPAEIVAEKLGAKLRDFV
                     INTRTATNSVLEGDSLERCVMIILDRNIDFSCIFSHSWIYQCMVFDVFKLTKNTIAIP
                     SKTAEGGELLKKYDIEPNDFFWKENAHLPFPEAAENVEAALSAYKEEAAEITRKTGVS
                     NLTDLDPNSNSDTVQMQEVVKKLPQLAARKNIIDVHMNIFAALLSQLESKSLDTFFEV
                     EQDPDNAKTRTRFIEILKDGKTNNMEDKLRSFIVLYLSSSNGLPQDFVKEVEAYFSGN
                     EFYSSALKYVYKLRQFMQLSNKTLQNKSLEDGTSKASAGGNLSLSGLYGLTEGRLQGG
                     VGSLISGIKKLLPEKKTIPITNVVEAIMDPLNSSQKNLETTDDYLYFDPRITRGSHTK
                     KPKRQSYNKSIVFVVGGGNYLEYQNLQEWAHSQLHNPKSVMYGSTSISTPSEFLSEIS
                     ELA"
     gene            complement(<847180..>848583)
                     /locus_tag="HG535_0F04410"
                     /db_xref="GeneID:59237687"
     mRNA            complement(<847180..>848583)
                     /locus_tag="HG535_0F04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289759.1"
                     /db_xref="GeneID:59237687"
     CDS             complement(847180..848583)
                     /locus_tag="HG535_0F04410"
                     /inference="similar to AA sequence:RefSeq:NP_010476.1"
                     /note="similar to Saccharomyces cerevisiae RVB1 (YDR190C);
                     ancestral locus Anc_8.395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145654.1"
                     /db_xref="GeneID:59237687"
                     /translation="MVAIAEIKDTNTGTNSPSGASLGGAARTAAHTHIKGLGLDERGI
                     AKQVEGGFVGQVEAREACGIIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGP
                     KVPFCPLVGSELYSVEVKKTEALMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPL
                     GGYGKTISHVVVGLKSAKGTKTLRLDPTIYESIQREQVSVGDVIYIEANTGAVKRVGR
                     SDAYATEFDLETEEYVPLPKGEVHKKKEIVQDVTLHDLDIANARPQGGQDVISIMGQL
                     LKPKKTEITEKLRQEVNKVVAKYIDQGVAELVPGVLFIDEVNMLDIEIFTYLNKALES
                     SIAPIVVLASNRGMTTVRGTEDVVSPHGIPPDLIDRLLIVRTLPYSRDEIRSIIDRRS
                     KTENLQVDVSALDFFADMGTETSLRYVLQLLSPCGILAQTSGHKEITISDIQEAKSLF
                     LDVKRSTQILESAANYL"
     gene            <848847..>850010
                     /locus_tag="HG535_0F04420"
                     /db_xref="GeneID:59237688"
     mRNA            <848847..>850010
                     /locus_tag="HG535_0F04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289760.1"
                     /db_xref="GeneID:59237688"
     CDS             848847..850010
                     /locus_tag="HG535_0F04420"
                     /inference="similar to AA sequence:RefSeq:NP_010477.3"
                     /note="similar to Saccharomyces cerevisiae HST4 (YDR191W);
                     ancestral locus Anc_8.396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145655.1"
                     /db_xref="GeneID:59237688"
                     /translation="MDQSTKVSPGSHSRSHSFPLTPPATVEKPSCDEIDETRTIKDIK
                     PRKLFTKLRKNTRKPKLKHRPESGTVFDLDQYMNGLCGKKDAMNAAFVRYAFQHSKRI
                     VVVIGAGVSVAAGIPDFRSSEGLFSILKGKHFSTGKDLFDFNKVYSSDEMSIAFNSMI
                     TKLHKMSSEAKPTQFHELLNRVSLEGRLQRLYTQNIDGLDTRLNDLQTRVPLEKPIPS
                     TIQLHGSINHMVCNKCAKIAQLDPTIFKNELCDEENSTIIPTCRQCEEFESVREIAGL
                     RLKGIGKLRPRVVLYNEIHPEGDIIGEVTGTDLKKKPDCLIIAGTSLKIPGVKNICRQ
                     FAQKVKSSNGIVLYMNKEMPSQSMIDHIGCVDLILLGDCQNVPQLLQDSTESF"
     gene            complement(<850045..>850860)
                     /locus_tag="HG535_0F04430"
                     /db_xref="GeneID:59237689"
     mRNA            complement(<850045..>850860)
                     /locus_tag="HG535_0F04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289761.1"
                     /db_xref="GeneID:59237689"
     CDS             complement(850045..850860)
                     /locus_tag="HG535_0F04430"
                     /inference="similar to AA sequence:RefSeq:NP_013344.1"
                     /note="similar to Saccharomyces cerevisiae YLR243W;
                     ancestral locus Anc_8.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145656.1"
                     /db_xref="GeneID:59237689"
                     /translation="MSRVGVLVMGPAGAGKSTFCNEIISHMQTIGRRAHIVNLDPAAE
                     PNKYEFTVDIRDLISLDDVMDELDLGPNGALIYCFEYLMKNLDWLDEEIGDYNDEYLI
                     FDCPGQIELYTHIPVLPNIVRHLQNQLNFNLCATYLMEASFIVDNSKYFSGALCAMSA
                     MILLELPHINVLSKIDMIKDSVNRKKLKRFLNPDPLLLADETNEETNPRFKYLNQCIA
                     NLVDDFGMVQFLPLEAKNPDSISTILSYVDDVTQWAEAQEQKEPNDQIEIEDM"
     gene            complement(<851024..>852766)
                     /locus_tag="HG535_0F04440"
                     /db_xref="GeneID:59237690"
     mRNA            complement(<851024..>852766)
                     /locus_tag="HG535_0F04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289762.1"
                     /db_xref="GeneID:59237690"
     CDS             complement(851024..852766)
                     /locus_tag="HG535_0F04440"
                     /inference="similar to AA sequence:RefSeq:NP_010478.3"
                     /note="similar to Saccharomyces cerevisiae NUP42
                     (YDR192C); ancestral locus Anc_8.398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145657.1"
                     /db_xref="GeneID:59237690"
                     /translation="MSYYNNTSSIPCKYFQQGRCNRGNSCKFAHVYTNNNSGSGQRPA
                     NDEGISAADLYRSFVNPSSLNKIEKSILSGLQDAEHFQMKPLSSAYSYGLPCAVNLIS
                     GRDYSQEESRYQYYQSQKNGLVTQYEVEMRSRESDMQKCFAHIRSHPDWAARFLQKKT
                     KDLVETGQLSIKKDFVDFELNLGNSGFQNLSAPGQGGNPFTAGKPAFGSTPSSGPVEA
                     FGGNTTSNTGAFGQPSFGKGGGAFGTPANSSNAGRSAFGVPTFGTSLSGAGQNNAPSA
                     FGKPAFDPTPSTSAFGNTAASNPGQFNAFGTSMGSGSVFGKPQFGTAPSQTTALGVSS
                     NQTGAFGTPSFQKQNDNNAFGSASFGSASFGSHNITTTAPPLGSAQNASMPSPFSNLQ
                     NGQNATASTNPPAGSPFASLQNKTSTSPFGTIPNNTSAFNNKASVNETSSSPFGSLNQ
                     GNSLGVQSSPFGSLQSNTASNTFGSKPSPFGSTGQSPFATQTNTSTTAQNPFVKPNVN
                     GISALNSMNARNATASNMHSLYQNFVQGLPSKDEKLTASDLDSHTLARFESETFSLGD
                     VPDIPPPSALIVHN"
     gene            <852920..>853840
                     /locus_tag="HG535_0F04450"
                     /db_xref="GeneID:59237691"
     mRNA            <852920..>853840
                     /locus_tag="HG535_0F04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289763.1"
                     /db_xref="GeneID:59237691"
     CDS             852920..853840
                     /locus_tag="HG535_0F04450"
                     /inference="similar to AA sequence:RefSeq:NP_013343.1"
                     /note="similar to Saccharomyces cerevisiae ARV1 (YLR242C);
                     ancestral locus Anc_8.399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145658.1"
                     /db_xref="GeneID:59237691"
                     /translation="MICIECTTPVTSLYVVYANNHIQLTECPNCHKYVDKYVEMDHVI
                     LFIDLLLLKSGAYRHLVYNSLENELSKYKEWDIKKGRPLEMAKSICENLKNWFLKFDR
                     LNRIWVLLIAFEIYLTWVTEERKYSLFLNGDTFNSRFALKDLMMNKVFSWNPLYQYLY
                     FAVRCMIDISIFHGLTSYLLLHWLKWGKDVKYAKDVLSYAILLSYGAKIFPILMLIWP
                     YDNVVSMNIIKWIANLYIVESLQIVTNLPYSSIFEVLFVVSIAKWFLVKSLLMFFIAE
                     GCIGQTLIYLNSEIQFSFQKFAIMENFFLL"
     gene            complement(<853908..>856253)
                     /locus_tag="HG535_0F04460"
                     /db_xref="GeneID:59237692"
     mRNA            complement(<853908..>856253)
                     /locus_tag="HG535_0F04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289764.1"
                     /db_xref="GeneID:59237692"
     CDS             complement(853908..856253)
                     /locus_tag="HG535_0F04460"
                     /inference="similar to AA sequence:RefSeq:NP_013342.1"
                     /note="similar to Saccharomyces cerevisiae YLR241W;
                     ancestral locus Anc_8.400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145659.1"
                     /db_xref="GeneID:59237692"
                     /translation="MFSKAIELLGLYDRREDIDSNQGHDFRKPTAQVVSAQLYTATLM
                     GLFALLSFSLLLQKLPKLYASRRYKDNGSLRLPSWEEGKLFSWLTVIYKIRDEQVLEY
                     AGLDAFVFLGFFKMCIKLLSVCCVFSVCIISPIRYHFTGSYDDGDDNNHKLNILLKFV
                     KRSSIPSGEDTQPEGARGYLWMYVIFTYFFTCLAIHLLVSQTVLVVNTRQAYLGKQNT
                     VTDKTIRLTGIPIELRDPEALKNKIEQLKIGKVSSVTICREWGPLNRLFRYRENVILQ
                     LESKYAECPPEHRDREAYSENYNLQRNTGELGSSPNPISREVIHTDDNEDDLLYPQKA
                     LQRPMMRTGFLKLFGPKVDAINHLEKQLRFIDQEISEARKKHYSATTTAFVTMDSVAN
                     AQMAAQAVLDHRVHYSIANLAPAPHDIKWENVCLSRKERLTKVYCVTAFIGLSSLFLI
                     IPVSYLATLLNLKTISRFWPSLGALLKENKWAQNLVTGLLPTYLFTLLNIVIPYFYEY
                     LTSRQGLVSHSEEELSLVSKNFFYIFVNLFLVFTLAGTASNYWGYLSDTTKIAYQLAT
                     SVKEFSLFYVDLIILQGIGVFPFKLLLVGSMIGFPFVKIKSKTPRQQRELYNPPIFNF
                     GLQLPQPILILIITLIYSVMSTKILVSGLAYFFVGFYVYKYQLIFATDHLPHSTGKVW
                     PLIYRRIMAGLLLFQLTMAGTLAGFESGWILSSCLFPLPFITCSFWWDFEKHYMPLGK
                     YIALSSIREHEEEHTLVSSPADTDTYDYPYLVHGLEGPILE"
     gene            complement(<856494..>859223)
                     /locus_tag="HG535_0F04470"
                     /db_xref="GeneID:59237693"
     mRNA            complement(<856494..>859223)
                     /locus_tag="HG535_0F04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289765.1"
                     /db_xref="GeneID:59237693"
     CDS             complement(856494..859223)
                     /locus_tag="HG535_0F04470"
                     /inference="similar to AA sequence:RefSeq:NP_013341.1"
                     /note="similar to Saccharomyces cerevisiae VPS34
                     (YLR240W); ancestral locus Anc_8.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145660.1"
                     /db_xref="GeneID:59237693"
                     /translation="MPFTIRWNLNERVNQTESTLVPNVFKAWLNYRFNRIQDMASNSV
                     TFCVSQDLDIPLSIKIKSLEGRKRLSRASEKISQPQLSQIASNVVPNSDMMVSVQVFD
                     IESNRNLTMPISTSYVPFKKSRTWDQWLTLPVSLNQLNLSSRLRVELWEYDGTKKIPF
                     HFLQTTIFRTDNSLKRGQESLKFEYNDPKNGCVLEDNDVVDTLNKYHQGDIKKIEWLD
                     SITFPSVEDILAKRRWPIGTFVINIEFPVFELPVVFTEKLYDNVQLNIPTLHNFEQGT
                     EMTDHSKTESRLTISLGDKYESTLKFYDPDQFSNNPIEEKYRRLERASKRSNLDRQVK
                     PDTKKRDYLNRIINYPPGTQLTAHEKGSIWKYRYYLMNNKKALTKLLQSTNLTEENER
                     TEVLDLMDSWAEISIDDAIELLGSAYKNISVRAYAVGRLKKASDKKLELYLLQLVQAV
                     CFESLSTFSDKSNSEFTIVDMASSQNPGTMNSVAVAGQHQKMINSVNTSDGLSLEDSA
                     IVISPLAEFLIRRAIINPRLGNFFYWYMTSEAEDNPYLNQITDSFWSRLSKERRKTLH
                     DQITFIEMLREFCEEIKRSKDTTAKKSELLSHLLTTKLRVLLKNGPISLPIDPDIVVT
                     DVVPEMSKVFKSSLSPLKIAFKTGTNEIYPLMYKVGDDLRQDQLVVQIISLMNELLMN
                     ENVDLKLSPYKILATGSQEGAIQFIPNETLASILSVHHGILPFLRSHYSDAKEELGVE
                     SWVMDNFVKSCAGYCVITYILGVGDRHLDNLLITPDGHFFHADFGYILGQDPKPFPPL
                     MKLPPQIIDAFGGAESSNYNKFRSYCFVAYSILRRNAGLILNLFELMKTSTIPDIRID
                     PDGAVLKVKERFNLNMSEEEATLHFQNLITDSVGALLPIVIDHLHNLAQYWRA"
     gene            complement(<859347..>861332)
                     /locus_tag="HG535_0F04480"
                     /db_xref="GeneID:59237694"
     mRNA            complement(<859347..>861332)
                     /locus_tag="HG535_0F04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289766.1"
                     /db_xref="GeneID:59237694"
     CDS             complement(859347..861332)
                     /locus_tag="HG535_0F04480"
                     /inference="similar to AA sequence:RefSeq:NP_010480.1"
                     /note="similar to Saccharomyces cerevisiae MSS116
                     (YDR194C); ancestral locus Anc_8.402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145661.1"
                     /db_xref="GeneID:59237694"
                     /translation="MSARTVLLWNRLPSSLSQRGRAGFLIHARSYMDDGFKRPSYRGG
                     RNPNFNNRNRNNNRYGGRDRVQRKEHDEDDHASLSKSIPATLIHVPKQADAPEVTLDT
                     LHNDGVLHKMLYKSISRMGFPGLTPVQQMTIKPIVESLDQDVIARAKTGTGKTFAFLM
                     PIFQHLLNSRTESPYMVRAVIVAPTRDLALQIESEVKKIYDNNYGLEKFGCISLIGGT
                     NFSQYMKKMHSNRPNIVIATPGRLMATLERFSNKFFKHVDFLVLDEADRLLEIGFKED
                     LESISRTLNENNAAGPDHIRTLLFSATLDSKVQSLAGNIMHKKECLFLDTVDKNEPEA
                     HEKIDQSMVVSENFAHSVCAAMDHINNKIASSPNYKAILFSPTVKFTQYLSSILRKKF
                     RSQLPILEFHGKIDQKKRTNLVKQFKREKSGILICTDVGARGMDFPNVQEVLQIGVPS
                     ELANYIHRIGRTARGGQEGASTIFLCKDELPFVDELLHRRNVTIANKEEYTPLNETIE
                     GLTSETDPQELSDVIISVLSFFRTAIKEYRFKENRLLPNVASAYGILLGDKEAKIPIY
                     DRDMLQRLGMRNSSLTSKMFDLQGSAAQESGYERSNRGSYQNQNSYHRNRGNTRSQRY
                     NRDGDEQFSFNRDRRSNSFHDRKFYQKSQGENPRYDE"
     gene            <861817..>863238
                     /locus_tag="HG535_0F04490"
                     /db_xref="GeneID:59237695"
     mRNA            <861817..>863238
                     /locus_tag="HG535_0F04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289767.1"
                     /db_xref="GeneID:59237695"
     CDS             861817..863238
                     /locus_tag="HG535_0F04490"
                     /inference="similar to AA sequence:RefSeq:NP_010481.3"
                     /note="similar to Saccharomyces cerevisiae REF2 (YDR195W);
                     ancestral locus Anc_8.403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145662.1"
                     /db_xref="GeneID:59237695"
                     /translation="MSSSHPIPQMVNISHALQSTAVEKIRSDIKDLQQVAELTLDQKQ
                     TINKYIESLNAAFAQFTKDNEHVERSVDKSITAADTQLYMGLKGMYTDYLSQLERIRQ
                     EKSTDVVNAKASNESVLHIIKEELPTKHAKERRLYIDKLIKNYPNDKLPKKSVGLVQS
                     IIKLCSLDSDFTPTLKSYVHLLKMMGYKYEAIKKYVPQDLDNLMSELFDKGSTKNEEI
                     SSLMASNGDSQNALLDDEPKKKISFSKYLKKGDEVVNENNKRESSKISEITSRPAKII
                     KKNNKGIGSNSGTKVSLNSILKTSGSSRSKRSSTGIRFEDDSQLVRVYGYGLPNEGLK
                     VSPEELKKVLKPFKEGEPREALLIKNYEGKAKELDIEFDMLAEQSDISELKGGPIPCD
                     TAVPLKYRKGFSNFTSDLGNKPAREPVIIDDLNENSKNLKGPLIMKAFGKNSLLLRKD
                     RGGIPYRRIPDVVPINYPPRPVD"
     gene            complement(<863375..>864094)
                     /locus_tag="HG535_0F04500"
                     /db_xref="GeneID:59237696"
     mRNA            complement(<863375..>864094)
                     /locus_tag="HG535_0F04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289768.1"
                     /db_xref="GeneID:59237696"
     CDS             complement(863375..864094)
                     /locus_tag="HG535_0F04500"
                     /inference="similar to AA sequence:RefSeq:NP_010482.3"
                     /note="similar to Saccharomyces cerevisiae YDR196C;
                     ancestral locus Anc_8.404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145663.1"
                     /db_xref="GeneID:59237696"
                     /translation="MLVVGLTGGIASGKSTVSNRLQEKYTLPIIDADHVAKEVVEPGQ
                     SAYKQIIEYFSDKIPDLLLPDGHLNRGSLGKRVFEHSDDLKKLNSITHPAVRKSIFKQ
                     VLLYYSKGYRMCILDVPLLFEARLDTFCGVTIAVIASEDIQLSRLQVRNPGMTLEDCR
                     NRIKSQMTSEERIEKADYILQNDQDLANLYAQVDTLITSIRPSLLRTALEYFPPFGAV
                     SAAAIILSKSFLNFQKLKKID"
     gene            <864308..>865444
                     /locus_tag="HG535_0F04510"
                     /db_xref="GeneID:59237697"
     mRNA            <864308..>865444
                     /locus_tag="HG535_0F04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289769.1"
                     /db_xref="GeneID:59237697"
     CDS             864308..865444
                     /locus_tag="HG535_0F04510"
                     /inference="similar to AA sequence:RefSeq:NP_010483.1"
                     /note="similar to Saccharomyces cerevisiae CBS2 (YDR197W);
                     ancestral locus Anc_8.405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145664.1"
                     /db_xref="GeneID:59237697"
                     /translation="MGTVPRIYSVVNTPIASILACEIAILPNQPPVPQVVLLLNDHKK
                     LNRFLDNDSKIIIDRNKGKNIHQTQFMAAYLPPVYSTGKIATIDNLIVSGQHSKNIVS
                     SVRKYLHCLNAGSNLFLLNPPFGAIEHLYRNLWTTSESRPNLFVGISMKREANLVSVS
                     DEFRLKLKCSGISMRVSPVPRDFASYSHESGVNALEELRHENDMLKLLDATAHNPNPI
                     ASISPLFYSYGDLLLIRLERLIVESCIEPLAALFGCRYTGELLQTPKSKDLILKLINE
                     QVWILKCAQPFLTNMPSFHVAMDTGRLYELILKELRDKPKLRSQLNHSLNQLNQSNIN
                     QLTGYFVQLANYKKLDCRWNEVITGLVKGKAGIAKHRSLNYKYL"
     gene            complement(<865509..>866936)
                     /locus_tag="HG535_0F04520"
                     /db_xref="GeneID:59237698"
     mRNA            complement(<865509..>866936)
                     /locus_tag="HG535_0F04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289770.1"
                     /db_xref="GeneID:59237698"
     CDS             complement(865509..866936)
                     /locus_tag="HG535_0F04520"
                     /inference="similar to AA sequence:RefSeq:NP_010484.1"
                     /note="similar to Saccharomyces cerevisiae RKM2 (YDR198C);
                     ancestral locus Anc_8.406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145665.1"
                     /db_xref="GeneID:59237698"
                     /translation="MKKSMRLFQRKKKMTMKAKVDSLLKWLRTSEQFYLATNISIHES
                     DTSGRGVVLIDEKLTTNEVVISIPPSHQLNFYTILYHISMFNTKLDIHGITAASEENI
                     MERNIGSQDPRFQAYGLLKQEFLLGLSSFQLLTLYILAEWILLPQWSSSEFVSYWKPF
                     FDIWPAKEELGSVPAIWNLTGDSKYKELLHLSSLASKKHCSRISALVKSDWSVILPIL
                     KDWNTMFNGDANNELFLEKLYREFLHIYFVVNSRCLYADISLKKDDIDSQFTMVPYVD
                     FLNHTDEVDVHCYPKLVKSSINANNLGRFEIRCGKFCYANKGEEILLNYGAHSNDLLL
                     NEYGFTLPQNCWNCIDISDEITKLMDGQDTIVSFLKSNGYWGDYTISFNEISYRVLVA
                     LSLVITSDFKRVEKLLLGYISEDFFLPKIRPALQRLLLLLLDTYHEKLRLLRILPLSL
                     STCTENIANIYFGYIEIIENNLENM"
     gene            <867064..>868017
                     /locus_tag="HG535_0F04530"
                     /db_xref="GeneID:59237699"
     mRNA            <867064..>868017
                     /locus_tag="HG535_0F04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289771.1"
                     /db_xref="GeneID:59237699"
     CDS             867064..868017
                     /locus_tag="HG535_0F04530"
                     /inference="similar to AA sequence:RefSeq:NP_013340.1"
                     /note="similar to Saccharomyces cerevisiae LIP2 (YLR239C);
                     ancestral locus Anc_8.407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145666.1"
                     /db_xref="GeneID:59237699"
                     /translation="MYVKVTSPLARFARYLSTKTCSLQAKTRPIEESANIIRHLQFTN
                     QLPFEKGLLIQEKFVKAELELKELHSKIRRKLERLHQSADNTTTINEHEKKIIDRILA
                     MKPNPIVMTFEFEPAYSGGKRIKKTITPEEIKKYESFVPLAQKENKKPKFVQVERGGQ
                     VTFHGPGQMVAYIVLDLKSFSDFPAKCLVSSIETATITTLKNTKTNGGTSLLNLQSET
                     TENTGVWTLDHKKIASVGVHVRRSITSHGVAINVCSDLSYMNNFVMCGLPSSEATSIK
                     EQLPDCNVGVQDISVSFVNEFAKTLGISTVERMQLSDLDVE"
     gene            complement(<868146..>869687)
                     /locus_tag="HG535_0F04540"
                     /db_xref="GeneID:59237700"
     mRNA            complement(<868146..>869687)
                     /locus_tag="HG535_0F04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289772.1"
                     /db_xref="GeneID:59237700"
     CDS             complement(868146..869687)
                     /locus_tag="HG535_0F04540"
                     /inference="similar to AA sequence:RefSeq:NP_010486.3"
                     /note="similar to Saccharomyces cerevisiae VPS64 (YDR200C)
                     and FAR10 (YLR238W); ancestral locus Anc_8.408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145667.1"
                     /db_xref="GeneID:59237700"
                     /translation="MTEVERNWRRPPPQPQSPSASEAPISSTSEMSNGKAHDTSVKRR
                     VRSNSKSTPSKSSTLTSGNAFKQKSEIESLQPAVAPRNKYTHIIILKSLNETFETKFL
                     VVPFKPDSLKLGRPVLNSNSSSQSYGVNGSTGNIGKVDSQQAPQVRPDNGHFDSRVLS
                     RNHASLSCDINTGKIYIRDLKSSNGTFVNGNRIDQQDVELKVGNIIDLGTDIDSKFEH
                     RKISAFVEDISVIPLINEVPSNGPTNGKLGEPTKTEIGTENGSGYSVVSATTAQRAAF
                     EAAMFGDVNNLDLEDTVLGSETEILSGIFINNSIGTSPNLINVIKTLATEVALEKHEF
                     TKLRSMENFLINYTTNLEYVNKLLVEKNDKQLAKLQNALKQKLTERQGLIIQEHKAQL
                     EKMERENLNMKSSFETQEREKLEHVKSLTNDIEDLRTRLEVEKYRKSQLAKSNVSIDQ
                     DSTRQVIQINEKATHIKDPSGATDETRQTPGYRKLGGGALLIMSAISVGLVAYAMTFS
                     SEQHI"
     gene            <869904..>870371
                     /locus_tag="HG535_0F04550"
                     /db_xref="GeneID:59237701"
     mRNA            <869904..>870371
                     /locus_tag="HG535_0F04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289773.1"
                     /db_xref="GeneID:59237701"
     CDS             869904..870371
                     /locus_tag="HG535_0F04550"
                     /inference="similar to AA sequence:RefSeq:NP_010487.3"
                     /note="similar to Saccharomyces cerevisiae SPC19
                     (YDR201W); ancestral locus Anc_8.409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145668.1"
                     /db_xref="GeneID:59237701"
                     /translation="MTDSLQRSMACLEDTITILENSVSKLASNSKPNDYLTQTMLSSR
                     RVFELVPEYDVQEAKLDLIEEVEPLVKTLEDKLEKSVVKMKRELDTLRQTYELNRLRL
                     DKTLNSKTDIDVSTDVVIMASSTNEELEELKMLKAKKENLQRKLQLLREKHPK"
     gene            complement(<870399..>871424)
                     /locus_tag="HG535_0F04560"
                     /db_xref="GeneID:59237702"
     mRNA            complement(<870399..>871424)
                     /locus_tag="HG535_0F04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289774.1"
                     /db_xref="GeneID:59237702"
     CDS             complement(870399..871424)
                     /locus_tag="HG535_0F04560"
                     /inference="similar to AA sequence:RefSeq:NP_010488.1"
                     /note="similar to Saccharomyces cerevisiae RAV2 (YDR202C);
                     ancestral locus Anc_8.410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145669.1"
                     /db_xref="GeneID:59237702"
                     /translation="MTARLYPNDYFGGPENYTREQDVINERSWLVEDIIKPELPNILG
                     NVEKCLEMLNSEQIFKMPISNGASGDDGSNPSIKGIVVRQGSFLLDFKAIIIFPEFHN
                     GKQILLRMDTGKKFPLAQIQSIELNLQEILEILEELQTLKELDNFIEKFGIVLKLLIE
                     SINLIENPPRTLCFPDSNNFAMRQMFKEYQSICESHHHEISMDIILFKSELCVDLRNL
                     SIVTKKPWCNIDVETGKSFSDTIKDKLTVDRSKTLVNTLKENGVHIEEPSIINNIIMS
                     TFNTEATTLAQAQYYMNRCVTFNGKAVIECEKLEITTSDPSLISITTKLNALENSISN
                     YYTNLKI"
     gene            <871567..>872559
                     /locus_tag="HG535_0F04570"
                     /db_xref="GeneID:59237703"
     mRNA            <871567..>872559
                     /locus_tag="HG535_0F04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289775.1"
                     /db_xref="GeneID:59237703"
     CDS             871567..872559
                     /locus_tag="HG535_0F04570"
                     /inference="similar to AA sequence:RefSeq:NP_010490.1"
                     /note="similar to Saccharomyces cerevisiae COQ4 (YDR204W);
                     ancestral locus Anc_8.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145670.1"
                     /db_xref="GeneID:59237703"
                     /translation="MSFKSLRLQGFLHLKHSHQQQKRQFVVASALTLGSLIFGRNAKL
                     ADAIDNGDLHNKNEDYELKRKETMENRIKSLQNSRPVAPRYEGHVPLYKAEKLLLTII
                     SGLKSYYHPEDGNNIVQLGEATAFPFFLENLKKTMLSDATGRKILRERPDITSETLHM
                     EDLAKMAENTLGYTYYKWLKKEGVSPDTRAPVTYIDDPTHAFIFKRYRQCHDFYHAIN
                     NLPIIIEGEISVKALEASNLGVPMAALGTILAPLRLRPAQRNRLYENYLPWAIKTGLT
                     CKPLINVYWEKILDKDINELRNELGITPPPDLREVRNERLKHNRELKMKYESFE"
     gene            complement(<872738..>874558)
                     /locus_tag="HG535_0F04580"
                     /db_xref="GeneID:59237704"
     mRNA            complement(<872738..>874558)
                     /locus_tag="HG535_0F04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289776.1"
                     /db_xref="GeneID:59237704"
     CDS             complement(872738..874558)
                     /locus_tag="HG535_0F04580"
                     /inference="similar to AA sequence:RefSeq:NP_013338.1"
                     /note="similar to Saccharomyces cerevisiae THI7 (YLR237W);
                     ancestral locus Anc_8.412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145671.1"
                     /db_xref="GeneID:59237704"
                     /translation="MGFKSVLSKSLSFLEIPVDQRGTLSVLKNPDLKPIPRAQQTWGF
                     WSNFAYWGVISFGVGTWASAASAADYGLSYAATIGTFIVGDVVTIMFTLANSYPGYDW
                     KVGYTMAQRFTFGIVGSWFGILIRVLMSVVNYASNAWLGGLCLNMILDSWSHHYLHLP
                     NTLTSHVAMDTRGVIGFMLFHVVCALFYLIKPYHLNYILIGSCTATCFSMLGMIIYLT
                     KQAHGVDELFTSLESTATGSTYSWAWVYLISYWFGSVSPGSVNQSDYSRFASSKTALW
                     LGTILALLIPTTLVPVFGVIGASTTYKLYGESMWMPSDIFNHWLTEDYSAGARAGAFF
                     CGVSFMMSQVAYTVSNAGFASGMDLAGLLPKYINIKRGALLCAVVSVACQPWNFYNNS
                     STFLTVMSSFGIVMTPIISVTICDNLVIRKRNYSVSQAYLLKGEYYFYKGVNWRAVFA
                     WVAGMTPGLPGIAWEVNNNYFHNTGIVNFYYGDSFFSFMISFFLYWILCVFFPIKMTI
                     DHDDKDYYDCFTDEIARSKGMVPYSEVSPEEVAMHDITNKLGCMDQISENTDTLNTVE
                     VNGDDDEGLKERKISNNSPQSSLSNYEQKEAHTQNVQETS"
     gene            <875710..>877749
                     /locus_tag="HG535_0F04590"
                     /db_xref="GeneID:59237705"
     mRNA            <875710..>877749
                     /locus_tag="HG535_0F04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289777.1"
                     /db_xref="GeneID:59237705"
     CDS             875710..877749
                     /locus_tag="HG535_0F04590"
                     /inference="similar to AA sequence:RefSeq:NP_010491.4"
                     /note="similar to Saccharomyces cerevisiae MSC2 (YDR205W);
                     ancestral locus Anc_8.413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145672.1"
                     /db_xref="GeneID:59237705"
                     /translation="MVMSEVSSLIPLLLSYPTIVLSSHLILPAPQDALISYCLLPFFI
                     ASSFTAVGFGIGVIDDSLVAGTLLLSFVTSQLGRVLGTVQTTSLSLLTIKLVYGRKGL
                     ASWRSVGKVFGPLFLISYAIGRSYAVVAGYVLLIGSATWVYPRVVGGGVVIPAKRAVK
                     FLPFVGFALLYGYGKYSQDDVQLLMMVVFFGCLAVFNLSLKDSFMQNDRFLNLSKTVV
                     IGSGAMAIVLQYLSFNTISSTFLADVLTLSFTAVCAVICVVQDRSNPDQHCHGHDHAD
                     HHGHEHGNEHEHEHEHEHEHEHSHACEDDHKHGPAHMHAGSSIIREIATDKDTRSIFS
                     YLMLNTTFMFVQLLYSFRSKSLGLLSDSLHMALDCTSLLLGLIAGVLSKRPPSDKFPF
                     GLKYLETLAGFTNGVLLLGIVCGIFVQAIERLLNPVNIHGTNELLVVATLGLVVNLFG
                     LFAFDHAGHSHGGDNENMRGIFLHILADTLGSVGVVISTLLIKWTHFHIFDPIASIFI
                     GTLVLLSAIPLLKSTSSSILLKLGDKKHNLVKSALNQISTTPGITGYTTPRFWVATPE
                     SSGHSHAHSHEEKNNDHEQDHGHQHSHSHSRSHSCTDTCKESHASKTPSLVGYIHIQY
                     ADGENSTIIKKRVEKIFSSVSINAWIQVEPNNSTCWCRSSSISGSNFFTPQSTIN"
     gene            complement(<877817..>879808)
                     /locus_tag="HG535_0F04600"
                     /db_xref="GeneID:59237706"
     mRNA            complement(<877817..>879808)
                     /locus_tag="HG535_0F04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289778.1"
                     /db_xref="GeneID:59237706"
     CDS             complement(877817..879808)
                     /locus_tag="HG535_0F04600"
                     /inference="similar to AA sequence:RefSeq:NP_013335.1"
                     /note="similar to Saccharomyces cerevisiae TOP3 (YLR234W);
                     ancestral locus Anc_8.414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145673.1"
                     /db_xref="GeneID:59237706"
                     /translation="MKVLCVAEKNSIAKAVSQILGGGRLNTRDSGYMYVKNYDFDFNG
                     FPFISNGSNCQVTMTSVAGHLTGIDFANDRYGWGKCNINELFDAPLDEVLDSNQRKIS
                     SNIKKEARNADFLMIWTDCDREGEYIGWEIFREANRGNSSLTQAVMYRAIFSHLERGH
                     ILHSARNPQRLDMRSVNAVSTRMEIDLRAGVTFTRLLTDTMRNKVMSANGAVRPSHHS
                     NNNNNNNNNNTREKKDAPIVISYGTCQFPTLGFVVDRFERIRNFISEEFWYIQLLLKD
                     GDINTTFQWQRGHLFDRHSVLTFYEVCIEKAGNIAKVNDLKSKPTSKYRPLPLTTVEL
                     QKNCARFLKLKAKESLDAAEKLYQKGFLSYPRTETDIFPQSMDLKSLVKKQAMLETSD
                     QNSRTSWAAYAEELLSDSPGTNKFTIPRSGTHDDKAHPPIHPVTSLGPQANISAVERR
                     VYEYVARHFLACCSADAKGQTTTLTIDWAEEIFTASGLIVLERNFLDVYPWAKWETTK
                     RLPRLEMNQECKIEKAEMRSGSTSPPNPMTESELIMLMDANGIGTDATIAEHIEKIQL
                     RKYIKSEKSGKETYLQPTTLGVALVHGFEAIGLEDSFAKPFQRREMEVDLKKICDGNK
                     TKNEVVVDIVAKYKKYWAKTDSSKSKLLEVYDNVLRSMS"
     gene            <881387..>884026
                     /locus_tag="HG535_0F04610"
                     /db_xref="GeneID:59237707"
     mRNA            <881387..>884026
                     /locus_tag="HG535_0F04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289779.1"
                     /db_xref="GeneID:59237707"
     CDS             881387..884026
                     /locus_tag="HG535_0F04610"
                     /inference="similar to AA sequence:RefSeq:NP_010492.3"
                     /note="similar to Saccharomyces cerevisiae EBS1 (YDR206W)
                     and EST1 (YLR233C); ancestral locus Anc_8.415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145674.1"
                     /db_xref="GeneID:59237707"
                     /translation="MTVTPSDAEKNVWDTISELHNQLNATIQSKQIIEDYALLSGFLT
                     FVDSKLSRMISESLQMQQAIYEDTVDREVSHSHVIRIDNESVPLILRLYWEKICHPIF
                     KWFQAWRAALLSKDSKEQRKHVEFRKMNSKLTKFFKSVHKFYYRIIDDLLSKYDTSAV
                     IAAEIIKQLCAGVEKEGEKKIVLDAKSNFTILIVVSLHSCLLNLGSAHRYKSIAEKFS
                     NHYVFQDFKKSMRYLDLACLILPSIGEAHLQKGLIYVQIERLGAAMYEFIRSSLARIP
                     NNAAQANFATIIAEKDSRLRKRLDILLKDINAQDLNSSRIVNREIIEYYFLAIFGSYF
                     APQCWLNSAKSKELQNGISLEYLKKTLKDKMSTRYLKNIDTIYEDLIVLIGGFDLLLL
                     SSDKGSKCIDIKTISLKTLKAKDHAYLEFAFSFVTDILKIVRESWEKNIEKYQYLAMV
                     RVVECWLKSNRAVLQYSHRNESFCRALAELLNDILRSQKVHLDSLMHRPKRSYYMEED
                     VDLKEMSTIKYALSDFNDDHIFSMGDCTDRSAGFPPPGEKLDAQAQSILRLQAIFVSG
                     KKFLAKNSCGVEWSNEDMVFKFPTRVKQVKRLKPDSWASVLSKKEPDSVTIAEQKSEH
                     DYMIAQLKQNVERGGTDVEVLSQGVYSGSSAPMPPTTFTIKPSSKLTADISKSSILNA
                     AIDVIEENSLSSTDLAKDAATIEQKLQIPNSPDVNDRQEILESAEHKAAYNEKSEHFK
                     SIFNSGAFDTVKASGFQEQTTLPSIAHPSAAHNIGFNPAMATTEQGVQTHSAQMWHPG
                     YGMSPMMNVPLVQTHHFANDSSIHGWISQYPQQVFNPQVQQHQQQHQQYPQQPYFLDY
                     HSASIHRNQNNVHESSVNKSHPI"
     gene            complement(<884136..>886478)
                     /locus_tag="HG535_0F04620"
                     /db_xref="GeneID:59237708"
     mRNA            complement(<884136..>886478)
                     /locus_tag="HG535_0F04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289780.1"
                     /db_xref="GeneID:59237708"
     CDS             complement(884136..886478)
                     /locus_tag="HG535_0F04620"
                     /inference="similar to AA sequence:RefSeq:NP_010493.1"
                     /note="similar to Saccharomyces cerevisiae UME6 (YDR207C);
                     ancestral locus Anc_8.416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145675.1"
                     /db_xref="GeneID:59237708"
                     /translation="MMSSADKAETKSSALGIDRDVSAVETRRQFDMRGEGDSVLKTAS
                     REEEMSSKGGSQVSNPLIQYRNTNSVDKSLSEMTKPTFVPNNTPVQSPLGSPQLEHSA
                     TQTTQILHTDTCSSATRDSLLRDSLTSTSSLPELRPPSVHFPQIRLRDVLRNDDNGGC
                     LPPKPENVAACVGEKDHVVSHIQHHSSGIVKNKDGTVSGSSSQQDNDNSPIAIINRRN
                     FFNTSDSRSSGSLQPLGASGSGNSQSLGENVKNTEQSSQGSERDVQVSELSGSPSRRG
                     SEQQKKRFGDRSSSSGQECGIAPTIFYFDKDRSVTDPYVKHDQANEKIRISSWINSKQ
                     NAQIYSLIENNGNSEKHEGDYENNKNANNPITCENNELSRNDRSGFSNNRRPYSSDGF
                     ISPQPPRSALSMSSSLGGGAELDLADSADSIIDTRRFGDVAIEGEDEKFIPPPPPKFI
                     NSKLDGLRTRLLVNPRANSNKFEDDIGTATAAAVLSNMRSTPLRFSDRSQMFSPNNNT
                     NSKATYNSSNTTSSSRPGSSSFSSVKNFPRPVIRVHQRESPLEDTDESAILDDNDDED
                     DDEEYGNEKGIELENDEEKAGLTNTKKNQKGDIKYINDVTNSSNVIKRQKLKTSIKEE
                     DVTKEVTWNKNGKRVTTRKLLESPNRRRRPRNRTNKAKESKDDNFHSDTGRDDEDSKE
                     EEEDEEYTAKTESQGCNKKNSMGSRSRTGCWICRLRKKKCTEERPHCFNCERLNLECN
                     YGSAKPDFILDPAKKQLKLEEIKKKTKEAKRNAMRKKPFR"
     gene            <886762..>888150
                     /locus_tag="HG535_0F04630"
                     /db_xref="GeneID:59237709"
     mRNA            <886762..>888150
                     /locus_tag="HG535_0F04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289781.1"
                     /db_xref="GeneID:59237709"
     CDS             886762..888150
                     /locus_tag="HG535_0F04630"
                     /inference="similar to AA sequence:RefSeq:NP_013332.1"
                     /note="similar to Saccharomyces cerevisiae BNA5 (YLR231C);
                     ancestral locus Anc_8.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145676.1"
                     /db_xref="GeneID:59237709"
                     /translation="MEEAIQLDQRYPGTLRDEFNIPTFQSMGLPYSDADDGNKSVYYL
                     CGNSLGLMPKNTRNAINAELDAWSERGVESHFRHPREEDGFASWVDIDLPAMPLLAPI
                     VGADIDEIAIMNSLTSNLNALCVAFYKPKGARNKILFEKSAFPSDYFALSNQCRIHDL
                     DPQETLIQLSPRPNETYLRTEDILQTISENKDNIAMVCLSGIQYYTGQFFDIEKITKY
                     AHQYPDIVVGWDLAHAVGNVPLKLHDWGVDFACWCSYKYLNSGPGGIGGLFVHSKHAN
                     DVTRPRLAGWWGNNASQRFRMVEIFNPIPGGLGFRQSNPSVIDVVALKSSLELFKRFG
                     GMNSIRDRSLYLTNYLLRLLKASRYYYDVDKVNPEVLGFMIITPVYNDQDHGAQLSLR
                     FYPHHQDNPEHDTMEQVFKYINTRGVIADERRPSVIRLAPAPLYNTFQDVYHAVKFLN
                     EAMDVLSTRTCS"
     gene            <888551..>890866
                     /locus_tag="HG535_0F04640"
                     /db_xref="GeneID:59237710"
     mRNA            <888551..>890866
                     /locus_tag="HG535_0F04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289782.1"
                     /db_xref="GeneID:59237710"
     CDS             888551..890866
                     /locus_tag="HG535_0F04640"
                     /inference="similar to AA sequence:RefSeq:NP_010494.1"
                     /note="similar to Saccharomyces cerevisiae MSS4 (YDR208W);
                     ancestral locus Anc_8.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145677.1"
                     /db_xref="GeneID:59237710"
                     /translation="MGYGISDPSTTLAVDVAVREGIYRHKGEHLQAQAKSRAHSQAQS
                     QERSQSQSQLESQSYSGKTRPEHTPNENKSRHKHNRSFQSSSNSESNTDSPRLSDGEC
                     SSSTPTSIDEGAMQQQKNLLVAKNNASVDIGTTGDDDKVNSDTGEDQTLSVSNKFQDL
                     AICPLDATVTAAEQVCTGDETPKVKEDALNENYQIVAKRRTKDLSIGVANEEATAEKK
                     NKTANEGLLDNNSLVQTDSYIQDLNDDHVLLNKRVSRISTKRTKTQESIRKSLPFHSS
                     KHAQILPIDQSDDDRPSRSRSHTSIVSLPATNTIHAQKYKARKHKTSSFSSLPPVTTH
                     PMTKNSELATVEIKQMKKSMLHKRDYRRKRKSFLMDDDRVLIGNKVSEGHVNFIIAYN
                     MLTGIRVAVSRCSGIMKPLTPKDFKFTKKLAFDYHGNELTPSSQYAFKFKDYSPEVFR
                     ELRAMFGLDPADYLVSLTSKYILSELNSPGKSGSFFYFSRDYKYIIKTIHHSEHLHLR
                     RHLLEYYQHIKKNPDTLLCQFYGLHRVKVPISFKNKIKHRKIYFLVMNNLFPPHLEIH
                     TSFDLKGSTWGRFTKVDSSNPEEQPVLKDLNWLDRDETIKFGPLKKKKFLEQLKMDVE
                     LLAKLNIMDYSLLLGIHDMKKDNADDLIALDTESNRNDHPISGDQMLHGSVIPHFFKQ
                     YEGGIRSSDPFNNDTELIYYVGIIDCLTNYSLLKKLETFWRGLHHDLKVVSAIPPKDY
                     GDRFYEFIADSVDALPPARYKDNPQIQNYKD"
     gene            892441..892576
                     /locus_tag="HG535_0Ftrna8I"
                     /db_xref="GeneID:59237904"
     tRNA            join(892441..892480,892540..892576)
                     /locus_tag="HG535_0Ftrna8I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUA"
                     /db_xref="GeneID:59237904"
     gene            <892833..>895040
                     /locus_tag="HG535_0F04650"
                     /db_xref="GeneID:59237711"
     mRNA            <892833..>895040
                     /locus_tag="HG535_0F04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289783.1"
                     /db_xref="GeneID:59237711"
     CDS             892833..895040
                     /locus_tag="HG535_0F04650"
                     /inference="similar to AA sequence:RefSeq:NP_010497.3"
                     /note="similar to Saccharomyces cerevisiae GCD6 (YDR211W);
                     ancestral locus Anc_8.420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145678.1"
                     /db_xref="GeneID:59237711"
                     /translation="MAGKKGKNSSKGSHGGPKADVVQDDRLQAIVLTDSFETRFMPLT
                     SEKPRCLLPLANVPLIEYTLEFLAKAGVNEVYLVCSSHASKIDEYIEDSKWNLPWSPF
                     KVTTLMSPEARSVGDAMRDLDNRGIITGDFILVSGDVVTNIEFDKVLEFHKRMHSKDK
                     DHIVTMCLAKASQFHKTRTFEPAAFILDQSNNRCLYYQDIPSSSSKAKTEVEIDSDLL
                     EDVDDFVIRNDLIDCRIDICSPLVPAVFQENFDYQMLRSDFIKGVLTSDLLSKHVYAY
                     VTEEYANRVVSWKTYDTITQDFIGRWCYPLVLDSNVLSDQTYSYESGHIYKERDIMLA
                     QSCKIGKNTAIGSKTKIGEGTTIENSVIGRNCQIGENIVIKNSYVWDNAVIGNNSIID
                     HCIVASNATLRDNVILNDGCIVGYNVFIDSNMEIPNGTKISGQPVKSMHAHEFGISDD
                     EEETIEEQAKNSRRIITSLAVNLVGPKGIGYVYDSDISDNDEDSSDSGEGANALSYRL
                     EEFYLSDDSISSKTFKSKKKRTMSTNSMYTDREENASELDEDEDFEVEGIETVKRAIE
                     NNHDLDTALLELNTLRMSMNVTYHEVRTATVIALLRRVYHFIATQTLAPKQAVTKVFG
                     QWGLLFRRQAFEHEEFLDLMNIIIHQTLAIGFEKPDLVLFSSLSTLYDNDILEEDIIY
                     EWWEQVSTDPAYNDINKLTAKWIEWLKQADEESSEEGDSEDGESETDEETDEE"
     gene            <895400..>895975
                     /locus_tag="HG535_0F04660"
                     /db_xref="GeneID:59237712"
     mRNA            <895400..>895975
                     /locus_tag="HG535_0F04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289784.1"
                     /db_xref="GeneID:59237712"
     CDS             895400..895975
                     /locus_tag="HG535_0F04660"
                     /inference="similar to AA sequence:RefSeq:NP_013330.1"
                     /note="similar to Saccharomyces cerevisiae CDC42
                     (YLR229C); ancestral locus Anc_8.421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145679.1"
                     /db_xref="GeneID:59237712"
                     /translation="MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTV
                     MIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVH
                     HHCPGVPCLIVGTQIDLRDDKVIIEKLQRQRLRPISSEQGERLARELRAVKYVECSAL
                     TQRGLKNVFDEAIVAALEPPVIKKSKKCTIL"
     gene            <896413..>898095
                     /locus_tag="HG535_0F04670"
                     /db_xref="GeneID:59237713"
     mRNA            <896413..>898095
                     /locus_tag="HG535_0F04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289785.1"
                     /db_xref="GeneID:59237713"
     CDS             896413..898095
                     /locus_tag="HG535_0F04670"
                     /inference="similar to AA sequence:RefSeq:NP_010498.1"
                     /note="similar to Saccharomyces cerevisiae TCP1 (YDR212W);
                     ancestral locus Anc_8.422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145680.1"
                     /db_xref="GeneID:59237713"
                     /translation="MAQVFNNSRSDTLFLGGEKVSGDDIRNQNVLAASAVANVVKSSL
                     GPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVV
                     IIAAELLKRANELVKNKIHPTTIITGFRVALREAIRFIDEVLSLNVDLLGKETLINIA
                     KTSMSSKIIGSDSDFFSSLVVDALLAVKTQNSKGELKYPVKAVNILKAHGKSAKESVL
                     VQGYALNCTVASQAMPKRIAGGNVKVACLDINLQKARMAMGVQINIEDPEQLEEIRNR
                     EYGMVLERVRKIIDSGAQVVLTTKGIDDLCLKEFVEAKIMAVRRCKKEDLRRIARATG
                     ATLVNSMSNLEGDETFESSYLGTCQEAIQTSFSDDECILIKGTSKHSSSSIVLRGPND
                     YSLDEMERSVHDSLSVVKRTLESGNVVPGGGCVETALNIYLDNFATSVGSREQLAISE
                     FAQALLVIPKTLAVNAAKDSSELIAKLRSYHAASQQAKLEDIKRRNYRNYGLDLIRGK
                     IVDEVQAGVLEPTISKVKSLKSALEACVAILRIDTMITVDPEPPKEDPHDHM"
     gene            <899031..>901616
                     /locus_tag="HG535_0F04680"
                     /db_xref="GeneID:59237714"
     mRNA            <899031..>901616
                     /locus_tag="HG535_0F04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289786.1"
                     /db_xref="GeneID:59237714"
     CDS             899031..901616
                     /locus_tag="HG535_0F04680"
                     /inference="similar to AA sequence:RefSeq:NP_010499.1"
                     /note="similar to Saccharomyces cerevisiae UPC2 (YDR213W)
                     and ECM22 (YLR228C); ancestral locus Anc_8.423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145681.1"
                     /db_xref="GeneID:59237714"
                     /translation="MNINNETKRVGKTSPASRKKEKVVELIEVDGKKVSKTSTGKRKF
                     HNKSKNGCDNCKRRRVKCDEGKPVCQRCLNMKLECVYTPVQPRRKKDFSKSKFETRHN
                     DERENTSNEGDDSMKSADESSDNRDAEYGKINSRHSSCSSCNHASAIKTEGHDESNSF
                     DPNNVKLNQSKSDINDLKNKSTLSKLGSPERRPSSLTPGKGVMDGLLLPNPIPEVING
                     HQNQQQHLQQQTQQQLQAQKLQQKQQQQQQQQQQQQQQQQQFLLLPQLMTLSNSEKYV
                     AFDLPNSPSFQPAGMNITNSIGSIFSPIRFPSATAVQHQPLSQPHSQPLSQSQSQSQS
                     QSQSQSQSHSSHQQPLPHSQQDILQQQNHTQSHTNGLLQNHIPTNNLSFQAESLAQLN
                     KASMNLKAMGSFPTAGIGGVTYDFQELLGIKYHANSQAAKASSAEEALANMQEQQENA
                     RKNEVRQDGNINHAEEGPSDMMQSPNLAGNPTILSMAPITPIAKNEMNTSGSSPSAAA
                     VAGRVDLEEPTTKSQGMNKTQTQESATTNDSSQNGMIAKLTQLSNQGSLNLVDLKLFH
                     HYCTKVWPSITAAEISGLEVWSTDIPELAFEYPFLMHSLLAFSATHLSRTEPGLEHYV
                     SSHRLDALRLLRQAVLEISEDNTDALVASALILIMDSLANASSSNSSSANSMSPSAWI
                     FHVKGAATILTAVWPLTEKSRFYNLISVDLSDLGDVINQESGTVSELVCFDESIADLY
                     PVEIDSPYLITLAYLDKLQREKNQSDFILRVFAFPALLDKTFLALLMTGDLGAMRIMR
                     SYYKLLRGFTTEMKDKVWFLEGVSQVLPQDVDEYSGGGGMHMMLDFLGGGLPSMTTTN
                     LSDFM"
     gene            <901861..>902913
                     /locus_tag="HG535_0F04690"
                     /db_xref="GeneID:59237715"
     mRNA            <901861..>902913
                     /locus_tag="HG535_0F04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289787.1"
                     /db_xref="GeneID:59237715"
     CDS             901861..902913
                     /locus_tag="HG535_0F04690"
                     /inference="similar to AA sequence:RefSeq:NP_010500.3"
                     /note="similar to Saccharomyces cerevisiae AHA1 (YDR214W);
                     ancestral locus Anc_8.424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145682.1"
                     /db_xref="GeneID:59237715"
                     /translation="MVVHNPNNWHWVDKNCFSWAREHFNQKLIGLNTGDNRDKYAEVS
                     SISSIEGDCEVSQRKGKVISLFDLQLVLLIKGNVEEEKFEGSVSIPEIAFDSEEADYQ
                     FDISIYKETSKLNEIKPVIREKLVPQLRKIFHNFSKELLDTHGSAIQLPEDQVNSTFT
                     KANQKPSSSTTSTNATTKQNEVKSNVTSSKPKNAKSVKSPQPSIATSGGNTTSIHLEP
                     TFNVPAEELYRTFIAKDRILAWSKSGINCIKGNGPEISVGDMFELFGGNVTSELVESV
                     LNKKLVFKWRLKDWRDKVFSNLSMEFHESKEYHETKLQVTWTGIPVGEEDRVRGNFED
                     YYVRSIKITFGFGAVL"
     gene            complement(<903104..>904933)
                     /locus_tag="HG535_0F04700"
                     /db_xref="GeneID:59237716"
     mRNA            complement(<903104..>904933)
                     /locus_tag="HG535_0F04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289788.1"
                     /db_xref="GeneID:59237716"
     CDS             complement(903104..904933)
                     /locus_tag="HG535_0F04700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145683.1"
                     /db_xref="GeneID:59237716"
                     /translation="MADKLTEKLVDMTKKPFAKHHGHGSKKNTAATRSSVAVRHDGGE
                     DEDANPVAFPAGDTDDADPKSKVPEKETKSSSSKDSALKVNSLKDNSLKTDSVDNSKP
                     RRKSFLENDKIENFTPATRKKRVSSLSLSDQWINGTAPMTPLDANAERNGSISSSSTK
                     FSSRKNSVLVRERKKTIEHERVASYAFAFDIDGVLIRGPETIPQAPKALRMLNGENKY
                     NIKVPYIFITNGGGRSEKARCKDLSKRLKITVTEDQVIQGHTPMKDLVPVYKNVLVVG
                     GVLDSCRKVAEDYGFKNVYIPLDIMKWNPSVTPYYQLNDEEKAIAKDVDFSKVNIDAI
                     LVFADSRNWAADQQIILELLLSENGIMGTICPTADSGPGLYFAHSDFVWATDYGLNRY
                     GMGALQVSIAALYQEHTGKELEVTRFGKPQRGTFRFAEKVLSNWRRETLSEHVEQLKL
                     ERTDSSNTSHDHDESLFTESETDAFDDEDDDDDDVNDDNDSTTQINDPFSEKGLDLSK
                     GSKIILELPPASTVYFVGDTPESDIRFANSHDSSWYSILVKTGVYQDGATPRYTPKKI
                     CENVLEAVEFAIEREHKKELEEWNKSATVDTPVVEERREVTRV"
     gene            <906616..>911124
                     /locus_tag="HG535_0F04710"
                     /db_xref="GeneID:59237717"
     mRNA            <906616..>911124
                     /locus_tag="HG535_0F04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289789.1"
                     /db_xref="GeneID:59237717"
     CDS             906616..911124
                     /locus_tag="HG535_0F04710"
                     /inference="similar to AA sequence:RefSeq:NP_010502.3"
                     /note="similar to Saccharomyces cerevisiae ADR1 (YDR216W);
                     ancestral locus Anc_8.425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145684.1"
                     /db_xref="GeneID:59237717"
                     /translation="MTITEHKPRDVPKQDVKQADAYVVQKSAEGGGIVTTSNNMNSRI
                     NKQLDQLPENLRFNGKTPSGRPRLFVCEVCTRAFARQEHLTRHERSHTKEKPYCCGIC
                     NRKFSRRDLLLRHAHKIHGGNCGDNILIRKNEKTQARASRGTEAATPITTTTRITASP
                     TNPTTAPTPTPRLNQVQVQTQPPMKNRIRPGHEISDKPVKKRKLSASAISNTIENSVP
                     PPKLGKTSRFKVKRRVSYSAQSGSYVAPTQNQDIHKADRLKFSTPELLPIDFKDFNRD
                     GSYFNTIGDKKAKIQVNNFDISSNTNTTVDEDSNIVFSSAIPNLQLNTPNEFNLLDQV
                     NWINDYNENSAAFSSNTETALTVKSESTGTNNSPYSLSNSDNNINNINNSNNSNSSNN
                     SSSGNNDNNDNNNSNEDNEDNEDNEDNDNKDNIDNNDNNDHIGNDNDNDHNYKYNDHD
                     DKAEISQFNHCDNDNDSIIEVNKIHPLSSTNNARNRNSSWSVNCDDGGLQMKSLFMSG
                     KSSSYSSADSGSNNNKSAIKKKSTNVASIFPNENKNSDWFHISTGDINDQNQADFNTD
                     VEMNDLTNLTNDVQSIFNKFIQDEETHLYDETVPEDPLIGNMANNVSAQNECLNSSPS
                     LKQSTANANQNVLSNTRTKTGTHTLNNNYSFYGIDYLSLSNISRATPPNEFEVKDLPS
                     SILFSKELREMCLKSLRYYNSYYTSNGNNDPILNSKELVLPSSNELNCYVSYFQEYFN
                     AHHSFIHPDFFHLDLKSLKRYVREEEEDVEYRDFNDSKIDDQYNNDSDLQFSNLVCLP
                     LFIATFGSLYKSGCNSKTMELYESSRRVLHVYLERRKEQKLKENESGRSTNSNSKVKQ
                     KVWLIQSLILSVIFALFSDYSEEFDTGMIKRQVSAVCSIVRNNFLNEISYTFLEQTSP
                     GSNDRKDFDIPVKFSNFNSSFDYIMFESKIRTSLMAYKFCQFLKIFYHVDSTLFLCER
                     DLENICISDDEFTWSKASLIVPMSSVIKKYTSSFKIFCNSFNFNKSGMHPIPESLATA
                     MLYYEFNASTYSTFHVFLTRIDTKKLEMNLSCSQSQSEFSNNNNYETNYSRILNGDAV
                     KLRNFLMTMVFFGRIDVNFGSKIWNGQLKDVHEYFLSSKNFNIMKKGSYNLLTDFLVA
                     INFSIKNIAKLLTLNDNGTVAELNKNVLSMFNLQGYYYNFLVIIKFINDFESTPNFKL
                     VCIYTELKKLANNLLIPYFSKLYPDEFAKFEDVSLTSEFLQRHVKSNLRTCFFTIDTD
                     KLEKSINNVLVYSFNDATFLNMAEQPTNEFSFDNKYPTYCPAVLSNELGSESSLNGVH
                     TFYSQNQKPSWFDAKSGANNELHQESNESTHGNNANDESKGDDLLPTKSTLDLLLYHS
                     NNLNGGSKKQGFSDRYHLLDKYISIAICFLKNVKEEYAHSHILDKMVNDFKRLEKCLE
                     DERAHEVLSKLEVSGDVSGGADMDSDFHRFTSDNLSAVKMNSCLSINATDDAFSKELQ
                     MKFLQPKV"
     gene            complement(<911411..>915037)
                     /locus_tag="HG535_0F04720"
                     /db_xref="GeneID:59237718"
     mRNA            complement(<911411..>915037)
                     /locus_tag="HG535_0F04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289790.1"
                     /db_xref="GeneID:59237718"
     CDS             complement(911411..915037)
                     /locus_tag="HG535_0F04720"
                     /inference="similar to AA sequence:RefSeq:NP_010503.1"
                     /note="similar to Saccharomyces cerevisiae RAD9 (YDR217C);
                     ancestral locus Anc_8.426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145685.1"
                     /db_xref="GeneID:59237718"
                     /translation="MLLKQRNQKKKCILNLNKEGSLMSDGIQLTDEAYGDEQDMGRTR
                     VASPERVKDNPLIPNDRANFNGELRHKPEKLQERSLPAKIAAQISLSQGETVDYDRTP
                     PLGSPTETAKDKEVRYNTRTPNLDKIAKFFKNRPSASKENLLKKFEASHLEDTPESQR
                     KWNPPRYPINARKVSSTELISNAEAMIEPPFFEANDSEERFSVTGPFNEEPNMKPCKA
                     DASKQDNTETIAQPLVKGIDCTVFDGNDHVISNASPLNERYEVSQKEKHPVIHLERGC
                     ERQVSGDSKSAGPTERRLYHQRELLNYSSDRELVRDSGREETGRKELTDSQRIFSQTH
                     TTGAQPEYLSYSERLLDDPNDSKCHDQSVNSTRVDDTTADLIPSPWILHPIEGGIFNS
                     NKSTQIVNTGGTQHISSQSAVSLDTSGMNKRFDLEPLKYGEETQIIASYISQAMPSPN
                     ANGSTQRENELMCSTQIIKSQDNATPHDLNTPPNLTRIIFEPIMEVPETSSPTKSKDD
                     KMINFSPSSAPDALNNESYNVNDNLDNQDKVHLKILSKIENLSDQERNSTTPPDDKRN
                     FDVVISETEYTQDLPEVEEVEGTQEIEVSNFDSWDALSTTGTEDASTDSLLKRPHGES
                     LRPTFNNEHNRSLSRKKVRKIANSGGKTSRQLSDHFLKDFSYSNNQNGSDMEVSNHRS
                     IHDQETVMTFPKEVLREEKDFLSKSDIKFEDAVWCQYSLDYNYYPGRIVSSDVNSDKS
                     WVYFDTGTSLTKNDDIYYLDIRIGDVVDIKSRKYIVIGLECISHEPGTIRCIRGFDTV
                     HLKKKNNSGKLAKKIIVRRLAEVTIDLKEWTKRPKVILQQGSQARTMAHGDLQHPIRG
                     RKNTLKLSPRKFKSNVCSDDHPIYKEESDADDTQDVELTSALKPNGKTKSSLFSQSCR
                     DQIEGRIFEGCLFVFTGFSEEREELTEVVTSLGGEVLDGGFSSIFKIGSPVQDAASKQ
                     LKYDLQIHLENSMKYSQYKFACLLTTQHSRSLKYLETLALRWPTLHWKFVRHCIGRNT
                     LALDAIHQYLLPSGESYRLSISSSRGGGVIKSSDIFHFHENLILGKRLNEQIRGLQTV
                     MQKFIVVVYGRSELDSFVKFAFCCLGVSTLYQVSEQGNALEISDHFTRRFDHIARKTN
                     ENSQILIYMNDNGGKSNSFLNDLRRKLSISVGYLRNDISTIHVETKEWLIQTIINENT
                     GYFN"
     gene            <915155..>916686
                     /locus_tag="HG535_0F04730"
                     /db_xref="GeneID:59237719"
     mRNA            join(<915155..915167,915251..>916686)
                     /locus_tag="HG535_0F04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289791.1"
                     /db_xref="GeneID:59237719"
     CDS             join(915155..915167,915251..916686)
                     /locus_tag="HG535_0F04730"
                     /inference="similar to AA sequence:RefSeq:NP_013328.1"
                     /note="similar to Saccharomyces cerevisiae ADY4 (YLR227C);
                     ancestral locus Anc_8.427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145686.1"
                     /db_xref="GeneID:59237719"
                     /translation="MIDNDDTELLLKNSEYFNLIKHFELEVGLLTNQFKISYIYQEQL
                     YQGILNLMCCFCPLKLWKPLLDRETSNFSRLQIERLLFKQLIKYPELDFDMDAKFLAK
                     SLAKTQAVSEKVSIAHKISFMVRSKGILSFMLYFDGRNMESFEGFRWCLQLLYHIERY
                     AIDIQDIRSLLEDCQRIFSILCAKSLINRIIERGQFFPNEQSLLSKSNEGDVLQGLLF
                     TIMECTEPSMIISETQLELFVLSKFFEVLGDIESCMAVLNGFLIECIYNDGPYNLALR
                     LQRSSLNEMIRKYIFGTTMTVEGDPTVMHQSGKIIEAIILYGGIHIDILRFFHAVYGF
                     YRSSFMDAVDYIPESVLTRECISMVDNIIKEWDGITSQCDPKTVQLPQVLLRTTEGSI
                     VMVEEVLEESLNEHRHEITSLLSSIKLRTKRRLLGETQVQNNYSIYLRKLGVDWVTLW
                     EQSYLDNNDDLPADLLQLASDIKQWSFGFPIS"
     gene            complement(<916766..>917962)
                     /locus_tag="HG535_0F04740"
                     /db_xref="GeneID:59237720"
     mRNA            complement(<916766..>917962)
                     /locus_tag="HG535_0F04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289792.1"
                     /db_xref="GeneID:59237720"
     CDS             complement(916766..917962)
                     /locus_tag="HG535_0F04740"
                     /inference="similar to AA sequence:RefSeq:NP_010504.1"
                     /note="similar to Saccharomyces cerevisiae SPR28
                     (YDR218C); ancestral locus Anc_8.428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145687.1"
                     /db_xref="GeneID:59237720"
                     /translation="MIGSIMKGYRTLNVDEIRKRRNAKKATRLCILLIGESGTGKATF
                     LDNLCGKKIFPTGNDVKASETSYHSLRKTKITVISEKVQLEDNAFSPVVLDIVLFPGC
                     GDHINNSKTPEQIAGYLEAQFSSILSEEVRIKRNLGNRDNRPHVCLYFLTANSRGLRE
                     LDIRLMQELGKRTNLLPVISKADLLTEEELKNNKKLIMRDLSAHKINFFDFKDDTVED
                     NLMEIDHNSSIRKNTEFPSAMYIRDIMPFSIICSEDKTASGSGPTQHIRKHPGGNIIV
                     EDPKNSDFIFLKGILLGSHLEVFKDYTNEVFYESYRTSALTEQQNCMDGIFMSAQKET
                     MDRPVSISNSTRRNAFSVSGDFPKQSPAEVPLKCDGLEEKNNMIAAYRKKIELLEKRL
                     KDGTDI"
     gene            complement(<918167..>919426)
                     /locus_tag="HG535_0F04750"
                     /db_xref="GeneID:59237721"
     mRNA            complement(<918167..>919426)
                     /locus_tag="HG535_0F04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289793.1"
                     /db_xref="GeneID:59237721"
     CDS             complement(918167..919426)
                     /locus_tag="HG535_0F04750"
                     /inference="similar to AA sequence:RefSeq:NP_013327.1"
                     /note="similar to Saccharomyces cerevisiae BUR2 (YLR226W);
                     ancestral locus Anc_8.429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145688.1"
                     /db_xref="GeneID:59237721"
                     /translation="MDVDQTGKQVGTNGNADVSKLEKSTKTPGTLDEIILESRQMSGT
                     PPQGNKAEFKPRILWPDVIKTPVNPWIFSCKEIIEKLGMDPQQTTEMKRSMEKCLIYF
                     YTLKKKLNLFDHTYTASCILFFRYWFIYGLPSSIPECIHISQAILVTACKTMENNRPI
                     DAYVKATCEFLTKDLTTLKSKQNMDKLKWDVRDKLVSNEKRILCSFGFDLNIENPKEL
                     IEEMFSGYYRFNRDFDLPEEFKTVFPKILQEARNFIVQAVTQPVSLLCDGYSFVALSL
                     IYCGLQYQKLIDKTFKYPKNFFRDKFPVAVTSKQYEEIFTDYRLIEENFFDLKSNKRE
                     KLQISAEEIKNLIEEDINETEEITAALNNPYDYEHIKTGEVRQELLDHISKRIKELYE
                     KTVNDTKKRSLADPQTNSDQLNKKSKV"
     gene            complement(<919848..>921236)
                     /locus_tag="HG535_0F04760"
                     /db_xref="GeneID:59237722"
     mRNA            complement(<919848..>921236)
                     /locus_tag="HG535_0F04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289794.1"
                     /db_xref="GeneID:59237722"
     CDS             complement(919848..921236)
                     /locus_tag="HG535_0F04760"
                     /inference="similar to AA sequence:RefSeq:NP_010505.3"
                     /note="similar to Saccharomyces cerevisiae MFB1 (YDR219C);
                     ancestral locus Anc_8.430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145689.1"
                     /db_xref="GeneID:59237722"
                     /translation="MNSNRCANESPHGLTDLPLNVIFRILSFLDLKQLQSIAKCCRLL
                     RVLANENFFLTNTLMNLHSRRDQWTRRLIFDVFDIFNGSRHVILRLTTAYNISLLESI
                     RIVQKNYGLGYSKWRSSPGTSYSKSLSKDVLEGSGEIQTSNIESGDAASCNTTFMENR
                     NCIIEREAMTYMEILQGFHRLCASSQDDIIESKRVNEETWDDSEHEISLEENLSVNDQ
                     DVDSDIGTPTQKDKKTFDTTSKQPRTLSPTSSDYSKSSSNSIFSELPPKLSTCGWHSS
                     IYELEHVSDELNSGNSDENTSSSSESIVKLRNSNKVKDKAALFEKLISNDYAMSGNQK
                     KLKKKKSYGVLTSAGHNNMLSSLSNTFSSSKRNISKGYLEELERCNLIIAGIPTSRNE
                     LEDMVMSNHTSRLNRNEVVPSRSNETELRLQSNMGDREIRESSRLKSRKLQRSKLNAF
                     VTGDNKICYEKL"
     gene            <921897..>923909
                     /locus_tag="HG535_0F04770"
                     /db_xref="GeneID:59237723"
     mRNA            <921897..>923909
                     /locus_tag="HG535_0F04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289795.1"
                     /db_xref="GeneID:59237723"
     CDS             921897..923909
                     /locus_tag="HG535_0F04770"
                     /inference="similar to AA sequence:RefSeq:NP_010507.3"
                     /note="similar to Saccharomyces cerevisiae GTB1 (YDR221W);
                     ancestral locus Anc_8.431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145690.1"
                     /db_xref="GeneID:59237723"
                     /translation="MLYRTLCNSWLLITIAAVLAENSDLAADNSDLRIHGVPPEKQYL
                     YQPIEGTGGKWACLNDPQKLIDISRINDGICDCTDGSDEPGTGSCGDKGPSFYCANEG
                     FLPRYISQSMVNDGVCDCCDCSDELLSPVKPFSHKTDCITLSSSFDKLVQEELREYKD
                     GLGALEKMQTKESIEDSKIVTENLFEEIAVLERDLQANELKLNSTKDKYKEQLKNNNP
                     LYYEFQRLNEDYISHVINASFIKIIGMSEAYEELIQILNNLKDSYTKSLNDRVVNSNV
                     KKYNFMKNQQLKKLSIDSKVEEDQRQELMNFFSEELPATFMEGKIDQPPTYLRGKMIF
                     VDVLITGRTEYTSTVLDAIRKLSELLNDISENYNVNYQDAAVKKSVELYANWLGNHAS
                     LEEVQLPEKFTSQFTELKQFVEANSVHILTSGSLEKNSLDAKNIGNHLRFLLSKIKQF
                     FKQDLRHQIETCEEINTQLREQLEEKKSKFASLRETRYGNRNAYIQRLISTGAIECIQ
                     GSLSGYLYEICLNQEVSQRELAPPHRAVTIGKFQHIQFDDEQTRKEKYMEHLRIKYPD
                     QMDLMTELVSEKNNIPEYIFGNLHDMSNGLAIRFEDGSKCWNGPKRSATVFVACGSTV
                     EIINVYETSRCNYGIEVKSPIGCNPHFNGFSETFSEPSSHPVVATD"
     gene            <924458..>925654
                     /locus_tag="HG535_0F04780"
                     /db_xref="GeneID:59237724"
     mRNA            <924458..>925654
                     /locus_tag="HG535_0F04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289796.1"
                     /db_xref="GeneID:59237724"
     CDS             924458..925654
                     /locus_tag="HG535_0F04780"
                     /inference="similar to AA sequence:RefSeq:NP_010508.1"
                     /note="similar to Saccharomyces cerevisiae YDR222W and
                     YLR225C; ancestral locus Anc_8.432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145691.1"
                     /db_xref="GeneID:59237724"
                     /translation="MLGKKDKIKFAPVQEVKSEKDYSIVNDIEQLEWYVKSKSKSAGR
                     SHSFMKAVKKSVETNIETQTVYFTDLASGRCGFIQVLYSSVMGGIYKGFQLNFKIFRS
                     RDVGKDEENIDIWESFKLGDIQEFEGLKFVSPELNFEFIPASHDDEVIATLKIDVNMP
                     QNGSDKPSLKIDLMIDLYQGFTINPNGCNYYLEKGISKEELKQRKFQSKRVLRHLFVP
                     RVKCHGSIEYKSKAGATVILDLIGVPGSYIDAVQGLPPNKAARAWNFLCYQDAKRSLI
                     CMEFTTTEEYNATTVTIWCSTNDHKIETVGSSINNVPVKFGATRKDDLNGWSYPTGIN
                     FPLDFSEDKLRLVNRYDIMGELPYIVKSLAENVAKIKPFIYQYCQDSNYKDGKGISIV
                     ESTFIS"
     gene            complement(<925699..>926727)
                     /locus_tag="HG535_0F04790"
                     /db_xref="GeneID:59237725"
     mRNA            complement(<925699..>926727)
                     /locus_tag="HG535_0F04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289797.1"
                     /db_xref="GeneID:59237725"
     CDS             complement(925699..926727)
                     /locus_tag="HG535_0F04790"
                     /inference="similar to AA sequence:RefSeq:NP_013325.1"
                     /note="similar to Saccharomyces cerevisiae YLR224W;
                     ancestral locus Anc_8.433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145692.1"
                     /db_xref="GeneID:59237725"
                     /translation="MLSVTDLPVEILLEIVGECPTSKGVSRQFYRLNNELYREKTLGL
                     LRSTTSLEDCNRFWECCEDDIRNYMKSLNFLRKDARKIVSTSLPFIEDSWQLIFNILN
                     CTLNCMNISNLTRSLDSLDYHRPIFVGRSTFPYSSNDTKIPINGWFHIRSLEGTFRLA
                     TLVTEIRISPYDKYRTISMPTNIRDFIKEPGIYCFNMGNVPKFELSDAAVKPLLVPFE
                     IRLVERAMTPPTYFEHSDLIFLGYDFVSYERNKPWIFFHIDEEYKDAIFNPLETSLSK
                     SLVKFTKKFRNSDTNQKNISVKPNIEPYFDLDSRPTRYFNWKYPKDRSDFYREKMLPD
                     WRAPHLQF"
     gene            <927327..>930413
                     /locus_tag="HG535_0F04800"
                     /db_xref="GeneID:59237726"
     mRNA            <927327..>930413
                     /locus_tag="HG535_0F04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289798.1"
                     /db_xref="GeneID:59237726"
     CDS             927327..930413
                     /locus_tag="HG535_0F04800"
                     /inference="similar to AA sequence:RefSeq:NP_010509.1"
                     /note="similar to Saccharomyces cerevisiae CRF1 (YDR223W)
                     and IFH1 (YLR223C); ancestral locus Anc_8.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145693.1"
                     /db_xref="GeneID:59237726"
                     /translation="MVATKMPRKNLGSYEDRKVGQKLPVNTAKLKKKAQIASEAPIIS
                     NRPRRFSLIYSSDSSLTDVPEEGNRRVDLGVSAANRRHGKVKSISNNATGKRSKLIHQ
                     SSNSDNESTDSSNYQAVASDNNNDYGVDEGDENSSDSDSESDSDSDSGSDSDSELTSS
                     DDETIDFVKLTAQRKKRAMKALSALKRSKSPTKSAVNDEKRIGKNKENRVSTQVQDST
                     SDPASESDYDSNQNSGSSSDNEGSGVDNNGALAFNFRKDDDGIRYGRVSNQGSEEDIG
                     EEVKESNEIQVSALENDNLNRFNVPEFSASEESEYDIDQDAYFNVIDDENISLNEMDT
                     GLETGEDELPLLQEEEKNLVSQLQDDDELSFDGSIHESGSDPAERSRNENKNKDEEYD
                     DEDEEMTIFDMPFYEDPKFASLYYCEDGNEPRLSLSTSLPLLITDEKRLKLKRREAKK
                     IERKELMERRRNLKQGKNKGLKVDVGEYIFGVFFQDENEDDDHDHDGRSREGKRRVEF
                     NKNLDLESPLRRLGSAAASDASSDDEYENILLDIAHLPSEDDDYMDEEKKEDLKDSSG
                     SVVKVEEIERKDYVPGDSEIDMDADEGYDDDDDDDDDMTDTNVFIDIDDLDPDSFYFQ
                     ALDDENSSSFSETTSDDTDLDDKKISKDEVTETIVYVDDESTDEDDNLPSPSAQSKAI
                     GSKAKEVVSANIVGLRPPKLGTWETDSKPFTIIDGLSTKSLYPLIQEHQQFLEQQRAQ
                     SQSPDAHSMPDLSPANGDELTLNELLNMSELEDEESAAPSYSKAVSDWYKKPTVPLSA
                     FRNKGVNSMEEDEYMLPANSTRKVPIGYIGTERTRRKIDKMKELQRKKSEKRRKLKKR
                     KKLLKLKRERERMDKENSLLSEKTPELDAGALIDTLHPFSEIESQTDNFKKYSIPASE
                     RKNSAKSVGLEEINEILGKDNSDLSCVYDIPATGADLIGISDADIVTSLTAPIQLTDF
                     ESGSSWRRRQSMVEAAAENLRFTKNGLFSESALADIEGIIGNGPTSGAFEFNEALQ"
     gene            <930765..>933191
                     /locus_tag="HG535_0F04810"
                     /db_xref="GeneID:59237727"
     mRNA            <930765..>933191
                     /locus_tag="HG535_0F04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289799.1"
                     /db_xref="GeneID:59237727"
     CDS             930765..933191
                     /locus_tag="HG535_0F04810"
                     /inference="similar to AA sequence:RefSeq:NP_013323.1"
                     /note="similar to Saccharomyces cerevisiae UTP13
                     (YLR222C); ancestral locus Anc_8.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145694.1"
                     /db_xref="GeneID:59237727"
                     /translation="MDLKTSYNGTPLNPIYAGSGAIATISKDGDILACPMLDEINVIQ
                     LLPTRKILHTIENDDEQEITALKLTADGRYLCFVSQAQLLKIFDLSTGKILKSMKISS
                     PAYILDTDSTSTLVAVGGTDGSVTVVDIENGYITHSLKGHGGTISSLKFYGERNNSKW
                     LLASGDTNGTVKVWDLVKRKCLHTTQEHTTAVRGMDFRSTDDEDTLQMITGGRDDIIN
                     YWELNMKKKCKLLKTIAVHQQVESCGFVNSPERNLIYTAGGDAVFQIVSLQNEGIIKK
                     TRKPIEELFIVGVLPILNDQQLYLVLSDQTLLLLDMQRALSSGEEIMKIESRIAGNHG
                     TVADIRAVGPDLDKLALATNSPALRMISMPRDSNDTLCIDAEIYEGHADLLNSLDATE
                     DGLWLATGSKDNSAILWHYEVATCKFIAYAKFEGHASSVTAVGLPNVVTKGWPEFIIT
                     ASNDLTIKKWIVPKPTGGKTASLQTVNVSDYTFRAHEKDINALAISPNDSLFATASYD
                     KTCKIWNLDSGELKATLANHKRGLWDVTFCQYDKFLATCSGDKTIKIWNLDTFAVVKS
                     LEGHTNAVQRCSFMNKQRQLVSSGADGLVKIWDCSTGDCLKTLDGHGNRIWALTVLED
                     GDLIVTADADGVFQFWRDSTEEQKELDVEKEKLKVEQEQSLQNYLADGDWTNAFLLAI
                     TLDHPMRLFSVLKKSISIRDSETDSTVVFNKELDHTISTLNSDQLLLLMKRCRDWNTN
                     ARTHSVAQKTIKCILLQHNIADLSEIPGLVRIVESIIPYTKRHVSRIDNLVEQSYILD
                     YSLVEMENLF"
     gene            <933427..>934026
                     /locus_tag="HG535_0F04820"
                     /db_xref="GeneID:59237728"
     mRNA            <933427..>934026
                     /locus_tag="HG535_0F04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289800.1"
                     /db_xref="GeneID:59237728"
     CDS             933427..934026
                     /locus_tag="HG535_0F04820"
                     /inference="similar to AA sequence:RefSeq:NP_013322.1"
                     /note="similar to Saccharomyces cerevisiae RSA3 (YLR221C);
                     ancestral locus Anc_8.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145695.1"
                     /db_xref="GeneID:59237728"
                     /translation="MSKSELRAVDNTAKKSRRKKKRRTLDVSDSSSSESDSEIETKPD
                     QRQEAIEVDNDIELTDDESNNFTEKGPDKISGAEQWKDETRDELNSIPFTKTDLTNKN
                     DFNQKSNSNENGVQDSLDLKKVRETIEEDQKKMKKIGEANLKNDYLGLIFENYGEDIN
                     SLREAPDFTNKSLVILANVLKEGSAMFDVETLKTMLDTK"
     gene            complement(<934158..>935114)
                     /locus_tag="HG535_0F04830"
                     /db_xref="GeneID:59237729"
     mRNA            complement(<934158..>935114)
                     /locus_tag="HG535_0F04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289801.1"
                     /db_xref="GeneID:59237729"
     CDS             complement(934158..935114)
                     /locus_tag="HG535_0F04830"
                     /inference="similar to AA sequence:RefSeq:NP_013321.1"
                     /note="similar to Saccharomyces cerevisiae CCC1 (YLR220W);
                     ancestral locus Anc_8.437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145696.1"
                     /db_xref="GeneID:59237729"
                     /translation="MSVVALKNAMVNFMRFGRSGSENEGTAPLLTSDSQSITSQVGYG
                     TTATNSNIDLESARARRASNSSGKLNLSMDKDTQSSDSQTHRGFFNSVDPRVISDLVI
                     GLSDGLTVPFALTAGLSSLGDSKLVITGGFAELISGAISMGLGGYLGAKSEGDYYHSE
                     VKQEKRKFYDNTTMINHEIEDILLDINPNFSDETIVSFIKDLQRTPELMVDFIIRYGR
                     GLDEPAENREIISAVTIGGGYLFGGLVPLLPYFFVDEVGAGLLWSTVVMTITLFWFGF
                     VKTQVSMSDNCTLSKKIGEGVQMVLVGGVAAGAAFYFVKILG"
     gene            complement(<936176..>936574)
                     /locus_tag="HG535_0F04840"
                     /db_xref="GeneID:59237730"
     mRNA            complement(<936176..>936574)
                     /locus_tag="HG535_0F04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289802.1"
                     /db_xref="GeneID:59237730"
     CDS             complement(936176..936574)
                     /locus_tag="HG535_0F04840"
                     /inference="similar to AA sequence:RefSeq:NP_010510.3"
                     /note="similar to Saccharomyces cerevisiae HTB1 (YDR224C);
                     ancestral locus Anc_8.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145697.1"
                     /db_xref="GeneID:59237730"
                     /translation="MSGKAEKKPASKAPAEKKPAAKKTASAPDAKKRGKVRKETYSSY
                     IYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAV
                     RLILPGELAKHAVSEGTRAVTKYSSAASQA"
     gene            <937385..>937780
                     /locus_tag="HG535_0F04850"
                     /db_xref="GeneID:59237731"
     mRNA            <937385..>937780
                     /locus_tag="HG535_0F04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289803.1"
                     /db_xref="GeneID:59237731"
     CDS             937385..937780
                     /locus_tag="HG535_0F04850"
                     /inference="similar to AA sequence:RefSeq:NP_010511.3"
                     /note="similar to Saccharomyces cerevisiae HTA1 (YDR225W);
                     ancestral locus Anc_8.439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145698.1"
                     /db_xref="GeneID:59237731"
                     /translation="MSGKGGKAGSAAKATQSRSAKAGLTFPVGRVHRLLRKGNYAQRI
                     GSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVT
                     IAQGGVLPNIHQNLLPKKSAKTTKASQEL"
     gene            complement(<938006..>939994)
                     /locus_tag="HG535_0F04860"
                     /db_xref="GeneID:59237732"
     mRNA            complement(<938006..>939994)
                     /locus_tag="HG535_0F04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289804.1"
                     /db_xref="GeneID:59237732"
     CDS             complement(938006..939994)
                     /locus_tag="HG535_0F04860"
                     /inference="similar to AA sequence:RefSeq:NP_013320.1"
                     /note="similar to Saccharomyces cerevisiae MSC3 (YLR219W);
                     ancestral locus Anc_8.440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145699.1"
                     /db_xref="GeneID:59237732"
                     /translation="MVFGLTKKEHRVPDLSRYDYYYRDKQNGERNPQLSAAAAYAAST
                     GLATHGATGRSQQPGRAQSMTHSAGYQSAQYKNRVPDRVLSVGAMNSSRNSGVVPNYR
                     TYSLRSQSSGQPGQGRTSSIASSNKYNRRNLPVSVNSNPSNGSRANSITVKTTEVKDP
                     HGRTQSITKRTIKRVNGYEYVETTTTTTQAIPLVDSNRHFDEFSGNFILQENGLDELS
                     EEDDSHSTAPAVGHAYAALTEPRNSSQYDAELQLSDGEVPLDQTSSISAFSDALEYPP
                     GERKRNGKKTIRNKVQRSAAPKKKADSHLKKKRATQSHPMTEQEMYNKALAVAQQKVY
                     SQSNYSGNIPVEKNNRMSTLGQRNLREEPRVTGKAPTTGENSRRGSKKISGFFNKNNK
                     GDDSPIEKPSPAVKAITELNNSSSRLIADDEMYAQALAIAQNKYNKQHAIETVPSVQV
                     EDNLSQPHARVPQKHAQATQTKPPTQSTQNLPGVQSMREDRQDLAEKLSGASHETNDN
                     SRNLSIEEQDSQVFETQNGTTATKTTTASDVLQVQEPISVTETLKKNESGERKSKLKN
                     VFDKIKQFSAENSGYQPPKREKQLASANSPSAAAPTPSGQRSSFQRTTVPEIGQQAST
                     HAIGQENENMANNSAENGSGLSKQKGKKNFISKLFNRS"
     gene            <941310..>941978
                     /locus_tag="HG535_0F04870"
                     /db_xref="GeneID:59237733"
     mRNA            <941310..>941978
                     /locus_tag="HG535_0F04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289805.1"
                     /db_xref="GeneID:59237733"
     CDS             941310..941978
                     /locus_tag="HG535_0F04870"
                     /inference="similar to AA sequence:RefSeq:NP_010512.1"
                     /note="similar to Saccharomyces cerevisiae ADK1 (YDR226W);
                     ancestral locus Anc_8.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145700.1"
                     /db_xref="GeneID:59237733"
                     /translation="MAQEDSIRMVLIGPPGAGKGTQAPNLVKRFNAAHLATGDMLRSQ
                     VSKGTELGLEAKKIMDKGGLVSDDIMVNMIKDELLNNAACKNGFILDGFPRTIPQAEK
                     LDKMLAEQGRPLEKAVELKVDDDLLVARITGRLIHPASGRSYHKLFNPPKTDMVDDIT
                     GEPLIQRSDDNVDALKKRLNAYHEQTEPIVDFYKKTGIWEGVDAAQPPATVWESILKC
                     IGKN"
     gene            <942319..>946095
                     /locus_tag="HG535_0F04880"
                     /db_xref="GeneID:59237734"
     mRNA            <942319..>946095
                     /locus_tag="HG535_0F04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289806.1"
                     /db_xref="GeneID:59237734"
     CDS             942319..946095
                     /locus_tag="HG535_0F04880"
                     /inference="similar to AA sequence:RefSeq:NP_010513.1"
                     /note="similar to Saccharomyces cerevisiae SIR4 (YDR227W);
                     ancestral locus Anc_8.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145701.1"
                     /db_xref="GeneID:59237734"
                     /translation="MDSNSIPPMPASEISKSTSGYPQKKSETREPISTLEKKLDRGPQ
                     SENTKLDGQSEKKVDSIQTNSIKLVKFTPTSKKWEKPSSGSAPGTPVRRREQSTKPLP
                     RSQSLKLASLDSIPLPGVDTEGRNNEEKNDKLLGLLRSKNAHGNFLNLTMSKEEMAAA
                     PKSYSTSTREFISSNNTARIRTSPVRKEITNIDVNKLAELRRTSSPRDELKKEERSNE
                     SRANNMSFSSSVEELLRRRKVKQQSRIPNLPFRHALNFPLAVNPENSELAKKNAEKYK
                     LHKPVSSSAEDHDQTETVSNDLKKAGSEGRDVQVQDAAEKESIAQTLHTENLPVIKSS
                     KVMETQIRKGATVEKDNIQNDEEKQEVSIKENSNKSTTYKDGIPSASSASLAAKPDMR
                     NIDDESIRKSKVVAAFEEHSQLTETPDVSHSKHIILQTPMKRHENSSTFKNNNNSAIL
                     KSLKAKWKEILQSEDPYSGDRAKELVKFFGDTQVGQERIDTSQGRSLLKMHPGITKAD
                     DLPHDPIFDGFRPTVVLTQNGNRLMSRNGVSAANTNSSNNATGRNPQNAVDHTNKQSP
                     SKPPKVTNSGNSMETNINAIIQEPAPYLTVPREIPSEKIPKLNPSNSGTPRFSKIKVP
                     HINLKSTFASNTNSTLASNTYRKSISPKISDPETETRKFNRTFPSSVLTKLHGKRRYG
                     REIIQGLVQTGVAQHKPFSEDSDVSVTNDICSASNYEVSYAYYYQQLQRRGKLEYLTL
                     DNPTETKLVENASVLHQPTSDSSVRMKHVMSSPEKLNGKSDIEGYSKEGWMKEWRSKL
                     RTCTVYFDIPGSSEIGVPGNQTDYLKRIFEVDFGVKLAKTLNEHVDLMIINENCDGID
                     DRIPFSQTVTNAIPGVKCDKKLRVWNQAKAWQFIKNLGIVVPPFKSISAMQVRSKDSK
                     QKENLNKEMAEKNVVAVKATEEELKGKEVNVEQQKEKEVEKRESEKRELEKRELEKRE
                     SEKRESEKRELEKRELEKRELEKRELEKRESEKRESEKRELEKRELEKRELEKRELEK
                     TETEKRELEKTETEKRELEKKELEKKELERNVKRKEAERKEVEKKGIKREANEVKKAK
                     VSSVKYSRNKNIVEGQKHDRGKNQNLPILAEPFNSNPVQNQNDQSEISALEQESDDEK
                     SYLEGLLENASIITDAKDKQLEDGRRLVLKLSREVMLRELKITSLEGQLRSSQKEIEK
                     ERSTLEDCKKLLTEKDLIISEYQQHIETLTQNKRSRDKDDKDTQTKKKYRKLTK"
     gene            <946870..>948678
                     /locus_tag="HG535_0F04890"
                     /db_xref="GeneID:59237735"
     mRNA            <946870..>948678
                     /locus_tag="HG535_0F04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289807.1"
                     /db_xref="GeneID:59237735"
     CDS             946870..948678
                     /locus_tag="HG535_0F04890"
                     /inference="similar to AA sequence:RefSeq:NP_010084.1"
                     /note="similar to Saccharomyces cerevisiae ASF2 (YDL197C);
                     ancestral locus Anc_8.443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145702.1"
                     /db_xref="GeneID:59237735"
                     /translation="MNGNKRELSNDSNIVDRAFDISKPRQDSKKNAFHYIHPSQRPQK
                     AWLTSKANRSSHLKENLSFNPLRSLLRSSPGNFSVITASERNMQKNENPIDKNAARDH
                     MNINKNSSSMRNSSINDTAVSDHQGPRPISVDDCSVNSTCKVSVDANGGYDMLEPPIR
                     PGRSIKDDTPVQTLEPQDSMKKMIEDIMRYEIRIASLYGRMAKMQKENDILRDDFKMV
                     SERNIDLTLSLRKKLNSRSKEAFYDSAEEQSTSREDRKRKVADVVEDRDNPNGIQHFK
                     RQNTHSTQVTDKAELSKMLEKLQRSIIKRLEEYRGVQKKLEKRFEQLEESEKHQLDSL
                     REESPLIKHLRSNLLRVHNELKVVREFGNVRAANLKAALDLQKNNVVVLNRKLEANHV
                     HMDKSSKSLREASKYIKSYQMAFNEQRKQILDLSDKASQINSTSAPKAIEKEQLSKSD
                     NTTDMESLTKVIEIQREDISILNEELHQEKLKNKSLLRTLEGHNTGQQNGAIRANDHQ
                     REGLTKSYIEVLEQQAQDKENYHKRIQHIHKTYRAILHQKDVEHRNHLNSISLSFREN
                     NEPKSLSTNVITEKKSDPNSGLVITFNDHKRAGDKT"
     gene            complement(<948864..>950720)
                     /locus_tag="HG535_0F04900"
                     /db_xref="GeneID:59237736"
     mRNA            complement(<948864..>950720)
                     /locus_tag="HG535_0F04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289808.1"
                     /db_xref="GeneID:59237736"
     CDS             complement(948864..950720)
                     /locus_tag="HG535_0F04900"
                     /inference="similar to AA sequence:RefSeq:NP_010514.3"
                     /note="similar to Saccharomyces cerevisiae PCF11
                     (YDR228C); ancestral locus Anc_8.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145703.1"
                     /db_xref="GeneID:59237736"
                     /translation="MEKETALVVKDFTSILEELTFNSRPIITTLTKIAEENIPCAQYF
                     ADALEARVERCPPGQKLYAFYAMDSICKNAGSPYTIYFSRNLFALYKKTYLLVDNNTR
                     TKLINMFKTWMNPNDSTGGYSPLFEKGALVKIEQFLIKASALHQKNLQTMLPKPTVPL
                     LLREIDKLTSLSNERLKKQPNDEKLSVKLVVLSQLKQELSRESLTQDALKQLQLQLRQ
                     IFAQDQQVLLDIQRQQQYIDVQKQQQQQQQQQQQQQQQQQQQQQRHTDAGNNGSFIPI
                     FGGSQIDGSVSSLFGPSSGVLGSPGFANTGASGQTSSIKNLYESLDTEGLLYKPPRDS
                     IVALYAKIDVDVKDDYNGNQNQKNLPSLPLLQSIVSDCKAYFATANIDILNTPNLQLS
                     QRAIVNDFPVVNNNLIHLLYRAKPNKCNICGKRFGNTSEEKKLMADHLDWHFRISKRL
                     KGSEITSNSLAGNVTATQKNIQARSWYLSDSQWISLKDEEIIATNRDSNDTKSITVAN
                     LDDSNVLPATGNNSDASKQGSSFAIDENVLRKKYVIVPETSEDMSFQCPICKEKVTGL
                     YDEEIGEWIWKNAIETDKKYFHATCYYEAARNNGGSTGFQLDLEKLKHLVTD"
     gene            <951216..>952118
                     /locus_tag="HG535_0F04910"
                     /db_xref="GeneID:59237737"
     mRNA            <951216..>952118
                     /locus_tag="HG535_0F04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289809.1"
                     /db_xref="GeneID:59237737"
     CDS             951216..952118
                     /locus_tag="HG535_0F04910"
                     /inference="similar to AA sequence:RefSeq:NP_010083.1"
                     /note="similar to Saccharomyces cerevisiae GGC1 (YDL198C);
                     ancestral locus Anc_8.445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145704.1"
                     /db_xref="GeneID:59237737"
                     /translation="MAQNDKKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTK
                     ISSSGQLNGVIFREHAGEALSKRVLTLFPGLGYAAVYKVLQRVYKYGGQPFANEFLNN
                     HYKADFDNAFGPKTGKALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPESFRGRGFIK
                     ILKDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLQDYSQATWGQNFVSSI
                     FGASASLIVSAPLDVIKTRIQNRNFDNPQSGFNIVKTTLKNEGFTAFFKGLTPKLLTT
                     GPKLVFSFALAQSFIPMFENLLKK"
     gene            <952526..>954649
                     /locus_tag="HG535_0F04920"
                     /db_xref="GeneID:59237738"
     mRNA            <952526..>954649
                     /locus_tag="HG535_0F04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289810.1"
                     /db_xref="GeneID:59237738"
     CDS             952526..954649
                     /locus_tag="HG535_0F04920"
                     /inference="similar to AA sequence:RefSeq:NP_010082.1"
                     /note="similar to Saccharomyces cerevisiae YDL199C;
                     ancestral locus Anc_8.446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145705.1"
                     /db_xref="GeneID:59237738"
                     /translation="MVQDPDQDKKNLLNQSTTRAPDQIKDDERSDIGLRQPNQNEIRL
                     GRLATIGATRKVGGESLTPVLSRGREHSASPRTSLAGLGSGGPNEGAGGPLQDHGHLY
                     VKESYLTGRALLYFTSIFVSLGVFLFGYDQGVMSGCLTGPYFKEQFGNPSRAMIGNMV
                     SILEVGAFISSLMVGRLGEKWGRRRTIKYGSIVFVIGGLFQGFAQSMLHLIIGRLISG
                     LGVGLLSTIVPIYQSEISPPHNRGKLACIEFTGNIVGYAASVWIDYGCTFIEGNLSWR
                     IPLLIQCVIGFALFCGTFVIVETPRWLLNHDHDVEGLIVIADLHSGGDVQDQKAKDEF
                     HSIKETVIISRMEGEGKSYTKVFKRYTRRVLIAMSSQMFAQLNGINVISYYAPLVFEQ
                     AGWVGREAILMTGINGIIYVLSTLPPWKLVDTWGRKPVLMIGGFCMGCALVSISASLV
                     ANIHATPHLVVIFVIIFNAFFGFSWGPIPWLYPVEIAPLSARSAMASASTATNWFCNW
                     LVGILTPILQEKISWRLYLIHATSCFLSFAVVMKVYPETAGLRLEDMDSIFDDRSSTF
                     SFARSSHTVTDYDGLSTKSNIINTTGPVPDRQNVLQPASSSHIGQQYPQHQQPVARSN
                     QSFKSTTNFGNLDPPTVDEVVRFKLTQQNSRGLKTTIRRGSENLSLFINKVIRLGKFE
                     NNGNAAYGAIPPDDLESASRFDSQS"
     gene            <955433..>956035
                     /locus_tag="HG535_0F04930"
                     /db_xref="GeneID:59237739"
     mRNA            <955433..>956035
                     /locus_tag="HG535_0F04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289811.1"
                     /db_xref="GeneID:59237739"
     CDS             955433..956035
                     /locus_tag="HG535_0F04930"
                     /inference="similar to AA sequence:RefSeq:NP_010081.2"
                     /note="similar to Saccharomyces cerevisiae MGT1 (YDL200C);
                     ancestral locus Anc_8.447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145706.1"
                     /db_xref="GeneID:59237739"
                     /translation="MEETISYSFCEHELTGIMLMMRVKSGKLVYASLGDEEDYLLKSA
                     EQDFQRLSKKTHTKYHLRKVDSTAHNEEFEKIRKQYISVLEFEDVGKEESESSSGQKA
                     VDYEFMFGTPFQRKVWTELTKVPFGGTVTYGQIAAKIALPKAIRGVGTAVGQNKLAIV
                     IPCHRCLPSDGKIGKFRWGSNMKQKLLLHEKMLKKTQNVE"
     gene            complement(<956075..>956935)
                     /locus_tag="HG535_0F04940"
                     /db_xref="GeneID:59237740"
     mRNA            complement(<956075..>956935)
                     /locus_tag="HG535_0F04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289812.1"
                     /db_xref="GeneID:59237740"
     CDS             complement(956075..956935)
                     /locus_tag="HG535_0F04940"
                     /inference="similar to AA sequence:RefSeq:NP_010080.1"
                     /note="similar to Saccharomyces cerevisiae TRM8 (YDL201W);
                     ancestral locus Anc_8.448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145707.1"
                     /db_xref="GeneID:59237740"
                     /translation="MKAKPLSQDSGSRRYAYRVNKQENRKELKHVKIDEKSVESKTET
                     LDLPKKKFYRQRAHSNPFSDHQLEYPLSPEEMDWSKLYPEFKDPTTGDMTKKVTVADI
                     GCGFGGLMVDLSPEFPDDLILGMEIRVQVTNYVEDRIIALRNNNIESKRYQNINVLRA
                     NAMKFLPNFFTKGQLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLKEGGIVYTI
                     TDVEDLHNWMVKHLEEHPLFERLDRTWENGDKCVSIMLNATEEGKKVERKKGDKFVAC
                     FKRLPNPSDL"
     gene            complement(<957215..>957955)
                     /locus_tag="HG535_0F04950"
                     /db_xref="GeneID:59237741"
     mRNA            complement(<957215..>957955)
                     /locus_tag="HG535_0F04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289813.1"
                     /db_xref="GeneID:59237741"
     CDS             complement(957215..957955)
                     /locus_tag="HG535_0F04950"
                     /inference="similar to AA sequence:RefSeq:NP_010079.1"
                     /note="similar to Saccharomyces cerevisiae MRPL11
                     (YDL202W); ancestral locus Anc_8.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145708.1"
                     /db_xref="GeneID:59237741"
                     /translation="MLERVRFLDGRSLARSLNIVGRFNRYRSVGLLLSTRQLTNGVDC
                     DAERVTAKPIDSRKTFLVDSYKHLMEKNSVVLFLHYNNLLKHEDHHYRSQIEQLGGKL
                     TILRNNLFKLYLKNSHLEDPCAPVKSKNQSKRHPLLPLFKGPTAAIAFPETNPKDVAN
                     VLKLLEKAQDKLFVVGAKVETESYDLAQLNKYKLLPDKTALQGQLLGLLHTLSGAGLV
                     KTLESASQSLYLTLSSHRDNVKSEGKDD"
     gene            <959367..>960755
                     /locus_tag="HG535_0F04960"
                     /db_xref="GeneID:59237742"
     mRNA            <959367..>960755
                     /locus_tag="HG535_0F04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289814.1"
                     /db_xref="GeneID:59237742"
     CDS             959367..960755
                     /locus_tag="HG535_0F04960"
                     /inference="similar to AA sequence:RefSeq:NP_010515.3"
                     /note="similar to Saccharomyces cerevisiae IVY1 (YDR229W);
                     ancestral locus Anc_8.450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145709.1"
                     /db_xref="GeneID:59237742"
                     /translation="MNINSNNNNSSSHISPTRYAPHLSEFYSIVNNTSPRSNNRLPEP
                     IATHGALKEEDQYNRRMAPASVRSAMSTISDLRTLVTKRDIKDTVDAMNSLFDSSQGY
                     AKSLQEVSKCASLMAQSLETLARLKGCRDDTAERMLSASGLFYLQANHENIMSQCLQG
                     ALGDELLNEMDEFQIKSKTMENQFKKNFKDQSMKLKMQERHNIKQSKRKTRNILLYKE
                     SLMNLQTQLDQLETLRHDYYQSSYDLVETACDKVLENVATVSRARVEISENIARKGWS
                     GGGLDDLLMDAEDPFGKEDDQEEGEMEGEYQRQQEEGTHERVDDVDPEATLGSKSSSG
                     TTKDTIDENNVSNSDFLRGPPTPVRKMSPLNTVKSPLGHKSGSVRNSSIHDYDESIKM
                     ESPQMDISDTAESAFDNSFSLPLAGSAKSRINENDDKSILGDKENILKDMLAIDLNDA
                     SPCSSSIGPQDN"
     gene            complement(<960820..>961866)
                     /locus_tag="HG535_0F04970"
                     /db_xref="GeneID:59237743"
     mRNA            complement(<960820..>961866)
                     /locus_tag="HG535_0F04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289815.1"
                     /db_xref="GeneID:59237743"
     CDS             complement(960820..961866)
                     /locus_tag="HG535_0F04970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145710.1"
                     /db_xref="GeneID:59237743"
                     /translation="MTQKSVTVLLVCFPLFIALFKFYNSRASFDMVETVDSSEKIMKK
                     TPVFALSHGGPTFMYEDAAMGGDKGAFQCTRRIGKYISEVVKPKFIIYVSAHWQSGSN
                     NLIEVGVPTLNKAALQGPPVENNLIYDFYGFPKNMYDEKFHSMNDIPTAYQLVKDLNS
                     YFRATDTLLHSSLAERGIDHGVWVPLKVAFPDKATDFWNTGIPVIQVSLTQDATDFDM
                     HYKLGQALSTYRSDAVVIVSGMTVHNLRDLSLAPPGKSLPYVKKFNQLLREIMTDTHT
                     ENNHKLSKLKELLTDPQKRQLLYSAHPTLDHFVPFVVGLGAGEGESSACNVKELYNNE
                     QGSLGWGIYQYDQN"
     gene            complement(<962308..>962907)
                     /locus_tag="HG535_0F04980"
                     /db_xref="GeneID:59237744"
     mRNA            complement(<962308..>962907)
                     /locus_tag="HG535_0F04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289816.1"
                     /db_xref="GeneID:59237744"
     CDS             complement(962308..962907)
                     /locus_tag="HG535_0F04980"
                     /inference="similar to AA sequence:RefSeq:NP_010517.1"
                     /note="similar to Saccharomyces cerevisiae COX20
                     (YDR231C); ancestral locus Anc_8.451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145711.1"
                     /db_xref="GeneID:59237744"
                     /translation="MRWWPFSDKENSRSLDEARTPKTANIGPMASNYSKGQKILLEDT
                     DPRFDSETSQRQMAHSQEEANLKKALDSIKVEDFSFAKLSMIPCFRDAGLIGFTSMFV
                     SGTVTFLYHKNPLRSANWSVAGLLLGSVVGWEQCRLKRKRSFQVGQMARDTIASKKRP
                     MLNSVKHEEKLVQQWEGHKNGERLVEAVSEKKSPWYKFW"
     gene            <963260..>965014
                     /locus_tag="HG535_0F04990"
                     /db_xref="GeneID:59237745"
     mRNA            <963260..>965014
                     /locus_tag="HG535_0F04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289817.1"
                     /db_xref="GeneID:59237745"
     CDS             963260..965014
                     /locus_tag="HG535_0F04990"
                     /inference="similar to AA sequence:RefSeq:NP_010078.1"
                     /note="similar to Saccharomyces cerevisiae YDL203C;
                     ancestral locus Anc_8.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145712.1"
                     /db_xref="GeneID:59237745"
                     /translation="MFRDQHHDNGNRYDTHINMYPPAPAPMTEPLRSSSPVRVAARSQ
                     EVSAPYPIEDANDIINPVPMFTSLAPPATRIPTDSRTFGDSGNDSIENGERYGMPFQF
                     PMNSSSSQSLANSQDSLRATSQSTDDIKDSHFNEDILHKRDSTERIAPPPPYEESQIK
                     ILQEKAYRTNDREASIPAFKGSKEEKVNAKTRDLSQYSDSALAFRKVYIETVADSSTF
                     TPQIQIKWCETLLEYAFNDEFLTYYNINADKLKRELKSEEKLKNQKVILEHSFKVLTK
                     LISMKCGAAMYLMGTLYSHQPYLKIKNRNIVVKNDKKALEYYCRASRLDHSDACYRAG
                     VCYEFQKGVSAEEMTKPQSLQKALYYYDRGAQICNNSSCMYKLGMLSLYGEDETNLNP
                     LKAVEWFKKAGKSGNSPQSIYELGKIYEFTGLPKHTQKLLQQSNIKMSSSKSLKYYYD
                     CAMNFSYPIAQWKLGHCYEFGELQLPVFAKKSIAWYAKASLAEPKGNAMAMLSLSGWY
                     LTGASGVLQPNDEEAFKWAQKSCQASDGKFGRAEYALGYYYENGIGCQKDLSEAMKHY
                     NHAAKLGHLKAIERLRTR"
     gene            <965459..>967153
                     /locus_tag="HG535_0F05000"
                     /db_xref="GeneID:59237746"
     mRNA            <965459..>967153
                     /locus_tag="HG535_0F05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289818.1"
                     /db_xref="GeneID:59237746"
     CDS             965459..967153
                     /locus_tag="HG535_0F05000"
                     /inference="similar to AA sequence:RefSeq:NP_010518.1"
                     /note="similar to Saccharomyces cerevisiae HEM1 (YDR232W);
                     ancestral locus Anc_8.453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145713.1"
                     /db_xref="GeneID:59237746"
                     /translation="METLARHSVKLCPFMQRASSSAKDVQLLRNFNMRAIAQECPVVG
                     KAMRKRTVGNSGAARTYATASAARVTPDPASDSAVDSVIDHSTQESSFDFEGLFESDI
                     EKKRLDNSYRYFNNINRLAREFPMAHRQLEDDKVTVWCSNDYLALSKNEEIVSVMKKT
                     LDKYGAGSGGTRNIAGHNRHAMKLEAEIAALHKKEGALVFSSCFVANDAVLSLLGQKI
                     KDLVIFSDELNHASMIVGIKHANTTKHIFRHNDLNHLEEMLQMYPKSTPKLIAFESVY
                     SMSGSVSDIAKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEAHRLHGISSV
                     KGYKTVMDRVDMITGTLGKSFGTVGGYVAASRKLIDWCRSYAPGFIFTTTLPPAVMAG
                     AAEAIRFQRRHLELRQQQQKHTTYVKEGFEDLGIPVIPNPSHIVPVLIGNAELAKQAS
                     DLLMENHRIYVQAINFPTVARGTERLRITPTPGHTDDLSDILLDAVDDVFNRLQLPRV
                     RDWETQGGILGVGEKNFIEEENLWTEEQLRLTNKSLNPNVKDPVIDQLEVSSGILV"
     gene            complement(<967271..>968179)
                     /locus_tag="HG535_0F05010"
                     /db_xref="GeneID:59237747"
     mRNA            complement(<967271..>968179)
                     /locus_tag="HG535_0F05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289819.1"
                     /db_xref="GeneID:59237747"
     CDS             complement(967271..968179)
                     /locus_tag="HG535_0F05010"
                     /inference="similar to AA sequence:RefSeq:NP_010077.1"
                     /note="similar to Saccharomyces cerevisiae RTN2 (YDL204W)
                     and RTN1 (YDR233C); ancestral locus Anc_8.454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145714.1"
                     /db_xref="GeneID:59237747"
                     /translation="MSAPVEQKSSESSGNCGSCGCESGCGLLLWKNPIETGKVFGGLL
                     VGLLVLKTVNLITFFLKVFYTTLFISGSIEFVSKIILGKGLVTKYGLKDCPNVVGMIK
                     PSVDHMFKVFPVYQAKFRKLVFAYQPKNNFKAAVILFVLHRFFSWFSVWTIAFIGVIS
                     TFTVPLIYSMYKKEIDTAVDNGIKVAKVKTDEFTQLASEKTKPYLETLDSKLGPVSGF
                     VKSQYHNANTVSSKSTTTGLAAKVPLEEPSKGTTTGSTSFPSVPQTAPLNQQTQEFSV
                     DALQSELKQSTDGLKRDLQENNNVSY"
     gene            <968846..>970903
                     /locus_tag="HG535_0F05020"
                     /db_xref="GeneID:59237748"
     mRNA            <968846..>970903
                     /locus_tag="HG535_0F05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289820.1"
                     /db_xref="GeneID:59237748"
     CDS             968846..970903
                     /locus_tag="HG535_0F05020"
                     /inference="similar to AA sequence:RefSeq:NP_010520.3"
                     /note="similar to Saccharomyces cerevisiae LYS4 (YDR234W);
                     ancestral locus Anc_8.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145715.1"
                     /db_xref="GeneID:59237748"
                     /translation="MLRFSRSLHSSFVLRRGQNLTEKIVQKYAVGLPKDKVVHAGDYV
                     SIKPAHCMSHDNSWPVALKFMGLGAKEIKFPEQIVNTLDHDIQNKDEKNLTKYRNIEN
                     FAKNHGVAFYPAGRGIGHQIMIEEGYAFPLNMTVASDSHSNTYGGIGSLGTPIVRTDA
                     AAIWATGQTWWQIPPVARVELVGELPLGVSGKDIIVALCGIFNNDQVLNHAIEFTGES
                     LDKLPIDYRLTIANMTTEWGALSGLFPVDKTLIDWYKQKRLPKVGSSHPRINESTIAE
                     LEKSLPSWKSDSDAVYAKRLTIDLSSLTHYVSGPNSVKVSNTVQDLSNQDIKVDKAYL
                     VSCTNSRLSDLESAASVVCPTGDINKINKVSPHVEFYVAAASSEVQSDAIASGAWEKL
                     MKAGCIALPPGCGPCIGLGAGLLEPGQVGISATNRNFKGRMGSKDALAYLASPAVVAA
                     SAIAGKIASPAEVINIKDPQFRGVTSTMETYETTDSAVESAGSVEILEGFPSQISGEL
                     VLCDADNINTDGIYPGKYTYQDDVPKETMAKVCMENYDPNFQHKVKKGDVIISGFNFG
                     TGSSREQAATALLAKGIDLVVSGSFGNIFSRNSINNALLTLEIPALIEKLRAKYKDAP
                     KELTRRTGWFLSWDVANRKVVVTESSFEGPVVMEQTVGELGKNLQEIIVKGGLEGWVK
                     AQL"
     gene            <971293..>972294
                     /locus_tag="HG535_0F05030"
                     /db_xref="GeneID:59237749"
     mRNA            <971293..>972294
                     /locus_tag="HG535_0F05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289821.1"
                     /db_xref="GeneID:59237749"
     CDS             971293..972294
                     /locus_tag="HG535_0F05030"
                     /inference="similar to AA sequence:RefSeq:NP_010076.1"
                     /note="similar to Saccharomyces cerevisiae HEM3 (YDL205C);
                     ancestral locus Anc_8.456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145716.1"
                     /db_xref="GeneID:59237749"
                     /translation="MTMGEIIRIGGRRSKLAVVQSTIVKQLIEIEFPDYECPILALQT
                     FGDQVQFKPLYSFGGKALWTKELEDLLYDEDPARRIDLIVHSLKDMPTLLPDNFELGG
                     ITKRVDSTDCLVMAKDSEYKTLSDLPTGSVVGTSSVRRSAQLKRKFPGLKFESIRGNI
                     HTRIKKVDDPSTPFKCIILASAGLVRMGLEHRINERFDSSVMYHAVGQGALGIEIRKN
                     DKRIAKILERVTDFETTVCCLAERALMRTLEGGCSVPIGVESFYNQETKTLLLKGIVV
                     SVDGKQSIEDQQEMIINNVKEDSMACGKLLAEKMMADGAKKILDEINFDKVEQENFN"
     gene            <972494..>974116
                     /locus_tag="HG535_0F05040"
                     /db_xref="GeneID:59237750"
     mRNA            <972494..>974116
                     /locus_tag="HG535_0F05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289822.1"
                     /db_xref="GeneID:59237750"
     CDS             972494..974116
                     /locus_tag="HG535_0F05040"
                     /inference="similar to AA sequence:RefSeq:NP_010521.1"
                     /note="similar to Saccharomyces cerevisiae PRP42
                     (YDR235W); ancestral locus Anc_8.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145717.1"
                     /db_xref="GeneID:59237750"
                     /translation="MDKFTGIISDEKFSKISLAVAQYPKSLVHWEELLNYLISNSLPL
                     NRSLDHRLYELIETTYDSMLSHFPYTENYYIDHALFQYKLGKVSKMHAVYQQGLKVFS
                     YRSLHLWISYLKLCNEVVTSNKLLFQKYETAEKYIGLHYFSGEFWDLYLQQIQERCQR
                     KERYFIILRKVLEIPLHSFSRFYAAWLRHIEEVQDVSQLNSFSSNEDLMKKLKIDVTY
                     RGRKGPYLIECKKLLKKFTKELYMVVQYQVLEIYSLFESKLKTHYYSGPATLLPAVEV
                     EIWDKYLDYTMSQRLDSLTHLNFQRALLPFAHYDIFWLKYANWLIDYSDDIASARNIL
                     IKGLSMSSKKNAIAKLLYATLCRLNDYDFLALIFEQHEDAHGDHIENVDDFEVFWDYV
                     QFQTFCSSVTKSRYSKSELHSFMTPNVLDVILKRLSLQESKIDQLLLLSSILQLQTKS
                     NTTFIEEKIFKHIIRSNWEFFLQNGQFWSLYSRLTFFNSSLSYLEKRRHIVKNIWLQG
                     KRYNIKNLEPLREFCQSYLPEDIDALEEIFET"
     gene            complement(<974166..>976232)
                     /locus_tag="HG535_0F05050"
                     /db_xref="GeneID:59237751"
     mRNA            complement(<974166..>976232)
                     /locus_tag="HG535_0F05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289823.1"
                     /db_xref="GeneID:59237751"
     CDS             complement(974166..976232)
                     /locus_tag="HG535_0F05050"
                     /inference="similar to AA sequence:RefSeq:NP_010075.1"
                     /note="similar to Saccharomyces cerevisiae YDL206W;
                     ancestral locus Anc_8.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145718.1"
                     /db_xref="GeneID:59237751"
                     /translation="MHKHLRWAITTTFYSVQLIILYHSLNNETIWILIVEPFILIECF
                     IALGLIASDYLTPSLSRISKDILQISDKVSGLTLLSLGNSIPDITSTYQAMSTGATSL
                     ALGELLGGIFFLMTVVLGIMAFIKPIKLRKSMILLSDNTGTQYFDINETPGVSYSRAD
                     FYQDILMFGALVLMSGLFLADGRLMFWECITMVLAYSLYTSFLILQNRTSICIEESFD
                     NRASCRDEIESLSAIISNSGLANNDEQNILLFNNGVNRRRANIRSGIRHYLRSRYHGW
                     VKITLSDCLEIWENEANLNRNKNDRAEENSIVSAEDQIYVESFAPPRRATSLRDVDRT
                     DQISIIYGLALDNKKSVEERDATTNTPGFDNPQELTVPMRPKTQKSLSCDCIPNLPRY
                     RDDESNFDSHIERTSLCSTKDEALPTWPQRLMLPQYISDEAMYLPVTEYLALLFTTPP
                     TIVLSCLIPYLGHIKCCGKLHVLEVVRLTMAPIYLNVLFSGSVSIWTLAISGLLGGTL
                     IYRYFTSQVRTNEHIVAVAGFLLSLSMIYLCVHIVVRMLTDWSTKLDISPSILGLTFF
                     AWGNSMGDLVSNVIFADIGVIELALGACFGSPLLYFVFGVGINGIFLLLRQKKQMQKS
                     IFKSHLSYVIDPSLEYTALGIVLAFLIFLIAVPFNNWRIDKRISILLLLLYAAVTIVN
                     VLQEIK"
     gene            complement(<976553..>977122)
                     /locus_tag="HG535_0F05060"
                     /db_xref="GeneID:59237752"
     mRNA            complement(<976553..>977122)
                     /locus_tag="HG535_0F05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289824.1"
                     /db_xref="GeneID:59237752"
     CDS             complement(976553..977122)
                     /locus_tag="HG535_0F05060"
                     /inference="similar to AA sequence:RefSeq:NP_010522.1"
                     /note="similar to Saccharomyces cerevisiae FMN1 (YDR236C);
                     ancestral locus Anc_8.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145719.1"
                     /db_xref="GeneID:59237752"
                     /translation="MTTRHCDAEIPDSPRPPYPLVSGYCDITCGFGRGSAELGIPTAN
                     VPIEELSVEFNNLSLGIYFGFAKVQAIDKQLSVDSRSDGTKVEFNYGRYLSKEKDDLN
                     VLPVVLSIGKNPFYGNNFKTIELHIIHKFNKDFYGAKVKFCILGYLRPELDYTTKEAL
                     IKDINIDIYKSLSVLSKDSYKSLGSLLDD"
     gene            complement(<977363..>979042)
                     /locus_tag="HG535_0F05070"
                     /db_xref="GeneID:59237753"
     mRNA            complement(<977363..>979042)
                     /locus_tag="HG535_0F05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289825.1"
                     /db_xref="GeneID:59237753"
     CDS             complement(977363..979042)
                     /locus_tag="HG535_0F05070"
                     /inference="similar to AA sequence:RefSeq:NP_010074.1"
                     /note="similar to Saccharomyces cerevisiae GLE1 (YDL207W);
                     ancestral locus Anc_8.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145720.1"
                     /db_xref="GeneID:59237753"
                     /translation="MRFSLDEISVDSSSEDDRSDHDNNDIASACSSESSLNEYSFINT
                     GDEDDGVPQLYLPKYESVHGLRVRKNQGAAEEERLDPELMRLMGILQSKLPRAMERSI
                     IPLTNLDSMSDNTGADATAIGVENKFQETRSQSVSKTDISKLLSAMQNCFLSKLNNLE
                     EENKKQVECVTIIKKKDEEERRRKMKEERKRMEEEERKQRLAEEERQRLIDEQRKQEE
                     KELRIKEAEEKKAKIAREAERRAEEERRKLQVQQKLKQEELKSNAVTNFEAIEQLFCK
                     YKEKIATIKRDIVEPIKKADPTLRALLSRHKRKVNPKFGQLTNSNQQLEKIQFDICSL
                     VDETRSNDLAYRWILNFIAKAMVHQAETEARVKPESGLPLGKLALNLLVKYPELEDLL
                     LARFVKKCPFVIGFTANINTELGRQKMGWKRNSDDKWEEETSYDERMGGIMTFYALIT
                     TLPLPAQVINSREHPLPISKSWHILARICNTSVDLLTNTHFVVLGAWWDAAASVFLQA
                     YGNQGRKLLQLVSTDLTLSVADRKYVGAARLRILFEEWQTAGIKSFPAMET"
     gene            <979307..>980185
                     /locus_tag="HG535_0F05080"
                     /db_xref="GeneID:59237754"
     mRNA            <979307..>980185
                     /locus_tag="HG535_0F05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289826.1"
                     /db_xref="GeneID:59237754"
     CDS             979307..980185
                     /locus_tag="HG535_0F05080"
                     /inference="similar to AA sequence:RefSeq:NP_010523.3"
                     /note="similar to Saccharomyces cerevisiae MRPL7
                     (YDR237W); ancestral locus Anc_8.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145721.1"
                     /db_xref="GeneID:59237754"
                     /translation="MQAPIILKRAFSGSSLVGKAACSLIKPVHHLVKIDKSKLSPRFE
                     ELKYAKNDIRSPGFVPVSTHPDRLREHYFNTVQPDLLLMNYSHTFKRQEGLKNRSWDG
                     SSPYHINRAPKNPVGSKSQKPDLHPIKWHNIPEIESVVLNCYVNEAKENQLLAISAAL
                     QLQQITGCKPKTLYSKSDVPSWKVRRGHQMGAKIVLKGRPMSQFFSTLTEIVMPRIRE
                     YKGISTRSGNGFGSISFGLTSEDVRFFPEIDANQDLWPKTFGMHVNINTSSQTDSQAR
                     TLISSFQIPFSGIEKN"
     gene            complement(<980350..>983259)
                     /locus_tag="HG535_0F05090"
                     /db_xref="GeneID:59237755"
     mRNA            complement(<980350..>983259)
                     /locus_tag="HG535_0F05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289827.1"
                     /db_xref="GeneID:59237755"
     CDS             complement(980350..983259)
                     /locus_tag="HG535_0F05090"
                     /inference="similar to AA sequence:RefSeq:NP_010524.3"
                     /note="similar to Saccharomyces cerevisiae SEC26
                     (YDR238C); ancestral locus Anc_8.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145722.1"
                     /db_xref="GeneID:59237755"
                     /translation="MTVENEELAYTLVFDPSRSGNSYTVSDFQKALEKGSDEDKVETM
                     KHILVTMLEGNPLPELLMHIIRFVMPSKNKKLKKLLYFYWEIVPKLDEEGKLRHEMIL
                     VCNAIQHDLRHPNEYIRGNTLRFLTKLKEAELLEQMVPSVLACLEYRHAYVRKYAILA
                     VLSIYKVSDHLLPDAKDVLNTFLAAETDPICKRNAFVGLSELDREAALIYLEENITAI
                     EALDPLLQAAFVQFIRRDAIHTPTLKAQYIDLLLDLLKSTTSHEVIFETALALTALSS
                     DASVLTVAASKLIDLAVKVFDNNVKLIVLGRIDDINDKNPGSLEELTLEILRVLNAED
                     MDVRRKALDIAMNLVTSRNVDNVVRLLKTELQNTVYNSEKEKSMEYRQLIIKTIHVIA
                     IRFVEVAANVVSLLLDCIGDLTSSAASGVISFVKEVIEKYAHLREPILKNLIMVLDNV
                     KSAKAYRGALWILGEYAETYQEIQRCWKHIRSSVGEVPILQTELKRISENSEKDEETD
                     EVPQKRTGPIVLSDGTYGSENAFNSEKSSSEDERDLRPPLRRFILNGDFYTGSILAST
                     SIKLVLRLEKTSRDDSILNALKAEALLILVSIIRVGQSSLVEKKIDEDSLERIVTGIS
                     ILMDDLDPTESDAERKLLETAFLDATKSSFKTQVARSKHKNAKISARNLSKAAEPIDA
                     PVAFRQFAHADTRAAEDDMIEEDLQLALKGNYDSLSANSAMSKLRKVVPLTGFSDAVY
                     AEAYITTHQFNVVLDVLLVNQTRETLKNLHVQFATLGDLKIVDTPSSTNVVPHGFHKV
                     SVTVKVSSADTGVIFGNIIYDAAHGEDAHYVILNDVHVDIMDYIKPGKTDDEHFRTMW
                     NAFEWENKISVKSQLPSLHAYLEELVKGTNMGVLTPAEALGENDCRFLSCNLHAKSSF
                     GEDALANLCIEKDPSSGQVVGHVRIRSKGQGLALSLGDRVALIAKQTGKVQLSRV"
     gene            complement(<983551..>985923)
                     /locus_tag="HG535_0F05100"
                     /db_xref="GeneID:59237756"
     mRNA            complement(<983551..>985923)
                     /locus_tag="HG535_0F05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289828.1"
                     /db_xref="GeneID:59237756"
     CDS             complement(983551..985923)
                     /locus_tag="HG535_0F05100"
                     /inference="similar to AA sequence:RefSeq:NP_010525.1"
                     /note="similar to Saccharomyces cerevisiae YDR239C;
                     ancestral locus Anc_8.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145723.1"
                     /db_xref="GeneID:59237756"
                     /translation="MFSSNTSDNKNRRRSFFLFGGSQVVPKASTHKASTSNGSGKVLS
                     SQTHRQQAVDISSSHNRKPSLHAVDGQRESKPVFKSQLSETGTAAHVNDILDDKDVPN
                     GMHTDIAKRSTSHMKRPPPPPIDLEALNFVKQTPTLRVSSSGDIGQLSSTQETLKSAS
                     YSPSKTPVALDQEPEVKQHKRQISEAEKLVDDLDSYIKQQKEMSESAGNGSKGEDVPN
                     QFTSGNSNFADDSFLSPKSSTSSKSSINAESPIESPFTYVGPLNLPVEDRNPLKNKEA
                     SLSKRRYDPFLDLDVDNDRFSFTTSLNDKSVKSIQHVALNDSMGAAPIITNYGYGYGA
                     ITDSDIDTNGSENDETSRLLGTGHDDDENLSLKREPSITVQETGNELEFSDRNTDDEE
                     AVSRNFRVVNEDKPSFYLNGNDNNTTSTTNSTATEDYERPQDGQSKLSLPDASDNYGE
                     LSITSTASSYEPTPGMRETGADDIILETKNMVPLPDKSVSNDIEKPSGAPHVVDNLTT
                     LSQSSRSSLTSSNNSSSVSPHPDKMVRLVSSYVEESRLKYYTTSNFLQAPPNLPISLK
                     QKNNLIQPKNIKVRIRTSSKQIGIKHGGAKQKLLSLETTKEEENENASDQLLGSRNRI
                     TADHTKEFHNLLSKGVIRRQSNLFPNPQTFDTGSRGRTTNETNADKDSEYYLEDIPGD
                     DAYDSDDAMAPLRENRGSQSSKRVSRSDTVVSYFTKNQRRLRSGTLENSYAYLQGLPK
                     DVNIDDYRAASASHTLERSDSKKSLASNILDPTYSNGNTLHVANPDTDSE"
     gene            complement(<986255..>987652)
                     /locus_tag="HG535_0F05110"
                     /db_xref="GeneID:59237757"
     mRNA            complement(<986255..>987652)
                     /locus_tag="HG535_0F05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289829.1"
                     /db_xref="GeneID:59237757"
     CDS             complement(986255..987652)
                     /locus_tag="HG535_0F05110"
                     /inference="similar to AA sequence:RefSeq:NP_010526.1"
                     /note="similar to Saccharomyces cerevisiae SNU56
                     (YDR240C); ancestral locus Anc_8.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145724.1"
                     /db_xref="GeneID:59237757"
                     /translation="MAVKRKAVSSAYDGTANSKRQRRQQHEFFESQDIWKNLNKISTN
                     LTNSSREKKNSQLFIPVYTATGVENAKVCVEALQEFIETSKIEVYFGLGGNRSIGFVR
                     LRNFNILDCCLVLSVILAARNKNHIISDTKNMFTIPQSTALAASFYLPSNFTYLDAKW
                     VPPSGLRISEVVCTDTYNFKEFHVSLSKNRSLSIFIEGIASFLTNLKFGKCKGAKDQD
                     FRSYLSKIFNSIKSSIYQTCLPKDVMFDSADLVAVNRPKIEKSKENLLKYAKDIINSN
                     KYDGMIKPASEPVNDRNIHVSQSSRHDSNANGAPSNRYRAASRSTGTNLHIPQDGHPA
                     ESANTIVPSNYMTQEQIKQHCQATVSASMDALKSKSPYQIFTMYVKCPRQKYTDIVYQ
                     SLNDLRTQSNCNIVVLNLNNLNESKSWFDTLDTSKYTAFTKAPHPSTVRVISIGGVGE
                     HMMKALELISRIMEA"
     gene            complement(<988011..>988466)
                     /locus_tag="HG535_0F05120"
                     /db_xref="GeneID:59237758"
     mRNA            complement(<988011..>988466)
                     /locus_tag="HG535_0F05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289830.1"
                     /db_xref="GeneID:59237758"
     CDS             complement(988011..988466)
                     /locus_tag="HG535_0F05120"
                     /inference="similar to AA sequence:RefSeq:NP_010073.2"
                     /note="similar to Saccharomyces cerevisiae NHP2 (YDL208W);
                     ancestral locus Anc_8.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145725.1"
                     /db_xref="GeneID:59237758"
                     /translation="MAKESTKESKSEDNYDARMPAVLPFAKPLASKKLNKKLLKTVKK
                     ASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDNAVPYIFVPSK
                     QDLGSAGATKRPTSVVFIVPGSNKKKEAKAKEEEYKDSFNEVVKEVEAL"
     gene            990127..990210
                     /locus_tag="HG535_0Ftrna7L"
                     /db_xref="GeneID:59237899"
     tRNA            990127..990210
                     /locus_tag="HG535_0Ftrna7L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /db_xref="GeneID:59237899"
     gene            <991393..>994305
                     /locus_tag="HG535_0F05130"
                     /db_xref="GeneID:59237759"
     mRNA            <991393..>994305
                     /locus_tag="HG535_0F05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289831.1"
                     /db_xref="GeneID:59237759"
     CDS             991393..994305
                     /locus_tag="HG535_0F05130"
                     /inference="similar to AA sequence:RefSeq:NP_014851.3"
                     /note="similar to Saccharomyces cerevisiae PTP2 (YOR208W);
                     ancestral locus Anc_8.623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145726.1"
                     /db_xref="GeneID:59237759"
                     /translation="MMLNKEATDAGTGGGTPRGATDTSGLNLNIYSSTQVRRPMLFSM
                     KTAPAFQMAGASGKETVDIKKCKDCDVPALQICERVDDLIVGACNSMIIIFDLTTTGS
                     LVSSGAVTPNGSEAGSENSSSGGGNGSASGNASANGKGSGPCHNAKDIYRIHLSLPST
                     LVKRPKFHFEKILHTVIDDSKRLKLLNLIDNCNRFLFFDGTSTLSTCSLTTFWLIKKF
                     NAFLHDKLGKSNIELFILEKMDTPFSSLQTTTTANADTTVKTMSAAATATAFSSIGQS
                     SDFLSSDKKTFQGKMNLTVKVLPRSNEKMFIQSIKKDTVHYSPTSLRKFFKFKIPENL
                     SQNDPILPNWLKQFADKDKNDVLLQKLLSNFEFLESLELERLERGLTVEQQRQQQHEQ
                     HEQQQQQQQQQQRALQKSKSYQKIYSLSNLQKEFRKQKKFNYNDKCKYSSSSCPTSPR
                     HEVLDLKLSIPKDSKSTSISTNNLQVPPTFAVYPSTNDVNTNSPASSPHPDTDSDSLL
                     TPMNNYEMSEGIKSFSKNRYSNILPYEHSRVKLQPSPLCGPPNINNISYSSSVSDNSS
                     GKSINNGTKTPAATTLTSTNNTASELAPAPASALASTSKSASLSKPTSESTLISVPVD
                     NTKDTCDCSKNHKKRRNSCSISPPSSASYFNQTIDSSCLEQPNIETSPETKDSFDDYF
                     NANYLKIPQVNGDFEYIATQAPLPSTIDDFWKVISTNGVKVIISLNSNDELFMRKWDI
                     YWNNNRSNQKYKIDMTESFENVCEVDGCILRIFSFYKNSTLNNVETAEANDISKTSAP
                     SGDYNPSSSKLTVYQLQYTKWLDSCGIVMKDILNLYTIKNILLNNPNELINDLRSKKT
                     KPISKYHKDLWLDDHKDMKQPPLLVHCSAGCGRTGVFITLDFLLNILTYPSNCNNKID
                     VWKMTQDLIFITVNELRKQRISMVQNLTQYITCYEAILEYFSLKKIEFEMNKTENR"
     gene            complement(<994538..>997630)
                     /locus_tag="HG535_0F05140"
                     /db_xref="GeneID:59237760"
     mRNA            complement(<994538..>997630)
                     /locus_tag="HG535_0F05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289832.1"
                     /db_xref="GeneID:59237760"
     CDS             complement(994538..997630)
                     /locus_tag="HG535_0F05140"
                     /inference="similar to AA sequence:RefSeq:NP_015200.1"
                     /note="similar to Saccharomyces cerevisiae KAP120
                     (YPL125W); ancestral locus Anc_8.624"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145727.1"
                     /db_xref="GeneID:59237760"
                     /translation="MADLASLSEKNLVETLEQASNPQHIGSQVQKAAEQQLKDWCVHS
                     GFHYLLQSIYLDLSNSLQIRWLAVIQFKNGVEKFWRATRINAINKDEKASIRERLFNS
                     ITEQNNQLCIQNAQATAKISRLDFPADWPNLFEQLEQLLNNEVILSDTVKVYNILTHI
                     NQIIKVLGAARIGRCKPAMQSKVPLIFPLIVRIYIKSFEEWTTSPHAHAKDFTKFQVS
                     YLALKVLRRITTEGYERPYADETVCEFMNVAVTHFQLLISNQQKFKEFDIYEKFIRCY
                     GKLYYNLIIGAPANFILLPCSTQILITYTKLLFEKAADVYSENSDLNGDFWEQTAIRG
                     FLILKRVINFLNKKGAITLKARSDKAAIDASIARINSEFLNEQLIKNLVDTLMKWYLK
                     LRPSELENWFMDPEEWINEQMSTSYEYQIRPCAENFFQDLINTFPTFLVPYLLNKIEN
                     EAAHLSNSLEDFLMKDAIYSSFELSAAAVSDMVDFDTLLVQVFLPEATAQDKPKDQMK
                     IVQRRVCLIINEWSSIKCSEESKQLCYQFFSDLLLKEEDKVVLLTCVKSLRTMIDDWN
                     FNKGTFEPFLNKIVNILPKKLLPSVCLTETRMYILNTLSDIIIQTKPLIDKDVLLEIL
                     QLVPNLWEISTTNPTEAILSNALLRLLRNLVTSLGPQSYLTWSISLAVVADACNPSSS
                     NYQLLNEDGYELWGSLLQNYSSSESKFDQEFYKLIPFLEFGIETHTEILPTLLEIIKS
                     YSLILNTAEFFSFEVFSQIFSQVSKYLLKLRDDSFHLILEIWEILILSNESDYEEPLL
                     QYFHNNGVLHCLFDSIFKEESLSSYQCGEILQNVSRISYVNPQALMDSLAVYYQSLPN
                     DITNRSLPLNERRVVHQNMSFDQIAQRFLSIWLVSYKDVYDPKFRKVHALGISSLLRT
                     GLVSILSEFPLIASLWIEILEEINETNNGDCEKYHLNDVVTPQTISYHPLNSEQLREY
                     ELSKNNDPVHNISLREFIAQTMRFLEQHLGSKYNDLLNNVDPKIMENLQLFLTITPQN
                     "
     gene            complement(<997964..>999250)
                     /locus_tag="HG535_0F05150"
                     /db_xref="GeneID:59237761"
     mRNA            complement(<997964..>999250)
                     /locus_tag="HG535_0F05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289833.1"
                     /db_xref="GeneID:59237761"
     CDS             complement(997964..999250)
                     /locus_tag="HG535_0F05150"
                     /inference="similar to AA sequence:RefSeq:NP_014852.1"
                     /note="similar to Saccharomyces cerevisiae NPT1 (YOR209C);
                     ancestral locus Anc_8.625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145728.1"
                     /db_xref="GeneID:59237761"
                     /translation="MTDSVITSFLDTDLYKLTMHAAVFSSFADIEVVYKYTNRSAQLN
                     LNAEAIEWLKQQFGYLGQLKFTEEEIEYLRKQIPSLPQDYLDFIKHFKLYPERQLSVT
                     AEKVAGKEDQYNLNVLVQGKWVDTILYEIPLLALISESYFKFVDVDWEYEGQLEKAQA
                     KAKKLFENSIKFSEFGTRRRRSKKTQDLVMQGIVKAVAENPDVYTKLLLGTSNVHFAK
                     EFNVKPIGTVAHEWVMGIAAITNDYINANKNAMDYWIKTFGPENAGLALTDTFGTDDF
                     LKSFHPPYSNAYVGVRQDSGDPVEYTKKIAHHYYDVLRLPKFSKIICYSDSLNVEKAI
                     DYAHVAREYGLLATFGIGTNFTNDFQRKSERTIKSEPMNIVIKLLEINGNHAIKISDN
                     LGKNMGDPETVERVKQELGYVEKKWSGDNEAHRWSA"
     gene            complement(<999547..>1002189)
                     /locus_tag="HG535_0F05160"
                     /db_xref="GeneID:59237762"
     mRNA            complement(<999547..>1002189)
                     /locus_tag="HG535_0F05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289834.1"
                     /db_xref="GeneID:59237762"
     CDS             complement(999547..1002189)
                     /locus_tag="HG535_0F05160"
                     /inference="similar to AA sequence:RefSeq:NP_015199.1"
                     /note="similar to Saccharomyces cerevisiae NAN1 (YPL126W);
                     ancestral locus Anc_8.626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145729.1"
                     /db_xref="GeneID:59237762"
                     /translation="MTQSGVYQKYKLSVVSGGRPILPRGGNTSCCNKSQACLTPDELG
                     YIIPFNNQIKVYSVETRQCIKTLKFGNNGILSKIFANDDTCIAHISIGDITSQDSDDD
                     RKITVFTNDGSVIVLNYRGKLIDSPKYLNIKLAENETICKVFGSKTSDTSDSKEFKIL
                     TAEPTFSFGSQYTYRLYSLRPKEEMKIALEQVVESVILSSWSQNDKLLAFLYYKEKRK
                     QFMIMSVFEKTSALPKEFDFQSILTSQDPSSTSSNNSRYITSMALDSDGSQLALGFAS
                     GVITVVTLEDLQTRVLKWHIDSVLSLSFTQDGTYLLSGGWEKVLSFWQLSTNLQQFLP
                     RLNGVIVDCQPLGNDKYYSIALQMTENFSSSDFQLLLLNSGDLTSRVSINGPLPVFNS
                     VVKNTVQPFSAISSKASTTVSAVNNSKKKHKKKLLKSKRQDYTTCAEINPLSKHIYFP
                     HISAMQMYDFYKNEQVSYQYMTSGINNSMGKVRFELNIKDPEVVNVKFTKNGKWMITY
                     EVEYPPEDLLSSKDLLHTLKFWSQEDNDVNWTLKTKVINPHSTGVPVTSILPAPHAIN
                     GSKGFLTADNAGGLKYWSFQENENNWCLVKLSLPNFNHFSNSVSLAWSQDGSLIFHGF
                     DEKLLTIDFDTFAPFEGSGNIDTINEFNLDSEIQAIKVINNTNLIVATRTTLNTINIL
                     QGQMVNSFDLFPYVNGVYKKGHLDRLIACDEKTGRVALVINQQYEDSNLKLSMGYKAR
                     IVIFNADLSEKLGIFTHEEYIAWIGWNHDTDFIFVDIGSRLGVVGTTINTEMLDEVDK
                     DILLNNLQPGHQDFKQQLLKLSSSKLTEGVIDHDQEDDLTLELINGNKNEKLINMNSF
                     TNMFENIQNVQMDTLFDRVMKVIT"
     gene            <1003031..>1003243
                     /locus_tag="HG535_0F05170"
                     /db_xref="GeneID:59237763"
     mRNA            <1003031..>1003243
                     /locus_tag="HG535_0F05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289835.1"
                     /db_xref="GeneID:59237763"
     CDS             1003031..1003243
                     /locus_tag="HG535_0F05170"
                     /inference="similar to AA sequence:RefSeq:NP_014853.3"
                     /note="similar to Saccharomyces cerevisiae RPB10
                     (YOR210W); ancestral locus Anc_8.627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145730.1"
                     /db_xref="GeneID:59237763"
                     /translation="MIVPVRCFSCGKVVGDKWESYLTMLQEDELDEGTALTKLGLKRY
                     CCRRMILTHVDLIEKFLRYNPLERRD"
     gene            complement(<1003501..>1006152)
                     /locus_tag="HG535_0F05180"
                     /db_xref="GeneID:59237764"
     mRNA            complement(<1003501..>1006152)
                     /locus_tag="HG535_0F05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289836.1"
                     /db_xref="GeneID:59237764"
     CDS             complement(1003501..1006152)
                     /locus_tag="HG535_0F05180"
                     /inference="similar to AA sequence:RefSeq:NP_014854.2"
                     /note="similar to Saccharomyces cerevisiae MGM1 (YOR211C);
                     ancestral locus Anc_8.628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145731.1"
                     /db_xref="GeneID:59237764"
                     /translation="MRLSSGGLYIGLRTSLLGTTGMRASGSRLLALAGRRSRSTSAHG
                     RVAGYLTGYPTTVVNRLHYHSYARAHPFQFRLFQGLNYTSKRFINIFPNIIARAIKFP
                     AYVGGGMAAAGSYLAYKMEKANSYAQDKWGNFRDKLSGLFPNENEYGQNNNNNNGDGD
                     SAGAAALLISSNDDKRESDDDEEEDDNLDEDNTQDEMLNLTKQMIEIRSILNKIDSAS
                     AHLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVNTPNSADVTA
                     DFPALRMYNLKNFKEVKRLLMELNMAVPSTEAVSEDPIQLTIKSSRVPDLSLVDLPGY
                     IQVEAADQPFELKSKIKNLCDKYLNEPNIILAISAADVDLANSSALRAAKNADPQGLR
                     TIGVITKLDLVSPEVARGILTNRKYPLKMGYVGVITRAPRTSKVHVGLFGRDVNLEGT
                     TSAKHSSSDLEPEQIKTRQFEKDFFKENKQVFTNCEVSTKRLREKLIKILEISMSNAL
                     EPTSMLIQQELDDTSYLFKVEFNDRQLTPKSYLLNNIDVLKLGIKEFQEKFNRNELKS
                     ILKADLDQKVLDFLATRYWKDENLQELSSKMSSDEEILYWHKKLELASSSLTKIGVGR
                     LSTMLVTNAILKELENILQETQLRNHDLIKELVTNTAVNVLNTKYYATADQVENCIKP
                     FKYEIDLDSRDWNIAREHAIMLMKEETRQCNERYQAIKNAIGGRKLQQVMGYLQQDPT
                     KKETLGMSKLLLERGSEAVFLNKRLQVLSFRMKLLKNKCHSVNEKDHCPEIFLNAVSD
                     KLTSTAVLFLNVELLSDFFYNFPIELDRKLNILSDEQVEMFAKEDPKIARHIELQKRK
                     DLLDLALEKIDAILVFKKSYKNLAKKK"
     gene            <1006726..>1007556
                     /locus_tag="HG535_0F05190"
                     /db_xref="GeneID:59237765"
     mRNA            <1006726..>1007556
                     /locus_tag="HG535_0F05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289837.1"
                     /db_xref="GeneID:59237765"
     CDS             1006726..1007556
                     /locus_tag="HG535_0F05190"
                     /inference="similar to AA sequence:RefSeq:NP_015198.1"
                     /note="similar to Saccharomyces cerevisiae HHO1 (YPL127C);
                     ancestral locus Anc_8.629"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145732.1"
                     /db_xref="GeneID:59237765"
                     /translation="MAPKKSAIKSKKTGKGVAKANAKAVAKPPAKAPVKATAKAPVKT
                     AGKHPVVKAKGKMSIGVKKEESEASKSYKELITEALLALKERKGSSRPALKKYIKDKY
                     PKIGSSTNFDLYFNNAIKKGVETKDFDQPRGPSGTLKLVKKSAAPAAGTAGTPSPSAN
                     TATAANGKSANGVKKTHEKVKQAKKAPSPIANPTYRDMILAGLLKLNDGKGSSRIALK
                     KFVKDQFFPSSKATSNFDHLFNSAIKKGVETGAFAQPKGPSGLLKKGKGKPIMQKITA
                     "
     gene            <1008416..>1010002
                     /locus_tag="HG535_0F05200"
                     /db_xref="GeneID:59237766"
     mRNA            <1008416..>1010002
                     /locus_tag="HG535_0F05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289838.1"
                     /db_xref="GeneID:59237766"
     CDS             1008416..1010002
                     /locus_tag="HG535_0F05200"
                     /inference="similar to AA sequence:RefSeq:NP_015197.1"
                     /note="similar to Saccharomyces cerevisiae TBF1 (YPL128C);
                     ancestral locus Anc_8.630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145733.1"
                     /db_xref="GeneID:59237766"
                     /translation="MAEVFSDNLSRFNEILQSLPLELRLKISSLSLLDNVSTQLLRLL
                     VSNSGSPQTFEAIEGSSGYPISGERQIFQTLLRLFKEIRLIYNDGSCLLNVHNVAPGM
                     WLPNCSAPLLLRGHETYIMTTIRKANLLTYMLTILGCFDYGFDFLQESFFEVFCPNTA
                     FSGGSSLDQNGKLLKSHGILYLGLKTQAYISGLKTMNNENKNDSMVEDDDLISRSKCE
                     HFLDLIFPNNLDELLILRRTDRSDQNLSELMTPSEREFIERCIRRRENLSQYTSYKSL
                     TQDYSWYHFIKELLDYINKNMGVIILGRKSRGKSTLHSYSISAFDPQVLYASGEGNTV
                     EVEDSPTQQNSMENTDNGPLPGSFASSDSVVHFSAATKVLDPNTHLTAKSIADTAVSV
                     TANHSIAIKKVKPKRTWSKEEEDALVEGLKAVGPSWSKILDIYGPGGKISEALKNRSQ
                     VQLKDKARNWKLHYLKSGRTLPEYLVKVTGTLERTFRSKKKNLKPTLELSQRQSNASD
                     LFRAATTEPSDFDPSLQSTI"
     gene            <1010502..>1011770
                     /locus_tag="HG535_0F05210"
                     /db_xref="GeneID:59237767"
     mRNA            <1010502..>1011770
                     /locus_tag="HG535_0F05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289839.1"
                     /db_xref="GeneID:59237767"
     CDS             1010502..1011770
                     /locus_tag="HG535_0F05210"
                     /inference="similar to AA sequence:RefSeq:NP_014855.3"
                     /note="similar to Saccharomyces cerevisiae STE4 (YOR212W);
                     ancestral locus Anc_8.631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145734.1"
                     /db_xref="GeneID:59237767"
                     /translation="MMNDHLENRTNSCDHYIQPQEIVVPDYLLLEDKIQCKIDSARRE
                     SEQLHQQIDKVRSKACDAQLLEMTRNVGSLNKNKVNLRPTILLRGHNSKISSFKWAHD
                     SKSILSASQDGFMIIWDSVSGFKKNAIPLDSQWVLSCGISPSNALVSSAGLNNNCTIY
                     RVSKEHKVQQNVVSIFKGHTGYISDTDFMDNSHVVTASGDMTCAYWDIPKAKRVREYA
                     DHLGDVLALSIPNEQAQQSGNNIFASCGSDGYSYISDIRAPTMVQSFFVGDADVNAIQ
                     FFRDGNSIVTGSDDGVSRMFDLRSDCSIAEFSLSHSIRHEKHSTHTGSTVDGGDSSSQ
                     RAFASLTSPSYLDNQGVVSLDFSGSGRLMYACYTDVGCYVWDVLKAEIVGKLEGHSNR
                     ISGVRTSPDGQAVCTGSWDSTMKIWTPGYM"
     gene            complement(<1011874..>1012601)
                     /locus_tag="HG535_0F05220"
                     /db_xref="GeneID:59237768"
     mRNA            complement(join(<1011874..1012527,1012593..>1012601))
                     /locus_tag="HG535_0F05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289840.1"
                     /db_xref="GeneID:59237768"
     CDS             complement(join(1011874..1012527,1012593..1012601))
                     /locus_tag="HG535_0F05220"
                     /inference="similar to AA sequence:RefSeq:NP_014856.1"
                     /note="similar to Saccharomyces cerevisiae SAS5 (YOR213C);
                     ancestral locus Anc_8.632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145735.1"
                     /db_xref="GeneID:59237768"
                     /translation="MEIPTIDVTIRVKTQQLIIPSTVAVNGLPRRHWKVGLCMLDEKE
                     GEVEINIISNCTFFLHETFEEPVRSFNSPPFAVEEDGWGEFEMKIVCDFVENGGKFTI
                     RHSLTFDEPAYGVDYDIKVPYHIPLLKTLLSKHFKLPDVSKDEKKNNMSSATSWFKQI
                     ASADQDVVTEVVQMIVSHPAVQAEVNKRPKHDDFLLGIHQLPNELVKRIAEYIRNTDS
                     AQ"
     gene            complement(<1012783..>1013601)
                     /locus_tag="HG535_0F05230"
                     /db_xref="GeneID:59237769"
     mRNA            complement(join(<1012783..1013487,1013593..>1013601))
                     /locus_tag="HG535_0F05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289841.1"
                     /db_xref="GeneID:59237769"
     CDS             complement(join(1012783..1013487,1013593..1013601))
                     /locus_tag="HG535_0F05230"
                     /inference="similar to AA sequence:RefSeq:NP_015196.1"
                     /note="similar to Saccharomyces cerevisiae TAF14
                     (YPL129W); ancestral locus Anc_8.633"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145736.1"
                     /db_xref="GeneID:59237769"
                     /translation="MVTSVKRTVRIKTSQHVLPDLPPVENFPMRQWRIEIYLLDEEGK
                     EIPATIFDKVVYHLHPTFANPNRTFTETPFAIEEQGWGGFPLDISVFLLEKAGERKIT
                     HDLNFLQKEYEIDHVIQIPTNKPLLATELLKSGSVDDAGAKRKASATNGEPKVKKAKT
                     ASASTIKGNVDIEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLY
                     SLPDGLLKSLWEYVKKNTE"
     gene            complement(<1013920..>1014870)
                     /locus_tag="HG535_0F05240"
                     /db_xref="GeneID:59237770"
     mRNA            complement(<1013920..>1014870)
                     /locus_tag="HG535_0F05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289842.1"
                     /db_xref="GeneID:59237770"
     CDS             complement(1013920..1014870)
                     /locus_tag="HG535_0F05240"
                     /inference="similar to AA sequence:RefSeq:NP_015195.1"
                     /note="similar to Saccharomyces cerevisiae SPO19 (YPL130W)
                     and YOR214C; ancestral locus Anc_8.634"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145737.1"
                     /db_xref="GeneID:59237770"
                     /translation="MFLHSIAATLFLLDVIRQSSASKLSFTLTTEELGGDSTDSAAVR
                     PLVVHVDKKNMSPEILKQLYRTSNIIFADFPEVPEFINLKEYENMKSATEELLDQLTN
                     ERNIALENVKKNEKFSEIETLLQEIIDQEDLEKKNAGEELFWGTGISTAAVVNVTNPP
                     ATNAQPSQMQSQVSLSKSIHPQSSHSASSRTKVVSSSSHSTSTYMHPTIAPIQSMTEH
                     PKSSKISSYSSELRTSHGYNSSSSWFKNVTSTSYQTSSGSFVMKPSRSSGTFTSGSWK
                     VHGNFVNATANALNNGSTFVMPTTFIMALLLSAILFALSY"
     gene            complement(<1015178..>1015729)
                     /locus_tag="HG535_0F05250"
                     /db_xref="GeneID:59237771"
     mRNA            complement(<1015178..>1015729)
                     /locus_tag="HG535_0F05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289843.1"
                     /db_xref="GeneID:59237771"
     CDS             complement(1015178..1015729)
                     /locus_tag="HG535_0F05250"
                     /inference="similar to AA sequence:RefSeq:NP_014858.1"
                     /note="similar to Saccharomyces cerevisiae YOR215C;
                     ancestral locus Anc_8.635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145738.1"
                     /db_xref="GeneID:59237771"
                     /translation="MLKLRSPLLQRLNRQIRCASTSSYNNALLTLKKDLKEAMISKND
                     LKKNTIRGLLSAIKNKEIDNRDKNFDEFMLFEVFSKLVKQRQDSIKEFLKNERGELVD
                     KEKQEMQLIQGYMDSLPVSTSEEIDIKAVEYLEKLKASQPELQMKQVFNKIDWNTMPA
                     AWKASPNAIKSSIAAHYKKFFWN"
     gene            complement(<1016039..>1017823)
                     /locus_tag="HG535_0F05260"
                     /db_xref="GeneID:59237772"
     mRNA            complement(<1016039..>1017823)
                     /locus_tag="HG535_0F05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289844.1"
                     /db_xref="GeneID:59237772"
     CDS             complement(1016039..1017823)
                     /locus_tag="HG535_0F05260"
                     /inference="similar to AA sequence:RefSeq:NP_014859.3"
                     /note="similar to Saccharomyces cerevisiae RUD3 (YOR216C);
                     ancestral locus Anc_8.636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145739.1"
                     /db_xref="GeneID:59237772"
                     /translation="MGKNKKKNGKKTKQIAATAGHSTAKEESKEQVDVSATSHLEGIS
                     RDNVPVVQDIDQVEKLESGLEGNSQIENGNRTEDGPSNDLNNSEMHKTQQEIVKLRLE
                     LDEEKKANQKIETLRLELEKEKKNKEDIAKLKLELEEEKKANQKIETLRLELEKEKKN
                     KEDIAKLKLELEEEKKANQKIETLRLELEKEKKNKEDIETLRHELEKEKKARKEMEKL
                     TSSHDEHNKDDLSKELEEIKSERDELETQYNNLLNRISSMKTVFSKMKESQDELNMVK
                     EQLEESESQNVRLKSKLDTLNKEKNEIQKAVVTLSKEFSDLDKEHSALQDQCNEHREE
                     IESLYSKLESSSNEISNELNSSREENAQLKSQIEELMIVLENSKQDITLLKEAKDDLE
                     LNLENILKEKYKMQNTLKELESELEQSLTQYQEETKERTLEIKSLRAQLDSSVESFKE
                     SSKIIETLTQKIESMKEDVSLKAKLEKECKDRVLQIGKLRHEAIILNEHLTKALSMLK
                     QSSDSESVDKELISNLLISFVAIPRADPRKFEVLELISSFLNWDDDKKRQAGLIYSSD
                     NNHKSSGSSTENFVSMWTDFLEKESEAK"
     gene            <1019526..>1022078
                     /locus_tag="HG535_0F05270"
                     /db_xref="GeneID:59237773"
     mRNA            <1019526..>1022078
                     /locus_tag="HG535_0F05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289845.1"
                     /db_xref="GeneID:59237773"
     CDS             1019526..1022078
                     /locus_tag="HG535_0F05270"
                     /inference="similar to AA sequence:RefSeq:NP_014860.1"
                     /note="similar to Saccharomyces cerevisiae RFC1 (YOR217W);
                     ancestral locus Anc_8.637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145740.1"
                     /db_xref="GeneID:59237773"
                     /translation="MVDVTSYFGKGQNSQRVGKSSQPTRLKRKADAPEFIDLDKDDDI
                     EEPQSLKRPRDNVEAKQERRTVDHPKRRASKTGCQKMGSPNESPKIPKNQRKTSLNVH
                     DVLENIPSVDLSGVHVKENVSRFGGTKTSDDAGDLKNVVGFPEGKPNCLLGLTMVFTG
                     VLPSLERSQAEGLAKRYGARVTKSISSKTSVVVLGDEAGPKKVENIKKLGVKAIDENG
                     FKQLIEGMPAEGGDGAAAEKARQKLEQQQQQAILDAETIAKEEDERAKRIASAKKSGQ
                     NMKSSHMVDDKNKLWTDKYAPTSLQQMCGNKGSINKLKNWLINWEQSKKDGFKNAGRD
                     GTGIFRAALLYGPPGIGKTTAAHLVSEELGYDILERNASDVRSKSLLNAGVKNALDNT
                     SVVGYFKKKEQEQESNCDKFVIIMDEVDGMSGGDRGGVGQLAQFCRKTATPMILICNE
                     RNLPKMRPFDRVCLDIQFRRPDANSVKARLMTIAIREKFKLDPNIIDSLLQATNADIR
                     QIINLLSAVSKTSKSIGHENVADIMAAWQKNIALKPFDITHKLLDGRYYTDAGSQSFT
                     LNDKIALYFDDFDFAPLMIQENYLSTRPSNLMPGKSHIAAVADAAESISYSNLVEAKI
                     RSSEQLWSLLPLHAVVSSVYPSSKVAGHMSGRINFTSWLGQNSKSGKYYRLLQGLQYH
                     TRLSTSTDKMGLRLDYMPTFKRRLLNPILKNGAEGIPPVIELMDAYYLTREDWDTIME
                     FQVGPDAADAQLKKIPTSVKTAFTRRYNSTTHPVAIYRTGTTTAVTAGSTIKPDFEDI
                     VDADDGAPPADEDEIKEDEDLKKDKLIKQKAKPTKRKPRATNAGATKKRKTK"
     gene            complement(<1022156..>1024870)
                     /locus_tag="HG535_0F05280"
                     /db_xref="GeneID:59237774"
     mRNA            complement(<1022156..>1024870)
                     /locus_tag="HG535_0F05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289846.1"
                     /db_xref="GeneID:59237774"
     CDS             complement(1022156..1024870)
                     /locus_tag="HG535_0F05280"
                     /inference="similar to AA sequence:RefSeq:NP_014862.3"
                     /note="similar to Saccharomyces cerevisiae STE13
                     (YOR219C); ancestral locus Anc_8.638"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145741.1"
                     /db_xref="GeneID:59237774"
                     /translation="MSSTHSHKRKNSHLFLQRRNSSSADMTSYEMNNMYGNSNNDSND
                     TKNSNETELREQSSDDRTFARAQSEDIENQLLPSPSLNWQFKTHAQKFKKKGIVITFT
                     IVSLVLLALFLIPISRLVRTPGKVNNNFSKRSFTIDQVLKGEFLYEEKDFHFIRPPSL
                     LLSHDADPGLYLTVDNTGDGEFLVAKQLFSDSFSINLGKTSINYNDIEYIIKKVKVNY
                     ALDKMIIGINIKHEYRHSSKGLYFLKDLKTDTINPISPLSTGEPADISYVHFSPCYNF
                     IYYVFENNLYVQNLHSGRPAMQITQDGSSDIFNGRPDWIYEEEIFSNEKAVWWAPDDS
                     KLVFAKINDTEVLDYYIPKYTNEDNSASICKLKYPRPGTKNPKISLLMLDLQVGTVYA
                     LNLIDERNENDKPFKDLIIYDANWIDPNTFLFKIADRTSKKMLVKVYEKHPDFESLDT
                     VRMLDATQYGGWIEKTRRILPIPPNVELGRRTYGYVDIETDASGFNHLFYYDTSKATE
                     GKQITSGDWEVTGRGIVGYEYESDTIFFTANAIGQMSQHLYGVAFNLNGDSEIRTFQN
                     PESKEDFYDYELSSSGNFALMRKLGPGVPFTAAGLLIDVFDANNIHDMHTITLIDNTT
                     IEESLVKYDLPHKRYSSMVIEDNVRINYVEIRPAHLDVDRKYPVLVSVYGGPGSQTYT
                     TKHSVFFEEAVSSGLNAIVLEIEPRGTGGKGWAFKKWATERIGYWEPRDITEVTKRYI
                     AQNRNMIDEDHIAVWGWSYGGFSTLKTVEYDSGQVFKYAMAVAPVTNWSYYDSFYSER
                     YIGDPIVNYKTYRDTAAVINVENFKKLERFLIIHGTADDNVHIRNTYEFIDKLNTLNI
                     ENYDMHIFPDSDHSIQFHNSQQIVFRKLYYWLQGAFNGHYKHLETAVK"
     gene            complement(<1025065..>1025955)
                     /locus_tag="HG535_0F05290"
                     /db_xref="GeneID:59237775"
     mRNA            complement(<1025065..>1025955)
                     /locus_tag="HG535_0F05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289847.1"
                     /db_xref="GeneID:59237775"
     CDS             complement(1025065..1025955)
                     /locus_tag="HG535_0F05290"
                     /inference="similar to AA sequence:RefSeq:NP_015194.1"
                     /note="similar to Saccharomyces cerevisiae RPL5 (YPL131W);
                     ancestral locus Anc_8.639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145742.1"
                     /db_xref="GeneID:59237775"
                     /translation="MAFDQVIKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKY
                     ATPKYRLVVRITNRDIICQIVSSTITGDVVLAAAYSHELPKYGISHGLTNWAAAYATG
                     LLIARRALQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVF
                     GALKGASDGGLYVPHSENRFPGWDFEAEELDAEMLRSYIFAGHVSQYMEELADDDEER
                     FSELFKGYLADDIDADSVEDIYANAHEAIREDPSFKPTEKKFTKEQYAAESKKYRQVK
                     LTREQRQERVAAKIAALAGN"
     gene            <1027998..>1028777
                     /locus_tag="HG535_0F05300"
                     /db_xref="GeneID:59237776"
     mRNA            <1027998..>1028777
                     /locus_tag="HG535_0F05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289848.1"
                     /db_xref="GeneID:59237776"
     CDS             1027998..1028777
                     /locus_tag="HG535_0F05300"
                     /inference="similar to AA sequence:RefSeq:NP_014863.1"
                     /note="similar to Saccharomyces cerevisiae YOR220W;
                     ancestral locus Anc_8.640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145743.1"
                     /db_xref="GeneID:59237776"
                     /translation="MPKTQILITDIPTAYFKEKWPDQLEKELFVKLFPQFSSNLLYYS
                     PLAFLNRIVIIMDNEETTIQMYNSLKNLLASQKRTAKLYLTESLLTKPKSRSSDDLTL
                     MSKRSPERQNTNTTTDTHLEQPESQRLQTPSQQLSQASKPILSIDTDPSSTGISTYSL
                     SIGSPSLSPDRTSLESPTMLKFDSQSKLHYYKEPLPKLNKRVSQSTFDSSPADTTTYL
                     FKPRNTGDLASASSTDMVSSSSSRIDIPPPSPSITLNEFHL"
     gene            complement(<1028894..>1029772)
                     /locus_tag="HG535_0F05310"
                     /db_xref="GeneID:59237777"
     mRNA            complement(<1028894..>1029772)
                     /locus_tag="HG535_0F05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289849.1"
                     /db_xref="GeneID:59237777"
     CDS             complement(1028894..1029772)
                     /locus_tag="HG535_0F05310"
                     /inference="similar to AA sequence:RefSeq:NP_015193.1"
                     /note="similar to Saccharomyces cerevisiae COX11
                     (YPL132W); ancestral locus Anc_8.641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145744.1"
                     /db_xref="GeneID:59237777"
                     /translation="MTQLFLWGFNTVIRGTHCSLARCSLPSVGLSATLRPKYVSGCFK
                     RLNSTKSPRIDLNKMSTEEIRALRNEWIARQRKYKDRTAALYFSSVAVIFLGLAYAAV
                     PLYRAICARTGFGGIPITDKRKFTQDKLVPVNTDKRIRISFTSEVSQILPWKFTPEQR
                     EVYVHPGETALAFYKAKNRSRDDIIGMATYSITPGEAAQYFNKIQCFCFEEQKLSAGE
                     EIDMPVFFFIDPDFASDPQMRNIDDIVLHYTFFKAHYNDGSAVTKGETIDKEKAAISS
                     QLLSPQVVNVQEEAGE"
     gene            <1029964..>1031130
                     /locus_tag="HG535_0F05320"
                     /db_xref="GeneID:59237778"
     mRNA            <1029964..>1031130
                     /locus_tag="HG535_0F05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289850.1"
                     /db_xref="GeneID:59237778"
     CDS             1029964..1031130
                     /locus_tag="HG535_0F05320"
                     /inference="similar to AA sequence:RefSeq:NP_015192.1"
                     /note="similar to Saccharomyces cerevisiae RDS2 (YPL133C);
                     ancestral locus Anc_8.642"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145745.1"
                     /db_xref="GeneID:59237778"
                     /translation="MEGPEKRRKKVSRSCVFCRRSHLICDEQRPCKRCIKRDIAHLCT
                     DEPLSNSVTPVSITEPDEQLRPGDNEIKKNDHMEGLHMYNGSASQMNRAPSFLTQQPT
                     FVSEHVGSEFSSLNAFLNMLDDPVLMNHGPATNSEISSHHSLPQQSMIGSPEPSLPVL
                     LEDQNSAVENAPTPKEHFFLTAADPSTEMTPEDRLKSVINAKLEAGLLQPYNYAQGYS
                     RLQNYIDKYMNQSSKQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFERLLLSYDRV
                     FTSMSMPACLWRRTGEIYRGNKEFGSLVDCTVDDLRDGKLAIYELMSEESAVNFWEKY
                     GSIAFDKGQKAVLTSCNLRTRDGRKKRSCCFSFTIRRDRYNIPICIVGNFIPIS"
     gene            complement(<1031219..>1032277)
                     /locus_tag="HG535_0F05330"
                     /db_xref="GeneID:59237779"
     mRNA            complement(<1031219..>1032277)
                     /locus_tag="HG535_0F05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289851.1"
                     /db_xref="GeneID:59237779"
     CDS             complement(1031219..1032277)
                     /locus_tag="HG535_0F05330"
                     /inference="similar to AA sequence:RefSeq:NP_014864.4"
                     /note="similar to Saccharomyces cerevisiae MCT1 (YOR221C);
                     ancestral locus Anc_8.643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145746.1"
                     /db_xref="GeneID:59237779"
                     /translation="MRLVTFPGQGTPISIPMLKSVIRNKGKEFQTVLDNCGEKSNDLL
                     QFILKNPSSPGSIAACSNLYYQLYKTTETRPKKSVLLGHSLGELVCLSANNLFSLKDL
                     FDIANYRNELMVQYTENYLHAHRISRSSLFEMWALSSPRARNLPEEVTQLLSALPIGT
                     VSIANANSIKQCVVTGLVEDLESLRTELHLKIPLLRITELTNPFNIPFHNSTVLRPLQ
                     ERLYDYIWQILKRNNTHTLTELDYPIIANLDGRISFLVRHALERFVKCSSNTVQFTMC
                     YDTINNDLAKDLDEAVCIGPGNVIYNLIRRNCPHLKTYEYSSLTTIEKFHDAHVNDNE
                     KSSFKKQVDDGNEIENKI"
     gene            <1033059..>1033967
                     /locus_tag="HG535_0F05340"
                     /db_xref="GeneID:59237780"
     mRNA            <1033059..>1033967
                     /locus_tag="HG535_0F05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289852.1"
                     /db_xref="GeneID:59237780"
     CDS             1033059..1033967
                     /locus_tag="HG535_0F05340"
                     /inference="similar to AA sequence:RefSeq:NP_014865.1"
                     /note="similar to Saccharomyces cerevisiae ODC2 (YOR222W)
                     and ODC1 (YPL134C); ancestral locus Anc_8.644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145747.1"
                     /db_xref="GeneID:59237780"
                     /translation="MSDPKPLPFIYQFAAGAVAGISEILVMYPLDVVKTRMQLQVGKA
                     SGATAGQEQYSGVIDCLKKIVQKEGASRLYKGISSPVLMEAPKRATKFACNDEFQTIY
                     KKLFGVSALTQPLSILSGASAGICEAFVVVPFELVKIRLQDLNSSYKGPIDVVKQIIA
                     KEGTLAMYNGLESTMWRHGVWNSGYFGIIFQIRGALPKPKSKTEKTRNDLIAGTIGGT
                     IGSLLSTPFDVVKSRIQNTASIAGVVRKYNWSWPSLFVIYREEGFKALYKGFVPKVLR
                     LGPGGGILLVVFTEMTDFFRRMKNIQ"
     gene            <1034533..>1035345
                     /locus_tag="HG535_0F05350"
                     /db_xref="GeneID:59237781"
     mRNA            <1034533..>1035345
                     /locus_tag="HG535_0F05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289853.1"
                     /db_xref="GeneID:59237781"
     CDS             1034533..1035345
                     /locus_tag="HG535_0F05350"
                     /inference="similar to AA sequence:RefSeq:NP_014866.3"
                     /note="similar to Saccharomyces cerevisiae YOR223W;
                     ancestral locus Anc_8.645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145748.1"
                     /db_xref="GeneID:59237781"
                     /translation="MSEEPLLPLYNDSSLRRYIVIRFSDVGIRDLDIDVTNIPYSDIN
                     TQWLRRKCRALHPEETSNRRLKFIRSGAMLKSHSDLSREMNRYFIQHRDQQDSNRFYI
                     HCIVGSETLSNEQLTNEDALDDVSPSNEGTTTQAIGFDRLRAVGFSEQEIELLRQQFR
                     HTYGDLEEEASRHNGNEDGSTDIRQLEEQWMETGVDDGSGRALDDNRFNSIAVANFKH
                     NKDLLIGICIGFVFGIFGLLLMKLDGLFNKRQKMSIVAGVIVNIMFNLFRGF"
     gene            complement(<1035425..>1035862)
                     /locus_tag="HG535_0F05360"
                     /db_xref="GeneID:59237782"
     mRNA            complement(<1035425..>1035862)
                     /locus_tag="HG535_0F05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289854.1"
                     /db_xref="GeneID:59237782"
     CDS             complement(1035425..1035862)
                     /locus_tag="HG535_0F05360"
                     /inference="similar to AA sequence:RefSeq:NP_014867.1"
                     /note="similar to Saccharomyces cerevisiae RPB8 (YOR224C);
                     ancestral locus Anc_8.646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145749.1"
                     /db_xref="GeneID:59237782"
                     /translation="MSNTVFDDIFVVNDVDPGRYNKVSRIEATSTTQEQCKLSLDVNT
                     DLFPIQLQDQVSIAVATSLSLDKTTQDSSATRSWKPPQPNERSLADDYDYVVYGVSYK
                     FEEVSKDLIAVYFSFGGLLMRLEGNYRTLNNVKQENAYLLIRR"
     gene            complement(<1036204..>1036668)
                     /locus_tag="HG535_0F05370"
                     /db_xref="GeneID:59237783"
     mRNA            complement(<1036204..>1036668)
                     /locus_tag="HG535_0F05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289855.1"
                     /db_xref="GeneID:59237783"
     CDS             complement(1036204..1036668)
                     /locus_tag="HG535_0F05370"
                     /inference="similar to AA sequence:RefSeq:NP_014869.3"
                     /note="similar to Saccharomyces cerevisiae ISU2 (YOR226C)
                     and ISU1 (YPL135W); ancestral locus Anc_8.647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145750.1"
                     /db_xref="GeneID:59237783"
                     /translation="MFRFIRPGFSGSGMSAAGTRLTRRLYHPKVIDHYTNPRNVGSLD
                     KTLPNVGTGLVGAPACGDVMKLQIQVDDSGVIQNVKFKTFGCGSAIASSSYMTELVRG
                     KTLEDAAKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYQSKRKPTSLT"
     gene            <1037910..>1041554
                     /locus_tag="HG535_0F05380"
                     /db_xref="GeneID:59237784"
     mRNA            <1037910..>1041554
                     /locus_tag="HG535_0F05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289856.1"
                     /db_xref="GeneID:59237784"
     CDS             1037910..1041554
                     /locus_tag="HG535_0F05380"
                     /inference="similar to AA sequence:RefSeq:NP_014870.1"
                     /note="similar to Saccharomyces cerevisiae YOR227W and
                     GIP3 (YPL137C); ancestral locus Anc_8.648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145751.1"
                     /db_xref="GeneID:59237784"
                     /translation="MMNSVIVDIPTDWLYRGKRRQAKAKAGKQDVDGGLASEVAIEGA
                     GAAAPAGSLGEGERLPLRSRSASISNAALSKPAVKKPSPAQRSSSTNGAEQLQTATQL
                     EAEAPSRQQQVQPQQQQQKMRRSSSVSFSDLKKGDALNERSKKSLFGSLFGKKSTPSP
                     PLSRSQPQSQQQHQHQQQQHHAQNGASHTHHPVSSSIITHSITNSVMKEPVSPEVRPQ
                     TPILHPACLELHKPSATIPFGELAKIRLKRVTFAVDKFDCDPPQQLPSRKPKMGNVLV
                     PEDMISDVPPISLGITNGNPSPQQQQQQQQQQAHLEQQLQATAAAAAASSSTPVSQRE
                     PRYTKDSKEYKIALDDYRRALKESVKHQQEAHFAAKRIESEVASFKASSSLGRINSPK
                     WSQQVENDTTATVVDDKVASLSIDKPIHMHENHFNEYTKESSNMDAKNESETTLDVVY
                     TRCCHLREILPIPSTLRQVKGKTAPLHTLKFLNPKPTLIDILSFCDFISVVPINIVIF
                     DKVSLTPEMFQIVLMSLVNSTVLEKLSVRNVPINQGGWRLLCKFLLENKSLVRLDISQ
                     TKKRQDLPEILHRDNMDWSLFSQVLTKRTGKPLEELLMNGIKFQNLPIEQLEILLESF
                     GKANSKSPLRLGVATSDINTDCIKCIFNWMSKYKVQGVDLAFNDLSELVKVMVSKLSA
                     LELKNLEYFTLNSTNISSAYDLALLLKYLSLLPALKFLDISNLPQTFPDVLPYMFKYL
                     PRFPKLNRINLDNNNLSFKNMSMLCNILGKCNNLTHISIQSQTTVFDAIGPNNDMIKT
                     PEDLEQFKRFSRNTFSASLYALVKDSPNLVILDVDYDNITDDIKSRIALMLMRNMNKN
                     IDSNFQIDELSTQDELIFDGSLVTETAEEVLKRINNKEILNTDPTKRYLTKKYCEKLQ
                     KLHLKVQYKIDDMFEKRSSGELPLQEKENLLRLLLLEKNLTNILEIYANIPHLSQILG
                     PSSTQLPSLKHVSSEQALSTPVSAEHEIAARPHLMATDSGRVIDVITGKSLLVDSPSN
                     VSRVGSRRQEEEEGELHKWGFFVQQQRSIYPEHESRRPERVQHNESASSGSERSNNTA
                     KSDKLAQPILLPKIPSGTELREAIIQAKGIDSIDDLIKNVNKEQVELESIYGSSLRST
                     GSMTEHSLETRASSNICSVGTDSESGSECLHSTSKDHEEATVKETYDKLLNNLKMERP
                     IKPEGPPKLK"
     gene            complement(<1041698..>1042645)
                     /locus_tag="HG535_0F05390"
                     /db_xref="GeneID:59237785"
     mRNA            complement(<1041698..>1042645)
                     /locus_tag="HG535_0F05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289857.1"
                     /db_xref="GeneID:59237785"
     CDS             complement(1041698..1042645)
                     /locus_tag="HG535_0F05390"
                     /inference="similar to AA sequence:RefSeq:NP_014871.3"
                     /note="similar to Saccharomyces cerevisiae YOR228C;
                     ancestral locus Anc_8.649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145752.1"
                     /db_xref="GeneID:59237785"
                     /translation="MAKVEKHQDIFKMSLQELPPEPVEIDDPPEDPYRPKKFLGLPIY
                     AISHRSVIMGLRTIQKYSTIPMVAYFPLHAINTLVIPSISTDSAPDDVLMMIRELLPS
                     FTTKLLVGSSIVHLTCGLILRVWKLWSTSASSFKRRRRRRRSHRKKEVSIHLEDTRER
                     TSQRVIGLTGGLSGYFVGFNKSFNIPPQVLTGYILVPFLAYHLAIMKVIPNSSRIFVD
                     IDFNFVKWIFKHEDWRIRIFGGFIPFSMLIWSGTYHIIAGTCQYLRIKDISKRRKWSN
                     FITFLVGSGIFGIYRLSKIPNSILGSDRYEKIFRRLYML"
     gene            <1042789..>1043826
                     /locus_tag="HG535_0F05400"
                     /db_xref="GeneID:59237786"
     mRNA            <1042789..>1043826
                     /locus_tag="HG535_0F05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289858.1"
                     /db_xref="GeneID:59237786"
     CDS             1042789..1043826
                     /locus_tag="HG535_0F05400"
                     /inference="similar to AA sequence:RefSeq:NP_015187.1"
                     /note="similar to Saccharomyces cerevisiae SPP1 (YPL138C);
                     ancestral locus Anc_8.650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145753.1"
                     /db_xref="GeneID:59237786"
                     /translation="MSLPDWCPPYSKNRSLSITGEEVFCICKKPDTGKLMVGCDGCDD
                     WFHFTCMRIPEQYKDLVFSFYCPYCQAGVTGPASTSVEHKELPRTIWKRKCRLHNCFK
                     ECKPNSKYCCEEHGEQYMRQVLSKLRIDGMKQEQQENLVLRMAKYTKTGNVEDGFQKI
                     GNPAFIEGEVDKSQDPELYSSLIANDERMEELRSEDHKLGTETIPNCKQAIEHLNNYL
                     DWLNKVNSKLFAEDVVQDDINGKNRKKKSAARKKQKNAICGYNPTCKPPLTVDEFAAK
                     YDPEKASINGTCTKLRCNKHNDWSTMLMQQYTNKLRSLQNHQERIALLLSTRKSQLHI
                     QYYERLLRRKT"
     gene            <1044286..>1045719
                     /locus_tag="HG535_0F05410"
                     /db_xref="GeneID:59237787"
     mRNA            <1044286..>1045719
                     /locus_tag="HG535_0F05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289859.1"
                     /db_xref="GeneID:59237787"
     CDS             1044286..1045719
                     /locus_tag="HG535_0F05410"
                     /inference="similar to AA sequence:RefSeq:NP_014873.3"
                     /note="similar to Saccharomyces cerevisiae WTM1 (YOR230W)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145754.1"
                     /db_xref="GeneID:59237787"
                     /translation="MSDIKKNKLKNEEYKIWKKSIPLLYNHISSFKPKFDTRFDDILK
                     FDKRFTFTNKIIPDKEKGLLSTSALYSQGSDIYEIDCALPLGAFYKSSEETGKEQLPD
                     PDYGDAFRQVEKTSLKSTWNFPGENIIKMDYTGGPQRDSCLLAMSSNGSLAWFKKDVK
                     VPVHIMQEIMGPGTSFSSIHSSRNSNSLTISDFALSDDLETLVKCQSTVGEEESILKI
                     ADNSGKPGEVLRKINVPATVTHSVRFFDNHLFATCSDDNVTRFWDTRTNDKALWTLQD
                     PNHGKILSFDVSKVLDTLFATGSDTGIVKVWDVRAVAAATEDFTNRQNGQDPIQKELI
                     SLYHSGGDDVVDLQFSPTSSSEFLTVGGSGNIYHWDMEYFFSEFDDDNADVDDLDLAT
                     VEALQKQCLRFLHTGGSRRSIGAKGKRNTVAWHPVIDSLVGTVDTDSLITVYKPFSGR
                     EQDDDNDEIEGKDEAQEKDAETAKGAD"
     gene            complement(<1045992..>1047377)
                     /locus_tag="HG535_0F05420"
                     /db_xref="GeneID:59237788"
     mRNA            complement(<1045992..>1047377)
                     /locus_tag="HG535_0F05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289860.1"
                     /db_xref="GeneID:59237788"
     CDS             complement(1045992..1047377)
                     /locus_tag="HG535_0F05420"
                     /inference="similar to AA sequence:RefSeq:NP_010563.3"
                     /note="similar to Saccharomyces cerevisiae MTH1 (YDR277C)
                     and STD1 (YOR047C); ancestral locus Anc_5.644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145755.1"
                     /db_xref="GeneID:59237788"
                     /translation="MFVSPPPASTKVQGLGRRHVHVGGHVAPVNNGALQSIPEDFAMA
                     GSSGSREQPMYQPRQDLPSQQAGTMLPSPIKLEAANFVNAPPEYADRARDEIRKRLLQ
                     SSNGAGAGSLSTASSNSPSVRTPRSSRASSVLDSRSVMSDGASSIFSQPMTVYTQSTR
                     ESSLLPSQKIVTQVSLEDALPKTFLDMYPPEILLGEPSNLLCNGRPKFTERELLDWEL
                     NDIRSLLIIENPRPEWGNQLPSIIANHPNLPNFRFQLLPLSSSDDFIIETLVNSDLYL
                     EANLDFQFKLTSARYTVTSARKRHEHITGKNEPIMHLSKPEWRNIIENYLLNIAVEAQ
                     CRYDFKHRCSEFKKLKLQQELQQNLKRPNMPPPSFIPVNEKRSPVSKNNGSASLLRKT
                     LMKNLQLKNFNKSNEHQNNEKPNLSTGSNQTVGKISLTKDEKAKLWSHCQAQVYQRLG
                     LDWQPDKVTGL"
     gene            <1047611..>1048204
                     /locus_tag="HG535_0F05430"
                     /db_xref="GeneID:59237789"
     mRNA            <1047611..>1048204
                     /locus_tag="HG535_0F05430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289861.1"
                     /db_xref="GeneID:59237789"
     CDS             1047611..1048204
                     /locus_tag="HG535_0F05430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145756.1"
                     /db_xref="GeneID:59237789"
                     /translation="MASERLEKQHQSEAVCTAYSGARPQRPSKCCRGRCVKSAKRSLQ
                     FFRPDLLSEHLCTFFIAVSKEVRPTTRFFCFGVHHFGSATDVSPVTVETSDKCTKRKR
                     GDNCWDSRAPPLRLERCSGERNICQDISECGDFSRMKRGSGPKRRGGGAGQRSPPRRN
                     LETGWRRGGVSFFLLQGSEQYAPCRAQMAGMFDGFGL"
     gene            complement(1048437..1048508)
                     /locus_tag="HG535_0Ftrna9E"
                     /db_xref="GeneID:59237906"
     tRNA            complement(1048437..1048508)
                     /locus_tag="HG535_0Ftrna9E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAG"
                     /db_xref="GeneID:59237906"
     gene            complement(<1049546..>1052668)
                     /locus_tag="HG535_0F05440"
                     /db_xref="GeneID:59237790"
     mRNA            complement(<1049546..>1052668)
                     /locus_tag="HG535_0F05440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289862.1"
                     /db_xref="GeneID:59237790"
     CDS             complement(1049546..1052668)
                     /locus_tag="HG535_0F05440"
                     /inference="similar to AA sequence:RefSeq:NP_014691.1"
                     /note="similar to Saccharomyces cerevisiae RAT1 (YOR048C);
                     ancestral locus Anc_5.645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145757.1"
                     /db_xref="GeneID:59237790"
                     /translation="MGVPSFFRWLSRKYPKIISPVLEEQPPVVDGVALPIDYAAANPN
                     GELDNLYLDMNGIVHPCSHPENKPPPETEDEMLLAVFEYTNRVLNMARPRKVLVIAVD
                     GVAPRAKMNQQRARRFRSARDAQLENEAREEVLRQREQVGETIDHSVKSKKTWDSNAI
                     TPGTPFMDKLAAALRYWISFKLATDPGWKNLQVVISDATVPGEGEHKIMNFIRSQRAD
                     PQYNPNTTHCIYGLDADLIFLGLATHEPHFKILREDVFAQNNRRKHNFKDTLNMTEEE
                     KQLLAKQDSEKPFLWLHVSALREYLAAELWVPKLPFPFDLERAIDDWVFMCFFCGNDF
                     LPHLPSLDVRENSIDILLDIWKSVLPGMKTYMTCDGNLNLESVEMLLQQLGYREPDIF
                     KTRHIQEVRKQEAAQRRKMQKNMSKGQDRHPTVFNEQLQLYDTNGELAKGSWNLTTSD
                     MVNLKKEIMLANEGNAEAIAIVKAQSDKNNSLVEEISKGNMEKVIDDANKANFTVADM
                     MKKKLIAKKHKLELEEEEKSERQSKKRDTEAHSTITDELGKEIEEEVKKEVEEEDDDD
                     DENDGENDGEENSSALKKDVPDQKSLGIKTEEVPIVSHGDMKAGVFDSDAVVKLFESG
                     YRERYYLAKFNIERDQIEALRKDLVRCYIEGVSWVLAYYYQGCASWDWYYPYHYAPFA
                     SDFFGFSNMEVKFEKGTPFLPYEQLMSVLPAASGHTLPEIFRPLMSEPTSEIIDFYPA
                     EFPIDMNGKKMSWQGIALLPFIDATRLLKVVRAQYTLLTEDEKSRNVRKDPILLISNK
                     NVNYEKFAKKLYKELSEQKDFELKFQHFKSGLSGNVMVDNEGFVINSKLSCPIQTGSL
                     PELSTNLFLKMRYKFPELPSRNKSVILNGFIPSEAVLNNYDIDSIKYKYSNQNFSRSS
                     QWNFENTMKQNVVPVGPSGITQYQPRVGGFRAFFYFAQSNATANQYPSQFGNNNEHGN
                     GYNNNDHYNNNYNNSYNSYNYSSDKGYNQGSRYNDSGNYSQRFNNRGRYQQSRGTQSR
                     SNRGSFQHRR"
     gene            <1052987..>1054222
                     /locus_tag="HG535_0F05450"
                     /db_xref="GeneID:59237791"
     mRNA            <1052987..>1054222
                     /locus_tag="HG535_0F05450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289863.1"
                     /db_xref="GeneID:59237791"
     CDS             1052987..1054222
                     /locus_tag="HG535_0F05450"
                     /inference="similar to AA sequence:RefSeq:NP_012760.1"
                     /note="similar to Saccharomyces cerevisiae YKL162C;
                     ancestral locus Anc_5.646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145758.1"
                     /db_xref="GeneID:59237791"
                     /translation="MTQVLQRYLFQRIAVRNKSTHPVKIGIEELRFKKKTQAITNGSI
                     ALRDYYEWHKLSDIMVSETFFTHRGKCGGLGRSPSSQNDLLLYDPIMTHCIAKWLLVN
                     YKLNSYPYHDLNIVNIYADLRQSLQIAKTMMTYFKAVLSDTMFERIRFIMVPLYDHKH
                     AQVEKIRQEIPGEIELITDDAIFLSQGQDGIGQASPLVIEDPVSIIMLNDVMKNLSHD
                     VIKYSYEKNKWEQGYLEFDSHGNKRLEFQDSVDFWCKFAIENTLEDQIPSRQNPNQTV
                     YIPTRLAQLFEMIRKFAPQHRFFAVDEPQRWNPSVTSMLRLLLGYNPIRGSKVMKQRQ
                     GIELEDPVFMPDFTQVQQMYMNINGMGKISEINDLGEFVDKWVNLGNDYKNANITMDQ
                     LVSQLKMINESTLATIHSN"
     gene            complement(<1054338..>1055537)
                     /locus_tag="HG535_0F05460"
                     /db_xref="GeneID:59237792"
     mRNA            complement(<1054338..>1055537)
                     /locus_tag="HG535_0F05460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289864.1"
                     /db_xref="GeneID:59237792"
     CDS             complement(1054338..1055537)
                     /locus_tag="HG535_0F05460"
                     /inference="similar to AA sequence:RefSeq:NP_014692.1"
                     /note="similar to Saccharomyces cerevisiae RSB1 (YOR049C);
                     ancestral locus Anc_5.647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145759.1"
                     /db_xref="GeneID:59237792"
                     /translation="MLLEAAYGALLSARDSGSDSSSDGTGPVVDGISPVSMYSGMVPN
                     LAFNIAMLVIWSLLLAFHTTMVWWKQYWFSIAFMCAGIMEVIGYVGRVISHYNVFKID
                     PFLMQMVCLTIAPVFTMGGVYYQLAKLIEIYGHRFSLLPSPMAYSYIFIACDIISLVI
                     QAAGGGQSGSAATSGTNTDVGDNIFVGGLAVQVASMTIFICLMLHLFYKVFVQTRIDH
                     AGVNRLSWSLFKIPQTEIDYMYRKKFQHVRLNPDRWVFHYFPFALALAVFLIFVRCCY
                     RLAELAEGWGGNLITHENYFIILDALMMAAATTILTVFHPGLAFRGREVTIKITRGHV
                     DPETLQDLEKEKYSGEGTSEDDEKSNHSTKNAFLSFFRRKASTRSRTGTDTTTVKLEQ
                     ASLKESQ"
     gene            <1056831..>1059047
                     /locus_tag="HG535_0F05470"
                     /db_xref="GeneID:59237793"
     mRNA            <1056831..>1059047
                     /locus_tag="HG535_0F05470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289865.1"
                     /db_xref="GeneID:59237793"
     CDS             1056831..1059047
                     /locus_tag="HG535_0F05470"
                     /inference="similar to AA sequence:RefSeq:NP_012993.3"
                     /note="similar to Saccharomyces cerevisiae GPT2 (YKR067W);
                     ancestral locus Anc_5.648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145760.1"
                     /db_xref="GeneID:59237793"
                     /translation="MVEEAGKDTGAGNSGGSGVSAASEAHVPNGAQVYDNPYDGRSYN
                     LKAWLFDVVIFILDTLFTIFFREIKVRGGHNVPPVGTPTILVCAPHANQFIDPSLVMV
                     TTRKLSRYDKSRQVCFVTAESSLKKKFVSLFGVSTGAIPVPRAQDNLQFVDSRIKIYC
                     PDFNDPTLIKGKYEYESDELEGFDKLFKPKSLLGLPNYLGNAQIAEIIDGRTLRIAAP
                     FKFKSNKKIRALLTEGTNFNYAAKIDNSKVFQNVFNHLHTKGCVGIFPEGGSHDRPSL
                     LPIKAGVAIMALGATAADPSMNVAVVPCGLHYFHRDKFRSRAVLEYGEPIIVDGEMGK
                     RYSQNPRETVSDLLQTITKSLYSVTENAPDFETLMTIQAARRLYQPVRSKTALSLVVE
                     VNRRLLFGYSIFKDDPRVVHLKKMVSAYNSTLDSLGLKDHQVEELKTETKDIIRGVFT
                     LVSRIVRLFVFIALSLPGSILFTPIFISCRWYARKKAQDGLKKSLVKIKGTDLLATWK
                     LLFALVFAPILYITYSLLLVFLYVRNNRWIIRMWVPSNNIFIQFFYFYALLVLTTYSS
                     LKTGEIGMDLFKSLPPLFITLIYPGKKISQLKSMRKQLSAEVTGVCTELGPKVFPNFK
                     SLVKDEYEKEEASKSHDINPAFRYTLSMASQELHESQVPKERSRSSSTSSSEYSASNS
                     LSKVNSRGSLTDIPIFADGRQPSSESDDEIDLTTEDNDGSKISSMIRSKWEHEKND"
     gene            complement(<1059115..>1059708)
                     /locus_tag="HG535_0F05480"
                     /db_xref="GeneID:59237794"
     mRNA            complement(<1059115..>1059708)
                     /locus_tag="HG535_0F05480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289866.1"
                     /db_xref="GeneID:59237794"
     CDS             complement(1059115..1059708)
                     /locus_tag="HG535_0F05480"
                     /inference="similar to AA sequence:RefSeq:NP_012994.1"
                     /note="similar to Saccharomyces cerevisiae BET3 (YKR068C);
                     ancestral locus Anc_5.649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145761.1"
                     /db_xref="GeneID:59237794"
                     /translation="MSSKSSGSAQLRSLKIMGEDVWKNRTEKVNAELFTLTYGSIVSQ
                     LCIDYQRDFQKVNKQLFSMGYNIGVRLIEDFLAKTALPRCENMVKTSEAISKCAFKIF
                     LNMTPQVTNFSPEKDAFSLIIDENPLSDFVELPMDAMKQLWYSNILCGVLKGALQMVQ
                     LECDVWFISDVLKGDAHTELRIKLNKVLKDEIPIGED"
     gene            complement(<1059948..>1061186)
                     /locus_tag="HG535_0F05490"
                     /db_xref="GeneID:59237795"
     mRNA            complement(<1059948..>1061186)
                     /locus_tag="HG535_0F05490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289867.1"
                     /db_xref="GeneID:59237795"
     CDS             complement(1059948..1061186)
                     /locus_tag="HG535_0F05490"
                     /inference="similar to AA sequence:RefSeq:NP_014694.1"
                     /note="similar to Saccharomyces cerevisiae YOR051C;
                     ancestral locus Anc_5.650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145762.1"
                     /db_xref="GeneID:59237795"
                     /translation="MAKRALGLGQKSKEKKRKLEEKQATDSRDATPGADQLSVEMDEN
                     ADLDNEFSQLKGLWKTYFASDRESEMVLNGIVHECDRLLRQSSEDAAVKASLSGEFHS
                     IYALALSELTIFKAGEDGDSKDEKLVKGFFDNALERCELGQSSFPDSALLNLVKAKII
                     IQRIPLEYISQLNVKSTGKRFDVDLDDQLEIAKKNFNIYDDDLQLSSEVLQMLDDLLD
                     IVENFGHEDDIDEGLDSDDEEELEKIELSPSHPLFKLQKSVPENYKWLREQMIQLLQH
                     IKEKDSKLYHDTARSIGHLYLKFAEEPSSEFMRLQYGDEEEDPKKQSASKDCINAQRN
                     ALKYTKEALKYLEKGKISDEPETWVEVAEAYISLGNLYDYQSKDQEHAYSVAETILKK
                     ANKASHGKFQDILDNLLDKE"
     gene            <1062049..>1063818
                     /locus_tag="HG535_0F05500"
                     /db_xref="GeneID:59237796"
     mRNA            <1062049..>1063818
                     /locus_tag="HG535_0F05500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289868.1"
                     /db_xref="GeneID:59237796"
     CDS             1062049..1063818
                     /locus_tag="HG535_0F05500"
                     /inference="similar to AA sequence:RefSeq:NP_012995.3"
                     /note="similar to Saccharomyces cerevisiae MET1 (YKR069W);
                     ancestral locus Anc_5.651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145763.1"
                     /db_xref="GeneID:59237796"
                     /translation="MSVSPMIVAADCTGQVTLVVGTNAIGVTRGRINGILKAGASAVV
                     VNPSDGHVKGLLGQFGKHELFQLVNRKFELSDLTRLGRPVVAKVVDRVFVNLAMDQWP
                     LAKDIYDQCVKLRIPVNTLQRPEYSTFHLLSTYTDPKGSGLQIAVTTNGQGCLLANRI
                     KREIVSSLPGNISEVVSNMGSLRNHIINEDQKLLLQQHYQSTSELAVAENGWYGLADD
                     GWESHKLNTLVHEFDMTEREQKLKRTRWLSQVMEYYPLSKLADLSLEELENKDIAVLK
                     NKATGKAEGQQKGQATDIGMRSNDRDQKSVSLLETQSAENIKNSQQEKGSISLVGSGP
                     GSISMLTLGALQEIKRADLILADKLVPQAVLDLIPSTTETFIARKFPGNAERAQEELL
                     EKGLAGLENGLKVVRLKQGDPFIFGRGGEEYSFFTQHGYQPIVLPGLSSSLASTVVSN
                     IPATQRDVADQVLICTGTGRKGALPVIPEYVPTRTTIFLMALHRAVVLIEALDQHNWD
                     LNTPAAIIERASCKDQRVTRTLLKYVPEVVEEIGSRPPGLLVVGKAVTALLSKNASSF
                     DDSNKYSVEEGYQTFSIDSSLIV"
     gene            <1064769..>1065842
                     /locus_tag="HG535_0F05510"
                     /db_xref="GeneID:59237797"
     mRNA            <1064769..>1065842
                     /locus_tag="HG535_0F05510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289869.1"
                     /db_xref="GeneID:59237797"
     CDS             1064769..1065842
                     /locus_tag="HG535_0F05510"
                     /inference="similar to AA sequence:RefSeq:NP_012996.1"
                     /note="similar to Saccharomyces cerevisiae YKR070W;
                     ancestral locus Anc_5.652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145764.1"
                     /db_xref="GeneID:59237797"
                     /translation="MLFKRFLQHSAKKIGFAFDIDGVLLRSKNPIAGAGEALRTLNKN
                     KIPYILLTNGGGQLEEERAAFISKVLEVPISPLQVVLSHSPYKALVGKYDRILAVGTP
                     SVRRVAKHYGFKDVVHLSDIVRYNRDITPFSGLSDKQLLEYSEDIPDIDRKRFDAVLV
                     FNDPHDWAADIQIISDALNSEDGMLNTLRKETSCKPSIPIYFSNRDFLWANNYSLNRF
                     GQGAFRSLVRQLYCEMNNKLPLEDFTIGKPTKLTYDFAHHILIDWNQKLVTGNIEGEK
                     QDLPTLGVEPEQSPFDEVFMVGDNPASDIIGAQEYGWKSCLVRTGVYKDDTSRLGSVK
                     PTMIVDNVYEAVKSVLESNRVTE"
     gene            complement(<1066163..>1066606)
                     /locus_tag="HG535_0F05520"
                     /db_xref="GeneID:59237798"
     mRNA            complement(<1066163..>1066606)
                     /locus_tag="HG535_0F05520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289870.1"
                     /db_xref="GeneID:59237798"
     CDS             complement(1066163..1066606)
                     /locus_tag="HG535_0F05520"
                     /inference="similar to AA sequence:RefSeq:NP_014695.1"
                     /note="similar to Saccharomyces cerevisiae YOR052C;
                     ancestral locus Anc_5.653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145765.1"
                     /db_xref="GeneID:59237798"
                     /translation="MTDTNIDEFRIGGDMKEGEGVLERSSVANHDEGSFVNKEEHLGS
                     NGDYGCDSSRGGGNSPKEGTANSSRVTKKSSKKKKNTCYFSKCNNPASKFIGDCNFCK
                     GHYCSKHRLMENHACEGLTSCKEDMHKRNADKLAAEQTRVPKIQI"
     gene            complement(<1067222..>1068184)
                     /locus_tag="HG535_0F05530"
                     /db_xref="GeneID:59237799"
     mRNA            complement(<1067222..>1068184)
                     /locus_tag="HG535_0F05530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289871.1"
                     /db_xref="GeneID:59237799"
     CDS             complement(1067222..1068184)
                     /locus_tag="HG535_0F05530"
                     /inference="similar to AA sequence:RefSeq:NP_012997.3"
                     /note="similar to Saccharomyces cerevisiae DRE2 (YKR071C);
                     ancestral locus Anc_5.654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145766.1"
                     /db_xref="GeneID:59237799"
                     /translation="MTEGKSALVLIHPAVTTTPEKVIKVAQEAASEGVNVEDQFLINK
                     LNDESATLAKGKYDVIYYITPESAEEIKFPSKLVPVIADSLKDGGLFFGLSDVYKVDA
                     LINGFDISRDKERYVWKKNSTNLSQGPAVIPLKARNKNSAPKNLPRFKKSPSAKLPVF
                     KRKSEEPVKIARHIDDLDDDSDEEAQQFKAQFLKNLEVADELIEEEELITKNDQENDG
                     ITMITCKMTKTKRKKACKDCTCGLKEQEENEVEAVRKKQDTVVKLTDEDLTEIDFTIQ
                     GKRIGGCGSCSLGDAFRCSGCPYLGLPAFKPGQPINLNSIMDDL"
     gene            complement(<1068594..>1070606)
                     /locus_tag="HG535_0F05540"
                     /db_xref="GeneID:59237800"
     mRNA            complement(<1068594..>1070606)
                     /locus_tag="HG535_0F05540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289872.1"
                     /db_xref="GeneID:59237800"
     CDS             complement(1068594..1070606)
                     /locus_tag="HG535_0F05540"
                     /inference="similar to AA sequence:RefSeq:NP_012998.1"
                     /note="similar to Saccharomyces cerevisiae SIS2 (YKR072C)
                     and VHS3 (YOR054C); ancestral locus Anc_5.655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145767.1"
                     /db_xref="GeneID:59237800"
                     /translation="MTLPSKDKKHSGLVSPRFISAARKPNPDGSMSSPSVLSFQGGST
                     NAGPAAGVSVSTSNLGSPEVANSVSPAGSQTKSIMNASGTSGAVVSNSPEPGLKRVAT
                     VTFSDLKAANTAKPGASSESEPEGSQLKNAGNAPAERNGGASLPMGTSSERRRSLKSN
                     SLLSTLKTKSPGALGAPAVREPRTSSLPPEQRKINNIIAEEIGHSHSPLAPKRSDVEG
                     KPTKGEEHPHFYVEDPLHTPSTRSRSNSTSPKPGIGFPQLLNNTVGELEGYGIPKHNE
                     HILEAVLEESTGQKVAPNIPKRENAKNLDARLPQDDGKLHILFGATGSLAVFKIKLMI
                     KKLEEIYGRDKVSIQVILTQSAERFFSKRYTKRYGGGETPSDSRVCSGTMPAVSNLPG
                     SNLNPVQQQQQQEIKQQLQQSQIQQSQEKLPQRVGSTSSLTPGTPTIISGPSCSAALQ
                     AELPPHIQIWVDRDEWDIWKQRTDPVLHIELRRWADILVVAPLTANTLSKIALGLCDN
                     LLTSVIRAWNPMFPIFLAPSMVSSTYNSTMTKKQLKIIKEDMPWITVFKPSEKVMGIN
                     GDIGLGGMMDGNEIVDKVVMTLGGYPKDEKELDEDDEDDEDDDEDDDDDEGAKSKLCK
                     EGDGEDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEGNEAKQTLKK"
     gene            complement(<1071045..>1072457)
                     /locus_tag="HG535_0F05550"
                     /db_xref="GeneID:59237801"
     mRNA            complement(<1071045..>1072457)
                     /locus_tag="HG535_0F05550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289873.1"
                     /db_xref="GeneID:59237801"
     CDS             complement(1071045..1072457)
                     /locus_tag="HG535_0F05550"
                     /inference="similar to AA sequence:RefSeq:NP_014699.1"
                     /note="similar to Saccharomyces cerevisiae NOB1 (YOR056C);
                     ancestral locus Anc_5.656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145768.1"
                     /db_xref="GeneID:59237801"
                     /translation="MESNGTAHVKALVLDATPLITQPYNHYQNYAASFYTTPTVLQEI
                     KDERARKNLEIWKSLGTLQLRHPTAESIKRVSAFAKATGDYSVLSANDIHILALTYEL
                     ETELNQGDWRLRKLPGDSLDHLKPKIQAKDKIEEKIQEKTEEPKKKKNRRRGGAKQRA
                     KRESALASESAETTADSESGLQQKSEQEPEQVKVDREQSSEEATKGNEKTKEKPIFEK
                     SQDGEYFEDDDDGEWISVDNLTETIMKHSGEDTTGSCADSMTDDEREKALNASGNQVA
                     LATGDFAIQNVSLQMNLNLMNFMSGLRIKRLRNYMLRCHACFKLFPVPKNDKAIHFCP
                     SCGGEGTVLRCAVSIDSATGRITPHLKANFQWNNRGVRYSLASPLSKNSQKRYGKKGF
                     VHSKAPDSADIVRQDQKEYEKVTKQDEWTKRHNDKVLNDWIGSGSADNFISPFAISGM
                     KHHSVRIGRGRYANSSKKKH"
     gene            <1072907..>1074127
                     /locus_tag="HG535_0F05560"
                     /db_xref="GeneID:59237802"
     mRNA            <1072907..>1074127
                     /locus_tag="HG535_0F05560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289874.1"
                     /db_xref="GeneID:59237802"
     CDS             1072907..1074127
                     /locus_tag="HG535_0F05560"
                     /inference="similar to AA sequence:RefSeq:NP_014700.1"
                     /note="similar to Saccharomyces cerevisiae SGT1 (YOR057W);
                     ancestral locus Anc_5.657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145769.1"
                     /db_xref="GeneID:59237802"
                     /translation="MPIDKDLKNAYAALYDEHDPLKALKRYDVILEEHPDCLLALVYK
                     AASLEKLYYGFSDWHNEQSLENATQLLSKALAISEERGDRSKIGFVYFRYFVHYYNRK
                     DYDAANRYMILSQKFGYLDATLPMWQSQLNKKLGKLLRKQSNSKPTAQKDAPAKSDSC
                     GSLSNCKDTSIGTADEKPLERDSKKPELEGTQPAAQDPERLRTDWYQTTNTIVLSLFT
                     VNLPQSKEAMHVSVSPDDKKSLEVAYQVASTGSEFQYSIELSHEVDPEVVKINVFTKK
                     IELTLKKIEKLQWKILESSPQATEEDLASSKDVISQNRAVQNEGALDYPSSSTKHIDW
                     SKIDFDEEDDENSGSADAFFQKIYADADPDTRRAMMKSFVESNGTALNTNWNDVSKSF
                     VEPSPPEGMNLKHW"
     gene            complement(<1074228..>1076984)
                     /locus_tag="HG535_0F05570"
                     /db_xref="GeneID:59237803"
     mRNA            complement(<1074228..>1076984)
                     /locus_tag="HG535_0F05570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289875.1"
                     /db_xref="GeneID:59237803"
     CDS             complement(1074228..1076984)
                     /locus_tag="HG535_0F05570"
                     /inference="similar to AA sequence:RefSeq:NP_116582.1"
                     /note="similar to Saccharomyces cerevisiae ASE1 (YOR058C);
                     ancestral locus Anc_5.658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145770.1"
                     /db_xref="GeneID:59237803"
                     /translation="MRQLSTGTSSGTSPTSNCSLASDTLKLSDYNSSGMKTETTTTAL
                     TTTKSIATTADILAASLNTPSLNKRIDTFCYTKDCMKLTPVNIKTLASPIRHPRHEVN
                     QNISERISADDTYKENFGLIARQLEKLLESLNIVFRQIGYSNSEIVSKEKMIFNTLSD
                     SITKFSYQAESELKTLAQHNDFDQDILNRILEIIDDSTGIDSISDLYVRNAILVPKNK
                     PFVTSPKKPLSLLSKKKLLHSGKKFVLNAYIPKLLEFLNHSIQFQLLYNAVNESLKDL
                     RDPKILTSLPPLKLAVHLKNILRDSQNDIDAVTRLIKNYKDELLAGRYFNDLSKEMNE
                     LIADSIKLYEVEYKNRLGKITSMSRTISDLFKKLHVDTENEVDPQIKDLLVVYSTNNH
                     SGKNDFLPVHKNITERLESTLKEYQVAFGKRVENRDILLSKCRSLWYKLNVPDDYVNN
                     FLSENSTLSSVVLMRFANELEKLENMKKKVIKTLINDALRKIEGLWETLQSEAQERTE
                     FLRKFDSMKSTSINLEDDERLLGLCENEIKGLEEKLAIYMPVLKLIEEFKQLQADKGS
                     LEKSSKDSSRLLLRNSHKILLQEEKTRKRITRHFPRIIQDLKLGLSRIEEMSGKPLYI
                     DGENLNEMVVKQEEELLTRYPRSRVNRGARKPQISSASKPAAKRYQPEQKRLRRNASF
                     SFSYREDTSAIDLNQTPATRLNSVNKSDRDTTGSTDSDSSSIKYTQEVRFSSPVKPFT
                     KLLPPTYIARRSESKIPEPKVKNLNSLSLVPSPVFRPRNSAPKNEIVRPTRLFPISSN
                     KINQNKTYQANQFEELMKQGTVLSNEQINEPAGKENVVNSTPKFLHASTKDAFHFSSP
                     YRESNNSVYKLSMSPEGKCTLNVQESGLTSGVDDTSFVDDENDKYYDTWKKEQILKLK
                     NFNT"
     gene            1077352..1077440
                     /locus_tag="HG535_0Ftrna14K"
                     /db_xref="GeneID:59237887"
     tRNA            join(1077352..1077389,1077404..1077440)
                     /locus_tag="HG535_0Ftrna14K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:59237887"
     gene            <1077604..>1078044
                     /locus_tag="HG535_0F05580"
                     /db_xref="GeneID:59237804"
     mRNA            <1077604..>1078044
                     /locus_tag="HG535_0F05580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289876.1"
                     /db_xref="GeneID:59237804"
     CDS             1077604..1078044
                     /locus_tag="HG535_0F05580"
                     /inference="similar to AA sequence:RefSeq:NP_013000.3"
                     /note="similar to Saccharomyces cerevisiae YKR074W;
                     ancestral locus Anc_5.659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145771.1"
                     /db_xref="GeneID:59237804"
                     /translation="MTSMDYDSAEPLTSTGRPLSYATITVRVIKSFPYRNVKNIIMKN
                     YDLQKKSAKDLLNDCVQVIQNDGSYRPYRNVEYDCLKIYTHAHGSKTVNLVINFEKDK
                     EQILDMQNEDKKLYQYGIENETEISLFKYNDYLEFKSKPEEKWL"
     gene            complement(<1078048..>1079406)
                     /locus_tag="HG535_0F05590"
                     /db_xref="GeneID:59237805"
     mRNA            complement(<1078048..>1079406)
                     /locus_tag="HG535_0F05590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289877.1"
                     /db_xref="GeneID:59237805"
     CDS             complement(1078048..1079406)
                     /locus_tag="HG535_0F05590"
                     /inference="similar to AA sequence:RefSeq:NP_014702.1"
                     /note="similar to Saccharomyces cerevisiae YOR059C;
                     ancestral locus Anc_5.660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145772.1"
                     /db_xref="GeneID:59237805"
                     /translation="MIMSSGKHLFVLIHGLWGNHKHMKSLNQAFENVCGQDKNCVFFA
                     PTQNALFKTFDGIEIVGYRTLIEICQYIKEFKEGQITKISIVGYSMGGLIARFVIGKM
                     FTEFEQIFKGIEPHLFLTFASPHLGVQFYNPNKSTFKCLLQPILRGVGSNILGKSGRE
                     LFITNKFNDILVKLSEGEYLENLSRFKWRIIFANVKNDRTVAFYTAYITDCDPFISTE
                     NNVKYFFEQKIPGANYSRAPPRIIDIDELDITIKRPVFHRPRQYIRWIKIIPLIALFV
                     CFALPIMFCLNFLASIYSTVVTKKYRVTLPDGSTSSINYRELGYDDTLKEYFSDFYGS
                     VLNEEDDDDDGVNIPETDGVSEEQAQLHMTWKEFTDKYSSNWHKEKKFPRLPFDEKRA
                     TILKNLNSLSWIKIPVYIKSTNAHGGIVARRGLDENAASTSVACVEFAAQLVQYLLKT
                     CN"
     gene            complement(<1079607..>1080356)
                     /locus_tag="HG535_0F05600"
                     /db_xref="GeneID:59237806"
     mRNA            complement(<1079607..>1080356)
                     /locus_tag="HG535_0F05600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289878.1"
                     /db_xref="GeneID:59237806"
     CDS             complement(1079607..1080356)
                     /locus_tag="HG535_0F05600"
                     /inference="similar to AA sequence:RefSeq:NP_014703.1"
                     /note="similar to Saccharomyces cerevisiae YOR060C;
                     ancestral locus Anc_5.661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145773.1"
                     /db_xref="GeneID:59237806"
                     /translation="MFAKAGVLNFKLGEKYADTLIRDVQIWRDVDTAQENTKITTFKG
                     SFLCYIDMKKLPVWISHSSTISTCLTCSATAKSYFSVKLKRLRRGIVVELTEPLACKY
                     VILYRHESRVECLEVELSVKKALDGAIAKMQSTAAVSTKDNNIDAILRQSQEKHLIHT
                     KRIKKSMEISEKRLQFNETLSKLILGGLRLRGIPNSQSGFQKLYQMTFAAAEFTHRNE
                     LQQLPRTNALDVPFESLQSTVEALLKLFTKS"
     gene            <1080698..>1081717
                     /locus_tag="HG535_0F05610"
                     /db_xref="GeneID:59237807"
     mRNA            <1080698..>1081717
                     /locus_tag="HG535_0F05610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289879.1"
                     /db_xref="GeneID:59237807"
     CDS             1080698..1081717
                     /locus_tag="HG535_0F05610"
                     /inference="similar to AA sequence:RefSeq:NP_014704.1"
                     /note="similar to Saccharomyces cerevisiae CKA2 (YOR061W);
                     ancestral locus Anc_5.662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145774.1"
                     /db_xref="GeneID:59237807"
                     /translation="MPLPPSALNQKSSRVYSVAKVYRDACEKRPQEYWDYEQGVTIEW
                     GKISYYEIISKIGRGKYSEVFSGKSVLNNQPCVIKVLKPVKMKKIYRELKILTNLTGG
                     PNVIGLLDIVQDPGSKIPALIFEEVKNVEFRALYPTFKSNDIQYYFTQLLIALDYCHS
                     MGIMHRDVKPQNVMIDPSEKKLRLIDWGLAEFYHPGVDYNVRVASRYHKGPELLVNLN
                     QYDYSLDLWSVGCMLAAIIFKREPFFKGSTNADQLIKIAAVLGTKPLLAYLEKYGLKL
                     PSEYDNLMRDFTTKPWSTFITDETPLAVPEIVDLVDNLLRYDHQERLTAKEAIEHPYF
                     KTKFD"
     gene            complement(<1081921..>1082838)
                     /locus_tag="HG535_0F05620"
                     /db_xref="GeneID:59237808"
     mRNA            complement(<1081921..>1082838)
                     /locus_tag="HG535_0F05620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289880.1"
                     /db_xref="GeneID:59237808"
     CDS             complement(1081921..1082838)
                     /locus_tag="HG535_0F05620"
                     /inference="similar to AA sequence:RefSeq:NP_013001.1"
                     /note="similar to Saccharomyces cerevisiae YKR075C and
                     YOR062C; ancestral locus Anc_5.663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145775.1"
                     /db_xref="GeneID:59237808"
                     /translation="MTSLDDSVICRQNLMLLDNITNYSKPAVDYFHHEFKQNDLEMPV
                     TWSLLLKMRKHKLLRLPNCSIEDDKDYSMYSVRLHHCLWRRWSIEHYKLHSLKVDPLS
                     INWDKEIDITVLYGPDLAGQYENKSAGKENQIEFQKTNLLDDVKNDTTEYQEEDVFAK
                     SYEYSSSLDSNASSIFDERHDICTKTISNSSLKSVKFSETVMRRDIDKSGACHETEIV
                     VNDAKKVLSRKCRFPRKRHHHHHNHHHNSNSHSIHTSDGFHYERPLHLLPDDDDQMLE
                     QNIKSLNLDDETPSNVFDNCTFIRSQTVK"
     gene            <1084075..>1085238
                     /locus_tag="HG535_0F05630"
                     /db_xref="GeneID:59237809"
     mRNA            <1084075..>1085238
                     /locus_tag="HG535_0F05630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289881.1"
                     /db_xref="GeneID:59237809"
     CDS             1084075..1085238
                     /locus_tag="HG535_0F05630"
                     /inference="similar to AA sequence:RefSeq:NP_014706.1"
                     /note="similar to Saccharomyces cerevisiae RPL3 (YOR063W);
                     ancestral locus Anc_5.664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145776.1"
                     /db_xref="GeneID:59237809"
                     /translation="MSHRKFEAPRHGHLGFLPRKRAASIRGRVKSFPKDDKSKSVALT
                     SFLGYKAGMTTIVRDLDRPGSKFHKREIVEAVSVVDTPPIVVVGVVGYVETPRGLRSL
                     TTVWAEHLSDEIKRKFYKNWYKSKKKAFTKYSSKYANEGSQIERELARIKKYATVVRV
                     LAHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVSVDSVFEQNEMIDVV
                     AVTKGHGFEGVTHRWGTKRLPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHHRT
                     SINHKVYRVGKGDDEGNASTNFDRTKKNITPMGGFVAYGAVANDFVMVKGSIPGTRKR
                     IVTLRKSLYTNTSRKALEEVNLKWIDTASKFGKGRFQTPAEKHAFLGTLKKDL"
     gene            complement(<1085278..>1085868)
                     /locus_tag="HG535_0F05640"
                     /db_xref="GeneID:59237810"
     mRNA            complement(<1085278..>1085868)
                     /locus_tag="HG535_0F05640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289882.1"
                     /db_xref="GeneID:59237810"
     CDS             complement(1085278..1085868)
                     /locus_tag="HG535_0F05640"
                     /inference="similar to AA sequence:RefSeq:NP_014707.1"
                     /note="similar to Saccharomyces cerevisiae YNG1 (YOR064C);
                     ancestral locus Anc_5.665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145777.1"
                     /db_xref="GeneID:59237810"
                     /translation="MDIRYNFLNTLDHFPCELIRTLWILQSLDLQRDSIEKYEWSNAQ
                     MMSQSQLLCDLVNERIHALTSHRQELLLLMSIRKKYEAMMEKNDRALPKLTIKLNLKQ
                     QTTRDGDEKVSSNVKVRNNDTDENAKTYCICHKVSYGAMIACDNPKCPIEWFHYGCVG
                     ISKPPQGEWFCSESCKKQVQTKKRRNNKKGKRRRLN"
     gene            <1087433..>1088061
                     /locus_tag="HG535_0F05650"
                     /db_xref="GeneID:59237811"
     mRNA            join(<1087433..1087543,1087969..>1088061)
                     /locus_tag="HG535_0F05650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289883.1"
                     /db_xref="GeneID:59237811"
     CDS             join(1087433..1087543,1087969..1088061)
                     /locus_tag="HG535_0F05650"
                     /inference="similar to AA sequence:RefSeq:NP_014708.1"
                     /note="similar to Saccharomyces cerevisiae CYT1 (YOR065W);
                     ancestral locus Anc_5.666"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145778.1"
                     /db_xref="GeneID:59237811"
                     /translation="MFSQFSRRVAHRGLSTASKVSGNSAKLGRKILIGSSITRWLRLH
                     LFPINWLSRRASSGYCFTTRRQL"
     gene            <1088820..>1089932
                     /locus_tag="HG535_0F05660"
                     /db_xref="GeneID:59237812"
     mRNA            <1088820..>1089932
                     /locus_tag="HG535_0F05660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289884.1"
                     /db_xref="GeneID:59237812"
     CDS             1088820..1089932
                     /locus_tag="HG535_0F05660"
                     /inference="similar to AA sequence:RefSeq:NP_013002.3"
                     /note="similar to Saccharomyces cerevisiae ECM4 (YKR076W);
                     ancestral locus Anc_5.667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145779.1"
                     /db_xref="GeneID:59237812"
                     /translation="MSKQWADSTDGSFKRQVSSFQEVISPSHPIYKPAKNRYWLYVSL
                     ACPWAHRTLITRALKGLTAVIGVSVVHWHLDSEGWRFLTADQATRERADKDASYYEPA
                     GGITTATLDYSNPQAKVANNSARMFVDSTFDPNEQFERLSQLYLKTDPNYRARYTVPV
                     LWDTQTQTIVSNESAQIIRTLNSGVFDEFADPGTEPIELVPKNLEREIDEINAWVYDN
                     INNGVYKAGFAEKADIYEKEVANVFEHLDKAEKILKDRHEALVEKHGKNNITDILDDY
                     FLAGNQLTEADVRLYPTIARFDPVYVQHFKCNLTTIRDGYPYISLWLRNLYWGNDAFR
                     LTTDFNHIKLHYTRSHTRLNPLGITPLGPRPDILQL"
     gene            <1090308..>1091948
                     /locus_tag="HG535_0F05670"
                     /db_xref="GeneID:59237813"
     mRNA            <1090308..>1091948
                     /locus_tag="HG535_0F05670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289885.1"
                     /db_xref="GeneID:59237813"
     CDS             1090308..1091948
                     /locus_tag="HG535_0F05670"
                     /inference="similar to AA sequence:RefSeq:NP_013003.1"
                     /note="similar to Saccharomyces cerevisiae YKR077W and
                     YOR066W; ancestral locus Anc_5.668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145780.1"
                     /db_xref="GeneID:59237813"
                     /translation="MEKPVRKRGRPPITKDYKNPLESPMAHSSLKVQKLGAQGFSRPM
                     MKVGQLTPSPRNRRTSSSSAGSCGGSSIMEETVSGLQGSNSKRGRFRGVLLTTPTKIN
                     AGVSTSSTPSSNDSMFQSSSRMILKSSPPSVSSPLSETMESKEFNHMSSSQLFKFALT
                     IGDNGRASIAGSSPLTTPKKELRPILPEHAKVDSTSKKATEGQSRSGTTYEKKRVLSL
                     LRQMRNGPSSSKHLKNFRRSEQVQSKKSQDTFKVMDLQRYDSSPVKMSKNAEKNNCQL
                     SPSVYIPKSPQFPSTPRASFPMRTGLTPNVGIDQVLLDIVSSPRAGILTGNDGHIITL
                     SPRGRSLSKSAGLNRTAQQQQFEQQQQQQQYVFKFSSADPLLMTDDVEGSWSEVIYNH
                     VPSSPKHQICFNTPPSWMNLGSPKAFTPLRRDSNTILISACQSSGAEAISQVPIDMAN
                     LKNYSSNNQSISSSTRKGDNTKPSTPDVQQFTMPTMIECTPLIHQPMSGTLNSKCSSE
                     LTPVGSSNDARKHVPKPVTMAFEQEDAVVALKKLITER"
     gene            complement(<1092175..>1093881)
                     /locus_tag="HG535_0F05680"
                     /db_xref="GeneID:59237814"
     mRNA            complement(<1092175..>1093881)
                     /locus_tag="HG535_0F05680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289886.1"
                     /db_xref="GeneID:59237814"
     CDS             complement(1092175..1093881)
                     /locus_tag="HG535_0F05680"
                     /inference="similar to AA sequence:RefSeq:NP_014710.1"
                     /note="similar to Saccharomyces cerevisiae ALG8 (YOR067C);
                     ancestral locus Anc_5.669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145781.1"
                     /db_xref="GeneID:59237814"
                     /translation="MKTATSRKSTAAINPPSKDETKPVVMANRRFSLWNFWIASLALK
                     LLLMPDYFSTDFDVHRNWLAITNALPLSQWYRENTSQWTLDYPPFFAYFEWLLSLFVP
                     NKVRQDGCLDILEVGNFGWPTVVFQRLTVIASEIVLFVVLQVFINTSPLSERTQNFVV
                     ASSIVISPGFLMIDHIHFQYNGFLFGILIASIVAARNKQYLWCAVFYSTALCFKHIFL
                     YLAPCYFMFLLRAYVLNFKDFKFKSYKDLIFIVQWTNLFKLSAIVIGIFGACFAPFLN
                     DSPQVLSRLFPFSRGLTHAYWAPNFWAVYSFADKILTFLMLKLPYVHKFAIKIISPPL
                     IPASILEIKQRMLQNNNGTKGLVQDVAFVILPQITPKLTFILTAFYQALAVIPLLFDP
                     SFKRFIGSLTLCGLASYIFGWHVHEKAILLVIVPFSFLVVFDRRLLSSFMLVTAAGYV
                     SLFPLLYEHQDFLLKCLYTAAWCTIYFYAFKKTSKLSSSVERRIFFLDRLSTIYMFSL
                     LALVLGVQFLDVMNWRYQTFQKFEFLGLMSYSVYCSLGIISSWIGLSWLYNFDEPLWM
                     SD"
     gene            <1094050..>1096047
                     /locus_tag="HG535_0F05690"
                     /db_xref="GeneID:59237815"
     mRNA            <1094050..>1096047
                     /locus_tag="HG535_0F05690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289887.1"
                     /db_xref="GeneID:59237815"
     CDS             1094050..1096047
                     /locus_tag="HG535_0F05690"
                     /inference="similar to AA sequence:RefSeq:NP_013004.3"
                     /note="similar to Saccharomyces cerevisiae YKR078W and
                     VPS5 (YOR069W); ancestral locus Anc_5.670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145782.1"
                     /db_xref="GeneID:59237815"
                     /translation="MDYDEDLSAPVWDELNDHTSSPANEVNSDISKIAASELETVTDD
                     DENTSTNFTGRHETSEYQLGQTSPEEEAKNNYGVQSSSNLLEELAPEREAFSDLNLGT
                     NSNPVSPIKKSGDPLFSGSTYLPLVSGNAEPTVEEEADYTSGTSGQSSSKRKPQRLFN
                     SARVRRRPLLDSTKSVGKSSEEDKISDPLGEFKKENEFQDEPLDDTSSNANNKSLKGD
                     VVDLADGELFKLSPKKHLPSNTEQSSANTQRKTTNEQATTTQDKLVVEFEIEVKDPVK
                     VGELTSMHVEYSVATKSKLLENNFAQVNRRYTDFRWLYRQLQSNHWGTIIPSPPEKQS
                     VGRFKQDFIENRRFQMERMLHKITESPLLQKDPDFLMFLSSPDFSIDSKNREHISGSG
                     ASSDSNDLSEIHISDIQLLGPEDAALILKSGGIDTESQKRFMNISFSSPPKYIETDDY
                     FREHWQNAQVLEEQLRQLDKSLEMVDSERNELASVTEEFSKTMESLADLEVTKKNANL
                     LSNFADTQRRIKESLERSSLQESLTLGVTLDEYIRSLASFKAIFNQRARLGQYLVIVE
                     ADLMKKESQLEKLHNIFKTKPNSEKVQTAKKEYQILKTRFNNIKKSWQTVGDRIKNEV
                     ENYQLEKVHDFRNSIEIFLESAIESQKENIELWETFYQNYL"
     gene            complement(<1096110..>1098572)
                     /locus_tag="HG535_0F05700"
                     /db_xref="GeneID:59237816"
     mRNA            complement(<1096110..>1098572)
                     /locus_tag="HG535_0F05700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289888.1"
                     /db_xref="GeneID:59237816"
     CDS             complement(1096110..1098572)
                     /locus_tag="HG535_0F05700"
                     /inference="similar to AA sequence:RefSeq:NP_013005.1"
                     /note="similar to Saccharomyces cerevisiae TRZ1 (YKR079C);
                     ancestral locus Anc_5.671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145783.1"
                     /db_xref="GeneID:59237816"
                     /translation="MFNLTPIAHPTADTEHPLLLLQSHHGDRYFFGKVSEGSQRCLTE
                     NRIRISKLQNIFLTGELDWSTLGGLPGMILTVADQGKANLAVHYGNDLIDYVVAAWRY
                     FVFRFGIDLKTNILRDKEVYKDDIINVKSIVISQKSPHVATNFSVFPAKEKSVLRSII
                     SNMFPKNSPTSKYDPTSDPHLNVELPKDVEIPKISTSYEVSFHPVRGRFKAEEASKLG
                     VPKGPLLGKLAKGETVTLEDGTQVSPEQVLEKQRSFSKVLILDIPNDSYLPHFQERFE
                     KYATEDLGIVYYFLGEKITINDSLIKFMELFGNSTLHFVSHPRVCPNSMVFKGAAIIT
                     LKLKALQPENYNLPRTNTILSKEFYDCFEIPMEDGTTLSQSQEGPLKSKLPGDIVHVY
                     TQKKSVKVESYTKGQEKMKIKVDDESGRGWSWQKTFNKHVKPLKISSASFENVVSSQL
                     NIDNFNNDSKKGHVEIITLGTGSALPSKYRNVASTMIKVPFLTAASEFKNRIILFDAG
                     ENTLGTLRRMFSETARRRIFADLKMIYLSHLHADHHLGIISILKEWFRYHENNKDSYI
                     YVVSPWQYNKFVQEWLIIDNPTILEKIRYISCEHLINSSFVRRQTIPISLDDYCSAMG
                     SNNGKRRKLEVDANSSFRDMTKIKQMYQDMNIALFQTCKARHCNWAYSNSITFHMSHN
                     SRKQFKVSYSGDTRPNKELFAQGIGYRSDLLIHEATLDNELMEDAIKKRHCTINEAIQ
                     VSNAMEAEKLVLTHFSQRYPKAPQVGNNISIEAKEHCFAFDGLILDYENIGEQQNTFW
                     RFNTVFAEERKTEEEEGSKEFS"
     gene            complement(<1099020..>1100894)
                     /locus_tag="HG535_0F05710"
                     /db_xref="GeneID:59237817"
     mRNA            complement(<1099020..>1100894)
                     /locus_tag="HG535_0F05710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289889.1"
                     /db_xref="GeneID:59237817"
     CDS             complement(1099020..1100894)
                     /locus_tag="HG535_0F05710"
                     /inference="similar to AA sequence:RefSeq:NP_014713.1"
                     /note="similar to Saccharomyces cerevisiae GYP1 (YOR070C);
                     ancestral locus Anc_5.672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145784.1"
                     /db_xref="GeneID:59237817"
                     /translation="MGVRSNSSEMYQREQSGSLNNGGSSHRNNSSTNLVTSLMKSWRI
                     SSSSSTSSPPQQSSRDSLISIDGNFEAMAKQQTSAKRSSPSPYSPMRYTSPGLSNSTS
                     NLGSGGTSSSDAPRPSLITTTHRHSSTNHHHHHRRNENTGGKKVSKYFKDLDEDWSAV
                     IDDYNMPIPVISNGGIASPATPKVGRSSSITSTPTSSTTAVAPENVNPTFSYPQLPQL
                     KRSISSDLRSQLEMENERDAQELNAIMQRIAKFDAILKNKHIINQQELRQISWNGVPK
                     SHRATVWKLLIGYLPANTKRQALLLQRKRREYRDGLQHIFSTKHSRDVPTWHQIEIDV
                     PRTNPHIALYQFDSTQTSLQRILYLWAIRHPASGYVQGINDLVTPFYQTFLTEYLSAS
                     QMDDVENLDPKSYITDEQLKDVEADTFWCLTKLLEQITDNYIHGQPGILKQVKNLGQL
                     VKRIDQDLYKHFQNEHVEFIQFAFRWMNCLLMREFQMGTVIRMWDTYLSETSPETTSS
                     AAISSDLVPPHTPTEPKSATFQSPAQDFTSPTSASSSAKEEISKMRQSSLNEFHVFVC
                     AAFLIKWSDQLMNMDFQEIITFLQNPPTKTWQETDIEMLLSEAYIWQSLYKDATSHWQ
                     "
     gene            <1101763..>1102740
                     /locus_tag="HG535_0F05720"
                     /db_xref="GeneID:59237818"
     mRNA            <1101763..>1102740
                     /locus_tag="HG535_0F05720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289890.1"
                     /db_xref="GeneID:59237818"
     CDS             1101763..1102740
                     /locus_tag="HG535_0F05720"
                     /inference="similar to AA sequence:RefSeq:NP_013006.3"
                     /note="similar to Saccharomyces cerevisiae MTD1 (YKR080W);
                     ancestral locus Anc_5.673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145785.1"
                     /db_xref="GeneID:59237818"
                     /translation="MSVSAVKPGSTILASKISKEYVDEITKKVHDMKDIRPDGPLLVG
                     FLANDDPAAEMYATWTKKTSESMGFRYELRRVEEKDFLEEAIIEANRDDSVDGIMVYY
                     PVFGNAQDQYLQQVVSREKDVEGLNHVYYQNMYHNVRYLDENKQQKSILPCTPLAIVK
                     ILESLQIYNRLLPEGNRLYGKKCVVVNRSEIVGRPLAALLANDGAIVYSIDVNNIQKF
                     TRGEGLKFIKHHVEDLGDYTEELMKECCSDADVIVTGVPSAKYKFPTEYIKEGAACIN
                     FSSEKNFDDSVKTKASLYVPMTGKVTISMLLRNMLRLIDNSEKLKKGTQ"
     gene            complement(<1102887..>1103945)
                     /locus_tag="HG535_0F05730"
                     /db_xref="GeneID:59237819"
     mRNA            complement(<1102887..>1103945)
                     /locus_tag="HG535_0F05730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289891.1"
                     /db_xref="GeneID:59237819"
     CDS             complement(1102887..1103945)
                     /locus_tag="HG535_0F05730"
                     /inference="similar to AA sequence:RefSeq:NP_013007.1"
                     /note="similar to Saccharomyces cerevisiae RPF2 (YKR081C);
                     ancestral locus Anc_5.674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145786.1"
                     /db_xref="GeneID:59237819"
                     /translation="MIRTVKPKNARAKRALKEREPKLVENVKQAIFIPGQTSNKALHD
                     IMVDLSAMKKPDIKRFERKNNVHPFEDASPLEFFSEKNDCSLMVLSTSSKKRKNNLTF
                     IRTFGYRIYDIIELLVVENFKLLSDFKKKTFALGVKPMFSFQGSAFDTHPVYKHVKSL
                     FLDFFRGSVTDLQDVAGLQYVLSLTVQGDFQDGEPLPNVLFRVYKLKTYRSEQGGRKL
                     PRVELEETGPRLDFKIGRIQSASPEMEKEALKKAKNLEFKTAKNVEVDSMGDKFGTIH
                     MGKQELNKLQTRKLKGLKSKFDQITDDGAEMEEYMNDEEEDINQTGEDAADDTYGEDF
                     VTATDIEVAEPPSKRQKK"
     gene            <1104226..>1107669
                     /locus_tag="HG535_0F05740"
                     /db_xref="GeneID:59237820"
     mRNA            <1104226..>1107669
                     /locus_tag="HG535_0F05740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289892.1"
                     /db_xref="GeneID:59237820"
     CDS             1104226..1107669
                     /locus_tag="HG535_0F05740"
                     /inference="similar to AA sequence:RefSeq:NP_013008.3"
                     /note="similar to Saccharomyces cerevisiae NUP133
                     (YKR082W); ancestral locus Anc_5.675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145787.1"
                     /db_xref="GeneID:59237820"
                     /translation="MSTERPLFQLRKELNGKGTSTDTEISVDHCSLSNESNTSEYMNS
                     ALEDSECGTNTPGTYNNSRILTENEKFVVKKLSPELSMLTSDEDAELFEGLLDTHCSK
                     ALINDTNYLYIWDYQSSQKEVDFHKIPLHEEYAVLNTPPKCLFTWPAAMDDSTQMFLD
                     GAAGSAGGVCIIHRKNSQFIYFEDIASVNNLHSQLAKSKANAIDMKLKADETVTNAVN
                     CEPAGIVVATSLGRLLFITLRDSTGKLKVQLKQQLLKSQRGFFFHGFNRSKEIVSLKV
                     GAIVGRGERLLHVVTKGGDFETWQLSLSISCYKRVEVNLFEQILDSLQGLYPFAHGSL
                     QILDSHPLLPDMSSVHLVLSSIANEKETYYILSTVIVDEKTSSFTIFSTYRLNTYVAP
                     LNNNKPSLFIPDSLGESTKAVTTVFVLFPNAIVLTQVSSNLDSSFPLRRKWEDIICLR
                     ENIRIIGSGYSADSLFIMTNRMGVLEVTIKENTSPEDDGLNFVKSHIDQAIYFSDVGA
                     NPIEFNLPKDIFLESQEIEHDLSLSAEEIFFSKGRYIPPMLSTLTQHLSLRTGLYKHL
                     IEFVIRNFNFRISHYAKLDILEKFEILNCCLKFSTFLYSSAELSDIWNKTVASFSLDL
                     STDALMISHIDKFPQLFTQLLLYITKTGSALKSVEFKSQMLTLIVSCLFYATLEDGEK
                     TIRYQYFKLDPLELNKKLPWFISVDILTAINDLFFDYKFSVTPISGEMTEQLLSLIKV
                     LYYSFNQTNLWFSEEAKRENLPSYQNFKTLFNENHLSWNLALCELSVQESCLQITEFY
                     RDFEALTVILETLDRDESQELYQQYFTRFGYEFASTVFEYHIKQNKLKNLFNRFPEQH
                     AFLVRFFENSEQYGDVAWIQQILDDDYNKAFHTLCCITGENTIDQSLQTRQLHLSIAK
                     LTSLVADVATVQKGTVDTIQAELDIVDSQKDLTLRFDEGKIKLSSRYQSTEISKVFET
                     VTNLLKEEKPLSIYNITEVYSMLDDAESFYNALKLLAFSGESFDFGEKTLLIAQIWRR
                     CILLQEDWSEVSDITKTALYQVLYKYFDEGLYFSNCPLPSYELIVSKGCLGEEYLYKT
                     HENLTNDLNSIKGILAQDLQAIENLGRDFQTRLQSIIGSANTATGNKCTVNYERNVVE
                     L"
     gene            complement(<1107780..>1108139)
                     /locus_tag="HG535_0F05750"
                     /db_xref="GeneID:59237821"
     mRNA            complement(<1107780..>1108139)
                     /locus_tag="HG535_0F05750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289893.1"
                     /db_xref="GeneID:59237821"
     CDS             complement(1107780..1108139)
                     /locus_tag="HG535_0F05750"
                     /inference="similar to AA sequence:RefSeq:NP_013009.1"
                     /note="similar to Saccharomyces cerevisiae DAD2 (YKR083C);
                     ancestral locus Anc_5.676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145788.1"
                     /db_xref="GeneID:59237821"
                     /translation="MSLESQVALKRQELNALKKITRLTDSMKAQLDEMAHQVNHMESN
                     AASVSHVMENWNSITRSISQAGLSLLQYTEADYEVGTWDSRKKGEGETGDDRDKRTPL
                     PETLVRIRVEDQEELPN"
     gene            <1108446..>1110362
                     /locus_tag="HG535_0F05760"
                     /db_xref="GeneID:59237822"
     mRNA            <1108446..>1110362
                     /locus_tag="HG535_0F05760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289894.1"
                     /db_xref="GeneID:59237822"
     CDS             1108446..1110362
                     /locus_tag="HG535_0F05760"
                     /inference="similar to AA sequence:RefSeq:NP_014716.1"
                     /note="similar to Saccharomyces cerevisiae SGO1 (YOR073W);
                     ancestral locus Anc_5.677"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145789.1"
                     /db_xref="GeneID:59237822"
                     /translation="MARASRRYAKTNGRRAKDAAENTTAERTTPQIQELQNIMDLERS
                     KIEKMKSAYISQNCQLARANSSLMMKFSDLEARISDLVQENVALRSNKSKIELDYRKR
                     LKNQLQVLEEGISHRFEEIFHMFERIREKEKLSQTSDSSHLTDSTSVLATQIAKRRSS
                     TIGSRTSNHIHFAEVQNGGHFINTDNREYAGSDHDAEADDNPVSRLKRKRRKSSRRES
                     IIIPTSFNFYDETGSDIENPNHKPLSANSMTEKSQIPAEEQIRPEENSLRSSDNGPQV
                     LAQEETQNCDAMATFQTGTVERHVTDENGEKQDPMSAELHEDGSFNFTNSIIEYSIPE
                     EVINSNANNEVDPPSSSKIEVFRDNEDIELLLDKKSLSCETPDKKNGNKVIPINNENS
                     ETNKVTFIPMSKQNKVKHSMRLPNSRSEKKIIDEGMPGTGSQGIDLRSRRTRGKAVNY
                     ALPSLRAKMRRPTEKLVDATTFTNIHDLQVSKRSKRSESDNDVVRSESVETYSEFLPK
                     APTNSPNLSNMRPEVPAESMKPGQDLGKENLTTVAYKKISNTALNPILRDITNQPNPK
                     PLKTKKLYKNAIINDSLDKDEIAALEQSGDRTSKGAQSLEEGLSVFDLIGCNSFKAAH
                     KTYRAKVKKTNIYK"
     gene            complement(<1110457..>1111386)
                     /locus_tag="HG535_0F05770"
                     /db_xref="GeneID:59237823"
     mRNA            complement(<1110457..>1111386)
                     /locus_tag="HG535_0F05770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289895.1"
                     /db_xref="GeneID:59237823"
     CDS             complement(1110457..1111386)
                     /locus_tag="HG535_0F05770"
                     /inference="similar to AA sequence:RefSeq:NP_014717.2"
                     /note="similar to Saccharomyces cerevisiae CDC21
                     (YOR074C); ancestral locus Anc_5.678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145790.1"
                     /db_xref="GeneID:59237823"
                     /translation="MTAQQISEQAAKEGNLEESQYLDLCKRIIEEGESRPDRTGTGTL
                     SLFAPPQLRFNLKNDTFPLFTTKRVFTKGIILELLWFISGCTDGQKLSDQGVKIWEGN
                     GSREYLDKLGLTHRRERDLGPVYGFQWRHFGAKYKSCEDDYTNQGFDQLQDLISKLKN
                     NPYDRRIIMSAWNPPDFPLMALPPCHVFCQFYVNFPTDGSKPKLSCLLYQRSCDMGLG
                     VPFNIASYALLTKMIAHVCDMEPGEFIHTMGDAHVYKNHIEALQKQISRTPTSFPQLK
                     IKRKVDNIDDFKYEDFEIINYNPQKKIEMQMSV"
     gene            <1111644..>1112648
                     /locus_tag="HG535_0F05780"
                     /db_xref="GeneID:59237824"
     mRNA            <1111644..>1112648
                     /locus_tag="HG535_0F05780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289896.1"
                     /db_xref="GeneID:59237824"
     CDS             1111644..1112648
                     /locus_tag="HG535_0F05780"
                     /inference="similar to AA sequence:RefSeq:NP_014718.1"
                     /note="similar to Saccharomyces cerevisiae UFE1 (YOR075W);
                     ancestral locus Anc_5.679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145791.1"
                     /db_xref="GeneID:59237824"
                     /translation="MTDQTALFRKCVHIVQQSIGNNALETNANQWTNNEEGEYLLKDT
                     FIKESQDLLKVIFELRKVLKLIEPQYFSDTDMSESEKDEFDTELRLQFHRYAQKFRLL
                     QNYEEERQKLITQKFLSGATSMSSFFHSAPKNEKVALFHRTNNEFRLGVLQILSMWLN
                     TVSSQFTSMQQKRLSAQKKFDNLDFNSGLHSPSEMTEAKSVSSISQSHVLESTQEEVK
                     RYEETISMLTQEQLQLLENEHEDLLNQKDEQLKAVGKINKTIVDIVSIQNEISANLQV
                     QSQNINNILDHQDDIEINIKEGNKQLTRAKKAAGRTARMTTYTAIILAIVILFLDYVS
                     "
     gene            complement(<1112695..>1114962)
                     /locus_tag="HG535_0F05790"
                     /db_xref="GeneID:59237825"
     mRNA            complement(<1112695..>1114962)
                     /locus_tag="HG535_0F05790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289897.1"
                     /db_xref="GeneID:59237825"
     CDS             complement(1112695..1114962)
                     /locus_tag="HG535_0F05790"
                     /inference="similar to AA sequence:RefSeq:NP_013010.3"
                     /note="similar to Saccharomyces cerevisiae HBS1 (YKR084C)
                     and SKI7 (YOR076C); ancestral locus Anc_5.680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145792.1"
                     /db_xref="GeneID:59237825"
                     /translation="MRKLLFAEYFFFINTFHSVKLETEPSTMSKLEQLARMKVAERPS
                     HLVEKTGDDSNSTPNKGISLLSKLKKNGTSSLSTEMRQPLSLSDRLKAKRINGSNSAA
                     PSSTARTDTANNGKGSLHDKLRAMRSKAEIKKVASKAQSKPLVNDAPRDPPTSSSLPT
                     SWDQIRFFLSKQNFPSSVIPVSDSVLGIIEAVTVPCKQNARCKKLQKRKYGEIFSVFY
                     PDVLVNTNKRKATSKTAAANFKKPSPDDVVINAQNKALTRVNEMVSGLKISENKHSAG
                     EEWHDSDPETLDNDDGPPKYSYKRVSIPTKPTNPVDIQKYLETSKAHCSFVVLGHVDA
                     GKSTLMGRLLYDVGAVDNNHIRKLKKESERIGKGSFHFAWVMDQTQEERERGVTVSIC
                     PSDFETANTQFTIVDAPGHSDFVPNAIAGISLADIALLCVDCGTDAFESGFNLDGQTK
                     EHTILARSMGVNRIVVAMNKMDTVEWYYGRFDQIKNELSTFFKDVGFKEDQIDWVPCS
                     GLSGEGVYKIAYPENASWYKGPTLIEKLEYVAQHISNSYHNEVIGSPFLFSILEAIPT
                     NKNEEAIISGRVESGSIQPGETITIYPSEQSAVVSKILVGNDAKSSHIVVKGDFATLR
                     LRHAHVEDIETGDLAGAVDYDVPVMREFSTQLLTFKMDRPILPGTSFMLFRGICQQPA
                     RVSKLVSIIEKQDPSKVIKKKVRHLGSNQAAIVEIELTERKRYIPILKIKENKRLGRI
                     LLRKDGRTIAAGAVI"
     gene            <1115803..>1116300
                     /locus_tag="HG535_0F05800"
                     /db_xref="GeneID:59237826"
     mRNA            <1115803..>1116300
                     /locus_tag="HG535_0F05800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289898.1"
                     /db_xref="GeneID:59237826"
     CDS             1115803..1116300
                     /locus_tag="HG535_0F05800"
                     /note="ancestral locus Anc_5.681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145793.1"
                     /db_xref="GeneID:59237826"
                     /translation="MSTATLSLLDEESFSGLNPKSRTIKARTHIFRNAVLFNVLPSNV
                     ISDTSSCEYCRLFSGEVYVEEFLNIHESGSVDQVPSYKLRFGWKYSSNEFFCQTEKID
                     NIHKLNEVITKWSVWHRIMMQCSGNRYVLLELQFDDMEEDRRFRDLVFRISDEFEILA
                     ELMWD"
     gene            complement(<1116455..>1117075)
                     /locus_tag="HG535_0F05810"
                     /db_xref="GeneID:59237827"
     mRNA            complement(<1116455..>1117075)
                     /locus_tag="HG535_0F05810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289899.1"
                     /db_xref="GeneID:59237827"
     CDS             complement(1116455..1117075)
                     /locus_tag="HG535_0F05810"
                     /inference="similar to AA sequence:RefSeq:NP_013011.1"
                     /note="similar to Saccharomyces cerevisiae MRPL20
                     (YKR085C); ancestral locus Anc_5.682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145794.1"
                     /db_xref="GeneID:59237827"
                     /translation="MQVFVRNFHGTHRSLKGVSRFIDNSKKIPELRGLPSIYNTKSSA
                     SNYKGYIKAKIPSAMYYSPAQSSSSGSINIETFPASFLPKGDSRKEFIKNLNSNDKLS
                     GEHAPPVLTSRSTMNPDGKQYHLRPSDIETIKALRSEDPEKYTRKALAKQFNVSPLFI
                     SIVSDASKKRKLEMNDRLQQIKLKWHEKRAIARDDRKKRKEFWYRA"
     gene            <1117334..>1120693
                     /locus_tag="HG535_0F05820"
                     /db_xref="GeneID:59237828"
     mRNA            <1117334..>1120693
                     /locus_tag="HG535_0F05820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289900.1"
                     /db_xref="GeneID:59237828"
     CDS             1117334..1120693
                     /locus_tag="HG535_0F05820"
                     /inference="similar to AA sequence:RefSeq:NP_013012.3"
                     /note="similar to Saccharomyces cerevisiae PRP16
                     (YKR086W); ancestral locus Anc_5.683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145795.1"
                     /db_xref="GeneID:59237828"
                     /translation="MVEDAGDILRWIQEHFAEAVTEQLVATLRRLYKNNKDNLPGFIE
                     GCNAFGKLRGQDDFIRRLFERLAGAEKGSLSEEHVVKSEPARKKRLGEMSSRVPLNYD
                     SDDNDDDTVDNYPKETPVNVKSKFRMKEVKNDGEMPRMKFKKIKKEVANKLKEYSSTD
                     GRLSISNGKPSNRSNSPSIVHAQVPELQSFYMSISQEPENNDDGTVANSSESDVPEEE
                     QLSEDRGWYNCDDDYGNPVLDDSVKTKELDFTPANQTYMRNKEKATDANDSYTEIQVY
                     ALPMSRRKELIPRFLQQYIETRGISNATLIGSFLQSSRDGFTSPFKNPDGVFAINARK
                     GSKLVAIRRLARDQSKSSRQTAEVAGTAVGNVLGIKEDKTENPIAVEIDAKSDKIELT
                     RADIELSRRKLPSYAAKSALLQLIRDNQIMVIIGETGSGKTTQLAQYIYEAGICAGGQ
                     LIGCTQPRRVAAISVAKRVALEMDAELGQEVGYAIRFEDETSEKTKIKFMTDGILLRE
                     ALLDETLEKYGCIVIDEAHERSLNTDIVLGMLKRLLSRRRDLKVIITSATMNAAKFSK
                     FFGSAPLFTIPGRTYPKKLIYSKSPVEDYVEAAVMQTVSIHVSTEIDSGDILIFMTGQ
                     EDIEATFDAIKERLAEVYSRNSSISTFNDIDNVEIFTIYSALPGDIQNRIFESLPSGK
                     RKIVIATNIAETSLTIDGIRYVIDPGYAKMKIYNSRIGLDSLTVCPIARANADQRSGR
                     ASRTSPGTTYRLYPESTVEEDMFAQTIPEIQRTNLSNTVLLLKTLGIDDIMEFPFIDA
                     PPLQTFLSSLYELFFIGALDASGKLTSLGVAMSRFPLQPSLSKILLIASQNGCSEEML
                     TIVSMLSVPQVFYRPKERMRESDLSRRRFFVAESDHLTLLNVYSQWKCNKYSHRWCNK
                     YFLHYKSLQRAREIREQLKKIMAKNRIKLVSAGPDWSIIRKCICSGFAQQCAKRSGLS
                     KYVHLKTGMDIQLHPTSALYGMGDLPSYIIYHELLMTKTEYACCVTAVDPFWLMEYGA
                     LLYDIKRVAYVNDSQRITQVDVQSGNLPQKEDELEHRLKRCIAEKTRLIQTLKLQQDS
                     KDIIPKSEISTSNKKKQRHTAHIGLKRKRPF"
     gene            complement(<1120747..>1121787)
                     /locus_tag="HG535_0F05830"
                     /db_xref="GeneID:59237829"
     mRNA            complement(<1120747..>1121787)
                     /locus_tag="HG535_0F05830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289901.1"
                     /db_xref="GeneID:59237829"
     CDS             complement(1120747..1121787)
                     /locus_tag="HG535_0F05830"
                     /inference="similar to AA sequence:RefSeq:NP_013013.2"
                     /note="similar to Saccharomyces cerevisiae OMA1 (YKR087C);
                     ancestral locus Anc_5.684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145796.1"
                     /db_xref="GeneID:59237829"
                     /translation="MIRISLKRNFLGRNVFKSNPVLLARLYSGTRYRRFNGNQDKTFK
                     DYLYDASSRKYLAILLGGGSLFYISNLDEAPVSGRTRFIWLPRPIETLVGDYSYKSIL
                     GQTGNSILPESHSVTQRVARVFERIVDAAYKDPSVDKTMLEGVNWKIHVVNDPSAPPN
                     AFVLPGGKVFVFVSMLGICQNDDGLATVLSHEFAHQLARHTSENLSKAPFCVMLSAFM
                     YTLTGANAFNGLLLDGFLRMPASRQMETEADYIGLMIMSRACFNPDESVRLWRRMEEF
                     EKQQARGASNFEFLSTHPASERRIENMTKWLGKAREIYEQSDCSMYNSYYQGLKNSVF
                     GFADPQFTLSRI"
     gene            <1121954..>1122679
                     /locus_tag="HG535_0F05840"
                     /db_xref="GeneID:59237830"
     mRNA            <1121954..>1122679
                     /locus_tag="HG535_0F05840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289902.1"
                     /db_xref="GeneID:59237830"
     CDS             1121954..1122679
                     /locus_tag="HG535_0F05840"
                     /inference="similar to AA sequence:RefSeq:NP_014720.1"
                     /note="similar to Saccharomyces cerevisiae RTS2 (YOR077W);
                     ancestral locus Anc_5.685"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145797.1"
                     /db_xref="GeneID:59237830"
                     /translation="MAKAEFGSAKYLSNQMKARGLQKLRFYCQVCEKQCRDENGFKSH
                     IRSPSHLRKISQLSEASIDEYTRGFESDFLKLLKISHGEKKIRANKFYSQFIQDKNHI
                     HMNATRFTSLTKFVQHLSKEGKIRLHGSEDVPEEDMDVEQLSISYVDNSKENLQRKEA
                     LHELEINETSEQEINAKLLQRQIETCLKDAMEEEKNHEVPINASNSYNEHKDKVKIDL
                     KASIKSQRVAKKRSKPKKKSLFN"
     gene            complement(<1122705..>1123655)
                     /locus_tag="HG535_0F05850"
                     /db_xref="GeneID:59237831"
     mRNA            complement(<1122705..>1123655)
                     /locus_tag="HG535_0F05850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289903.1"
                     /db_xref="GeneID:59237831"
     CDS             complement(1122705..1123655)
                     /locus_tag="HG535_0F05850"
                     /inference="similar to AA sequence:RefSeq:NP_013014.3"
                     /note="similar to Saccharomyces cerevisiae TVP38
                     (YKR088C); ancestral locus Anc_5.686"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145798.1"
                     /db_xref="GeneID:59237831"
                     /translation="MSFREGDLFEDSFLGDFGNESNTNDLGDRDDDDDFLDVYNLTPR
                     QRLGHSLQKMSRKLVQQYNGLPWWQRYLAYFAGTCLLIAGITLLVFHDRILHRIVETS
                     NELKDEKRTSFVLVALIFVVAFPPLIGFSLLGTITGLIYEMSFQGWLILAVGAVAGSI
                     ASFATFKTVLHSRAESLVHSNRRFEAFSSLLRENNSFWILALLRLCPFPYSLTNGAMA
                     AIYGLSIKNFAIAQFIVTPKLLIYLFIGSRIKNIGETKSASSKILNLLSILATMAILT
                     ITAWILYFKTQRKYAELQRRDQQLNADSNQNAAFDASFDI"
     gene            <1124330..>1125175
                     /locus_tag="HG535_0F05860"
                     /db_xref="GeneID:59237832"
     mRNA            <1124330..>1125175
                     /locus_tag="HG535_0F05860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289904.1"
                     /db_xref="GeneID:59237832"
     CDS             1124330..1125175
                     /locus_tag="HG535_0F05860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145799.1"
                     /db_xref="GeneID:59237832"
                     /translation="MSTIASGIPIPQAKPELAENVMDLFSLKGKVASVTGASGGIGYE
                     VAVGFAQAGADVAMWYNSNPAIEKEVEGLSKKYGVTVKAYQCSLTDGEQVSKTIQQIE
                     SDFGKIDIMVANAGVAWAYGPLLDLAEEDSEKCDYEWKRMMDIDVNSVYYVAKNVGSV
                     FKKQGFGSFVITASMSGHIANVPKLQVAYNTAKAALIHMGRSLALEWAGFARVNTVSP
                     GYVETPLTASRAPELKQQWRTLVPMGRLAYPKEMVGAYLYLASDAATYTTGTDIIVDG
                     GYCCA"
     gene            <1125484..>1126110
                     /locus_tag="HG535_0F05870"
                     /db_xref="GeneID:59237833"
     mRNA            <1125484..>1126110
                     /locus_tag="HG535_0F05870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289905.1"
                     /db_xref="GeneID:59237833"
     CDS             1125484..1126110
                     /locus_tag="HG535_0F05870"
                     /inference="similar to AA sequence:RefSeq:NP_014721.1"
                     /note="similar to Saccharomyces cerevisiae BUD21
                     (YOR078W); ancestral locus Anc_5.687"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037145800.1"
                     /db_xref="GeneID:59237833"
                     /translation="MPAKPRSHVKFSEEIASDPAHVKVQTVQSTEHSSDDESDESEDD
                     APEEEGVSNGKLMVEKEILKREELLKAEQKQLKEQRRKNDAFYKSQQQSKKGRTSEIR
                     NNDTLDELPEEIFNKLEDDNKLCRQEASSKHINFNEEDYIPEIKKQLSDKKKLTLKKL
                     RATSAKKGPVSVKVLSSTQLLSSMAPKREASIMGTKEKWLRRKALKRR"
     gene            complement(<1126225..>1127250)
                     /locus_tag="HG535_0F05880"
                     /db_xref="GeneID:59237834"
     mRNA            complement(<1126225..>1127250)
                     /locus_tag="HG535_0F05880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037289906.1"
                     /db_xref="GeneID:59237834"
     CDS             complement(1126225..1127250)
                     /locus_tag="HG535_0F05880"
                     /inference="simi