GenomeNet

Database: RefSeq
Entry: NC_050731
LinkDB: NC_050731
Original site: NC_050731 
LOCUS       NC_050731            1098848 bp    DNA     linear   CON 10-NOV-2020
DEFINITION  Torulaspora globosa chromosome 5, complete sequence.
ACCESSION   NC_050731
VERSION     NC_050731.1
DBLINK      BioProject: PRJNA670758
            BioSample: SAMN14605265
            Assembly: GCF_014133895.1
KEYWORDS    RefSeq.
SOURCE      Torulaspora globosa
  ORGANISM  Torulaspora globosa
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Torulaspora.
REFERENCE   1  (bases 1 to 1098848)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     The yeast mating-type switching endonuclease HO is a domesticated
            member of an unorthodox homing genetic element family
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1098848)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1098848)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2020) Conway Institute, University College Dublin
            (UCD), Wolfe Lab, Belfield, Dublin Dulin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP059250.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: HGAP v. 3
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100.0x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1098848
                     /organism="Torulaspora globosa"
                     /mol_type="genomic DNA"
                     /strain="CBS764"
                     /isolation_source="soil, St Thomas, West Indies (strain
                     received from Westerdijk Fungal Biodiversity Institute)"
                     /type_material="type material of Debaryomyces globosus"
                     /db_xref="taxon:48254"
                     /chromosome="5"
                     /country="USA: Saint Thomas, West Indies"
     gene            complement(<3663..>4604)
                     /locus_tag="HG536_0E00100"
                     /db_xref="GeneID:59326296"
     mRNA            complement(<3663..>4604)
                     /locus_tag="HG536_0E00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283878.1"
                     /db_xref="GeneID:59326296"
     CDS             complement(3663..4604)
                     /locus_tag="HG536_0E00100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139774.1"
                     /db_xref="GeneID:59326296"
                     /translation="MSNSPKIVYGGYPFGLLPHEDSSKIVEVLKKSGIRELDTARIYP
                     GSEKAIGELHLPEQFVIDTKARGFTDGSLTKKGIEESIAESLDLLGVESVEIFYLHCP
                     DRDTEIEETIDAINELHQQGKFKKFGLSNFPAKDVEQVYNYAKSKGYVLPTVYQGNYN
                     AVARRSESELFPLLRKLNIAFYAYSPIAGGFLARSVDDIKNGEGRFDPNTPVGQIYLK
                     LYSRPALLTALDEWDKLAQKVGTTKARLAYRWVVHNSVLSGKFGDAVIIGGRNADQVT
                     DTAEAISEGPLPANIVSEIDKLWEKIKDEAPLDNYSF"
     gene            complement(<5367..>6509)
                     /locus_tag="HG536_0E00110"
                     /db_xref="GeneID:59326297"
     mRNA            complement(<5367..>6509)
                     /locus_tag="HG536_0E00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283879.1"
                     /db_xref="GeneID:59326297"
     CDS             complement(5367..6509)
                     /locus_tag="HG536_0E00110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139775.1"
                     /db_xref="GeneID:59326297"
                     /translation="MSELFAPAPEPPTELGRLNLLSKTAGIKVSPLALGAASIGNAWS
                     EYLGSSNKERAFELLDVYYEAGGNFIDTANNYQNEESEAWIGEWMESRKIRDQLVIAT
                     KFTSDYKAYEVGKGRSANFGGNNRRSLHVSVRDSLKKLKTDWIDILYVHWWDHMTSIE
                     ELMDSLHVLVQQGKVLYLGASDTPAWVVSAANYYAVSRGKTPFSVYQGRWNVMLRDFE
                     REILPMAKHFGMALVPWDVLGGGRFQTKESIEERKKRGEKLRSFGQPPEQTELEVKIS
                     SALEKVAKEHGTQSVTAIALAYIRSKGTNVFPLVGGKKVEHLKDNIAALSIKLTREQV
                     SYLESVVPFDIGFPTSLIGQNPAISGELAFLSASCYKLNLDSLQFK"
     gene            <7905..>9125
                     /locus_tag="HG536_0E00120"
                     /db_xref="GeneID:59326298"
     mRNA            <7905..>9125
                     /locus_tag="HG536_0E00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283880.1"
                     /db_xref="GeneID:59326298"
     CDS             7905..9125
                     /locus_tag="HG536_0E00120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139776.1"
                     /db_xref="GeneID:59326298"
                     /translation="MEFLETPAGNPLQYMATVYGRGLNYERPPFTFQSNEWEALARNR
                     MSQEALGYVCGNASTGETYQKNREAFKKWSIVPRRLVKTTSYPSLKINLFGREIPSPI
                     ATAPVGVLRIFNPDGEIAVAKAAARERVPYIYSSAAATAMEDVAKANGDGVRWFQLYW
                     PANEHNDITASLLKRAKANGFSALFVTLDTYKLGWRPSDLNNGYNPFLRSDSIGTALG
                     FSDPVFRSHFKAKHGKEVEEDLHSAASEWASMIFPGFSHGWEDIAFLREHWDGPIILK
                     GIQSVQDAKHAVELGIEGIVVSNHGGRQQDGGPASLDCLVKIVKAVRDKIDIIFDSGI
                     RCGADIAKAMAIGAKMVLVGRPYVYGLVLGGEEGVEHVLRSLLGDLTMNLHLAGIPSV
                     SQKDLNVDSLEFSG"
     gene            <10225..>11124
                     /locus_tag="HG536_0E00130"
                     /db_xref="GeneID:59326299"
     mRNA            <10225..>11124
                     /locus_tag="HG536_0E00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283881.1"
                     /db_xref="GeneID:59326299"
     CDS             10225..11124
                     /locus_tag="HG536_0E00130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139777.1"
                     /db_xref="GeneID:59326299"
                     /translation="MTELEEKLLVTSSYGYVNVDQGVKIWYRSAGKLGAPTILLLHGF
                     PTSSNMFRNLIPLLASKFRVIAPDIPGFGFTEYPANYEFTFENLTSSIEQFLEALRIS
                     KFSIYVFDYGSPIGFRLALRKPSSITGLVAQNGNAYEVGLDDRFWAPIKEYWKHNQED
                     PKYIQAFTEYLQDEKNVVTQYVGGVSDPSSVDPTNYTLDYALLKRPNQEAIQIKLFHD
                     YRTNVELYPEFQRFLRNADIPVLVTWGKNDTIFTVEGAESYRADAKRLKIVYYQTGHF
                     ALETHVAQIADEITTHIFQNIAH"
     gene            complement(<11598..>12344)
                     /locus_tag="HG536_0E00140"
                     /db_xref="GeneID:59326300"
     mRNA            complement(<11598..>12344)
                     /locus_tag="HG536_0E00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283882.1"
                     /db_xref="GeneID:59326300"
     CDS             complement(11598..12344)
                     /locus_tag="HG536_0E00140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139778.1"
                     /db_xref="GeneID:59326300"
                     /translation="MEVTQRLSPNLWIIMAEKRINKYLCPVPNCEKRYTRPCLLRQHV
                     LTHNNERPYACSFPGCGKRFFRGSHLKAHSWTHSVKKPITCSICCKGFVTNQQLSRHE
                     KTHKMQDILENCAENHSAHLPSVDLKEQPGTVSHICPYLECFDEFATESLLTEHMLDS
                     HMMSPIVHGLEPQLLSKRNSENEVSSNSPVDTNTGHWVDMSCKTTDCSSFEPFERPTQ
                     LIAHYDWDHAFVPESLYFTGINNEESDQSS"
     gene            <15056..>15523
                     /locus_tag="HG536_0E00150"
                     /db_xref="GeneID:59326301"
     mRNA            <15056..>15523
                     /locus_tag="HG536_0E00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283883.1"
                     /db_xref="GeneID:59326301"
     CDS             15056..15523
                     /locus_tag="HG536_0E00150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139779.1"
                     /db_xref="GeneID:59326301"
                     /translation="MRLNNDSSTFAVVGSDSTITEGSEADASGKFSIRNGHLLLNHLG
                     IFFFAIPEGASYLFSTHKGESAVEITIRATAPNGQTVPDFPPPGVDKDISSANETSAF
                     DTSTIAQSTTASATAISQTSDGQIVAIQTENSAPKAAVGLGASIVAAVAALLL"
     gene            complement(<16320..>17783)
                     /locus_tag="HG536_0E00160"
                     /db_xref="GeneID:59326302"
     mRNA            complement(<16320..>17783)
                     /locus_tag="HG536_0E00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283884.1"
                     /db_xref="GeneID:59326302"
     CDS             complement(16320..17783)
                     /locus_tag="HG536_0E00160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139780.1"
                     /db_xref="GeneID:59326302"
                     /translation="MKFNPSVTDLLKYDRDHIWHPYTSMSNPMLVYPVKEAHGCEITL
                     ESEEPKNHKMIDAMSSWWCAIHGYNNKEINDALVSQITKVSHVMFGGLTHEPAITLVK
                     KLLKLLNHDELQHCFLADSGSVAMEIALKMALQYQFSLNPVPSFQKRKFLTISKGYHG
                     DTIGAMSVCDPFSSMHSIYSGYVAENIFAEGPSTVPTLPTSKIFKENPQLFGDTVAFD
                     EKDIADFRVKLKNNHEEICAVVLEPILQGAGGMRLYHPQFLIEVRRLCDSYNIPLILD
                     EIATGFGRTGAMFAFHHCKIYQDEQNIPKESQVDVYPDIICVGKALTGGYMTLSAVVT
                     TPKIAITISNPSLPTGGCLMHGPTFMGNPLACAAANKSLDILLRGDWIDEVLFIENQL
                     FVGLYKKVIADDVVMQVVSDIRITGAVAVLELKNAVDSLWFHHKFVSKGVYVRPFRNL
                     CYIMPPYIISAEELSKVTRVIREVLREWAAEISAKKN"
     gene            <18440..>19099
                     /locus_tag="HG536_0E00170"
                     /db_xref="GeneID:59326303"
     mRNA            <18440..>19099
                     /locus_tag="HG536_0E00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283885.1"
                     /db_xref="GeneID:59326303"
     CDS             18440..19099
                     /locus_tag="HG536_0E00170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139781.1"
                     /db_xref="GeneID:59326303"
                     /translation="MQQPIIFVTGTDTDVGKTFVSTLLVYKWQANYWKPVQTGIESDD
                     GDSVTVSKAECGLPWKPEIYSPRYELLKPLSPYKAMDYEPEVDIRLSDFEIPKGSDSS
                     PLIVEGAGGVFVPLTRNLETMTDLMRKLAEKQDRPFKIIVVTRSGLGTLNHTLLTISH
                     LQNAGLREHIMGVIVNGERNPDNVQVFKDYGLKILAEVDKSESAAAATKFIPPLCQFL
                     K"
     gene            <19295..>20938
                     /locus_tag="HG536_0E00180"
                     /db_xref="GeneID:59326304"
     mRNA            <19295..>20938
                     /locus_tag="HG536_0E00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283886.1"
                     /db_xref="GeneID:59326304"
     CDS             19295..20938
                     /locus_tag="HG536_0E00180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139782.1"
                     /db_xref="GeneID:59326304"
                     /translation="MTRKSFAKFNWLSLLGIAFSLTSSWLGVSSSLVAGISSGGPLLI
                     IYGLIIGVVFTLMCGLSLSEFSSMLPNASGVCFWVLKLLSEELDPDMVEKEVGKCEEE
                     DTQEEVLEVMADGSLEDQLDEGLLEAYCSGKNLFITKKWKKDLGIMTGLINYAGAIFT
                     CASICASLSLSILGLYSLMHSDYELKHWHVFLTFELLNIAIAFVASWARWLPAISQFG
                     LGISVISYFMTFLVCIISRSLDHSEPWPSGKAIFGEFENTTGWSSKGIAFIVGLVNPL
                     WAFAAIDSTTHMVADVGYSTSRRLVPKTIMLTILLGFATSFPYAIVMFFCITDTKAVA
                     ESILPILQIYYQATGNKSLSAFMQSCCITTGFICGVSCSTWQNRILWSVSGTYHAIER
                     DEMHAKKAALVRKLGSINPQIRIPLYAHLLSHLFVAIIGCIFMGSSTAFNAVITACIS
                     ILLLSYAIPCVIMLFVVGKKSFYRRIASEHQALQVRQEFSESRASWYLIPNILTICWA
                     IFCLVFLSFPYVIPVDSSNMNYVCVVYGATAILIGIALL"
     gene            <21239..>22936
                     /locus_tag="HG536_0E00190"
                     /db_xref="GeneID:59326305"
     mRNA            <21239..>22936
                     /locus_tag="HG536_0E00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283887.1"
                     /db_xref="GeneID:59326305"
     CDS             21239..22936
                     /locus_tag="HG536_0E00190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139783.1"
                     /db_xref="GeneID:59326305"
                     /translation="MKRGPLKVPASQAQKKPKLHGDYDQYYNLNKTYYKNPITCQRAN
                     EFNNGKRKKPIDLLNHHISTQGKRDNVKTFIHWFRGDLRTHDNTGLFEAIKQFRERKD
                     KTSGQLLTVFTINEHDWRAHLDSGWKLKFMMNAVSSLGEKLSKMSIPLYVLHYNPESP
                     SLSNSNQFASWLKEECLNFAKGSGPVLLTANAQYETDELYRDVKILEQSDPSFKFKIF
                     HDACVIEPKLLTTGKGTQYTVFTPWYKKWAAEATSRMQKSKTFVRELSNDPIKDEEID
                     FKPLQYELPSEFLSYIPEGAPELPEASEDAAFQLLSDFLGQRAHAYDKKDYLPDEGSS
                     HLSCYITSGLISARYIVSEASKLSNGALAAKDIKKNSPIQEFIRQVAWRDFYKHAFCN
                     WPFLSMDLPYNFELNEMKWSNDQEAFRKWCEGKTGVPIVDAIMRELLCTAYVNNRARM
                     IAASFLCKNLLLDYRWGERWFRRHLIDFDLASNVGGWGFCSSTGIDAQPYFRILNMEL
                     QSKKFDPDGRYIRKWLPELKDCKDVHTFNLKRNGYQSAIVDYKKSREKALATYRQIL"
     gene            complement(<22982..>24034)
                     /locus_tag="HG536_0E00200"
                     /db_xref="GeneID:59326306"
     mRNA            complement(<22982..>24034)
                     /locus_tag="HG536_0E00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283888.1"
                     /db_xref="GeneID:59326306"
     CDS             complement(22982..24034)
                     /locus_tag="HG536_0E00200"
                     /inference="similar to AA sequence:RefSeq:NP_014046.1"
                     /note="similar to Saccharomyces cerevisiae YMR315W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139784.1"
                     /db_xref="GeneID:59326306"
                     /translation="MAPVLNVGIIGTGIFARDRHLPSYEEMSSDFKVVAAFNRTKSKA
                     LDFGKRAGLPEEKIYDDIDGILADKDVSYVDALVPAQFNVLTAEKAIAAGKPILLEKP
                     IAATMQQARELVKLSDSTDLPIGIAENWLYLGAIDVVQKHLPEIGAVIAFTHNSTGPF
                     LTKNKYLSTSWRQNPEHIGGFLSDGGVHQLALVTHLLGEFDTVSALTKQVRKESGTDD
                     IVFSTVKLVDSDVIGTFTYGSSFGATEKSVFLKIYGTKGSIEAQLSDKRNPVVKVQLG
                     DSAETSEKEVIYPIKEDGSFGVNAEFKSFHEAVVKGDKSLYKGTPRVAFHHLACVAAF
                     LESSAKNGDHVKVERV"
     gene            <24640..>25251
                     /locus_tag="HG536_0E00210"
                     /db_xref="GeneID:59326307"
     mRNA            <24640..>25251
                     /locus_tag="HG536_0E00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283889.1"
                     /db_xref="GeneID:59326307"
     CDS             24640..25251
                     /locus_tag="HG536_0E00210"
                     /inference="similar to AA sequence:RefSeq:NP_014492.1"
                     /note="ancestral locus Anc_3.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139785.1"
                     /db_xref="GeneID:59326307"
                     /translation="MATESNGASAMTMEFYRKALNFNVIGRYDPKIKQLLFHTPHASV
                     YKWDFEKNEWNKLDYQGVLAIYLRDVASKDSFLPASDIGEQSVSSSGGQQMETASYGE
                     THSGRDIYNYGLIILNRINPDNFSMAIVPNSVVNKRKVFEAEENAKNPLECMGVEVKD
                     ELVIIKNLKKEIYGIWIHTVADRQNIFELIKYLLENEPQSSFA"
     gene            complement(<25288..>27030)
                     /locus_tag="HG536_0E00220"
                     /db_xref="GeneID:59326308"
     mRNA            complement(<25288..>27030)
                     /locus_tag="HG536_0E00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283890.1"
                     /db_xref="GeneID:59326308"
     CDS             complement(25288..27030)
                     /locus_tag="HG536_0E00220"
                     /inference="similar to AA sequence:RefSeq:NP_014493.1"
                     /note="ancestral locus Anc_3.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139786.1"
                     /db_xref="GeneID:59326308"
                     /translation="MSNLPYDATGADANQSFGIAVNAGNGSSGGPVNAERPMGAQAGL
                     TQQQQLQLQQRQRMLLQQRALQQQKHQQALQNYESQFYQLLMTLNKKPKRIYNFVEDA
                     DQTLKKYEQYRPSFEFHIYENNYKICAPANTRLQQQQKTPELNSDGLILNKNNAILKD
                     FLEYVARGKIPESITEVLRDCNIQFYEGNLILQVYDHTNTVDVVANDQNGQQSSQQKN
                     SSTPEQQGDTAVKRETDPQSSSETPEAKKTRPATYKRPRVYRTLLEPSDLTHYYDMMS
                     YADHTRFSDSIYQQLESEILSLTKRNLSLDVPLNPYDHRDIFEPEAFATPSWDENTKR
                     FKHIHREECKKPGTKGAVGHIDEHEELPQHSSNYEQMMLIMSERTTTSTNATFAASLT
                     KNALQLEAASSKLSNGRGSPISGGGKSGNRGSTASRNQAAIAAAAAAAAAGLTAGNEN
                     NQFSRLKFIEQWRLNREKRKQQTLNNNIAPNSLNNAISMAAPLTAQQQLLQQQQSMER
                     ADQRQDFQSEQRVGSQQAAAKKRMTNDKPKPKRPRKTKKAAADGAEPQAKKKRVTKKK
                     QADNSSPVDTSEAF"
     gene            complement(<27186..>27881)
                     /locus_tag="HG536_0E00230"
                     /db_xref="GeneID:59326309"
     mRNA            complement(<27186..>27881)
                     /locus_tag="HG536_0E00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283891.1"
                     /db_xref="GeneID:59326309"
     CDS             complement(27186..27881)
                     /locus_tag="HG536_0E00230"
                     /inference="similar to AA sequence:RefSeq:NP_014494.1"
                     /note="ancestral locus Anc_3.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139787.1"
                     /db_xref="GeneID:59326309"
                     /translation="MVCDTVVYHPSVSRLIRFLDSTAGREKVLRLLQYLSRFLAFQQS
                     SVLAKQLQAQFTVVRKILRFLKPLNHLQAASKFYDNKLSGDALVRACNVIKNLAYAGY
                     LSFDQVNLLRMLRLVPVTGFTAKRVPLWSNWCWFVGLLTGLVMDARKIQLAQQRIVAL
                     AEEKSEKYEEDKLLAKSYQERGAAVRRLLWDAIDTFIVLNNLNFLHNEDGHVALAGVA
                     TSLFGLQDLWNAA"
     gene            <28139..>28711
                     /locus_tag="HG536_0E00240"
                     /db_xref="GeneID:59326310"
     mRNA            <28139..>28711
                     /locus_tag="HG536_0E00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283892.1"
                     /db_xref="GeneID:59326310"
     CDS             28139..28711
                     /locus_tag="HG536_0E00240"
                     /inference="similar to AA sequence:RefSeq:NP_014495.2"
                     /note="ancestral locus Anc_3.4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139788.1"
                     /db_xref="GeneID:59326310"
                     /translation="MGYYELEDVLADGSEVPCKFQYSMPGLGYLAGNAGKPIEKNSKL
                     LLPLWLARVLAIVGGSEGEEIADDEEAMPFVELSRPEMFSAKVVNAIKAGAASLDLHS
                     VNSHFYMLAIKWIALFGDAELGSVIAEMVMERSLELNGHASSVGVSAVESQASQAGSP
                     FLLTLDESEKETYRRAHDSYRRTKRWMLEK"
     gene            complement(<28766..>31984)
                     /locus_tag="HG536_0E00250"
                     /db_xref="GeneID:59326311"
     mRNA            complement(<28766..>31984)
                     /locus_tag="HG536_0E00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283893.1"
                     /db_xref="GeneID:59326311"
     CDS             complement(28766..31984)
                     /locus_tag="HG536_0E00250"
                     /inference="similar to AA sequence:RefSeq:NP_014496.2"
                     /note="ancestral locus Anc_3.5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139789.1"
                     /db_xref="GeneID:59326311"
                     /translation="MEAANPGAYPSMEWPSSLDIPLKASEEVVSIDLKTDLPDDPADL
                     KTLLVEEGSDKEHWLTIAVAYCNQGKTREGMRLAEMALETFENSESGSLHTFLTWAHL
                     KMAKEHPYDVDVKERELTEAEVHLKSAIGLDPTWIGNMLATIDLYYQRGHYDRALETC
                     DLFVKSIYAEDRRTGRTSKQNAFFLLLRAKLLYQKKNYVASLKNFQELLVINPVMQPD
                     PRIGIGLCFWQLKDYKIAISSWKRALELNPKNENAAILVLLGDFHTSLTTSETDAAFK
                     ESYSKVLSDLNNLYGKDKQNPVLLTLLEIYFFLKGDYEKVIDIYESNIKERSSLLTST
                     VLSEALFWCGRAYYAQHDYRKAFAMYQQCLKLNEDNLLAKFGVGQTQIKNKLVEESII
                     TFENLFKSFENIQELNYILGLLYASKHFDKGASKGSSGSDAMVLNEKAIQYLSKYIKL
                     TSSKKNQIVVPRAYLVISQLYEDQNNYKQSLEYLSKAYEELKALDSAVPLEILNNLGC
                     FHFINGDLATARQYFEEAKKMFKEGSEMTIGYNIARTLESTDEAESRKMYDQILSQHP
                     GYVDAQIRSLFLQLSNNDADTSAIEDTMRKFYKANESNLEVRSFYSWFLKKCKKDKKN
                     DDLETAHNKETLVKYDSHDLYALISLGNLYCVIGRGERKSPKPKDQENAKQSFLKAVQ
                     LFQKVLQVDPYNVFAAQGIAIVFAENKRIGPALEILRKIRDSLDNEDIHCNIANCLLE
                     MHENAKAIETYEYTLKRFGNPQNKSRLLNLLSKAWFSRGVREKSFEFLKKALSNAEMA
                     IELEVQSPSGKFAAMLKYNAALLHFQIAETLRRAPPKQRKVVQITEAITGLQTALKIL
                     KELQTSKDFNIIPEEELEQRIQLGETTMKSSLERIVKEQKEFEEEQDRKLEAARKILE
                     ESEIEKQRKQREEEQARRLKLEKQKEEYRKLQDEAQKLIQEREAMVAAEDEKEQLSDE
                     LPEDADHANGKKGTKKRKSKKRADGEPKKRRKKQEAERSTDARDSADEEDETVKPTGR
                     KAKKAALSNEFIEDSDDSDEAELAAGSRSDAATNDDEEDDLF"
     gene            <32246..>33658
                     /locus_tag="HG536_0E00260"
                     /db_xref="GeneID:59326312"
     mRNA            <32246..>33658
                     /locus_tag="HG536_0E00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283894.1"
                     /db_xref="GeneID:59326312"
     CDS             32246..33658
                     /locus_tag="HG536_0E00260"
                     /inference="similar to AA sequence:RefSeq:NP_014497.1"
                     /note="ancestral locus Anc_3.6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139790.1"
                     /db_xref="GeneID:59326312"
                     /translation="MSGIRKRIYVGNILQNEQSCLKELHGRFAKFGRCLSDEFEKHDS
                     YAYINMDFDDESQFQRLKKSFNNVKFKGNELRVNLAKPSWKETWQQRHKEEEMQSRRM
                     DKVNRKRDWEYYKKIENIGMSWEDRRSLIPGRVRKSQRRKAQMRNITFRVNVGGSLKV
                     YKCYKTKLWGYERDKDLKDLVFKFVNDKWRDGCDHIVDRLDYGRSKRSVLSILDLKPL
                     EAHVAGADDVEAEEEKKEKEKVKDVLTSVLRDFEFDKPLQLSDEEDFSMSSSKPTMNQ
                     KHGLPKRGQEEEPNLPSEPSQEEFYQKEGEKDEDGDDEEFIPTFSAQKDAPPEQTGSG
                     EISNTETLRNLFNPESNDPTSSFKLIAESDDDIDHKNDEEFKEITAAPQEVSEEVRSL
                     QNKERQHLFFPHFSSPFLVGQTKLSKLKSSDISETLSNWDEMFWENRGIWTKEMKRRQ
                     RDALRLLNKKRAKKNGGILL"
     gene            complement(<33688..>34206)
                     /locus_tag="HG536_0E00270"
                     /db_xref="GeneID:59326313"
     mRNA            complement(<33688..>34206)
                     /locus_tag="HG536_0E00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283895.1"
                     /db_xref="GeneID:59326313"
     CDS             complement(33688..34206)
                     /locus_tag="HG536_0E00270"
                     /inference="similar to AA sequence:RefSeq:NP_014498.1"
                     /note="ancestral locus Anc_3.7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139791.1"
                     /db_xref="GeneID:59326313"
                     /translation="MAVKGLGKVDKQYDGSKLRVGIIHARWNREIIDALVKGAIDRML
                     SMGVKEENIVVETVPGSFELPWGCRRFVEISHQEGRPFDVVIPIGVLIKGSTMHFEYI
                     ADSTTKALMSLQEKVGLPVIFGLLTCMTEEQALARAGIDEGHTMHNHGEDWGAAAVEM
                     AVKFNPDAQKRS"
     gene            complement(<34464..>35765)
                     /locus_tag="HG536_0E00280"
                     /db_xref="GeneID:59326314"
     mRNA            complement(<34464..>35765)
                     /locus_tag="HG536_0E00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283896.1"
                     /db_xref="GeneID:59326314"
     CDS             complement(34464..35765)
                     /locus_tag="HG536_0E00280"
                     /inference="similar to AA sequence:RefSeq:NP_014069.1"
                     /note="ancestral locus Anc_3.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139792.1"
                     /db_xref="GeneID:59326314"
                     /translation="MVYEAKPFDPITVKPNEKRRVAYFYDADVGNFSYGQYHPMKPHR
                     IRMAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESV
                     KFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKAEASGF
                     CYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGT
                     GELRDIGVGSGKYYAVNVPLRDGIDDATFRNIFEPVIAKIMEWYQPAAVVLQCGGDSL
                     SGDRLGCFNLSMSGHANCVNYVKSFGIPMMVVGGGGYTMRNVARTWCFETGLLNNVIL
                     DSELPYNDYYEYYGPDYKLDVRPSNMFNVNTPEYLDKIMSSIFENLENTKYAPSVQLT
                     NVPKDPEDLGDVEEDTAEAMDTKGGSQYARDLQIERDNEFY"
     gene            complement(<36055..>39150)
                     /locus_tag="HG536_0E00290"
                     /db_xref="GeneID:59326315"
     mRNA            complement(<36055..>39150)
                     /locus_tag="HG536_0E00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283897.1"
                     /db_xref="GeneID:59326315"
     CDS             complement(36055..39150)
                     /locus_tag="HG536_0E00290"
                     /inference="similar to AA sequence:RefSeq:NP_014070.1"
                     /note="ancestral locus Anc_3.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139793.1"
                     /db_xref="GeneID:59326315"
                     /translation="MKVNIQFDHTPRCNICEVSRDLFVGHESIKDTVYAAVEIPSYDK
                     ALPLRVTVNCIRNDTLPFETIKVSAKLFDVSASGPTVSVCNFEVLEGKPSVLESVTIL
                     LRDQLYSRLMQLRKPRHRLDFLEKRYGLQHCRTVVNDGFLLEPYWCAVSHCFPSREGV
                     VDFYETQFVFVKDKNHRLGDPIPSERLDESFMLGAASQATLKLAALKYPVSLELISPS
                     PSLKDDDSIYAFADFRTLLALGVTSGSHINISNKVTSRMVRIFVLVHPHRFESFTIYS
                     TPRLLASFQGDFNVTISKCTVNEIQLPTASSVSIARVGSWNQCQKIYQNIILTKLKLF
                     FTTKRRILHVGDMIPISFDTTLATLYSEDLDSGLSDSTFLDSSLLNQKEDALVWFYVE
                     GVKLNDDSHLDAEFVIEPSKTKLVTANIIDKAPLKLSKCDFISYFDLDPVFHYDLTKF
                     PYAQKLTDLLETSLKCKDKRIKISTTVLLRSTAPNCGKSSLVQSIALNLGFHLLAIDC
                     LTLSVNAGSQDSTAKTIGYLRGKIEGVLTNTRPAIVYLSHLDVLIMAKDPNQNPESLR
                     ASRAMDLEIAKLITDIASNFEDTVFICSVSDPDSLPTNVRNHMKFELDVPVPDEPQRN
                     AFFEWFLSPSLLNRGLGGNIPRYAVSTDVSLPRLSQHSAGLTPLDIRVIVETAKFQCA
                     KRHKSNDNVLFSPSDYMIISNDDLNFSISKARDDFSASIGAPKIPNVTWDDIGGMDLV
                     KGEIMDTIDMPLKHPELFASGMKKRSGVLFYGPPGTGKTLMAKAIATNFSLNFFSVKG
                     PELLNMYIGESEANVRRVFQKARDAKPCVIFFDELDSVAPKRGNQGDSGGVMDRIVSQ
                     LLAELDGMGSSGDGVFVIGATNRPDLLDEALLRPGRFDKLLYLGISDTNEKQCNILQA
                     LTRKFDLDDEVDLMAIADKCPFNYTGADFYALCSDAMLNAMTRTAGEIDQKLVEYNES
                     HSDSLTLKHWFDKIATPRDVKVKVAMTDFLKAQRELTPSVSDEELSHYLKVRANFESS
                     N"
     gene            complement(<39519..>39956)
                     /locus_tag="HG536_0E00300"
                     /db_xref="GeneID:59326316"
     mRNA            complement(<39519..>39956)
                     /locus_tag="HG536_0E00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283898.1"
                     /db_xref="GeneID:59326316"
     CDS             complement(39519..39956)
                     /locus_tag="HG536_0E00300"
                     /inference="similar to AA sequence:RefSeq:NP_014071.1"
                     /note="ancestral locus Anc_3.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139794.1"
                     /db_xref="GeneID:59326316"
                     /translation="MVLPIIVGLAVTVAALTVRSGLRAWEAYRHLSPTVIARMNNVKI
                     RSRRLDFRYSPSYNGRLNDSLRARLEAYRGGFNAKMTESEAILVLDVSPEEIEILDEG
                     LLKRKHRKAMLRNHPDKGGSPYLAMKINEAREVLEHSIMLRKS"
     gene            <40966..>43305
                     /locus_tag="HG536_0E00310"
                     /db_xref="GeneID:59326317"
     mRNA            <40966..>43305
                     /locus_tag="HG536_0E00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283899.1"
                     /db_xref="GeneID:59326317"
     CDS             40966..43305
                     /locus_tag="HG536_0E00310"
                     /inference="similar to AA sequence:RefSeq:NP_014072.2"
                     /note="ancestral locus Anc_3.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139795.1"
                     /db_xref="GeneID:59326317"
                     /translation="MFSYHIFLIGWLVFLSHLTGAASTAEVSQSFFIDVQLSDAFTGS
                     TNCTDVNHWFLVEADIFVPRGANEDIYLTVPQDFTSLPNDSFPLKSGSRTIGLVASDH
                     SNTLRISYNNSLPRNTTASLSFLAQLSGDAKKKIKSPGSENYSFEVSTGSSFNRTINY
                     VAKDLTALTSNGGIYAENNTAWFTADVPLSMLNRATIFSSQGTSNSSYAFDTSLTTVE
                     VVVAVNEFNQPQRSFPFTAFKDQSDSSRIQLRINTKIDGGKYLRVNYYSKPLKTATIG
                     NTVSLNYPNGLSKRDGALTISSNLYAVSQANVQNQGTGDESSASTPPVVSVSGTSNGA
                     YETFYLETKTEPGVYTEIGTWLPISTLSTSQASPVSSQSASDSIFLQPSSMPSSESSP
                     SSSFSSSGILSSKSSLSSSIFSSDASQSITATSVYLLSTSSVQSAGSASTTERSLAAK
                     VTQVSHFGAKANPSDAQLTYSLVTKTLNGEVVTFTTLCPASTISKILPTQGYYLNSTS
                     SSLLLSSTANSSFSHFETSTLGSESIITAGSLEPSVSQSKGSNPNTSVKSASWNATKT
                     KISNATESISSYLEPYQAYAVMTEDNGAIITSYLSLRGISTLSFPATSKTETTAVSSD
                     AIESVGSSSHELQNIEPVKSQSLGSFSSLGISGITSSTATKGYAAGPTINPGFGSSSG
                     LYSSSSVNSRTAGATQNHPTNSVMSSDRPSVTTMENYIASPSSNSSSSSLAIQTQLTS
                     TEGAFTSLLSIMYEGGANGALRRPTGLAGFFISFVLLWV"
     gene            complement(<43377..>44381)
                     /locus_tag="HG536_0E00320"
                     /db_xref="GeneID:59326318"
     mRNA            complement(<43377..>44381)
                     /locus_tag="HG536_0E00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283900.1"
                     /db_xref="GeneID:59326318"
     CDS             complement(43377..44381)
                     /locus_tag="HG536_0E00320"
                     /inference="similar to AA sequence:RefSeq:NP_014073.1"
                     /note="ancestral locus Anc_3.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139796.1"
                     /db_xref="GeneID:59326318"
                     /translation="MCLNGKWSVLTAFPRTLVVVLYSWTAFVTCTRVDQVPLAVVWLL
                     VLLLLGIGWYTYYKLISVDPGSPLDYPELAVGDIVSAENGAELPPDFLSRRSVTSKRD
                     GRFRVCRTCHVWKPDRTHHCSTCNRCILKMDHHCPWIPGCVGFKNQRYFIQFLVYTTL
                     YALAILAISSTQLYMWFQDGAFERELIDLNLLSVWLLAFVMSIAMLCFTGFSVYQVAK
                     NQTTIELYTQRSLREELAVLAETGFPRNYTADNVFDLGSRLSNWSDVMGETLAEWLLP
                     ISTARSVENKHTLDDKGLYFTFRSEMNERLLDTLDLQDRLLRRVTPRSSAEHRLGSRV
                     "
     gene            <44565..>45281
                     /locus_tag="HG536_0E00330"
                     /db_xref="GeneID:59326319"
     mRNA            <44565..>45281
                     /locus_tag="HG536_0E00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283901.1"
                     /db_xref="GeneID:59326319"
     CDS             44565..45281
                     /locus_tag="HG536_0E00330"
                     /inference="similar to AA sequence:RefSeq:NP_014499.2"
                     /note="ancestral locus Anc_3.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139797.1"
                     /db_xref="GeneID:59326319"
                     /translation="MPALIFPGDKLNIDSQKPTSLGPGLYYDPVTQEIEPTNAGIEVV
                     TETKRGQTAYVEFNSKRYIPAVGDYVIGVIVGQFSDSYKVSLSSFSSSVTLSYMAFPN
                     ASKKNKPTLKIGDLVYARVCAAEKELEAEIECLDSTTGKDAGFGLLEGGMVAEVSPAF
                     ARCMLFDQKFPFLKMLSNFTQFEVAIGVNGKIWFKCDELRNTLACYRSILDCQKIPVA
                     QYKDTIKTHFKNIVNAATGR"
     gene            complement(<45313..>47931)
                     /locus_tag="HG536_0E00340"
                     /db_xref="GeneID:59326320"
     mRNA            complement(<45313..>47931)
                     /locus_tag="HG536_0E00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283902.1"
                     /db_xref="GeneID:59326320"
     CDS             complement(45313..47931)
                     /locus_tag="HG536_0E00340"
                     /inference="similar to AA sequence:RefSeq:NP_014074.1"
                     /note="ancestral locus Anc_3.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139798.1"
                     /db_xref="GeneID:59326320"
                     /translation="MDGQGRGLGAGSPEAFHELSLSNETPKQRRTTKFILSKYTIYET
                     KERMYIVGSNKRETMFRILEIDLSVPQDRLSVLEDNVFFTRSEIMNVLSGLEDASEEG
                     LHKKLTGYGLVGFIRFTTCYYLIVVKKCSQVAVLAGRSIFHIDGTELVPISNNYKKPD
                     KYSAEARLMSTFQSLDLTKTFYFSNTYDITNTLQTNLVREKLKAVGRSDISVPSGIPD
                     YNEMFMWNSNLLKPVLPCIDTVYDWFRPIVHGFIDQVNVLVLGKSIYITLIARRSHQF
                     AGARFLKRGVNKQGYVANEVETEQIVADMLLTGFHNPGNGYFDSDRYTSFVQHRGSIP
                     LYWTQEASNLTAKPPIQITAVDPFFSSAALHFDMLFQRYGKVEVLNLIKTKEKIPRET
                     KLLKEFEQCINYLNQFLADDKRIQYTSWDMSRASKQDGQGVIEFLERYAAKTVASTGI
                     FQNGSNFKSTKMQQGICRSNCIDCLDRTNAAQFVVGKRALGVQLKSLGIVDNCYLEYD
                     SDIINILTELFHDLGDTIALQYGGSHLVNTMETYRKINQWSSHSRDMIESIKRFYSNS
                     FVDAQRQDAINLFLGHYVWKKDYPALWEMNTDIYLHNEYAVSGPKRSYTHWWNNYHII
                     SISELVQKEIIDKKKDLTLQEVVRNIRGYPGAFDNYWNEYYLPRSLTWIRDLFAFNMN
                     STRRYHSMRVEKDGISPFASRKQSWINNKLRSVTLDSDHPSSNEPKESIQEIKLRNSD
                     ELGMTSNQLNMVLADAAKAQENLNDLHRNERFPVFLESTKWANPETVEYELVSTKPDT
                     EPSLKINEAVDYSGYYANIAVDVEYYDSILKIDSYEPSEAYQVLDDRGECKASSDAIE
                     TYRLYTQGSNKDLVFV"
     gene            <48111..>50228
                     /locus_tag="HG536_0E00350"
                     /db_xref="GeneID:59326321"
     mRNA            <48111..>50228
                     /locus_tag="HG536_0E00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283903.1"
                     /db_xref="GeneID:59326321"
     CDS             48111..50228
                     /locus_tag="HG536_0E00350"
                     /inference="similar to AA sequence:RefSeq:NP_014500.2"
                     /note="ancestral locus Anc_3.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139799.1"
                     /db_xref="GeneID:59326321"
                     /translation="MPRTSIKEEMKRCKKALVESLAIGSRMPVEELTPRQLKQLEKQE
                     RRKKYADLAIQGTNNSSIASKRSVELLYLPKLSEAAGSGKPPREYFKYFVRKSPKRSP
                     CINRGYWLRLHAIRSRLDSIVEGTHDDIVVVNLGCGFDPLPFQILDQHNPASEKYKGR
                     VRFVDVDYSDLISEKVRIIQETAELAEILGPRSLEQERVAYGTDCYIAVSCNLNYPKS
                     FRDMLDAFRLNNPKTIKVFIAEVSLAYMSPGHADDIIATCGGMPNSHFLLLEQLTPAG
                     PSEPFAKQMLKHFKKNNSPLLSVQKYFTTEAQKNRFIRLGFPRVNAGNMFKLWQCVNP
                     AERLKVQSVEAFDELEEFHLFCHHYLICHATNENSFVFEDLYRFGPSAPAAEIDVKQD
                     AQFEVLNHSISRKFGASAALVPYERDFVLYFGGSSPGRLNQLLGIDVKTGAVVNLECT
                     NSPRARMCHTLTSLGDSKRLLLVGGRQSPHDGYEDSWFLDTSSRIWSEGPKLPEARYR
                     HCAALVDDQVIICGGVTTGAPFLRYDANANAFQPCTAEGLDVDCPLSSAAMDYSSDAQ
                     LGIIVGGSTDEVNVSDALHVFAYRNNKILIQKTIRHPLLQRYGAKVNFINDHEILVVG
                     GTSPEMLFGEDTSVIIVDLHTEKITGVRLHREVWQDQPLFLVGCELIAASAAEYIVIG
                     GGATCYGFGSVYNNGFKIRLSMG"
     gene            <50458..>51696
                     /locus_tag="HG536_0E00360"
                     /db_xref="GeneID:59326322"
     mRNA            <50458..>51696
                     /locus_tag="HG536_0E00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283904.1"
                     /db_xref="GeneID:59326322"
     CDS             50458..51696
                     /locus_tag="HG536_0E00360"
                     /inference="similar to AA sequence:RefSeq:NP_014076.1"
                     /note="ancestral locus Anc_3.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139800.1"
                     /db_xref="GeneID:59326322"
                     /translation="MVNFNLSGVGVFKKKDHVQKDADIPEEDDVDASEFEEDEVSPKL
                     VKNRRPLDTPFAQQRLASWNPVPTPRSVIPLYLFVAAIFVIVAGCLLSVASKVSELTI
                     YYQDCTTGAPSGGEWADMPADHYSMIFVKNKTFSVAPQWRYVADPEDDDQESGTCQIR
                     FTTPQDIPKDVYVNYLIENFAANHRRYVLSFSEDQIRGKSASRADIQDNTGINCKVLG
                     HNDEGKLYYPCGLIANSMFNDTFPFQLTNVSDPSNNYSLSNSNINWHTDRTRFKKTKY
                     KPEDIVPPPFWERQFPNGYNETNIPNIHEWEEFQNWMRPAALHKFAKLIRRNSNESLP
                     AGEYQIDIGLHWPVLMYNGKKAVYITHGSSIGSRNYFLGIAYLIGGCILAAFALMLLG
                     FWLLSGRKIADPSYLSWNRS"
     gene            <52251..>53522
                     /locus_tag="HG536_0E00370"
                     /db_xref="GeneID:59326323"
     mRNA            <52251..>53522
                     /locus_tag="HG536_0E00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283905.1"
                     /db_xref="GeneID:59326323"
     CDS             52251..53522
                     /locus_tag="HG536_0E00370"
                     /inference="similar to AA sequence:RefSeq:NP_014501.1"
                     /note="ancestral locus Anc_3.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139801.1"
                     /db_xref="GeneID:59326323"
                     /translation="MLKRYLSSTSAKSLASALDEKVYQVTTYARPDDLCITRGQNAKL
                     YDDINGREYIDFTAGIAVTALGHSNPEVADIMHKQALKLVHSSNLYYNKECLDLSSKL
                     VEKTKKFGGQFDASKVFLCNSGTEANEAALKFAKKHGITINPKKQGIIAFQNSFHGRT
                     MGALSVTSNPKYRTPFGDLIPHVTFLNLNDELTKFNDYISSNRDKLAGLIVEPVQGEG
                     GIFPVPADKLIGLKKICSENEVAVIYDEIQCGLGRTGKLWAHAALPKEAHPDIFTSAK
                     ALGNGFPIAATIVNDKINNALQVGDHGTTYGGNPLGSAVSKYVVDVIADEKFLSQVEA
                     KGEIFKTRLRELQKRFPEQIKDVRGRGLIIGAEFAEPPTEVIKRARELGLLVITAGKS
                     TARFVPALTIEDSVIEEGLEIFAKAVEAVYK"
     gene            complement(<53621..>54643)
                     /locus_tag="HG536_0E00380"
                     /db_xref="GeneID:59326324"
     mRNA            complement(<53621..>54643)
                     /locus_tag="HG536_0E00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283906.1"
                     /db_xref="GeneID:59326324"
     CDS             complement(53621..54643)
                     /locus_tag="HG536_0E00380"
                     /inference="similar to AA sequence:RefSeq:NP_014077.1"
                     /note="ancestral locus Anc_3.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139802.1"
                     /db_xref="GeneID:59326324"
                     /translation="MLAQLSIAWLLFLRLTGAVLTTSLLVTTDANGLPLTETSIFDPA
                     TLANAAAGTPITTVITTTNIAGVLVTLTQTRTPTATGTTDIAPTTAATATGTGLVTSF
                     VTTTNAAGATVTSPTVVTPAATTAATGLVTSVITTTNAAGATVVSTTIFNPTATTVIT
                     PSTAATGLITSVYTTTDAAGATITGTTLLSAAGASSSSSVSATSSATQAAVEDPNGRP
                     DPSTDFTQPPLTPVTTLPMDTYVTITEGTTRTYTTTRARTSGMWVTVVIQGRTITTTT
                     TFAQRFTSQYTTVASPSSGSIGLGTISGTIGRVKTDLESTIKNGAASICSSFLISFLA
                     FVMWFL"
     gene            <55338..>58151
                     /locus_tag="HG536_0E00390"
                     /db_xref="GeneID:59326325"
     mRNA            <55338..>58151
                     /locus_tag="HG536_0E00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283907.1"
                     /db_xref="GeneID:59326325"
     CDS             55338..58151
                     /locus_tag="HG536_0E00390"
                     /inference="similar to AA sequence:RefSeq:NP_014078.1"
                     /note="ancestral locus Anc_3.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139803.1"
                     /db_xref="GeneID:59326325"
                     /translation="MPKDHNPLHSLHSNGTIGSSNAPDHVYRVFSVDDDPDEIEHDVR
                     YLEGLHDGLKYALHNSKSKGHLLPSATSDGNGQHSKSKLKTKTKFRTSPKKKSVSKSR
                     KDADGGGPSKISIPPLGAPQNASNIDVEPDANKFVIHDHPSGIGHDLIFEDRNIDEEN
                     GPGDDERSTTSMESYTLRERQDAINETHPFGIRIWKPALYKKQRSVQKVAAEDIHETR
                     LKKITWEVHLSNILWAVSCGTFLFLLMDIAGVLVYVLGLFTRSSKEYALLCFRLGRYL
                     LWPFGKVVYLTHDEHYIQEDMDEGISTQQFYNWVTSYSNRLFFHQSQAETNDALKQHG
                     NKLQHPSYGSVRQHLAAAHEESPSIHGILSEHPSGTAETVEGYSSGTGIQRRYFGRGK
                     WSWGRLIFYVLFHLLIQPIVFVISLVTWLAVFTIPMSNILWNLMYHCRRHPLALGFKY
                     IKNTSAQDDSIIKAQVGKNVLLCTFRCAGWHYYKFTVDGTNVIVVNLMSLVLFTIFDF
                     YVFKKQWHFSNWLTHEITIFTLCLASIIPLAFYIGQAVASISAQTSMGVGAVINAFFS
                     TVVEIFLYCVALKQSKGRLVEGSMIGSILGAVLLLPGLSMCGGALNRKTQRYNPASAG
                     VSSTMLIFSMIVMFVPTIFYEIYGSYTVRCEDDKDLALTFANISKVFTSERCYFTHPP
                     LKYTKMYVNVIQPLSISCAIVLFLAYIIGLWFTLRTHAVMIWQLPITEQAKEMSASRT
                     LESNPRDDQDVNDDGASSGHEAPNWSRNRSTCILLVATLLYAVIAEILVSCVDAVLEG
                     LPSLNPKFLGFTIFALVPNTTEFLNAISFAMHGNVALSMEIGSAYALQVCLLQVPALV
                     LYSVLYTWKMDISEISIRDMMFPLVFPKWDLIASMASVFLFTYLYAEGKSNYFKGSML
                     ILLYVITVLGFYCQGIIEAWGPT"
     gene            complement(<58257..>58892)
                     /locus_tag="HG536_0E00400"
                     /db_xref="GeneID:59326326"
     mRNA            complement(<58257..>58892)
                     /locus_tag="HG536_0E00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283908.1"
                     /db_xref="GeneID:59326326"
     CDS             complement(58257..58892)
                     /locus_tag="HG536_0E00400"
                     /inference="similar to AA sequence:RefSeq:NP_014502.1"
                     /note="ancestral locus Anc_3.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139804.1"
                     /db_xref="GeneID:59326326"
                     /translation="MSVEEVSQKFEESVAVSEEKEPKTVLSDSQFDVKHPLNTKWTLW
                     YTKPAVEQSESWSDLLRPVTSFETVEEFWAIVQNIPEPHELPLKSDYHAFRNDIRPEW
                     EDEANAKGGKWSYQVKAKRADIDELWLRTLLAVIGETIDEDESEINGVVLNVRKGGYK
                     FALWTKSENKEALCNIGARFKQVLKLGDDDHIEFFPHSAANAKHHQPSITL"
     gene            <59165..>60025
                     /locus_tag="HG536_0E00410"
                     /db_xref="GeneID:59326327"
     mRNA            <59165..>60025
                     /locus_tag="HG536_0E00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283909.1"
                     /db_xref="GeneID:59326327"
     CDS             59165..60025
                     /locus_tag="HG536_0E00410"
                     /inference="similar to AA sequence:RefSeq:NP_014079.1"
                     /note="ancestral locus Anc_3.21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139805.1"
                     /db_xref="GeneID:59326327"
                     /translation="MLWGAVKMLLEGAAAVTSASLVALYFMQNRLIYPSWAQGARDFV
                     DTPDSYGLPYELVTLTTGDGVRIQAYDMRNTRSDSGSTVVVLCPNAGNIGYFISIAEI
                     FYRQLGMSVFIYSYRGYGHSEGTPSEKGLKLDADCVMEHLSREPFHKARKLVLYGRSL
                     GGANAIYIAAKFPSLCDAVILENTFLSIPKVIPYAFPALRYFSGMCHEIWNSEEQIKG
                     CDSTLPFLFLSGLRDEIVPPSHMSKLYEACPSHNKQVFQFPLGYHNDTIIQEGYWSVV
                     RSFLEQFALI"
     gene            complement(<60076..>63909)
                     /locus_tag="HG536_0E00420"
                     /db_xref="GeneID:59326328"
     mRNA            complement(<60076..>63909)
                     /locus_tag="HG536_0E00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283910.1"
                     /db_xref="GeneID:59326328"
     CDS             complement(60076..63909)
                     /locus_tag="HG536_0E00420"
                     /inference="similar to AA sequence:RefSeq:NP_014503.2"
                     /note="ancestral locus Anc_3.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139806.1"
                     /db_xref="GeneID:59326328"
                     /translation="MYNPPVAKGETATSFGRNEFKPSSFSRSSFRIHHYPVSTQISPM
                     GSSPRARATSRYSLSNSSSFNEGSLRESLHSDSQPAERAGSEGKRNHPVAPKCSGPMY
                     SSKARKELSSIDKINDPSSNALICAGTTHLGYYRFSPEDRSVVCLHDYVAVNNRHSNV
                     FSPNFKKRARQSKLSTIADVKTGFHNHKNYVAVCRSSTVISVYDVNRTTDADDALVAT
                     LSDHTRSVNSFDFNTSQTSLLISGGQDGSIKIWDLRSSGTKNSRRCDVNINTASDSVR
                     DVKWMPFQNYVTGGQQDVRNGSNAGLKFASIHDSGLLLTFDLRQPSQIEKRINAHSGP
                     GLCLSWHPNLEYIATGGRDGKCSLWNVGDRFQGDNMSSFYTPNSAPTAHLSTLHANTN
                     LAALPEITITTGLPVTKLKFRPSYERNVLNSILALSPMTNDAALNVYSLARKYIPKHV
                     LHKSTQTLGLVWWDEKLIFDIDKDNSINGWDLTQEPTILDNLSKCVTCWRDIEGNGLL
                     FLDQNSGGYEMQQNQPTVQDDDRKSINQKVGAGPLTSSIGNHAGIMNSLKKGISHSTL
                     SSYSGDRPSFYKSGFSFNAKSPSMGFSHNTSSVSSSPYPSQNEMKNVQSPVIVTLDLP
                     YILSNMRLSSLPPDRNKLRSPEVSAIRESPVKVFKFLARELEFSCNNEKREGNVKSID
                     QRSSMKDEDIETELMQRFGLSENTTWAALMNKKGEQEAKANRESGSTLKSPKQSKKET
                     LQKIISNEEERSVPRKKRSALTESIHCLTSGLEPKIEQLLELIPICSDNASVYSYIDD
                     LSNFKIWLLIRDSLLWDLKRLSSGYPSADPESAQGKLTEDGAEFVAAHNLNETGSPGC
                     SSSITSDVNSFVEETPQAFSTGVESGTRERAQVPETASKLKQQLMEDNGKITSHEQEI
                     PVGSYNSISSAKWEDLNQKGKQNVNDADIVITDDDDVEVEAIRAASAPASSSNGVGAT
                     NIPILQKRKQRQSFIDTFMTDVRSPSDINAEGGFSSRNRHPHSLVQSSPSSKLSSLQS
                     LASGTSPLTALRKITERTDFISPFSPKRLPSYASSNFEQLIKTRPANEVPKDNGPSKL
                     KHITPPWSTRRLIKQLYQQAVEMGNILLAVNILLLFQDIYQLAPVEVVKDSLARFTTI
                     LHQYELFEISAAILKYCPWDDIMSSQGGESLVSLFCERCHNLITNDSSKERFSLESQK
                     AGNNTPMSRFGHWYCDSCKKPNSLCVLCELPMKKMTMAMLECGHEGHYECLQSWFLTE
                     GMTECPGGCSNEVLI"
     gene            <64287..>68747
                     /locus_tag="HG536_0E00430"
                     /db_xref="GeneID:59326329"
     mRNA            <64287..>68747
                     /locus_tag="HG536_0E00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283911.1"
                     /db_xref="GeneID:59326329"
     CDS             64287..68747
                     /locus_tag="HG536_0E00430"
                     /inference="similar to AA sequence:RefSeq:NP_010621.1"
                     /note="ancestral locus Anc_5.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139807.1"
                     /db_xref="GeneID:59326329"
                     /translation="MVHTTTSNAKKKGRSSKKVERLAQLRFDYELLTNELFHLKEFMS
                     LVEFDPSYENESESYRRFLVEDGVSLGSFEDGETGEAGNGRVRRRQLRASTTPAANED
                     ANGTVWAEVEPVVRAKYGELKQALRAGHVKRDQVPMKRPRVPKLAGKRGSKLPSPVSN
                     GSSALSSSQKHGDRARSELGPDSREDSFDDEVYYGQNVEEDYYFTTSSEDEPESRRQH
                     QRKRPRINLVVNPPRQTVTNPLHVNKPQFTNLHEYINSFKSMDEDMSIEEYEHYIQEQ
                     KKVVAAIRRGLESGALRYDPDTDSVQPITTKEARLTQSHRPEPITYLYKQQNLQTFQD
                     YLLNHGIFMSRLFQNNRKARIARARKVSFMIEQHFKHIAGAEERRAKEEEKHKRNLAR
                     AAMQAVKKRWTLAEKAYRVLLKDEEEHLKRIKGKEHLSKMLEQSTQLLEAQLTHKGDE
                     SESSDRDSDNESDIEDSSGSENDDDLLTSSSEEEDISEEREIKSDRKPVEDENLTEEE
                     LKMKYANIDEAVAVQDERQMGDSHSSDDNLSVTTEQSSEELSEEEETGLVSDASNKSL
                     GLSLLLEQGYGNDDDVDDSDESVKYESDQSFKEDVTHENQEDEMEVEKKSDLVLPNGE
                     VGRMPDHTSENARDMDSSNEMGKSEADPYSVEDVPVPQLLRGTLRTYQKQGLNWLASL
                     YNNGTNGILADEMGLGKTIQTISLLAYLACEKHNWGPHLIVVPTSVLLNWEMELKRFA
                     PGFKVLTYYGSPQQRKEKRRGWNKPDAFHICIVSYQLIVQDQNSFKRKRWEYMILDEA
                     HNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNIAELWSLLYFLMPQTVTAGQEVTGF
                     ADLDAFQQWFGKPVDKLIETGQNYQHDAETKKTVTKLHQVLRPYLLRRLKADVEKQMP
                     AKHEHIVYCRLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHPDLFE
                     VRPILTSFCSESSVIQNYVSTDQFVHDLVNHEQYKNKVGLDTMNLVFTGNDLESTTHT
                     SRATSKLQCVAEFIEQIDELRQQEMSSDSKESDEIPPNFRNATEFFKRLGMKRLQETV
                     DNVESIRHINRLRCDRKPMYGTNAFKLLTIERDRSNDTDSLRTCTQPLQKKFDIYKDI
                     IEKYAVITPNAVTLDTRYLTLGLNDESPLDENTRNFVMSNFQNMKNPLHHLQTKLTVA
                     FPDKSLLQYDCGKLQKLAELLQELKDNGHRALIFTQMTKVLDILEQFLNYHGYLYMRL
                     DGATKIEDRQILTERFNSDPRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQ
                     CQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRHLDNVVIQEGDFTTDYFTKLS
                     VKDLLGSEVTGGLKVDDQPLLQADSEPTKDPRSLEKLLAQAEDEDDVMAANLAMKEVE
                     VDNNDFTDQNPSSEQQASAAEGTPQPYDEYEGTNHVEEYMLRFIANGYYY"
     gene            <69157..>69477
                     /locus_tag="HG536_0E00440"
                     /db_xref="GeneID:59326330"
     mRNA            <69157..>69477
                     /locus_tag="HG536_0E00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283912.1"
                     /db_xref="GeneID:59326330"
     CDS             69157..69477
                     /locus_tag="HG536_0E00440"
                     /inference="similar to AA sequence:RefSeq:NP_011955.1"
                     /note="ancestral locus Anc_5.384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139808.1"
                     /db_xref="GeneID:59326330"
                     /translation="MSSAVKYFYKGKETDLIVFVTSVDEVKEYLKDPSIGKLSEVVEV
                     FQVFTNNAGEGAEGELGEASKSQLANEFGKDKKVEEIIDIILKNGEPNAKVDTIEDRR
                     DFIV"
     gene            <69685..>70566
                     /locus_tag="HG536_0E00450"
                     /db_xref="GeneID:59326331"
     mRNA            <69685..>70566
                     /locus_tag="HG536_0E00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283913.1"
                     /db_xref="GeneID:59326331"
     CDS             69685..70566
                     /locus_tag="HG536_0E00450"
                     /inference="similar to AA sequence:RefSeq:NP_011956.1"
                     /note="ancestral locus Anc_5.385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139809.1"
                     /db_xref="GeneID:59326331"
                     /translation="MAAEEFNIKNKQKRQQLFAELKDEKNKERHKMRRERAKQERDDA
                     EAKSKRLAENVPNTIENMRVYDETIGHEAEGDEEDLARFFNTKGEPPKILLTTNVNAK
                     KKAYEFANVLIEVLPNVTFIKRKFGYKLKEIVDICSKRGFTDLVIINEDKKKVTGLTF
                     IHLPEGPSFYFKISSYVEGKKIVGHGRPTSHIPELILNNFQTGLGKTVGRLFQSIFPK
                     NPDFEGRQVITLHNQRDYIFFRRHRYVFRNEEKVGLQELGPQFTLKLKRLQRGIKEET
                     EWEHRPEMDKEKKKFYL"
     gene            <70856..>74533
                     /locus_tag="HG536_0E00460"
                     /db_xref="GeneID:59326332"
     mRNA            <70856..>74533
                     /locus_tag="HG536_0E00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283914.1"
                     /db_xref="GeneID:59326332"
     CDS             70856..74533
                     /locus_tag="HG536_0E00460"
                     /inference="similar to AA sequence:RefSeq:NP_010622.1"
                     /note="ancestral locus Anc_5.386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139810.1"
                     /db_xref="GeneID:59326332"
                     /translation="MDPNGASQVITALEVIYSGKSTNEERLEAQKFLDRVKGHEESPF
                     WGYEIALNNPADYILKHFGLGLLENAVRKNWVDYNLEKRLALRKWVVELNCGVQKEDP
                     RYIKQKLAFLWVEIAKRTWGEALRGDNPSKEELMESWVDMDANLTELWNIGGASRELA
                     LVIFKILFEDVFLLDDLTVLKRMTIIQPLCVMTISPMDVFATKYKFTEKWTLFKANQE
                     GWFALWVSELNNALAQNNAEYVIRLLETLKTCLNWPLGEVIIKNDIFSTLLQCFLSNI
                     PKAQSMALDSMHILLTRPYNNEEHYQIIIDKVFDSMDLLNQVYDYLQFDPEQGIDEVK
                     YPIVKKCVDMISCLYICVFKIKDTNNRIEKYLRLVLKATFNPSLIVSGLTLDVWCSCL
                     RNDEFLPLLDKYVIPDLLNFAADALIYYEQIDGHVSKKFAEIDFQSTSEFQSFCSTFR
                     KRIRDIIRLISCVKLDYTYDWLNNRLNSFFSSPYGQEVLTSTFLDRKCDPYLSALSQF
                     MIIECFINGCIRWKIWYPSGADYSEKLDSIMRKLEVLSNQLIALNIREPLLLKKEIQN
                     FALFLTMLKDNVLFTLLEKIITSATMDYPEIDLEERSSEADAVRDLRYACGIELNRMA
                     LLMPESLKEIFPDLENVVAKIMPNLSYHERISFKSFLLTIVLKSSMDGKEERFAAIVD
                     PELVAWSDQSTVVGLSELPWFMERLGIVQIAEYFQKRGINENSDLLSISIDDEGKKLK
                     SDLTKRWQTLFPVRATRMFIHYSMQSIKKDEELKMLQKMWRPRIVPILPYIMRLLYQL
                     QAYHDPENAKDLPVIVQSFVKYSTIERFWEAGASNKSKDEFINEHMKAMQTLRDFADS
                     VGHIVRYTREYTLLVISAISTLGNVFFDIDEAPEMLMDSIAIFKPSANHISPGVSTHG
                     WKHIMNVAIRPLLKNCPEECAPKFMTNFLPRLFETLDILLCQKWSSYMNSDINLEPVQ
                     TDDEDMTEEILEENLLRQLTTVVVRIMIDCVGQHSTNSQSSKGKFTSRQIKMRAIIFE
                     NINVLAPFLKLLNHLMSFRDSKCSFNAILVMRCCLNEVLIKEDSVDEFFTVEVMKNLL
                     LNVLCQSSFKDSFYEALNVFTVLFLTLCKEYKPARAYLYEISHGYDIDSLYENLKSVD
                     HYRNQRALMIEFIDWIKAANGRDDEEEDENRATETKRQEKRAAILKKASERLVRKQKE
                     DGDILDDPNTEDAAFGSLFGS"
     gene            <74976..>75980
                     /locus_tag="HG536_0E00470"
                     /db_xref="GeneID:59326333"
     mRNA            <74976..>75980
                     /locus_tag="HG536_0E00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283915.1"
                     /db_xref="GeneID:59326333"
     CDS             74976..75980
                     /locus_tag="HG536_0E00470"
                     /inference="similar to AA sequence:RefSeq:NP_010623.3"
                     /note="ancestral locus Anc_5.387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139811.1"
                     /db_xref="GeneID:59326333"
                     /translation="MDYKLLRRHLHQSFICRQAISNIKNIVVATNAAISGLAELRSKS
                     SRPIRHKTQSSPNPSVNFRDLYKKYNNGFTEPAVAELNSVNHFFNSADVKYEWSAGRF
                     MDVPGESLKAKYSQQLETRIGYSGKKFPGKTYIPFELVNGLPEVAFLGKSNAGKSTLL
                     NNLTTSQKRISLESTARSSRWAGFTKTLNSFNVGNELRIVDTPGYGFNSSIGQGDLTM
                     QYLKERKELARTFLLISAEQGFGEHDLQIVDFMRDNGIPFEIVFTKMDKIRNIEKFEQ
                     SMERDRKFLQSTMARILFTNSSTSKSCKKRYGIDILRYVIFESCGLEPGLKPSRKKPQ
                     "
     gene            complement(<76094..>76687)
                     /locus_tag="HG536_0E00480"
                     /db_xref="GeneID:59326334"
     mRNA            complement(<76094..>76687)
                     /locus_tag="HG536_0E00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283916.1"
                     /db_xref="GeneID:59326334"
     CDS             complement(76094..76687)
                     /locus_tag="HG536_0E00480"
                     /inference="similar to AA sequence:RefSeq:NP_011957.1"
                     /note="ancestral locus Anc_5.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139812.1"
                     /db_xref="GeneID:59326334"
                     /translation="MSFRGSSRGGRGGFSSRGGRGGGRGGARMPQGPPDSVLEMGSFL
                     HPCEGDIVCRSINTKIPYFNAPIYLENKSQIGKVDEILGPLNEVYFTIKCSEGVQAAS
                     FKDGDKFYIAPDKLLPIERFLPKPKVAGPPKPKKKKPSGRGAPGGRGGRGGFSRGGFG
                     GSSRGGRGGSRGGPRGGSRGGFGGSRGGFRGGRGGRR"
     gene            <76974..>77816
                     /locus_tag="HG536_0E00490"
                     /db_xref="GeneID:59326335"
     mRNA            <76974..>77816
                     /locus_tag="HG536_0E00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283917.1"
                     /db_xref="GeneID:59326335"
     CDS             76974..77816
                     /locus_tag="HG536_0E00490"
                     /inference="similar to AA sequence:RefSeq:NP_010624.3"
                     /note="ancestral locus Anc_5.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139813.1"
                     /db_xref="GeneID:59326335"
                     /translation="MLAIRNGLFVGGRLNRGFATTGVAQGLRAIKFLKAQKRKQKNEA
                     RQATLRNALDRVDPVLGRKDTPFISRIMAELKEPSVLSSGYEIAEVEKLLAAVESTKA
                     EQLRLSSVNEQFLERESLESLEARREALLRILSMRNADNKSAMKLAVKLAREEFQRFP
                     GDSGSSEVQAACMTVRIQNIVNHVKEHHKDFANTRILRMLVQQRQSILRYLKRDNPER
                     YYWTIEKLGLSDGAVTQEFNMDRRYMQDFKFFGDKILVKDSKKVADQKRRELRKQKRV
                     ARSA"
     gene            complement(<77878..>79362)
                     /locus_tag="HG536_0E00500"
                     /db_xref="GeneID:59326336"
     mRNA            complement(<77878..>79362)
                     /locus_tag="HG536_0E00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283918.1"
                     /db_xref="GeneID:59326336"
     CDS             complement(77878..79362)
                     /locus_tag="HG536_0E00500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139814.1"
                     /db_xref="GeneID:59326336"
                     /translation="MRSTTLLLAAKRFASQGTSRVSGSSTNPAMRFPCLDKLEEITEH
                     LKSQKPFCNESDVAGNAQKQNKDPIYGKVKSGFQVFESDRPLFLDYGGVLPSFRIAYE
                     TWGKLNNEKSNAILIHTGLSASSHAHSSDANKQPGWWEDFIGYNNPILDTSKWFLICT
                     NVLGGCYGSTGPASSDPADGMPYASRFPMLSVQDIIRAQHRLISEHFGIDKLYASVGC
                     SLGGMQSLCYGQQFPDNVQKIVSVSGCARSHPSSIAMRHVQRQVLMADPNWNRGFYYP
                     TQEQPNRIPPHIGMKLAREIATVTYRSGPEWESRFGTERLDDESPPVLCPDFLVETYL
                     DHQGEKFSLEYDANSFLYLSKTMDLFDLSQSHLARGERKRRETQRVYESNEPLVGRSF
                     VSDRPRAMKRHRTTSTEEARADLARGMAPLLDKEILVVGVKSDGLMPYWQQREIYDLL
                     GGDNNRKVKFTELAESDSLYGHDTFLLDLEHVGGSIGRFLREGS"
     gene            complement(<79591..>81654)
                     /locus_tag="HG536_0E00510"
                     /db_xref="GeneID:59326337"
     mRNA            complement(<79591..>81654)
                     /locus_tag="HG536_0E00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283919.1"
                     /db_xref="GeneID:59326337"
     CDS             complement(79591..81654)
                     /locus_tag="HG536_0E00510"
                     /inference="similar to AA sequence:RefSeq:NP_010625.1"
                     /note="ancestral locus Anc_5.390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139815.1"
                     /db_xref="GeneID:59326337"
                     /translation="MASLLSKTLSEVHPTLRTNGMGIGNTHRRISLGFFPVNKKNPLV
                     RKYRKKHAKADQRSYLSLGDDFGSSVREPNLHLRDIIDEEDLTYQEDGGELSRTISLP
                     SRVSETLDASSPDLDWILQEHERRYSSAYSSETEEQEDQNSVSPYYSRELEYEEFMRR
                     LQAQKAAAEQERTRHLRRPSYVSVTSRGSIPMIYQRYRSEDSADYEDFAHETVTVKSE
                     AKVLASYSIPLMITFLLEQIFPMVCSLTVGHLGKSELAAVSLASMTSNITLAIFAGIA
                     TSLDTLCPQAYGSGRYCSVGVHLQRCIAFSMVIYIPFAFFWFKSEYFLALVVPEKELV
                     ALTAKFLRVLILGAPAYILFENLKRFLQAQGIFDAGIYVLAICAPSNVFVSYTLVWNK
                     YIGVGFIGSAIAVVINFWLMFILLLLYTIFINGKKCWGGFTKKALTHWRDLSHLAISG
                     IVMLEAEELSYEILTLFSAYFGTSYLAAQSTASTMSALLYMVPFAIGIATSTRIANFI
                     GSKRPECAHLSSKIGIGYSAVGGLINCCILIFGRRPIANLFSRDEEVISLIIEILPLV
                     GIVQNFDALNAVAGACLRGQGMQALGSIVNLVVYYLFAIPLALILSHVLGWKLYGLWI
                     GIGFGMLAIGVIEAYYVLFPNWDAIMNYAEVLKETEEDEDSDANSYFTDSDDDPDEET
                     HLLAS"
     gene            complement(<81823..>82641)
                     /locus_tag="HG536_0E00520"
                     /db_xref="GeneID:59326338"
     mRNA            complement(<81823..>82641)
                     /locus_tag="HG536_0E00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283920.1"
                     /db_xref="GeneID:59326338"
     CDS             complement(81823..82641)
                     /locus_tag="HG536_0E00520"
                     /inference="similar to AA sequence:RefSeq:NP_011958.1"
                     /note="ancestral locus Anc_5.391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139816.1"
                     /db_xref="GeneID:59326338"
                     /translation="MDPSSVLEQTTQDVSNLQAEFRHLLEEIRAEDTQLYDLRKKAAQ
                     KDAQLHKFIRQHGSLTEHPNEEELSNGIREDLERCKELQQKKCTLANTALFLVAKHLA
                     KLEKSIVVLEEDGLLAPLENEVDSGSEYSRESSVQSTGERRRKAASAGSAESAVRRRR
                     QARGSPAVAERRVAPKSEDQSDGTPLESNFDLQDYNDDLFSGINNNEEEDKTLYCFCQ
                     SVSYGEMVACDGAHCKYEWFHYPCVNLKEPPKGAWFCPDCRQEMAKGRLKKRRL"
     gene            <82909..>83487
                     /locus_tag="HG536_0E00530"
                     /db_xref="GeneID:59326339"
     mRNA            <82909..>83487
                     /locus_tag="HG536_0E00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283921.1"
                     /db_xref="GeneID:59326339"
     CDS             82909..83487
                     /locus_tag="HG536_0E00530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139817.1"
                     /db_xref="GeneID:59326339"
                     /translation="MFFSYFVKKFTRKVVGDFNNGQDPFVEEYEFERKSFFSGSSKVV
                     KKTRPKSIAEYVPERQRGLVLSMRKRCYRMELMFSFWGMKFGWLNIVKIVPVVGDICA
                     LCLSLLVLREMRTAADGLPSDIMASCLFNILIDFTFSLVPIVGDIVSVAYKPNCRNAM
                     LIEEHIDRKYRKEMNLKAAKQMDTPISAAKQH"
     gene            complement(<83518..>84087)
                     /locus_tag="HG536_0E00540"
                     /db_xref="GeneID:59326340"
     mRNA            complement(<83518..>84087)
                     /locus_tag="HG536_0E00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283922.1"
                     /db_xref="GeneID:59326340"
     CDS             complement(83518..84087)
                     /locus_tag="HG536_0E00540"
                     /inference="similar to AA sequence:RefSeq:NP_010626.1"
                     /note="ancestral locus Anc_5.392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139818.1"
                     /db_xref="GeneID:59326340"
                     /translation="MGKAKKTRKFALVKRTINTKKDQRLQANKEKIVQKDDPELTRSV
                     PQVSSALFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVKGMMDCLLAKCNPLITDCV
                     MAELEKLGPKFRIALRLARDPRIKRLSCSHKGTYADDCLVNRVLQHKCYIVATNDAGL
                     KQRVRKIPGIPLMSVGGHGYVIEKLPDAF"
     gene            complement(84387..84486)
                     /locus_tag="HG536_0Etrna8S"
                     /db_xref="GeneID:59326897"
     tRNA            complement(join(84387..84432,84449..84486))
                     /locus_tag="HG536_0Etrna8S"
                     /product="tRNA-Ser"
                     /note="codon recognized: AGC"
                     /db_xref="GeneID:59326897"
     gene            complement(<87975..>89930)
                     /locus_tag="HG536_0E00550"
                     /db_xref="GeneID:59326341"
     mRNA            complement(<87975..>89930)
                     /locus_tag="HG536_0E00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283923.1"
                     /db_xref="GeneID:59326341"
     CDS             complement(87975..89930)
                     /locus_tag="HG536_0E00550"
                     /inference="similar to AA sequence:RefSeq:NP_010628.3"
                     /note="ancestral locus Anc_5.393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139819.1"
                     /db_xref="GeneID:59326341"
                     /translation="MLNKLPSALLSLRNCFCLSIGRHQLKKIYKFSQYTSVRTVRTMS
                     APAICPITAQLQKLSIEEPTVAEGSHPDVNIVDLMRNYVTQELSKISGVDPSLIFPAL
                     EWTNTLERGDLLIPVPRLRIKGANPKDLAADWASKFPCGPFLSKVENNGPFIQFFFNT
                     QFLLKTVIPDILNRKEEYGACKLVDNKKVIIEFSSPNIAKPFHAGHLRSTIIGGFLSN
                     LYEKCGWEVVRMNYLGDWGKQFGLLAIGFERYGDEKALAVDPIHHLFEVYVRINKDIE
                     EEGDSLPLEESTNGKARAYFKRMEDGDPEALKIWKRFRELSIEKYIDTYARLNIKYDS
                     YSGESQVSRESMEKALKLFEEKKLTHEDRGATLIDLTKFNKKLGKTLVKKSDGTTLYL
                     TRDVGAAMDRYEKYHFDKMIYVIASQQDLHTAQFFEILKQIGFDWAQNLQHVNFGMVQ
                     GMSTRKGTVVFLDNILEETKEKMHEVMRKNEVKYSQIANPDEVADLVGISAVMIQDMQ
                     SKRINNYEFKWERMLSFEGDTGPYLQYAHSRLRSVERNASNITPEMWLNADFSVLTEP
                     AAMLLIRILSQYPDVLRNAIKTHEPATVVTYLFKLTHQVSSCYDVLWVAGQTEEIATA
                     RLALYASARQVLYNGMRLLGLTPVERM"
     gene            complement(<90378..>92075)
                     /locus_tag="HG536_0E00560"
                     /db_xref="GeneID:59326342"
     mRNA            complement(<90378..>92075)
                     /locus_tag="HG536_0E00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283924.1"
                     /db_xref="GeneID:59326342"
     CDS             complement(90378..92075)
                     /locus_tag="HG536_0E00560"
                     /inference="similar to AA sequence:RefSeq:NP_010630.1"
                     /note="ancestral locus Anc_5.395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139820.1"
                     /db_xref="GeneID:59326342"
                     /translation="MSTAENTPVGNLTSTVSGSHSVLSTPSNKAERDDAKDLNSIAPP
                     EPAIDLPKKPASSYIGVSILCLMIAFGGFIFGWDTGTISGFVNLPDFVRRFGSRHSDG
                     TYYLSKVRMGLMVSIFNIGCAIGGIVLSKMGDVYGRRIGLVAVTIIYVVGILIQICSF
                     NKWYQYFIGRIISGLGVGGISVLSPMLISEVSPKQIRGTLVSCYQLMITLGIFLGYCT
                     NFGTKNYHDSTQWRVGLGLCFAWAMFMVGGMLFVPESPRYLVEVGNFEEAKRSLSRSN
                     KVSVDDPALLAELDAIAAGVEAEKLAGSASWGELFTTKTKIFPRLIMGVMLQSLQQLT
                     GDNYFFYYGTTVFKSVGLEDSFETSIIIGVVNFFSTFVGIFCIERFGRRTCLLWGAAT
                     MMCCFVVFASVGVTRLWPHGQANGASKGAGNCMIVFTMFYIFCFATTWAGGCYVIVSE
                     TFPLRVKSKGMAISTAANWMWGFLISFFTPFITNAINFYYGYVFMGCLVFAYVYVFFF
                     VPETKGLTLEEVDTMWMEGALPWKSASWVPPDRRGANYNAEDLAHDDKPFYKRMFTK"
     gene            complement(<94026..>95735)
                     /locus_tag="HG536_0E00570"
                     /db_xref="GeneID:59326343"
     mRNA            complement(<94026..>95735)
                     /locus_tag="HG536_0E00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283925.1"
                     /db_xref="GeneID:59326343"
     CDS             complement(94026..95735)
                     /locus_tag="HG536_0E00570"
                     /inference="similar to AA sequence:RefSeq:NP_011964.1"
                     /note="ancestral locus Anc_5.396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139821.1"
                     /db_xref="GeneID:59326343"
                     /translation="MNSTPDIISPQKSTSSNGDSETNNSKFMNAPEGKKGLGRDDLSH
                     VKSEPEIPKPNNSRSAYISTCLCCVMVAFGGFVFGWDTGTISGFVNQKDFIRRFGSKH
                     SDGSPYLSTVRMGLIVSIFNIGCAIGGIVLSRVGDVYGRRAGLVTVVVIYVIGILIQI
                     CSFDKWYQYFIGRIISGLGVGGISVLSPMLISEVSPKEMRGAMVSCYQLMITAGIFLG
                     YCTNYGTKNYDDSTQWRVPLGLCFAWALFMIAGMLFVPESPRYLIEVGKFDEAKRSLA
                     RVNKCSIDSAFIQHEFDLIEASIEEMRVAGTASWGELFTGKPAMFQRTVMGIMIQSLQ
                     QLTGDNYFFYYGTTVFKAVGLEDSFETSIVFGIVNFACTALSLYTVDKFGRRNCLLYG
                     CVGMICCYVVYASVGVTRLWPGGQGNGSSKGAGNCMIVFACFYIFCFATTWAPIAYVI
                     ISESFPLRIKSKAMAIASASNWIWGFLIGFFTPFITKAINFYYGYVFMGCMVFAYFYV
                     FFFVPETKGLTLEEVNDMYAEGVLPWKSSSWVPASRRGPDYNADDLTHDDKPFYKRMF
                     GMN"
     gene            complement(<96841..>98685)
                     /locus_tag="HG536_0E00580"
                     /db_xref="GeneID:59326344"
     mRNA            complement(<96841..>98685)
                     /locus_tag="HG536_0E00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283926.1"
                     /db_xref="GeneID:59326344"
     CDS             complement(96841..98685)
                     /locus_tag="HG536_0E00580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139822.1"
                     /db_xref="GeneID:59326344"
                     /translation="MVGCWMVLLFVYRGLSALRLRMSGREEDIIVAGNSNSQTNSNST
                     SLNEKSDRTDRVGLDSSGYAKDGGADLEQYRSHDVNDSEKDEMTILVKEADRQLSGMK
                     KSDLVFVSACCVMVAFGGFVFGWDTGTISGFVKQTDWIRRFGSERPDGTHFLSNVRTG
                     LLVSIFNIGCAIGGVLLGKLSDLYGRRVGLMIVVVIYTIGILIQICSFNKWYQYFIGR
                     IISGLGVGGITVMSPMLISEVAPKQIRGTLVSCYQLMITGGIFLGYCTNFGTKNYNNS
                     AQWRIPLGLCFAWALFMIGGMTFVPESPRYLVEVGKLEEARRSLARANKCSAESPLVT
                     LELENFQASVEAEKVAGDASWSELVTGKPAIFKRTVMGIMIQSLQQLSGDNYFFYYGT
                     TIFTAVGLNDSFETSIVLGVVNFVSTFVALYTVDKFGRRKCLLYGCVGMVCCYIVYAT
                     VGVTSLWPNGQHQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVIVSESFPLRIKSKG
                     MAIASASNWIWGFMIGFFTPFITSSINFYYGYVFMGCMIFAYFYVFFFVPETKGLTLE
                     EVNIMYEERVLPWKSASWLPPHRRTADFNADAFARDELPFYKRLFTRR"
     gene            complement(<99047..>100351)
                     /locus_tag="HG536_0E00590"
                     /db_xref="GeneID:59326345"
     mRNA            complement(<99047..>100351)
                     /locus_tag="HG536_0E00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283927.1"
                     /db_xref="GeneID:59326345"
     CDS             complement(99047..100351)
                     /locus_tag="HG536_0E00590"
                     /inference="similar to AA sequence:RefSeq:NP_010633.3"
                     /note="ancestral locus Anc_5.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139823.1"
                     /db_xref="GeneID:59326345"
                     /translation="MLKWIQGGLSAVTGIAEPEYGADYIHTVTDRVRGKQPFRETNRE
                     DLEWLKPDHTNVETVTFYFSDSATGIVGFAQIIHSNIVGIHTQAQFTFRIFNARKPQE
                     LNAWTSTKLEEFRIEGPNFYARGLSLELNEDNNQYHFLSEVNAKTKIDLVVTRLTPGC
                     KVGDDPNTYYGDNVEEPWGSMRHVFWPRNKVHGTITLCKPEPQSGEEEEQEEQPEDEE
                     PAEEPLGARNSVYEDQTITFAESKPAFSMFVMAFQGMKPHHAAKAWNFMHFHSEKHSA
                     VLMEFTTPKSYANTKVTIGILTTDSDILSVTIDNEVRHLDAEVDSVGWNVPKAISIDY
                     DGCPKDLPDDAVATGDRIRATAEGPLDNLVERIDVMSEIPSFIKTIVSGVAGTKPYIY
                     QYATDDFALELAGSAREKGIAWIEVTFISESELVTEEAYDEQ"
     gene            <100804..>101730
                     /locus_tag="HG536_0E00600"
                     /db_xref="GeneID:59326346"
     mRNA            <100804..>101730
                     /locus_tag="HG536_0E00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283928.1"
                     /db_xref="GeneID:59326346"
     CDS             100804..101730
                     /locus_tag="HG536_0E00600"
                     /inference="similar to AA sequence:RefSeq:NP_010634.3"
                     /note="ancestral locus Anc_5.398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139824.1"
                     /db_xref="GeneID:59326346"
                     /translation="MFSGCHSRLVGQCRRWYVRPALEHLVQGKGVPGLFSSRGLENAW
                     FERADLYTTKLNRFSGGGDETPLETLIYEDAKSGVKRNVVNYASLLFNLRFAMSCVRG
                     CSLPVPSSADYTSGEILKTPGLSLRFSNEPAANGNSTLQNALISSFGSIVEFRSLLMN
                     SSLAISGDGYTWLVARRPLGHDGSDGQVVFDKLFVVNTYNAGTPFNFHRSGHLDELRI
                     QYLKKSAQLKTVEEDSEFSMSKSVEEARQTEAYKKVSYIPLLAIDASPKAWLHDYGVF
                     GKQAYLDRVWESIEWNVVESRLPKQAVSYGLF"
     gene            complement(<101799..>102941)
                     /locus_tag="HG536_0E00610"
                     /db_xref="GeneID:59326347"
     mRNA            complement(<101799..>102941)
                     /locus_tag="HG536_0E00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283929.1"
                     /db_xref="GeneID:59326347"
     CDS             complement(101799..102941)
                     /locus_tag="HG536_0E00610"
                     /inference="similar to AA sequence:RefSeq:NP_010635.1"
                     /note="ancestral locus Anc_5.399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139825.1"
                     /db_xref="GeneID:59326347"
                     /translation="MSPPSNNPFLDDVSGGSRDGSKPGSYPVKGSRPTRSYPTAREEK
                     ERLRDRYKEERNVSGSGGDLPPSYDEVAGSKKSESGYPREKEGSSGHRSHRHRHHRSR
                     GDGDRERSGHGHRGSSHKDKKKGKPAVVPKNVDTIDKMDVTGLFGGSFHHDGPFDACT
                     PHRNKNSKAAPVLAFPADGPNNSIGGASAKKSALNEVFGREEVDDDDELYKTRGANRT
                     VRAMVDSNGSTSTLDAIKPNAKTVTQFDVKGKSQLVHGPTTAGLGSTTFLDGAPASNA
                     AIREDIRNHSHQTRTSGVQRKKSLTQRLQVGGTTNSGVRRSGSTIRSTTEPLVLAKTH
                     SGHLENGEEAGEDEYVGVRFDDSLRKESTGNKLLRRVKSLKVGRKA"
     gene            complement(<103891..>106674)
                     /locus_tag="HG536_0E00620"
                     /db_xref="GeneID:59326348"
     mRNA            complement(<103891..>106674)
                     /locus_tag="HG536_0E00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283930.1"
                     /db_xref="GeneID:59326348"
     CDS             complement(103891..106674)
                     /locus_tag="HG536_0E00620"
                     /inference="similar to AA sequence:RefSeq:NP_011966.1"
                     /note="ancestral locus Anc_5.400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139826.1"
                     /db_xref="GeneID:59326348"
                     /translation="MEQDGLSREISNLSLNQSGQQSGSRKSRRPNRAYHNLATGVSAP
                     ATPFATQSPGPDGRLSNNEGQTFSPMGMPQASVSTPGLLAASQSMMGQQQPGLQPQHG
                     SPEPDAHVSSSHLVAAQRWEDQIRYLTRTYDTARDSVPPLPTTQFYGADHGVCDPRFM
                     SLSMNCVPADERLRSATKLPLGLTVQPFARIIPEETVPVVDNSKDQGPLRCRRCRAYV
                     NPGFRMGYDSTALCNICEVKTQVPIDTYPPMAVDPHGAVNGANPELVRGCVDFLVPDV
                     YNAIQGEKPLPLHYVFLVDISLLANENGSSIAVVEGVKTCIEHISDFQPNCKVAIMAF
                     DSRIRFFNLSPTLETAQEYIIGDLNDVFLPFCEGLFVNPQESARIIDDTLKKIMSYIS
                     MGKLYHVVQNCYGSALQAAKLALDTVTKGQGGKIICSLNSMPTVGNGNLTLRKDDATK
                     KHMRCDNEFYTKLGHEFARSYISLDLFLTTSVFIDMVTVGYPVEATCGTLKYYPNFTQ
                     DRDEFVLVNDMLQHVSSIVGYQALLKVRSSTDLSIYQYYLESAGNTNRDPMLPVLTTD
                     TTVDVLLKLDQKLKVGNTVSFQAALLYTDIDGNRKVRSINSNAKVSGNIREVFQFVDQ
                     NVAMRIMIKDVISSLGDCDFNAIRKTIDNKMVDILTQYKALAGVSLSTQLVLPDALKT
                     LPTFMLAFEKSPLMAPNIHSTRGNDRCYDLYHFKTLNSAQLSYKLYPQIVPLHVLLDE
                     TDLTFYDTAEKLLQVSSSSVENLTVRNAHASITNGGCYLIFQGEKVYLWFNENTNRML
                     LLDLLQVDEDIPVGQVSLFGASLPQVPTQVNEKAHALIRNWCQLTNRSTLPIELLRPN
                     VDQYYSSVMGQILCEDKSVSKIESNDNYLVQLHRLIQEKLKKEDYVKINHSSASQNGN
                     AAQEDMHQKFVQF"
     gene            complement(<106898..>108619)
                     /locus_tag="HG536_0E00630"
                     /db_xref="GeneID:59326349"
     mRNA            complement(<106898..>108619)
                     /locus_tag="HG536_0E00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283931.1"
                     /db_xref="GeneID:59326349"
     CDS             complement(106898..108619)
                     /locus_tag="HG536_0E00630"
                     /inference="similar to AA sequence:RefSeq:NP_010636.1"
                     /note="ancestral locus Anc_5.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139827.1"
                     /db_xref="GeneID:59326349"
                     /translation="MYAVLLKAWCLFVIFLRCGWCQSNSSDDSLSGSGDAGFPIIVLG
                     KDESTLWYANVSFGTPNVQKSLRVDIGQPYTWLLKSLNGSETAVRLNDGHVYDFNFMD
                     GIDISGPAVMDTMNFTALAFPGENVPETHSINLSSTAVVAPDYLSISNISFFEANASA
                     ALNKGSLGLGGKITDQLSETDSTKFDSSFFFLDRLTDLGIIASPSYSLWFGADNVPYS
                     LRKLPSGTLGDCGKLILGAVDPTLFTGRLHMFKTIPYIDPETHLESSSYPILPLGTIY
                     INSATGKSLNVTAEEFVEPVLLDSRYSTSYLPIDAIIQIAVQIGATYVEALGRWVVAC
                     SVASYDVQLDFSFGDMSIRVPLEDFLVTTFDVNSNTTIHFSNGAEACLLAMGSKSTIG
                     FNILGGPFLKNAYTVFDLEDNAIALAQAKKVDSSSSSSASSSEAAQTSTSASAIRAIS
                     SGHIPYAESRNTSMTMTLIPAAVPSATSNIPDIFTGTIDSDGLISTGRSFYQTSRTTP
                     SSKTSETAYESLVISSIVSSSKYLGGATKNNAGHSSVPACVLEPRGKFPRQVLALLLL
                     VLLAVLL"
     gene            <110013..>110486
                     /locus_tag="HG536_0E00640"
                     /db_xref="GeneID:59326350"
     mRNA            <110013..>110486
                     /locus_tag="HG536_0E00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283932.1"
                     /db_xref="GeneID:59326350"
     CDS             110013..110486
                     /locus_tag="HG536_0E00640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139828.1"
                     /db_xref="GeneID:59326350"
                     /translation="MTLLRLSSMVKSRMPEVFHVRKPQFSCLPIMPSIMTFRSTWETS
                     STQTSSSAILSSNFTPSRPTDHEYEPCHPETIDPQNHDKPLTPPSHGEPQQQPLTCPI
                     GIIHTEDDRRVRKARKKPSYYLTGYVVQVQVVDCQPSQEPVEESTFKLLSTRSSS"
     gene            114006..114078
                     /locus_tag="HG536_0Etrna3M"
                     /db_xref="GeneID:59326889"
     tRNA            114006..114078
                     /locus_tag="HG536_0Etrna3M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:59326889"
     gene            <114404..>125599
                     /locus_tag="HG536_0E00650"
                     /db_xref="GeneID:59326351"
     mRNA            <114404..>125599
                     /locus_tag="HG536_0E00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283933.1"
                     /db_xref="GeneID:59326351"
     CDS             114404..125599
                     /locus_tag="HG536_0E00650"
                     /inference="similar to AA sequence:RefSeq:NP_011967.1"
                     /note="ancestral locus Anc_5.402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139829.1"
                     /db_xref="GeneID:59326351"
                     /translation="MFRSDMSYSEQIDQLASKFGDEHVTLEERHAAISELCDVLEFLN
                     TPDNYQSFFKAVIPTVVKQLEVVPASFDLGSSEHKLRNSMFTVLNRCPMNQALEPYVP
                     SLMEVLLASLPKENEENGVLCMKILTSLFKSFKALLQNQVEQFIQIIVQIYKNSPESV
                     RQAFDENSSETVNFEDDEMKDDDQLLNADIEADDRDLNGRPKADDVGKHSKSTLYSFK
                     VLSECPITMVTLYSSYKQLTSTSLPQFTPLVMDLLNMQVPQQQRAREEAEARGKRFTS
                     VSPDIKSRAVYCEFILAQIKATSFLAYVFIRGYASDFLQSYVGFIPDLIIRLLQDCPS
                     ELSSARKELLHATRHILSTNYKRLFLPKLDYLFDENVLIGSGFTTHETLRPLAYSTVA
                     DFVHNVRAELQLDDIEKTIQMYTGYLLDQSLALTVQIMSAKLLLNLVERILKLGKENP
                     QEAPRAKKLLMIIVDAYMNRFKALNSQYNTIMKYHKKYEQNKEANTNHVQQAAVADNQ
                     ETEKFMREVLHFNNENAGLPDTRSRLRKTDDEDSGEEMSSIEFFDIKNYAPLLLTSVS
                     TSDPIKDAFYLYRTLMSFLKTIIHDLKVFNPPPAEYTINNPKLWASVSRVFSYEEVMV
                     FKDLFHECIVGLRFFSSNTEKPNIPVKKHFDITMPSLPVSATKDGRELMDYLAFMFMQ
                     MDSSTFNEIIESEMEFMYQSMLDDSALLHIAQSFLTSEITSPNFAGILLRFLKSKLKE
                     LGNVDFNKSNILIRLFKLSFMSVNLFPNLNEIVLLPHLNDLILNSLNYATSAEEPLVY
                     FYLIRTLFRSIGGGRFENLYRSIKPILQVLLQSLNGMILTARLPHERELYVELCITVP
                     VRLSVLAPFLPYLMKPLVYALQGYPDLVSQGLRTLELCIDNLTAEYFDPIVEPVVEDV
                     TKALFKLLKPQPFNHTISHTTVRILGKLGGRNRRFLKPATDLKTKDELDVEINALFKI
                     NNMADEVPLSVTPGIEAALNIMEDYRLDLTYKKSAYKYLTSVLLLLIKSSAQFPDNYA
                     ILVETAVKICSLDKIEVQPNFTPEHMRDKKRFSTQESLIIDLLQMVFFSVSIPELKDD
                     AIQLINQLTDHFCLLQVNDTLIRKRNYSSMFNIDLKQPNVMINSKIFVKAVSHSLSSY
                     ISDVREVAVDVIKKIYEKSRLIYGEDLLYHHSFVVDLIKAFIHHCYEEAFYGKRAGVL
                     GMKTLVEEIEISEEFLKRTQFELVDGLLFVLKDTPLQSPAIITEDAENLMLSITKKTF
                     HDVKEETLDSKIVQNTLTDIVCELSNANPKVRKACQRCLSTISETTSIPIVRLMDHSK
                     NFLLSPIFAKPLRALPFAMQIGNVDAVTYCLGLPDTFLRFNEELFRLLQEAIVLADAE
                     DESLSTIQRATEYRTSEQLVQLRVACIKLLAFALKNEEFSAAQQGNIRFRILAVFFKT
                     MLKTSPEIINTTYQALKDVLAENSKLPKELLQNGLKPMLMNLSDHQKLTVPGLEALSK
                     LLELLIAYFKVEIGRKLLDHMNAWCRIEVLDTLFGHDIIEQMPTKIIVQIINVFHLLP
                     PQADMFLNDLLLKVMLLERKLRLQMDSPFRAPLAKYLNRFHGPVIEYVKKNMGLRQLI
                     LFMCSILQKPEAKDLADVFEKELGNFYDHYIESISTNQVRVVSFFANMVDMFSTMVKI
                     RGTQWLKDKRDMVFKLKEMLNLTLSTIKESNFYIDHLQLNQAVKQYQEIYLRFISFYP
                     EEKELLLDFIEFLFANDIKLSHSLPSYIFDNIIRTPSKKQQEAYLIACVKFVLSDRVL
                     NAQVFVLQNIVNATLIYEGVQNNNLARFGGEQKPEWLEILHSKAWNSSNQTLLNNVAG
                     ECDAYRFELLQLSAVFIKWGPELISDFKKDIIKLNWHFIKLKDVLVKQAAYLTISLFI
                     SKFDFPIKVVMQVFVAILRCSQAEARHLARQSLDVLAPVLHRRMQDFDTPNAWINWVK
                     RVLFENSSGQNNSLYQFLINHPDLLYPSRGLFMSHIILYMSKVTFMSNNTPDNHTLAI
                     DLGSLVLRWEAKALEDRKPAEKLSNQDVDMTGEHDPAIDHNPSDNAKELSAYSVPMNL
                     RETCIAFLIRYLCSSNHRASETDLGLRALNILSELLSDKHWSNVNVKLFYFEKFLMYQ
                     DLGSENILFYCMNALDVLHVFFQNKSAAWIIENLTTIQNLLEKCLRVDHHDIQEALQK
                     VLTVILKAIKAEEIINKAEEENPGKTFMKLLVTTVEQDLQGTSSVAAGVMLVWTLFMV
                     FPQSVDPLLGLIMKTFSKLCKDHLSISQPKDASGVEEARITTGLLEKVLCLLSLKVSV
                     LGDSRRPFLSTVALLIDRSMDQNFLRKIVTIARNWVFNNEIFPTVKEKAAILTKMLAF
                     EVRGEPSLSKMFYEIILDLFDQKQFTNTEITVRMEQPFLVGTRVKDETIRRKFMAILD
                     SSLERDIKERLYYVLRDQNWEFIADYPWLNQALQLLYGSFVKSHSLTLIDVYDLSGPK
                     IIHEFLPDDVDVPPESAHPHLSSFINEHVDTFGRVCEVKAADIIEPLIELFYQDSNAI
                     HRAWVSVFPQAYKCIPRNEKYGFVRSLITLLSKQYHSRQVAAKNNVVSMLLDSISRVD
                     SLELPPHLVKYLAISNNSWYQCIKILESAPFNTSIDNSKILEANEDALLELYINLQEE
                     DMFHGLWRRRAKYTETNVALSYEQVGLWDKAQQLYEVAQVKARSGALPYSEVEYALWE
                     DNWIICAEKLQNWDILTELAKHEGFTDLLLECGWRVADWSADREALEQSVKSVMDVPT
                     PRRQMFETFLALQNFADTRKGDQEVRRLCDEGIQLSLHKWASLPERFTPAHKWLLHGF
                     QQYIEFLEATQVYANLHTTTVQNLDAKAQEVKRVLQAWRDRLPNIWDDVNMWNDLVTW
                     RQHAFQVINNAYLPLIPALQQSSSNSNVNTHAYRGYHEIAWVINRFAHVARKHNMPDV
                     CISQLARIYTLPNIEIQEAFLKLREQAKCHYQNMNELTTGLDVISNTNLVYFGTVQKA
                     EFFTLKGMFLSKLRAHDEANQAFATAVQIDLNLAKAWAQWGFFNDRRLSEEPNNTSFA
                     SNAISCYLQAAGLYKNAKTRKLLCRILWLISMDDPSGSSANAFESFRGEVPVWYWITF
                     IPQLLTSLSHKEANLVRQILIRIAKSYPQALHFQLRTTKEDFAVIQRQTLAVMGEKGD
                     SQFQNGSQNGGPRQPWEYLQELNNILKTAYPLLALSLESLVAQINERFKSSTDEDLFR
                     LINVLLIDGTFNYNRLPFPRSNPKLPANTETNLIRFSETLLAPHIRPKFNADFIDSKP
                     DFETYIKRLRYWRKRLENKLDRAPKVENLERLCPHLSNFHHQKFEDIEIPGQYLLNKD
                     NNMHFAKIARFLPEVDFVRGTHSSYRRLTIRGSDGALHHFAVQYPSVRHSRREERMSQ
                     LFRLFNRSLSKNVQTRSRDIEFTLPIAVPLSPQVRIMNDNPACETLHQIYDQYCAKNN
                     MDPDTVQDFVNEQLNIAHDKALPPPDLTVVKVEIFSSIQSMFLPTTVLVDYFMALFDQ
                     FEDFWLFRKQFASHYGAFVFMTYMMMINNRTPHKIHVDKRSGNVFTLEMLPSRYPYER
                     VKPLLKNTDLNLPPDAPIFHNNEPVPFRLTPNIQKLIGDSALEGIFSIDIFVISRALM
                     EPDNELNTYLTLFIRDEVISWFSNLHRPIAENPQLREMVQANVDLIIRKVAQLGHLSS
                     NPAVTTQFILDCISSAVNPRNLAKSDLSYLPWF"
     gene            complement(<125652..>126209)
                     /locus_tag="HG536_0E00660"
                     /db_xref="GeneID:59326352"
     mRNA            complement(<125652..>126209)
                     /locus_tag="HG536_0E00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283934.1"
                     /db_xref="GeneID:59326352"
     CDS             complement(125652..126209)
                     /locus_tag="HG536_0E00660"
                     /inference="similar to AA sequence:RefSeq:NP_011968.1"
                     /note="ancestral locus Anc_5.403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139830.1"
                     /db_xref="GeneID:59326352"
                     /translation="MNASGTLNFFRLIWNPRLCMPHIWIATFNDLPVPINASIKAVVL
                     DKDNCFAYPEDNKVWPAYREKWEQLKRQYPGKRLLIVSNTAGSNDDKGYKEAEKLEAI
                     TGVPVLRHATKKPGCRDEVIQYFTKNGVVSNPSEIAVVGDRLFTDIMMANQMGAYGVW
                     VQDGVRKSTSSISRFEKTLYNYLKI"
     gene            complement(<126453..>127421)
                     /locus_tag="HG536_0E00670"
                     /db_xref="GeneID:59326353"
     mRNA            complement(<126453..>127421)
                     /locus_tag="HG536_0E00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283935.1"
                     /db_xref="GeneID:59326353"
     CDS             complement(126453..127421)
                     /locus_tag="HG536_0E00670"
                     /inference="similar to AA sequence:RefSeq:NP_011969.1"
                     /note="ancestral locus Anc_5.404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139831.1"
                     /db_xref="GeneID:59326353"
                     /translation="MTTLLTSCTSSPGIVHYGEEDTTDVSLSLERFSAISRQLLAYCN
                     SDAYVFINLPGITIDDFSEYKKEFTSLQRYIHSASTAVSFDRVDTPSNATFSELIEYV
                     SDQCRIDRFLVIEGDAADGYEPYIDAAGRILRIDFLMLPEDQDLRRQAIIDFDKSLRT
                     ILAQIPSPAHTVILTAVGPSEAPERSLAVPARPIFPEVLLDPAKRQEIEKNDHDLKMP
                     RHFNEPRPKFSEPQLRYMTAFDSEFISKNYDLIRLIVTSLIGFLLIQLLVKSRTEQTG
                     KPDTRQGKATSKVSEPQQGDESTKNANQEAPASKAKKLSGDREIEN"
     gene            complement(<127692..>129824)
                     /locus_tag="HG536_0E00680"
                     /db_xref="GeneID:59326354"
     mRNA            complement(<127692..>129824)
                     /locus_tag="HG536_0E00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283936.1"
                     /db_xref="GeneID:59326354"
     CDS             complement(127692..129824)
                     /locus_tag="HG536_0E00680"
                     /inference="similar to AA sequence:RefSeq:NP_010637.4"
                     /note="ancestral locus Anc_5.405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139832.1"
                     /db_xref="GeneID:59326354"
                     /translation="MLWACRRFGNSQLAGRLRWKSTATSAVPTNEKDVQKAASNIDEI
                     YQLVNQVTTRDLSGERPIPLLKLGGMIDSIANGHEMRRVRNKLQRKFGMSYNTVFTSL
                     LRVVADPSLFKMSMFRRLGWKQYYSFVNALRSTIGDRGLSNDQKKQKLYRIISFQHDL
                     FPKASEKAGYLIPTDVHQWFWENLPRDESFNHLYFLIKNDVLLSSCPYVWNFSKRLMQ
                     GSELEMQLATFEIFFHDKAHQGTFQQKFGKLHSFYAMNKLVNKVLSGKDFRFIKLYLS
                     SLLQKMESLKEDGDRPDTKSKKTLFIRFSNTLLFYLSQTGNVEMFLQTFEISLQYMRK
                     ARLLKDARFMQEYLNPSFHFILKLLRQKGLQEQVFHFIRVIQRVIRRRDPKFSTRVVG
                     ELVSSLRSFNDPKLSCEYILSAFNIKQTAALLNDLGLWGAIFHENSAKLSQRMLEAET
                     KVQEKIFPRSLQIEGTPSIPILTELYRVLLSTCARTMGHEMYQGIILELYSSYKKALE
                     DHRFPTAKHDTGILSVFLYHIRLELNNSKLAFEVLKDFYSQKFASSVRCTTKSCPFSY
                     VVYKNYDLTQSDLSHLLHLMQLNRVPLQFRFCTAMVLRYLKLGNVTEAYLWYRKILHA
                     GFEVDHFVLIKAITANGWEYPKNFDMSLLHRIDQRTLDSNEDALFLGESNELDDPNAI
                     SARGEDSLLRAINLVEELRGPKANSSPI"
     gene            <130166..>133162
                     /locus_tag="HG536_0E00690"
                     /db_xref="GeneID:59326355"
     mRNA            <130166..>133162
                     /locus_tag="HG536_0E00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283937.1"
                     /db_xref="GeneID:59326355"
     CDS             130166..133162
                     /locus_tag="HG536_0E00690"
                     /inference="similar to AA sequence:RefSeq:NP_011970.1"
                     /note="ancestral locus Anc_5.406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139833.1"
                     /db_xref="GeneID:59326355"
                     /translation="MKKSIGGDSGNEIPAKMDQDIGSLFKRSEIIGRGKFGVVYKGYH
                     VRTKQVYAIKVLNLDSDEDEVEDVQREIQFLASMKQVPNITHYYGSYLKDTSLWIIIE
                     YCAGGSLRTLLRPGKIDEKYIGVIMRELLMALKYIHKDNVIHRDIKAANVLITNDGQV
                     KLCDFGVAAQLNQTRSRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATG
                     NPPYCEVEALRAMQLITKSKPPRLEGRNYSALLKEFIALCLDEDPKARLSAEELLKTK
                     FIKTHKATSSALLKQLISRYLLFRDNKKKTRESVFLADEDPRADHKKYLQNDQLNGKT
                     SEDSSDFEVDVKWDFDSLSSADYIIENDINLEEIPEGSAYDWASAQDQHNYAYPDEDQ
                     FYCYPTNNNNGKVYQGTTMGKTQPGTMLYNSTLNAPLSHNNTTGNFPTRMMKSVRTNP
                     TVGTGSHTNSGGAKRSEMKVPKKLSELFEKVEQTNENIPGEPELSRINRNVSHLHMGS
                     LPEDTAALPVSELPAVRPHVGAINNGNFHSQSTPVLPVIQTKFSKATKGPPTAVTTAP
                     TPIEIEIPEELPTTTAAGSSNSDALAASHTKPRSSTVSTPGPTSHPKAPGISRRLTVG
                     TAVAPVSSNRGIDEKPKKMSNSPNDNAESNTLSSNVANIASSGPSNKLPLKSPSPTRS
                     YTNLGSSPTKRPGNSPTTGTAQPPTMKALGNAGENKDPLLQPINTNLHISNEIHNSMA
                     DKETSRVNRDFKRNNPNLKLQMPLPTSVVPHKLLDPSSSAVAATGSNNGPAGENINQF
                     GFNTSSASNIPVSMTPINEKHIDWGKKPKRGPSISNRKNSQNADISISTSTSGPTMSV
                     NGAQSTVPLNTGPMSSSSLSVASMFPNGSSASVTASGQQSSQINALGATNSTSNAISN
                     TNASTVSGNLHSPTVLQPPPSTINMGIFLDVDANMPDSNSWVDKKPLVLHELEALLKM
                     YEEGLPVIENALKKQLISAEVAQGDH"
     gene            <134416..>136890
                     /locus_tag="HG536_0E00700"
                     /db_xref="GeneID:59326356"
     mRNA            <134416..>136890
                     /locus_tag="HG536_0E00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283938.1"
                     /db_xref="GeneID:59326356"
     CDS             134416..136890
                     /locus_tag="HG536_0E00700"
                     /inference="similar to AA sequence:RefSeq:NP_010638.3"
                     /note="ancestral locus Anc_5.407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139834.1"
                     /db_xref="GeneID:59326356"
                     /translation="MSINTKRLGTLKEEESAGGSLTSHMLNHVSQDCEHNAKQETLKG
                     GRIGSPYVSGANGGSALPKSRCASISSNSVSTNSKTVGLGIARRPSDNLLLNMTALED
                     DIKKLDEEAVALSTNFGLPPPRKNFAAKAEKNDRPISNDSIATRTTELFSSATSDVNS
                     GSSSVENENDTESKECRDELNDSRSSTDNESDSETCSVENLSLSTHCNETIRSGTKGH
                     PDAVQRTRYFFNNGSKATSQISLAGSTSTITSPVETANDGALQRHSLPAASPLYFQVN
                     STSAILPSKGRLTPSQRYRLRKAQNETALRKSIRRKEKFYEEQDRSSELRDDLENILI
                     WNIPVASTSTNSFLTSSKENRRSRNMPSDSSLSRTKNSDDHFAAHRLPYLDYHEMPTS
                     PIPGVNNTTDFQYMQQATQNLSSVYLHSSDRLSQSKLCERTASADFLPIEFKAASDLG
                     LEDLKLVSEDKLEVTSHSRPSWLPPKDPQERKLHEEQISKSTSMASIEQLDRNKESQE
                     KAIRDETNRQKYVLLLARDITRNSSLRDLKKLIWETAFSDETRNQAYNDVLQSNARTI
                     TGEFLEPFEDMMRLLNEMDFPKGKEAEIEQLIKVGVRCKIAGKDGVPKELALMLKLKS
                     ISQQGLQCGDELLFHHFLSSKSFSSLEQVWDAVNLVQMTCFNDHCKEKFNSRILNSRG
                     IVAHYLLRGDDFKDEFNASCLNSSTWWNLMERVDHALFMWIIDIIVVANSQCFKKVPV
                     SKQNTKDKGWEDYRAKHVVVNYKILLSLVLNVLLNYHFGFNDLKSLSSLDDSNFCIPM
                     PMDHLLDTDSVNQIFVRKWLHYFKKF"
     gene            <137041..>137949
                     /locus_tag="HG536_0E00710"
                     /db_xref="GeneID:59326357"
     mRNA            <137041..>137949
                     /locus_tag="HG536_0E00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283939.1"
                     /db_xref="GeneID:59326357"
     CDS             137041..137949
                     /locus_tag="HG536_0E00710"
                     /inference="similar to AA sequence:RefSeq:NP_010639.1"
                     /note="ancestral locus Anc_5.408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139835.1"
                     /db_xref="GeneID:59326357"
                     /translation="MSCERSIWPIVSDINGSISFFCSFISLFPQILETFRDKTVEGLS
                     PYFLLAWVAGDITTLSGAILTDQLMFQVAMALYFLLNDLFICGQYYYYGILYRNALAT
                     TGHESKPHVALTPSETHTGPTGSGSRKGSAIARALAVASAVGTSEAFPIKAALSSLVH
                     RDLSHDDPPVPVPGNSSTSSLGRALAWTGAVCYVGARIPQLWKNYKRKSTDGISPFLF
                     GTTLLSNVTYNLNVLTSCGFIGSSDRRAFVLNALPFLLGASVTILFDLVYFYQHYVLY
                     AEDMNLRALEREQLRSSAEASPLLHE"
     gene            <138130..>139119
                     /locus_tag="HG536_0E00720"
                     /db_xref="GeneID:59326358"
     mRNA            <138130..>139119
                     /locus_tag="HG536_0E00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283940.1"
                     /db_xref="GeneID:59326358"
     CDS             138130..139119
                     /locus_tag="HG536_0E00720"
                     /inference="similar to AA sequence:RefSeq:NP_011972.1"
                     /note="ancestral locus Anc_5.409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139836.1"
                     /db_xref="GeneID:59326358"
                     /translation="MSRTVALNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFD
                     GAQDYGNEKEVGEGIRKAIQEGLVKREELFVVSKLWNSFHHPRNVKKALQRTLDDMQL
                     DYLDLFYIHFPIAQAFVPFEEKYPPGLYTGAQDEKEGVMSQESVPIIDTYRALEALVD
                     EGLIRSIGISNFSAALVMDLLRGCRIRPVALQIEHHPYLTQERLVSYVKQQGIQIVAY
                     SSFGPQSFLEMDSELARSTPPLFENHTVVDIAANHGPEVSPSQVLLRWATQRDIAVIP
                     KSSKQERLAQNLKIDEMLTLSDQELAQVSSLNKNIRFNDPYTWSSRTPFPIFD"
     gene            <139216..>139698
                     /locus_tag="HG536_0E00730"
                     /db_xref="GeneID:59326359"
     mRNA            <139216..>139698
                     /locus_tag="HG536_0E00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283941.1"
                     /db_xref="GeneID:59326359"
     CDS             139216..139698
                     /locus_tag="HG536_0E00730"
                     /inference="similar to AA sequence:RefSeq:NP_011973.1"
                     /note="ancestral locus Anc_5.410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139837.1"
                     /db_xref="GeneID:59326359"
                     /translation="MNVLAPEPITLADDESASSLGPTAALNVLRAHVTDCTVVSGENG
                     SKFAVWKVTLELQRPDAPADGHPSVAIYKRYSEFRRFRDQLARRCPASDLPQLPPRVS
                     WYQSWRYQDVNLDRAWLARRRQGLDYFLNKILLDQTLVAANRELIVRFLEPQPAANGL
                     "
     gene            complement(<140433..>141164)
                     /locus_tag="HG536_0E00740"
                     /db_xref="GeneID:59326360"
     mRNA            complement(<140433..>141164)
                     /locus_tag="HG536_0E00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283942.1"
                     /db_xref="GeneID:59326360"
     CDS             complement(140433..141164)
                     /locus_tag="HG536_0E00740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139838.1"
                     /db_xref="GeneID:59326360"
                     /translation="MDFVTGLPPTTNNLNMILVVVDRFSKRAHFIATRKTLDTSHLID
                     LLFRYVFSYHGFPRTITSDRDIRITAGKYQEFTRRLGIKSTMSTPNHPQTDGQTERTI
                     QTLNRMLRAYDSTDIENWHKYLPQIEFVYNSTANRTLGASPFEIDLGYAPNEPVLKTD
                     EELNARDFSAVEMSRRLKAITLQAKERLEAAQVEMEVNNNKGRKPLILERGDDVLVHR
                     DEYFPFTLVPSTSSKKSMTTLMKSD"
     gene            complement(<143043..>143723)
                     /locus_tag="HG536_0E00760"
                     /db_xref="GeneID:59326361"
     mRNA            complement(<143043..>143723)
                     /locus_tag="HG536_0E00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283943.1"
                     /db_xref="GeneID:59326361"
     CDS             complement(143043..143723)
                     /locus_tag="HG536_0E00760"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139839.1"
                     /db_xref="GeneID:59326361"
                     /translation="MDDPAERPILIKRQKMKTLFDSGSPTSFIRADMVKSLNLRTYET
                     PPFRFRGFIPTDASTTTEAVSLTVPVEDLQIPVVAYILESMDYQLLIANPILRRYSKL
                     LSIILESTPNLKACENRVKVSYLEPESTGNRGNSRRPEMSLATTTLEAIDRKSIGHRG
                     KAKCDVPSPVTTTSETASALDNPGYPGDPELIVQELLEQIPGGDGREVPGCKRKRFSP
                     AVVREQRL"
     gene            <144514..>145578
                     /locus_tag="HG536_0E00770"
                     /db_xref="GeneID:59326362"
     mRNA            <144514..>145578
                     /locus_tag="HG536_0E00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283944.1"
                     /db_xref="GeneID:59326362"
     CDS             144514..145578
                     /locus_tag="HG536_0E00770"
                     /inference="similar to AA sequence:RefSeq:NP_010640.1"
                     /note="ancestral locus Anc_5.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139840.1"
                     /db_xref="GeneID:59326362"
                     /translation="MNDDVDFTKVYKDRPRDSFMRIYRTLSSSIRVGMTATHHRVTII
                     GSGPAAHTAAIYLARAEIKPTLYEGMFANGIAAGGQLTTTTEIENFPGFPEGLTGGEL
                     MERMKQQSERFGTEIVTETVSKVDLSSRPFKLWTEFNEDSEPITTDAIILATGASAKR
                     MNLPGEETYWQQGISACAVCDGAVPIFRNKPLAVVGGGDSACEEAGFLTKYGSKVFML
                     VRKDHLRASTIMQRRAEKNDKIEILYNTVALEAKGDGKLLNALRIKNVKTNEESDLAV
                     NGLFYAIGHTPATKIVEGQVETDEAGYIQTVKGSAETSVPGFFAAGDVQDSRYRQAIT
                     SAGSGCMAALDAERYLTSLE"
     gene            complement(<145625..>146860)
                     /locus_tag="HG536_0E00780"
                     /db_xref="GeneID:59326363"
     mRNA            complement(<145625..>146860)
                     /locus_tag="HG536_0E00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283945.1"
                     /db_xref="GeneID:59326363"
     CDS             complement(145625..146860)
                     /locus_tag="HG536_0E00780"
                     /inference="similar to AA sequence:RefSeq:NP_011975.1"
                     /note="ancestral locus Anc_5.412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139841.1"
                     /db_xref="GeneID:59326363"
                     /translation="MTVEAATAGAAVEHNGAVQSIGISNLPNQRYKIVSERGGSFTMM
                     VCGESGVGKTTFINTLFQTTLKHSDNQQRRHQPIRRTVEIDVIRAVLEEKNFSLRVNV
                     IDTPGFGDNVNNNKSWQSIIDFIDDQHDSFMRQEQQPYRAVKFDLRVHAVLYFIRPTG
                     HGLKPLDIETMKRISTRANLIPVIAKSDTLTAQELTAFKLRIRQVIEAQEIRIFTPPL
                     ERERESDINSNQDLAAMEHARQLIESMPFAIIGSEKKIDNGQGKQVIGRSYPWGIVEI
                     ENDNHCDFRKLRSLLLRTNLLDLILTTEELHYETYRRLRLEGNTQPSEDPNSQNSSTI
                     PLRAPARKLSHNPKYKEEENALKKYFTDQVKAEEQRFRQWEQNIVNERARLNGDLEEI
                     QNKVKRLEEQVRSLQLKKR"
     gene            <147606..>148736
                     /locus_tag="HG536_0E00790"
                     /db_xref="GeneID:59326364"
     mRNA            <147606..>148736
                     /locus_tag="HG536_0E00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283946.1"
                     /db_xref="GeneID:59326364"
     CDS             147606..148736
                     /locus_tag="HG536_0E00790"
                     /inference="similar to AA sequence:RefSeq:NP_010641.3"
                     /note="ancestral locus Anc_5.413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139842.1"
                     /db_xref="GeneID:59326364"
                     /translation="MDVVKGLVRYTKKLLVVPPQLTPEDLYHAIGIIIEALAKEATLE
                     AEEVLQSYILVSSFLTSLRTTGLDHKAEYIAEAAKAVLRYSDTVDLSSHVREDEVVLD
                     IVGTGGDGQNTFNVSTSAAIVAAGIPGLRVCKHGGKASTSNSGAGDLIAKLGCDVSKV
                     NQKTVATLWHSGNTFLFLLAPYFHNGMKMVAKVRQLIGIPTIFNVLGPLVHPVSHVNR
                     RILGVYSRDLAPEYARAAALVYPTSEIFVVWGHIGLDEVSPVGGTTVWHVDPSKPGNV
                     DTFELRPDLFGLQEHELAECKSLGPAENAHILKDEILAGRYRLGDNNPIYDYILLNTA
                     VLYCLSQGNKDWKLGVEKAEESIQSGSALNALNRFLSEVQNI"
     gene            <148852..>151128
                     /locus_tag="HG536_0E00800"
                     /db_xref="GeneID:59326365"
     mRNA            <148852..>151128
                     /locus_tag="HG536_0E00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283947.1"
                     /db_xref="GeneID:59326365"
     CDS             148852..151128
                     /locus_tag="HG536_0E00800"
                     /inference="similar to AA sequence:RefSeq:NP_010643.3"
                     /note="ancestral locus Anc_5.414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139843.1"
                     /db_xref="GeneID:59326365"
                     /translation="MDETVNRPARDLKNFEFTPIGYVKEKQNGKRTNGPISDDDHGIP
                     RRKTRKMSLDDSFNSTRMFNDESQLEETLPHVRQEKENTNVDKRNLMQELSENAVTSN
                     PLREQQEKLHKLNTENYSLRLKCNSLLKFLNSVTDQGELKKSLGLLEEIQEWKQKFEK
                     LQGEVLKLRDANEQLQLSVKAPQLATPPDTKEELERLKERYAKLEEDTRAKHEQNQIK
                     IDMLKSDLNNLNVTLATKNNDLEEKERKIERLRTQLEEFDHRGSASLLELERSLDLKN
                     DVIKRLEDDLAKLEKLAKDKDNDILEFKRIIKRKDDELSKQSVSQVRYTQQEKVIRDK
                     TEEVRRLTERNRALDQSINQITVEHNKLERKVADFQHLKDELESQKKELALARTKLKE
                     AEELSARFQSQIIENTTKNSEKTSQRVKEKELEINNLKDQLRRLRQSQETLLQKAKAD
                     DNYEIEKMEREILLLKEELKVIEESHQRELETWKSKCDSLNRENERIVHQEVGSIGAM
                     KKNLDEKLSEIERLNKFLEQLRFEKSDLAEKAVQLQTSKDRYKEELKKIVSKFEHLSK
                     EYIKLREKNETGGDDELSRSFREKYNSMKQRLLDELKVLQQENLALERKLMESKGKSV
                     ENGTSARRSNTMSQDRIDYYKLKYHTEVKQNDDLRTMNEYLNRVLRAISQHVRLDLMK
                     IRNEVDPELPAYLAQRNQYPFAHNLAPLQRPKFKTIALFVQACVRMKQAALRHRWDQQ
                     RIRYLQRKMALEDDRVTW"
     gene            complement(<151135..>151473)
                     /locus_tag="HG536_0E00810"
                     /db_xref="GeneID:59326366"
     mRNA            complement(<151135..>151473)
                     /locus_tag="HG536_0E00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283948.1"
                     /db_xref="GeneID:59326366"
     CDS             complement(151135..151473)
                     /locus_tag="HG536_0E00810"
                     /inference="similar to AA sequence:RefSeq:NP_010644.1"
                     /note="ancestral locus Anc_5.415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139844.1"
                     /db_xref="GeneID:59326366"
                     /translation="MSTSGNTSVPNEDPLGIDRLTIDYDYLLYKINDYVASIQLETTA
                     ICRRQNELIREQIIDQVMEKNIEGLNNILKKCEELENHFDMLDQIAVISENFKVRLAR
                     VLKDYKQLKS"
     gene            <151695..>153455
                     /locus_tag="HG536_0E00820"
                     /db_xref="GeneID:59326367"
     mRNA            <151695..>153455
                     /locus_tag="HG536_0E00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283949.1"
                     /db_xref="GeneID:59326367"
     CDS             151695..153455
                     /locus_tag="HG536_0E00820"
                     /inference="similar to AA sequence:RefSeq:NP_010645.1"
                     /note="ancestral locus Anc_5.416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139845.1"
                     /db_xref="GeneID:59326367"
                     /translation="MSQGIYLTDAPVRRPQPVGNPLLRKVQTACRLSLPEPDLALNLD
                     VADYINEKQGPCPRDAVIAIVKLINSRDTHTAVFALALLDVLVKNCGYPLHLQISRKE
                     FLNELVKRFPEHPPMRYSKVQRLILTAIEEWYQTICKHAAYKEDLGYIRDMHRLLKYK
                     GYVFPKINESDLAVLRPSDHLKTPSEIQKEQEVAQAAKLEELIRRGRPEDLREANKLM
                     KVMAGFKQDNANEAKQTISNELNKLKRKADLLNEMLSSSDSVDLQDDTIVSLYSNLKG
                     AQPKFQKIIEEEHEDDNMVQDLLKFNDTVNQLLEKFDLLKAGDSSAASQIHPSNIAPS
                     SDSDGTSNAGNGGTLAKEINLIDFDDDEETQSSSPQPAQSGSGDVVADLLSDLTDLSI
                     SSNSASQSFGLGGSISLGAGQPTSAVSNTSNANSLDLDFLSGFSAQNSASSVSNSGQQ
                     KIDDFKLLADFGDSSSSASSATKVLASETKNLKIEFDIKRESDSTIELKTCFSNVSSF
                     TITDLTFLVAVPKSMGLRLQPQSGSSLSAFASNAVTQQAWIDNASAGATKPLKIKWKA
                     TYKINGSPVEETAVFTLPKL"
     gene            complement(<153682..>156582)
                     /locus_tag="HG536_0E00830"
                     /db_xref="GeneID:59326368"
     mRNA            complement(<153682..>156582)
                     /locus_tag="HG536_0E00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283950.1"
                     /db_xref="GeneID:59326368"
     CDS             complement(153682..156582)
                     /locus_tag="HG536_0E00830"
                     /inference="similar to AA sequence:RefSeq:NP_010646.4"
                     /note="ancestral locus Anc_5.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139846.1"
                     /db_xref="GeneID:59326368"
                     /translation="MSSRSPSPPRRTVIGSSSSRSDDSGSGSKTHVEDLVKTRNRKLV
                     ELYCMSRLSELLTIRDEKALKAEMDSFLRQNDIKKGLRFRSDTLPRQLWQAGSPMGTD
                     QPGSVVGSAKKAPRNVDAAKKVKNEQPRSSTADSYMAQKVKSELKRPLTESAAGELPP
                     EKKLKINRDTRPNTLESGTKSHSSSVPNLISSADEFGKARSASIYASPIPSVPNRPIY
                     YPDIDITPAEPTPLGGTKKCRNYLVDEVSRKSIEPMDYFKENNINSKESVYLLMKEIV
                     PSEIPQALPLAELKYMVQTLPLIKLIPMAHKVLTTDIMNNALSEGRITVVSSRIEELR
                     RLGLWSLRQPKKFVDAWQEEPSHYRTLIEEAKWMQADFKEGRKYKIAVCATIAHAVME
                     YWSFGKVCCISRRPIKHLSADAKDETSVLCSDTAGDSSACENVVNHTQQDRQIQPIEL
                     AGNEPGSSSGELDTESIEATEQNVTSVLDEKQAAEAMCNEKVEAIDVELLKKGSDSQK
                     EHFPTELTKDSTNEKEDDGKRFSQYPFKLHLSFDELNKTARTIAQEIPLYIGTQTESN
                     ALESLPFVAVSKSLVTLEDDHFLKLVEKQIVEEEQSLVQLSKRRGMFYGNRRSHYLKP
                     PPAPSLKYLQNRTPTIWLPEDDQELVKNINAYAYNWELISAHMTHRPTMSYFSNIERR
                     TPWQCFERFVQLNERFSFSDLKGPRAHSVHQWLLEAHKFQQKQNRRISPLGVGPESIQ
                     RGHRRLRWASMFEAMRKNIKKRENAPRPNPTQPRKPLDCKNMKVPTPAEMSQLKAQRD
                     EALRRDIQMRRNVKSRLQQKSSQSSPNVTQSRVANKPGMDYVNSSLPRDSGARQVSAP
                     APSQRPLTEREIVESYSRKILAQKPELSLETAMKAAQSYYKSGQQRRMQLQQQQQKLS
                     PHIQAASAPVQPTERMEQKVKATTNHLKPNHSAPNPDMKSPTPQEILERFQK"
     gene            complement(<156935..>157783)
                     /locus_tag="HG536_0E00840"
                     /db_xref="GeneID:59326369"
     mRNA            complement(<156935..>157783)
                     /locus_tag="HG536_0E00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283951.1"
                     /db_xref="GeneID:59326369"
     CDS             complement(156935..157783)
                     /locus_tag="HG536_0E00840"
                     /inference="similar to AA sequence:RefSeq:NP_010648.3"
                     /note="ancestral locus Anc_5.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139847.1"
                     /db_xref="GeneID:59326369"
                     /translation="MVQAVKLSEVSNRKRRVDENEPSEESDINVSSTDSENDSDDDDD
                     DDGGKQIVNVDFDFFNGNPEVDFHAFKNLLRQLLGPQESSRVQISQLADLMLQSPTTT
                     IKTDGQESDPYCFLSFINYKEHRDSDYAQYLRKAEPKLAAFLQSIDSNQTKSCALVIS
                     ERLINMPAEVMPPLYKITLEDVTNTLGDDKKYDFYIILSRKYEVNFDVDSDDEEDTSA
                     RSKKRVKQAEIDYFHPEDRYLEKHAKIKCESQSKGGIISSYMVVDHQGLVDSINELEQ
                     EIASWK"
     gene            <158351..>160090
                     /locus_tag="HG536_0E00850"
                     /db_xref="GeneID:59326370"
     mRNA            <158351..>160090
                     /locus_tag="HG536_0E00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283952.1"
                     /db_xref="GeneID:59326370"
     CDS             158351..160090
                     /locus_tag="HG536_0E00850"
                     /inference="similar to AA sequence:RefSeq:NP_011977.1"
                     /note="ancestral locus Anc_5.419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139848.1"
                     /db_xref="GeneID:59326370"
                     /translation="MSMSSVVDWFAKNANLKVNGALSVENSFFKGVPSGYGLFVDLAS
                     INYDPNDVTIELLRIPRLATFSLDTLLELIKDETQYSSKENMEKLHATVRAVFSQFLE
                     LDGLKSLLSETTVLVFYFTLLTLVKEEYELPKTLRFYLEDVLLQVKVDNAPMFCEQAA
                     ELYGQYSMFVALKDVLDLLEDFFKNKVSCSRSVLPLLRQVYAAISSRSLEIPDEVAEN
                     SDDFVVNTTLVPLLDFANHSNDLKNAHFDIDRQTRDVLLLLDVDRIPANATKFEIFIS
                     YSPVEDLISFIHYYGFVPSSADKCQFISLSFDRGYLREQEPMPAVNLRLFYKWMQINP
                     VVQLINFQNCWHINDSTEQFAYLLLAFMHSPDSESSSCWAYDPTCYRTFWYFQEHSSK
                     RKEDYISINDYKSRIASLENDDSDLIDLPQLAWSMSFQGDGLSTHRGRFPKDEALQLA
                     PFDNERTFSNAIDLFAKFFLGYIEWRLDKLENSEPHLTSPPLKQLVRLEKSVLLQLLH
                     EPHLYYWSDRQVDCESYDCTLRPLLDRGHRDADRNASKDVLSLENLSLEDYHPEDFTD
                     FLQDELKLYANLV"
     gene            <160191..>160835
                     /locus_tag="HG536_0E00860"
                     /db_xref="GeneID:59326371"
     mRNA            <160191..>160835
                     /locus_tag="HG536_0E00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283953.1"
                     /db_xref="GeneID:59326371"
     CDS             160191..160835
                     /locus_tag="HG536_0E00860"
                     /inference="similar to AA sequence:RefSeq:NP_011978.1"
                     /note="ancestral locus Anc_5.420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139849.1"
                     /db_xref="GeneID:59326371"
                     /translation="MMFGKLLHFLAWQLMLTSTTVRGLHLYLKSGETKCFYENLAKRN
                     LLIGDIDGYIEKDGIFVDDPDLKIGISLYETFDDDHRVLNQQNSHSGDFTFTALETGE
                     HKICIQPMYPVRNAKIRIFIELDIGSVQALDSRMRDDTTSLQSRVSQLIQRLETIRTE
                     QKAVRQKEAHFRDESEAVNSKILFWSVLQIAGLILVCVFQLRYLKNFFVKQKVV"
     gene            <161036..>162352
                     /locus_tag="HG536_0E00870"
                     /db_xref="GeneID:59326372"
     mRNA            <161036..>162352
                     /locus_tag="HG536_0E00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283954.1"
                     /db_xref="GeneID:59326372"
     CDS             161036..162352
                     /locus_tag="HG536_0E00870"
                     /inference="similar to AA sequence:RefSeq:NP_011979.1"
                     /note="ancestral locus Anc_5.421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139850.1"
                     /db_xref="GeneID:59326372"
                     /translation="MEASEELRKELTALKLENARLHRELQNREREQEKRYPLSLEEFR
                     RYGRQMIVEDTGGVSGQIKLRNAKVLVVGAGGLGCPVLPYLAGAGVGVIGIVDNDVVD
                     TSNLHRQVLHNSTTVGMLKCESARRVLNKLNPFVEVRTHPVRLSNANAFEIFEFYDII
                     LDATDTPLTRYLISDVAVNLGKTVVSASGLGTEGQLCILNYNNEGPCYRCFYPKPPTP
                     TSVTSCQEGGVIGPCIGLVGTMMAVETLKLILGEYEKIGFQPFLKTYSGFPEQVLRTF
                     RMRGKQSNCACCGQTPTVTRESIESGLIDYDAFCGSRNYDVCTSEERITVEKFEREYR
                     TRSDSNYILLDVRPRHHYKISHLSDSHNVTVKELRDMDGELEKLQAHIPNISKDSEVV
                     VMCRYGNDSRLATRLLIDRFGIPSVKDISGGLFKYIDKVDPSIPKY"
     gene            complement(<162417..>164288)
                     /locus_tag="HG536_0E00880"
                     /db_xref="GeneID:59326373"
     mRNA            complement(<162417..>164288)
                     /locus_tag="HG536_0E00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283955.1"
                     /db_xref="GeneID:59326373"
     CDS             complement(162417..164288)
                     /locus_tag="HG536_0E00880"
                     /inference="similar to AA sequence:RefSeq:NP_010649.1"
                     /note="ancestral locus Anc_5.422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139851.1"
                     /db_xref="GeneID:59326373"
                     /translation="MIPVKRRRGRPRKNEMTKVDPSIAAAAIASAVDPAASKSRPARG
                     PKKLESGDDYVQVNEEGDDEYIPAFEDLVVELDEPEIGNKARKSQGYKRTKTNGSRSN
                     TPSSTLEEKGRVVRALKDLSSARDKIERIYGLNKQKLLNLAKVKEGFETCVFCFPPEN
                     LQSDSPYFVDLVPPCASADVYKALVGTNRTKCHHMGELEMAQMFQKRSKPLQVVIGEA
                     EMSLGVDDKADFPVFQNDRRTGFLYNTGALITDIAWLKQEHEESQYLAVSLSQYMDRP
                     SDEHLKMFETEGNVSCIEIYKLHPHTMVFTKLQTMIHTFGETWNLKWHEGCQNESSIG
                     SLIFVCHDGSVKMLEVEHTQEFAVKLIDQPSLCIELPKVAITCYDFLSPTTIICGFKN
                     GYVAEFDLSDPTTPSYYRKIHDSYVISIVVAYSEFENLLVSTVAVDGYFYVFDPKDIF
                     TSKTTITRFRGTNIMPMAYIPQLYAIINSDGANSLKTVVPRAAFAIHSVCSLENSIVS
                     IGTSRLHPLSLSGSSDGSVVIDNVARRLLTGIKNSAHTHTSLRLWKWEYSELEEKYRL
                     NHAYETFKLSVNEVIALRIDPHGVNISCVKWCESTSSGQFYAFANNAGILTVEKLGT"
     gene            complement(<164522..>165661)
                     /locus_tag="HG536_0E00890"
                     /db_xref="GeneID:59326374"
     mRNA            complement(<164522..>165661)
                     /locus_tag="HG536_0E00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283956.1"
                     /db_xref="GeneID:59326374"
     CDS             complement(164522..165661)
                     /locus_tag="HG536_0E00890"
                     /inference="similar to AA sequence:RefSeq:NP_011980.1"
                     /note="ancestral locus Anc_5.423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139852.1"
                     /db_xref="GeneID:59326374"
                     /translation="MVDLATALIHADDKDNRVTDVAPPINVSTTFRYDENELIPWSER
                     ESFEFMDETPIYSRLSHPNSTRLESVFSEILEGNAVVYSSGVAAFFAAMVHYNPKRVF
                     MGNSYHGCQSVVKILGRNYGVERYMLEDIEEHASKGDIVHIETPVNPYGTSVDIESFA
                     RRAHAKGALLLVDSTFAPPPLQYAWKFGADIILHSATKYFGGHSDLLSGVLVVKDPGV
                     AAQLRNDRIYLGTNASNLESFLLLRSLRTYELRINKQSQSATQIAKYLHEHQKDFNGV
                     LSAVYHSSLQTEQYVKTQLEGGYTPVLSITLSTKEQCKSFTKKLKFFHHATSLGGVES
                     LVEWRAMTDPNVDQTLIRISVGCESAEDLINDLVNALHEVQDATT"
     gene            <166300..>167781
                     /locus_tag="HG536_0E00900"
                     /db_xref="GeneID:59326375"
     mRNA            <166300..>167781
                     /locus_tag="HG536_0E00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283957.1"
                     /db_xref="GeneID:59326375"
     CDS             166300..167781
                     /locus_tag="HG536_0E00900"
                     /inference="similar to AA sequence:RefSeq:NP_011981.1"
                     /note="ancestral locus Anc_5.424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139853.1"
                     /db_xref="GeneID:59326375"
                     /translation="MLRIHLRRLSTMQSVPKNTTTNYPQEFVKFLNGSHSPYHAVESM
                     KSVLLKHGFKELDERDGWNGKVEHKGKYFVTRNSSSIIAFSVGGKWKPGNPIAITGAH
                     TDSPTLRIKPISKKTSEKYAQIGVECYGGGIWHSWFDSDLSIAGRVFVKDRSTGDTVS
                     KLVDLNKPLLKIPTLAIHLDRDVNQKFEFNKETQLLPIAGLAKADQTPSESKDDATFS
                     SLQSIVERHNEDLIKLIAEELGLPSESDIEDFELILYDHAASTLGGLNDEFVFSGRLD
                     NLTSCFTSLHALVLAADTNIEEEHGIRLMASFDHEEIGSSSAQGADSNFLPNILERLT
                     ALKADGTDESDPLSRSWLLETSAKSFFLSSDVAHAVHPNYANKHESQHKPLIGAGPVI
                     KINANQRYMTNSAGLVLVKKLADRAKVPLQLFVVANNSPCGSTIGPILASKTGIRTLD
                     LGNPILSMHSIRETGGSADLELQIKLFKAFFEDYSSLESKIIV"
     gene            <167983..>169206
                     /locus_tag="HG536_0E00910"
                     /db_xref="GeneID:59326376"
     mRNA            <167983..>169206
                     /locus_tag="HG536_0E00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283958.1"
                     /db_xref="GeneID:59326376"
     CDS             167983..169206
                     /locus_tag="HG536_0E00910"
                     /inference="similar to AA sequence:RefSeq:NP_010650.1"
                     /note="ancestral locus Anc_5.425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139854.1"
                     /db_xref="GeneID:59326376"
                     /translation="MTNPQSNDFDYDDEFFMNEVTDDERDRSDSMVFIEADSIDKDSL
                     TYKKEVASIPALSQRSTNEPHAEGSTSESDEDIIITSESMTVSGLANRGSSVSRRLRS
                     ETAKLASDNRSAPLLPATRSKRRKLTSNVRQPPPSNGKASSASSEKKKSARLGKSKDC
                     ENEEPQRLYNVKFLSRLDGSIGRIIEVKVLGDREFSSILESVLDGFVKECDGCEDLDK
                     PHNADNVTLYWNNAKLLKFMTCDSLRIHRASEGEIVHIEITMVHREQEQEYEERLRSR
                     LVGLGNGARSVLYDGTGLLANEVEDSKNQGMNKLIESSNTSSLKNLVSEDSEKESNSA
                     AIKLALVGQDNKKLYVQVRPSTPFAKVADYYRSQKSLPATTQVKLMFDHEELDLNGTV
                     VEQDMENGDMLEVLL"
     gene            169936..170008
                     /locus_tag="HG536_0Etrna8K"
                     /db_xref="GeneID:59326896"
     tRNA            169936..170008
                     /locus_tag="HG536_0Etrna8K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59326896"
     gene            complement(<170165..>174547)
                     /locus_tag="HG536_0E00920"
                     /db_xref="GeneID:59326377"
     mRNA            complement(<170165..>174547)
                     /locus_tag="HG536_0E00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283959.1"
                     /db_xref="GeneID:59326377"
     CDS             complement(170165..174547)
                     /locus_tag="HG536_0E00920"
                     /inference="similar to AA sequence:RefSeq:NP_014759.1"
                     /note="ancestral locus Anc_5.426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139855.1"
                     /db_xref="GeneID:59326377"
                     /translation="MKEVVSGTTPKKISGLEFSALSAADIVAQSEVEISTRDLFDLEN
                     GRAAKAGGALDPKMGVSSSSLECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQI
                     LQGICKNCSAILLNDTDRRHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGAL
                     NGVVKKAAAGSGSASLKIIHDTFRWAGKKSAPEKDKWVGDWDEVLSHNPELERYVKRC
                     MDDLNPLKTLNLFKQLRPDDCELLGIDSSVKSGRPETYIWRYLPAPPVCIRPSVMMQD
                     SPASNEDDLTVKLTEIVWTSSLIKSGLEKGISINNMMEHWDYLQLSVAMYINSDSVNP
                     AMMPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEV
                     AVPDRVAKVLTYPEKVTRYNRQKLRQLIINGPNVHPGANYLLKSDEDARRNLRYGDRV
                     KLAKNLRVGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPY
                     NADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISH
                     KDSFFDRATLTQLLSMMSDANTQFDIPPPAIMKPYYLWTGKQVFSLLIRPNKLSSVVI
                     NLDAKNKVFIPPKNKSYPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTIL
                     RDYGPQEAAHAMNRMAKLCARYLGNRGFSIGISDVTPADDLKRKKEDMVEYAYAKCDE
                     LIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRELDNLNAPLIMATCG
                     SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL
                     TPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQF
                     TYGGDGLDPMEMEGNAQPVNFVRSWNHAFNITFNNTDKGLLPYQIMSETDKILGPLQD
                     RLIRYDNVGKVVPKEENALVEYIDQNDAERNFYLSLRKFMLSKAELLASVRKQRGMKE
                     LLDEPGEEFKSMDLDEHVPESTRYSVDQLCRITGRAVSEFLKIAILKYRRAKVEPGTA
                     VGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV
                     NDNDERAARVVKGRIEKTLLSDVAFYIQDVYHDNLSFIQVRVDLSTIDKLQLELTIED
                     IAVAITRAPKLKIQASDVSILGKDKIAINVFPEGYKAKSISTSAKEPSENDVFFRMQH
                     LRRALPDIVVKGLPDISRAVINVRDDSKRELLVEGYGLRDVMATDGVVGHKTVTNHVL
                     EVMSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSK
                     MRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVIKATEI
                     DDGDLKPKPTLFENLVQAVSVKAN"
     gene            <174866..>175159
                     /locus_tag="HG536_0E00930"
                     /db_xref="GeneID:59326378"
     mRNA            <174866..>175159
                     /locus_tag="HG536_0E00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283960.1"
                     /db_xref="GeneID:59326378"
     CDS             174866..175159
                     /locus_tag="HG536_0E00930"
                     /inference="similar to AA sequence:RefSeq:NP_010651.3"
                     /note="ancestral locus Anc_5.427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139856.1"
                     /db_xref="GeneID:59326378"
                     /translation="MSGSGKAAQKSNGADAGAVEDLKKVHKQSLEEDDEFEDFPVDTW
                     PIDESLRSATNGQTNLWQEDWDDVEVDDDFTKELRAELERNKEQQQQPQAQQR"
     gene            <175454..>176758
                     /locus_tag="HG536_0E00940"
                     /db_xref="GeneID:59326379"
     mRNA            <175454..>176758
                     /locus_tag="HG536_0E00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283961.1"
                     /db_xref="GeneID:59326379"
     CDS             175454..176758
                     /locus_tag="HG536_0E00940"
                     /inference="similar to AA sequence:RefSeq:NP_014760.3"
                     /note="ancestral locus Anc_5.428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139857.1"
                     /db_xref="GeneID:59326379"
                     /translation="MATLEELDAQQLPGDDEVDQEILNLPTHELQTRTKLLDNEIRIF
                     RSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANIVEIMDMDALGDKENSEAVTQ
                     SGNLNLDNTAEGKAAVVKTSSRQTVFLPMVGLVDPDTLKPNDLVGVNKDSYLILETLP
                     SEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIKAPKGA
                     LMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMFIGEGAKLVRDAFALAKEKAPA
                     IIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFGSDDRVKVLAATNRVDVLD
                     PALLRSGRLDRKIEFPLPTEDARAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLK
                     AVSVEAGMIALRNGQSSVKHEDFVDAIGEVQARKSKSVSFYA"
     gene            complement(<176793..>178139)
                     /locus_tag="HG536_0E00950"
                     /db_xref="GeneID:59326380"
     mRNA            complement(<176793..>178139)
                     /locus_tag="HG536_0E00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283962.1"
                     /db_xref="GeneID:59326380"
     CDS             complement(176793..178139)
                     /locus_tag="HG536_0E00950"
                     /inference="similar to AA sequence:RefSeq:NP_010652.3"
                     /note="ancestral locus Anc_5.429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139858.1"
                     /db_xref="GeneID:59326380"
                     /translation="MALVAGYNSSSESETEEVKASGDALAGGNGGAELEANNDTKRSS
                     SFTLKAVKRRRLARQGKGPWARWSDSDTDNSDQELHEEAEHLDEFQETTEINEINTSF
                     TETSTFYGESEKDYLNRGFLHPPVDVDIDLRKEPLSFKCYLPKKTIHVYKGHLNGTGV
                     LKYLPKTGHLFLSGGNDNMLRIWDSYHDRQCLRDYRGHSKPIKAIDFAHDGTSFLSAA
                     FDQSVKLWNTETGKVTTRIQLKSTPNDVRFHPTQSDVFIVGLSNSKINQYDLRVSAKE
                     GLVQIYDHHLSGILSLKYFPDGSKFISSSEDKTVRIWENQINIPVKQISDTTQHSMPF
                     INIHPQHKYFCTQSMDNAIYTYGMQPKYKKNAKKVFKGHHSAGYGVGFTFSPDGHYIC
                     SGDSKSKVLIWDWTTTRLLKTININGDKPVTQIAWNPQETSKIICSGGAGKIYLLD"
     gene            complement(<178333..>180183)
                     /locus_tag="HG536_0E00960"
                     /db_xref="GeneID:59326381"
     mRNA            complement(<178333..>180183)
                     /locus_tag="HG536_0E00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283963.1"
                     /db_xref="GeneID:59326381"
     CDS             complement(178333..180183)
                     /locus_tag="HG536_0E00960"
                     /inference="similar to AA sequence:RefSeq:NP_010653.1"
                     /note="ancestral locus Anc_5.430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139859.1"
                     /db_xref="GeneID:59326381"
                     /translation="MSGKESADPRFAKIYNDPKFKNVRKKGFKVKLDDRFSKKDLEVK
                     RKTKVDRYGRKIRDQDDKELKDFDKYFEKSDEEAEKVKEKVTSIDRARGEVPSDYVSS
                     SEDFTSSESEVSSEEELESEEESEVKLEKTEPSSGEPSKKLAVVNLDWDNVRSADLMI
                     TFSSFLPPDGKITEIAIYPSEFGKERMQREEVEGPPKELFKKSKKKSKKREDDDSDSD
                     VDIKDLYEEGDADKNVDNKALRQYQLDRLRYYYAIVSCNSVKAAESIYKNCDGTEYES
                     TANIFDLRYVPDGMEFDENPRDVCSELPKNYKPLQFSTDALQHSNVKLTWDETPADRL
                     DVAKRAFTQKEIEDMDFKAYLASDSDGSEDDLGVESKDKLRSLVNGASAFDFSKQDAK
                     IGIEDDSEVDMEITFTPGLDEKGDAAPKEDQEESTIDKIRRKEKERRKARKARVKELK
                     QQAETEKKAKLKSLKQKTDQNEEQDSKLKAELELLMMEDEEDNHSSLNKKAHFNMNEI
                     LKSEKEKKKKNKYQDRKKIVEDDFKPDLQDSRFKEVFEGHDFAIDPSQPEYRDTKAMK
                     EILAERSKRSRKNKSRKRRPSVQAGDADEKSDIAGIVAKLKKTGSKKIKS"
     gene            <180821..>182527
                     /locus_tag="HG536_0E00970"
                     /db_xref="GeneID:59326382"
     mRNA            <180821..>182527
                     /locus_tag="HG536_0E00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283964.1"
                     /db_xref="GeneID:59326382"
     CDS             180821..182527
                     /locus_tag="HG536_0E00970"
                     /inference="similar to AA sequence:RefSeq:NP_014761.1"
                     /note="ancestral locus Anc_5.431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139860.1"
                     /db_xref="GeneID:59326382"
                     /translation="MGQQTSVPQGDQNEADNKGKRFASSVDLMQYFNKRAIGFFSVAE
                     IAAFKSRFDGRKLSATIKSADLAEWLHIPGDSVLLCQMIYEFVRVLSNFPLMKDAFEE
                     VTGVGLLKAILLSDPVRCHKYVGVKNYDYLKLLFIAFSTRKSVKEELSSGSSTSLEEG
                     EDLKKLIRNYNGIAVDELVLDAKLLLQLLTWLLLLTSHCPTGNCEFPDETAYNDWSSY
                     KQAATCLLRAMNPEIISVSDLQSVTFEQFSSSIKAIMPNIFRPLQKLMEHLLYRDEDL
                     VACLLDTGNLRNRSKLMTQPVLAQLFVSLPDKLSVSNLQKLYVGSESGFSMRSLQAKV
                     FKWMAPTLLLVSGKSILDDEEFSKSNPRYRKFLSEFPKLKEGTPNPFDLRSNKTKVTF
                     AIYVPDPWRVTNKDFFGGLGTTIVQLAPIQDVFKAVKDGTMYFNTMGGGIGIGDNQPQ
                     IKASSKSYSVGNVSLTIDNTLEFAAFRQTGYGGIFSPSSRLKEIHKENRPFEVRFLIQ
                     HVEVWGCGGEKELEEQYKKWQWEEAEAKRRQQINLRSIGEDRALLEMAGIIGHAQSGG
                     SI"
     gene            complement(<182586..>184040)
                     /locus_tag="HG536_0E00980"
                     /db_xref="GeneID:59326383"
     mRNA            complement(<182586..>184040)
                     /locus_tag="HG536_0E00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283965.1"
                     /db_xref="GeneID:59326383"
     CDS             complement(182586..184040)
                     /locus_tag="HG536_0E00980"
                     /inference="similar to AA sequence:RefSeq:NP_014762.3"
                     /note="ancestral locus Anc_5.432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139861.1"
                     /db_xref="GeneID:59326383"
                     /translation="MSLEDDFDRLHVSSQSRQHTDIQLLDRHSHNINTDELSFTRAKT
                     SKDKANRATVENVLDPRTMRFLKSLMNRGVISDFNGCLSTGKEANVYHAFAGYGEAGS
                     PDDQEAGHEKRELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE
                     FRNLRRIHQSGVIPTPEPVEVKNNVLVMEFLSRGDGFASPRLKDYVFADRSEIYHFYY
                     VMLAYIRLLYQVCRLVHADLSEYNAIIHMGKLYIIDVSQSVEPEHPMSLDFLRMDIKN
                     INSYFEKLGISIFPERLIFQFVISERLDKFDGNYRSYYDLSDYVSKHLPIKSSAKDAD
                     EDEIFRSLHLVRSLEGLEERDFDRFTDGKFDLLKSLIAHDNERNFSAVKDVSGSNEAS
                     EASESETDSGNDEDSEAEDELASSGNESDGSDEDDDEDNKYLNKKPKGKKFEDKEEKK
                     KRKQEAKESKKEKRQTKVKKHVKKKLIKKTKSKK"
     gene            <184187..>184900
                     /locus_tag="HG536_0E00990"
                     /db_xref="GeneID:59326384"
     mRNA            join(<184187..184216,184277..>184900)
                     /locus_tag="HG536_0E00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283966.1"
                     /db_xref="GeneID:59326384"
     CDS             join(184187..184216,184277..184900)
                     /locus_tag="HG536_0E00990"
                     /inference="similar to AA sequence:RefSeq:NP_010655.1"
                     /note="ancestral locus Anc_5.433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139862.1"
                     /db_xref="GeneID:59326384"
                     /translation="MNPKQFRLPKSFFGFLPLYLGVEIALGISILNKCSGAYGILALF
                     TGHPLHFSQWLLYIWSIITLIICAQGLYQVHKPSVLTFSHIFVTFVIDTAVTCLFSVW
                     FTAQWYSLEGNSGSTDKTKSSYSEDPVDYSTKISDQGASESFEYGVTIFITVLSLAAK
                     LYFTFLMASFVQELLLHPRYMLDQDDVEQDLKNQSSWKRWWVKSQKICYNISKSMLV"
     gene            <185433..>186368
                     /locus_tag="HG536_0E01000"
                     /db_xref="GeneID:59326385"
     mRNA            <185433..>186368
                     /locus_tag="HG536_0E01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283967.1"
                     /db_xref="GeneID:59326385"
     CDS             185433..186368
                     /locus_tag="HG536_0E01000"
                     /inference="similar to AA sequence:RefSeq:NP_010656.1"
                     /note="ancestral locus Anc_5.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139863.1"
                     /db_xref="GeneID:59326385"
                     /translation="MSTAVSKNTSTIKLNTGYTIPQVGLGTWRSKENEGYKAVLTALQ
                     AGYRHIDDAAIYLNEEEVGRAIKDSGVPREEIFLTTKLWNTQQRTPEEALNQSLKRLG
                     VDYVDLYLMHWPVPFRTETIKDGNYLTIPKKADGRPDVDEEWNFVKTWELMQELPKTG
                     KVRSVGVSNFSINNLKELLSSPGNKLTPAVNQIELHPLLPEFALVDFCKEHGIVVEAY
                     SPFGGQDAPVLDDNIINQIAKDHGADAGQVIVSWGVQRGIVTLPKSVTPARVVSNLQT
                     FKLSDDEFRSISQLTNSKKPKRTNAPDMSPFPLFE"
     gene            complement(<186416..>188743)
                     /locus_tag="HG536_0E01010"
                     /db_xref="GeneID:59326386"
     mRNA            complement(<186416..>188743)
                     /locus_tag="HG536_0E01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283968.1"
                     /db_xref="GeneID:59326386"
     CDS             complement(186416..188743)
                     /locus_tag="HG536_0E01010"
                     /inference="similar to AA sequence:RefSeq:NP_010657.3"
                     /note="ancestral locus Anc_5.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139864.1"
                     /db_xref="GeneID:59326386"
                     /translation="MWILRYKYDLDDGTIRNVSRCLQSGQTYTIGRSSKSLLNIKNDK
                     SISRNHVSLSWNKENGRITLSNQGKLTAAGGKYLKVGEDMIFQESLFRDKNVVIELGT
                     KPITVDISWKDAIWDIPQSFSGFTEELGQFGIEAQVGKADVRSTAVVVAENEAHRSLF
                     GLVHNIPLKTAQFLCSAKDVLSSSDATFDESWSKLDRNERTMVVPSGRTLEQVFSGLK
                     FYMIERNEQVTKYTQKAITRGGGELVCVGALKELLGLLKLEDSTQNLVVIQSPESAVQ
                     VAQAGIIAFTLDDIVSKVQDNATAKLLGGVPNFSLAAPILEGSPEVSSGDKLGLASQA
                     RQTSEEPNQDVEKRPRKKRRLNRRAVKPLDSLMFFAGGDSFKSEALSDTSMPSLEKKA
                     PSPKDNLAHAGPTASLGAASALETKEQPTFANESYENQVHHSALREPTQPISPSVNTP
                     VPVENFDERTRDREIDEVKISQEQNYPIYDDGVVMKKQPTRQRTLRDTSLSENDSRRA
                     ATPKEDLVEVINDTKNREVKRLNSTLIQVSTDELTEDAINQLGNLAIIRPNENLMRER
                     EHDNSEQTAEHNTPWHGRKNFKNFFKIQPKYKKDHFSDKYREGSSDFIRRSAFSLIKE
                     YVPLKPYSRELPKRVEDFPPIAKERSVSGTALDRARDHSPEQASSTHYSNGSTPVQEL
                     FVVDEDDSQSAHLTVPGEQTLQAEESETADVLPSRQTSGLMQTRKRKTTTRRSPARFS
                     NIENEDSGDDDDDDDDDDDDADEPKFKFRRRMRYS"
     gene            complement(<188980..>190422)
                     /locus_tag="HG536_0E01020"
                     /db_xref="GeneID:59326387"
     mRNA            complement(<188980..>190422)
                     /locus_tag="HG536_0E01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283969.1"
                     /db_xref="GeneID:59326387"
     CDS             complement(188980..190422)
                     /locus_tag="HG536_0E01020"
                     /note="ancestral locus Anc_5.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139865.1"
                     /db_xref="GeneID:59326387"
                     /translation="MLDQKLAKKLEESRLEGSGTKPLYISKISIDGDNINSPLSNSSY
                     KAILDQALTQPLQNVGSSLYTFGDIRRKLLCTGLYQDVKITLESDPDISSQDYLRERV
                     PSELGIELPLATHAKILLTPSAVYNSTAGTTSLFDDEASMAISRSCMNLFGRGDSEYV
                     HMGLNYDPETSKWEGKSLKGLLSVPLTKNPSVRANLNLDAVKMDMTSKPYLSPEDGHE
                     LYQYSLSAGLQKRWILEQVTSVPTLYAGISSSNRCISGLGDKASETFAKHSGNFNKIA
                     VEMKFHNDTRKYFGAFPISGYELQIQNDYIISQSNAVHQSLPPERNFSKFHFSLQHHS
                     SHWQNKLTKSLDIQLGALIPFGNEKDGIHPLDKWYLGGLGSLKGFQSNSVGLRGSNFY
                     YKLCLTSSQKLIRTPLDSPLRLQFFMNLGNTFNDLRSARSSCAAATGVSLAYKTPQAD
                     VDFTYALPLTSRLQDISKPGLSFGVTFSYF"
     gene            <191870..>192982
                     /locus_tag="HG536_0E01030"
                     /db_xref="GeneID:59326388"
     mRNA            <191870..>192982
                     /locus_tag="HG536_0E01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283970.1"
                     /db_xref="GeneID:59326388"
     CDS             191870..192982
                     /locus_tag="HG536_0E01030"
                     /inference="similar to AA sequence:RefSeq:NP_011555.3"
                     /note="ancestral locus Anc_4.186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139866.1"
                     /db_xref="GeneID:59326388"
                     /translation="MSLSEADNTEETSSTSFGDSDESQDVRGILQSYFLENFGGAQNV
                     PPRIPEMLAERDVRRVSRDVSVSTVSTALLLEQSSGSADNDYVTANEVEPTVEQGVRF
                     LRREPAGNAQVSYVRTSFDGGAEAREYRLPRKVSQPLLEPEVAGRPKAPHSPSLLNNI
                     LMPSPLDQSARTIPALRAVSGSYQVQQRTWEARRQSVASVVKPQGTVLAAPERARIAR
                     LTDSQMDLTLSTLQEYQKDVEATAGRGTYTQSSGISVQHIDSSSIQSFDSQDHKFSDI
                     YSIARITALIGICLIVPPLFFMIASGERGGGVSNYRLMRLIMNSKHRVGMMKGFVWDV
                     DVGWFRYLCLSLGIFETLGILASIGSGIAIGRRRET"
     gene            <193038..>193580
                     /locus_tag="HG536_0E01040"
                     /db_xref="GeneID:59326389"
     mRNA            <193038..>193580
                     /locus_tag="HG536_0E01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283971.1"
                     /db_xref="GeneID:59326389"
     CDS             193038..193580
                     /locus_tag="HG536_0E01040"
                     /inference="similar to AA sequence:RefSeq:NP_011556.1"
                     /note="ancestral locus Anc_4.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139867.1"
                     /db_xref="GeneID:59326389"
                     /translation="MQAVEFTCQYSDQVRKKHKTWHDGRLKLIQSAKRLMLYSGEDKK
                     LLCSTIMTSERELQRILEPEDFGATEHHIFGRYVVIICERVGEHEEPTERKATEPPVM
                     AKRPLAKVPSRKLLKSPVASHGDHPLALKMNTPFKPPRSTAKANRPSIRQRAVREEQR
                     PAGTKARARIRRVKHLPIML"
     gene            complement(<193629..>194630)
                     /locus_tag="HG536_0E01050"
                     /db_xref="GeneID:59326390"
     mRNA            complement(<193629..>194630)
                     /locus_tag="HG536_0E01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283972.1"
                     /db_xref="GeneID:59326390"
     CDS             complement(193629..194630)
                     /locus_tag="HG536_0E01050"
                     /inference="similar to AA sequence:RefSeq:NP_011557.1"
                     /note="ancestral locus Anc_4.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139868.1"
                     /db_xref="GeneID:59326390"
                     /translation="MAQPAQKKQKLSSLDQLKASGTVVVADTGDFESIAKFTPQDSTT
                     NPSLILAAAKKEGYAKLIDVAVAYGKEHGKTTEEKVENAVDRLLVEFGKEILKIVPGR
                     VSTEVDARLSFDKEATVKKALHIIDLYKSVGIDKERVLIKIASTWEGIQAAQELEKEH
                     GIHVNLTLLFSFPQAVAAAEANVTLISPFVGRIMDFFKAKTGKTYSGEEDPGVKSVRR
                     IYNYYKKHGYKTIVMGASFRNTAEIRALAGVDFLTISPNLLDELYNSTEAVPKVLDPE
                     SAKEQGEDKVSFINNESAFRFELNEDDMATEKLADGIRKFSADIVTLFDLIEKKIVA"
     gene            complement(<196367..>197335)
                     /locus_tag="HG536_0E01060"
                     /db_xref="GeneID:59326391"
     mRNA            complement(<196367..>197335)
                     /locus_tag="HG536_0E01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283973.1"
                     /db_xref="GeneID:59326391"
     CDS             complement(196367..197335)
                     /locus_tag="HG536_0E01060"
                     /inference="similar to AA sequence:RefSeq:NP_011558.1"
                     /note="ancestral locus Anc_4.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139869.1"
                     /db_xref="GeneID:59326391"
                     /translation="MPQSLADDYIEHIYVMGASPAPSLQEVLKFQDPSSALRQLQEIL
                     EGTYKARAGSGLDGFVSGRDYTFTARCEAGGADAQLDLLEAQLEIGDPQYRLDGLLEL
                     PGEWAGSELGPSSPRFLQAQDEVEEEEEDERASRSLPTPGASLVEQLQMDQPLMQVIA
                     NKHKRGYYRCTHCPQTFSNIFDYAAHMDEFDIKREFKCPFALCPWKILGLPRRPDLRR
                     HCAIQHKHELPDDLKQTLNLNDETYPALKCPHQYCDKVFHRRDAYNRHISIVHEKLGS
                     RFNKRLFQILAECPYDKETDRHAFVKSRMRSRKTNCNNRKTTTPQQ"
     gene            complement(<197824..>198639)
                     /locus_tag="HG536_0E01070"
                     /db_xref="GeneID:59326392"
     mRNA            complement(<197824..>198639)
                     /locus_tag="HG536_0E01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283974.1"
                     /db_xref="GeneID:59326392"
     CDS             complement(197824..198639)
                     /locus_tag="HG536_0E01070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139870.1"
                     /db_xref="GeneID:59326392"
                     /translation="MILALFFFRAAIGHHTCGVALRQSPHPLDKSFRERQHRRPPPTS
                     PATPMNTPIRPQVYLGSRAPNFTAASSQGPIDFYDYVGDSWCLFFSHPGDFTPICTTE
                     IGAFAALHDEFKLRNCKLLGLSTNSRETHIRWIKDIQQVTGFNVEFPIVCDQDRKIST
                     MYGMIDLRNFDDKGRPVPIRSVYLIDNRKEVRLLHAYPLSTGRNTAEILRCLDSLQVV
                     DKHDRNVLTPVNWVPGDDVVVSPELSPASARSVFPHHRSVRSYLRLTPLDPDI"
     gene            complement(<198823..>200010)
                     /locus_tag="HG536_0E01080"
                     /db_xref="GeneID:59326393"
     mRNA            complement(<198823..>200010)
                     /locus_tag="HG536_0E01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283975.1"
                     /db_xref="GeneID:59326393"
     CDS             complement(198823..200010)
                     /locus_tag="HG536_0E01080"
                     /inference="similar to AA sequence:RefSeq:NP_013459.1"
                     /note="ancestral locus Anc_4.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139871.1"
                     /db_xref="GeneID:59326393"
                     /translation="MLRAQAARLICNSRVVTAKRTFALAARAAAYKPAAKQFVKPLVA
                     TRGLKQINFGGTVETVYERADWPKEKLLNYFKNDTFALIGYGSQGYGQGLNLRDNGLN
                     VIIGVRKDGASWKAAVEDGWVPGENLFEVEEAVKKGTYVMNLLSDAAQSETWPTLKPL
                     ITEGKTLYFSHGFSPVFKNLTHVEPPSNVDVILVAPKGSGRTVRSLFKEGRGINSSYA
                     VWNDVTGSAHEKAQALAVAIGSGYVYQTTFEKEVNSDLYGERGCLMGGIHGMFLAQYE
                     VLRENGHSPSESFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYPIFKNA
                     LKPVFQDLYESTKNGSETKRSLEFNSQPDYRAKLESELETIRNMEIWRVGKEVRKLRP
                     ENN"
     gene            <200482..>201087
                     /locus_tag="HG536_0E01090"
                     /db_xref="GeneID:59326394"
     mRNA            <200482..>201087
                     /locus_tag="HG536_0E01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283976.1"
                     /db_xref="GeneID:59326394"
     CDS             200482..201087
                     /locus_tag="HG536_0E01090"
                     /inference="similar to AA sequence:RefSeq:NP_011563.1"
                     /note="ancestral locus Anc_4.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139872.1"
                     /db_xref="GeneID:59326394"
                     /translation="MSVCLAVTKSIAVSSLGIYAGMLTTTTLVSYITPLKVITQHLSP
                     VICKLGEVASVLATLSTGFFAASYFGAPPHLRHPYLLYGALVAPVSALYLWAISRCNH
                     KYYSKRGCRRGGDAEDASSAPQLNDSVVDLGKDAPAGHPAISENSSAKCPFAPASKEC
                     HCHRPPRCQAKIVAHLTLISAATVAGFVASVVGVYGEGQFA"
     gene            <201566..>202486
                     /locus_tag="HG536_0E01100"
                     /db_xref="GeneID:59326395"
     mRNA            <201566..>202486
                     /locus_tag="HG536_0E01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283977.1"
                     /db_xref="GeneID:59326395"
     CDS             201566..202486
                     /locus_tag="HG536_0E01100"
                     /inference="similar to AA sequence:RefSeq:NP_011566.1"
                     /note="ancestral locus Anc_4.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139873.1"
                     /db_xref="GeneID:59326395"
                     /translation="MYVIIEPIQSGTFSTVYRAWDRRGQRYVALKVIPAEYYRDEIET
                     MRVLRHRNICPMLDFYGDETNCILVLEYCSLGDLCDFIELSRGRGYSAIDVRQMARQI
                     RSALCYAHSLGIAHRDIKPENILLTADGNVKLADWGHAVQGQWSSDTDVGTDAYRSPE
                     TFFGKRYDNFKADYWSFGLTLLYALFGKTPFNCPRNCDGTVDPYPNCCENFASFVQDP
                     HQFMYQFYIKPFVESPDASFTGGSDTLPISEIIHICSAVVENLVNIDARKRNLDEFIR
                     VMERSSSQSTGCAFQSESSIRLPPFLRLKS"
     gene            complement(<202508..>203335)
                     /locus_tag="HG536_0E01110"
                     /db_xref="GeneID:59326396"
     mRNA            complement(<202508..>203335)
                     /locus_tag="HG536_0E01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283978.1"
                     /db_xref="GeneID:59326396"
     CDS             complement(202508..203335)
                     /locus_tag="HG536_0E01110"
                     /inference="similar to AA sequence:RefSeq:NP_011567.3"
                     /note="ancestral locus Anc_4.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139874.1"
                     /db_xref="GeneID:59326396"
                     /translation="MVAILQSDGPLNTFLVYTKKYLSSTHGWKEARSVDGRRTSNMSF
                     RASAALSNCWQGSVRCYSARHSNLGQITEYLLKEGVPNLLQTSFEDRYLDEQIRLRFL
                     PTTHPYFPVLQGKTKYKASLNAIRVISNKLILSKDCKLHVNSVTTLLRDNKTHRYNCV
                     TGNDKLVVKWQSCTPQETFQHRGTQGKVSSVPQNLLAETAPPVVKYILHPTGKPLSKE
                     MISNEEPLVAESDLINRVVKGIFVFEFNEDNSKISVHTFEDVEMIDFKKIETGALAC"
     gene            <203951..>205909
                     /locus_tag="HG536_0E01120"
                     /db_xref="GeneID:59326397"
     mRNA            <203951..>205909
                     /locus_tag="HG536_0E01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283979.1"
                     /db_xref="GeneID:59326397"
     CDS             203951..205909
                     /locus_tag="HG536_0E01120"
                     /inference="similar to AA sequence:RefSeq:NP_011568.3"
                     /note="ancestral locus Anc_4.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139875.1"
                     /db_xref="GeneID:59326397"
                     /translation="MASQFFLKTSQDIELFQGYPDFTQSATNPDGSSVTSSLLSPCGR
                     FMALATTESVKVFSGELFDKLLVSLSISNVYNLHFSPSGSYLSSWERPSAQDESHQNV
                     KVWYLNQDFASQSDEHKPVYEYQARTQNGWSLQFSKLDNYAFKQFSTELKIVKLDQTA
                     EEEKKFDFDHPYATLSQSQESEAQMFSTFLVSPAEHPTICTFTPEKSGKPAHLTIWPL
                     VEGQITKKIVTKSFFKADSCQLQWNALGNAVLCVATTDFDSSNKSYYGENTLYLLSFQ
                     GVNGALGGNSVRVPLSKEGPIHDFTWSPTSRQFGVIYGYMPATITFFDLRGNVVHSLA
                     EQAKNTMLFSPSGRYILIAGFGNLQGAVQILDRHDKFSCISNFDAANTSVCKWSPGGE
                     FIMTATTSPRLRVDNGVKIWHVTGKMVFVKEFKELLKIDWRPSSKYKTLGNTHVIKNW
                     HEISDSTAPTDPKIHNASQLQIHPTVTEYELKHPRRNGNSGSGAQSKPVGAYRPPHAR
                     RAGGSSVPGMNIVNAKPTQRSVPGMVPGMAPPKSSKAAAKNKKKRANKKKGDGEENND
                     DHESKAGSPAPSASPAGDSPVVKEVASPEEKKIRSLLKKLRAIETLKQRQANGDKLED
                     TQVLKIQTEEKVLNELKFMGWKEDVAEN"
     gene            complement(<206129..>207835)
                     /locus_tag="HG536_0E01130"
                     /db_xref="GeneID:59326398"
     mRNA            complement(<206129..>207835)
                     /locus_tag="HG536_0E01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283980.1"
                     /db_xref="GeneID:59326398"
     CDS             complement(206129..207835)
                     /locus_tag="HG536_0E01130"
                     /inference="similar to AA sequence:RefSeq:NP_011569.1"
                     /note="ancestral locus Anc_4.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139876.1"
                     /db_xref="GeneID:59326398"
                     /translation="MAGKGRSFVSQLNIFNKQNYVFSKESSVENGSSEDVEDHFVTEL
                     DRGKKELGLFSCICLICNRMLGTGVFATSSTIYTLCNSTGLALVMWAVGAIISLAGLF
                     VYMEFGTAIPKNGGEKNYLEFIYKKPKFLVTSMYASYIFFLGWAAGNSVNTAVMFLTA
                     ANAEITEWNQRGIAVAVVGFAFLINGVNVKAGIYLQNLLGVFKIGIVLFISVTGWVAL
                     GGGLKKDYNLHNAFEGADQATAYGVVNALYNVIWSFVGYSNVNYALGEVKNPVRTLKV
                     AGPTALVAIAIIYIFVNMAYYAVVPKEKLISSKLILAADFFDIVFGGQAKRAAAVFVG
                     LSALGNVLSVIFSQGRIIQQLGREGILPFPSFFASSKPFNSPFVGLLQHFIVCVVTII
                     APPPGDAYNFILNLISYPMNIINFCVSTGLLYIYWKRRRGELEWDPPIKAGYFITIFF
                     SLANLYLIVAPYVPPVGNQSVYEHLPYWIHCVVAWGIFGFGGCYYLVTSQILPRLGHY
                     QLMTREVLGDDGFWRNEVIKVYADASLSEESVYENDQPVYGESSKGESKKYSSNQTFD
                     DC"
     gene            complement(<208254..>209351)
                     /locus_tag="HG536_0E01140"
                     /db_xref="GeneID:59326399"
     mRNA            complement(<208254..>209351)
                     /locus_tag="HG536_0E01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283981.1"
                     /db_xref="GeneID:59326399"
     CDS             complement(208254..209351)
                     /locus_tag="HG536_0E01140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139877.1"
                     /db_xref="GeneID:59326399"
                     /translation="MSQGEASTAQSGSSPANESDTRHLKSFHRYLKKARKVLCIVGAG
                     LSQSSGIPTYQLQRGSWKGYTSLDLATPEAFDANPGLVWLFYSNRRYIAMRAKPNRGH
                     YALAELAKRMRERRRSVLVVTQNVDGLQRRAGQAEQDLCELHGSLFDLRCTSFFCTYK
                     GSNTRDLFLTPKLREFTPRDVGVKRKRAAELERSAKRARRGPAGPSGATASQASEPEE
                     TASSSDFDPLPHLDQEDLPHCPKCKTGLLRPGVVWFGEPLPLLQMDKVDAFFVQGNDD
                     STTPIDLVLVIGTSGKVWPAMGYVERCKQNGGRVAVFNTKIDDLDLVNRDNASWAFQG
                     EASYWLPRALEPIIGKIYGPSSRRHYGTALP"
     gene            <209596..>212250
                     /locus_tag="HG536_0E01150"
                     /db_xref="GeneID:59326400"
     mRNA            <209596..>212250
                     /locus_tag="HG536_0E01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283982.1"
                     /db_xref="GeneID:59326400"
     CDS             209596..212250
                     /locus_tag="HG536_0E01150"
                     /inference="similar to AA sequence:RefSeq:NP_011570.1"
                     /note="ancestral locus Anc_4.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139878.1"
                     /db_xref="GeneID:59326400"
                     /translation="MSEEGNSLQSRLRAEYEALFTLKEENGLEIYPIFNVLPVKKEYP
                     DYYALIKNPVSLNTLKKRVPHYTDPQSFVNDVVQIPWNAKTYNTKESAIYRYAGILEK
                     YVKEHLVPNLQKFYPQVEYPYLGPLPDEIEAHRKLHPGGTLPAPRNTVTIKTRRNRER
                     DASVGPGEAEEEEEDEEYNVEEEDDEEYTEGRRLPHLKLTLHRGMHQAHSPPSQHRSH
                     SSTPKPYGRHQQQRTHMRRGRPPVIDLPYVQRIKNVLKMLKKEIDDENEPLTATFEKL
                     PDEMRDAKYYTMISNPICLEEIRKKVKTRKYKDFQAFQNDFTLMLTNYRLYHRAEPHY
                     MKRAAVLEKKFNVFARHELSKPDRDYMPEGELRYPMDELNLNGKNYKIGDWVLLENPN
                     DATKPTVAQIFRLWSTSDGRRWLNGCWYLRPEQTVHRVDRLFYKNEVVKSGQYRDHLV
                     EEIVGKCYVIHFTRFQRGDPDIKLEGPLFVCEFRYNENEKIFNKIRTWKACLPEEIRD
                     QEEVTIPVNGRKFLKYPSPLKHLLPPNASYNDPIPQPTEGAVNAPPLIGAVYLRPKLE
                     RDDLGEYSTSDDCPRYIIRPGDPPEEGKIDFETSTILTNTTTATALPKTSQSNSRLAS
                     LKHNRSGTGLSGMRNGLYSSPIGSAAALANASQGSRLGTPNGLGPGQQLTVQGLKQHQ
                     LNKQQLHLQQQQQHKRSQASGYNLATVVNNLAAQASKTSLGYISIDAPSSFVLPISIT
                     KNVDVLQREDYDSQVRRLGKDQVPRRKRHKGEVLWFRGPSVAIEERLLNSGDKRLQPP
                     LNRWFSKNVNKKPKPKLDYEEIEELVDTNEIDMEEDDDSEDSEYDITLDQEDEALPDS
                     FPLGLRPSARFMAFKLAARDKSAETESI"
     gene            <212397..>213845
                     /locus_tag="HG536_0E01160"
                     /db_xref="GeneID:59326401"
     mRNA            <212397..>213845
                     /locus_tag="HG536_0E01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283983.1"
                     /db_xref="GeneID:59326401"
     CDS             212397..213845
                     /locus_tag="HG536_0E01160"
                     /inference="similar to AA sequence:RefSeq:NP_013463.1"
                     /note="ancestral locus Anc_4.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139879.1"
                     /db_xref="GeneID:59326401"
                     /translation="MSEFDKYTTPLSSRYASKEMSEIFSLRNRFSTWRKLWLNLAIAE
                     KELGLSVITDKAIEEMREHLAITDEEIAQASAQEAIVRHDVMAHVHTFGQTCPEASGI
                     IHLGATSCFVTDNADLIFLRDAYDLIIPKLVNVINRLSDFALKYKDLPVLGWTHFQPA
                     QLTTLGKRATLWIQELLWDLRNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEA
                     LDKRVTELLGFDVVYPVTGQTYSRKIDIDVLSPLSSFAATAHKMATDIRLLANLKEME
                     EPFEKSQIGSSAMAYKRNPMRCERVCSLARHLGSLFNDAVQTASVQWFERTLDDSAIR
                     RISLPSAFLTADILLSTLLNISSGLVVYPKVIERRIKSELPFMATENIIMAMVEKGAS
                     RQEVHENIRVLSHQAAAVVKEQGGDNDLIERIKNDAFFAPIHSELDSLLEPSTFVGRA
                     PQQTEKFIKNDVKNALQPFEKYINDADVKLNV"
     gene            complement(<213896..>214612)
                     /locus_tag="HG536_0E01170"
                     /db_xref="GeneID:59326402"
     mRNA            complement(<213896..>214612)
                     /locus_tag="HG536_0E01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283984.1"
                     /db_xref="GeneID:59326402"
     CDS             complement(213896..214612)
                     /locus_tag="HG536_0E01170"
                     /inference="similar to AA sequence:RefSeq:NP_011571.4"
                     /note="ancestral locus Anc_4.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139880.1"
                     /db_xref="GeneID:59326402"
                     /translation="MASMLISLAHFCDKHGPRILMVTQAGSPGSTGDELLVPNYPTDS
                     YCESCSMYFPGDLHGGVRSMKSNIANRCYVSTQYSSVRYQLLTLIIRRCFSEETMTYD
                     GTPVVFYDDLRGLNLMVGFKLNDENARGNERRYCMIFTIDSKDHKTSMRRISENWNFI
                     TGGFGRMISYIAEAHERELRRQNTLRDEQCSFSLLGGSYLRGNKVKIPRRLSDLTDDK
                     LLFVRMHRWNSFLLDSCLRN"
     gene            <214785..>216107
                     /locus_tag="HG536_0E01180"
                     /db_xref="GeneID:59326403"
     mRNA            <214785..>216107
                     /locus_tag="HG536_0E01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283985.1"
                     /db_xref="GeneID:59326403"
     CDS             214785..216107
                     /locus_tag="HG536_0E01180"
                     /inference="similar to AA sequence:RefSeq:NP_013464.3"
                     /note="ancestral locus Anc_4.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139881.1"
                     /db_xref="GeneID:59326403"
                     /translation="MPSYLLRRRLRHVRSIGINNVSAAIETKSEKVVVPFPACFLALQ
                     SMKGEVLYVSEVQRGFINTVQFNELPRLEHSISHIMLRIMVKVPEQCGLASAMKRDSW
                     LVLREFEVDFNKLQSIDLEDQLEGHNVPLFEMNDGVYTLQCQPVVKATANDDAYLRHR
                     RNASRNQVQESFSYNSALKLNIMVSYKAQVLREIQETSKKLENAIDSNGKHSRWQIDC
                     VKRHLADLRQSFTTKNAYLRQLDEELKSSIDQYHKTSTPSPDGQSLQEYYGNNYPNLI
                     KIKDRVDSLKLKKLSRLISIFQTTCLFQKEIGFIEHESACMAGAPYERTKLKLVDQER
                     VLAIALRSDAERNIINTCLGYYLLFIQLTATTVFQIALPYRMKFNGSTSMVGNGCLYF
                     NDNSSAKRSEAQLDAIDCFNKNLIQVIQRWEHHVLTRAGDQMSRMESH"
     gene            complement(<216037..>217728)
                     /locus_tag="HG536_0E01190"
                     /db_xref="GeneID:59326404"
     mRNA            complement(<216037..>217728)
                     /locus_tag="HG536_0E01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283986.1"
                     /db_xref="GeneID:59326404"
     CDS             complement(216037..217728)
                     /locus_tag="HG536_0E01190"
                     /inference="similar to AA sequence:RefSeq:NP_013465.1"
                     /note="ancestral locus Anc_4.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139882.1"
                     /db_xref="GeneID:59326404"
                     /translation="MRWLSRRYWRYLTYLLGIVVLKCVIQSLYSRRQGTTPESVNGDV
                     KEEDLGSQIVVNVGKIDCFHVGRLWNHCYGTRQAAVVNTAYTTRKIIRKDLKSSLGYR
                     WFGTSEFLFYDVLPLSFVSELDEEVLRDFNIVTSVGNSGGTKMVDNLHISLEPLSLAA
                     VSQDKPILSGINVLFGEDCLDPRPDWHLDKSWKVENKRFPSYLTYRYLKLPESANHVR
                     RLTVKEDGKFKIVQLADLHFATGKSQCRDEYPKHAECDADSKTMHFIEKVLDIESPDM
                     VVYTGDQIMGDQSIQDSETSLMKALAPVIERKIPWALIWGNHDDEGSLTRWELSKLAR
                     TLPYSLFTIGPKDTADNSFGVGNYFHQVFDSNGKNALITLYFLDSHKYSTMGKVYPGY
                     DWIKEAQWDYLRQSYDQKLKLTASEDESAHLSMAFFHIPLPEYLNIDSRRSPGTRNPF
                     VGSLKEGVTAPKYNSGGIDTLNYLGVDITSCGHDHCNDYCLLDDSTSKKIWLCFGGGA
                     GEGGYAGYGGTERRIRTFQLDTKEGNIYTWKRLNGSPSETFDHQLVLKHGVPNAE"
     gene            complement(<217889..>218149)
                     /locus_tag="HG536_0E01200"
                     /db_xref="GeneID:59326405"
     mRNA            complement(<217889..>218149)
                     /locus_tag="HG536_0E01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283987.1"
                     /db_xref="GeneID:59326405"
     CDS             complement(217889..218149)
                     /locus_tag="HG536_0E01200"
                     /inference="similar to AA sequence:RefSeq:NP_878134.3"
                     /note="ancestral locus Anc_4.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139883.1"
                     /db_xref="GeneID:59326405"
                     /translation="MSGTESQKEVLGGSSGTAEEKPKIVLERGGKVKEFDPETLRRPH
                     TVIHGGTFERKVLGDQPGGNAGGLLRNDHRPQSDERQPVGKD"
     gene            <218381..>220420
                     /locus_tag="HG536_0E01210"
                     /db_xref="GeneID:59326406"
     mRNA            <218381..>220420
                     /locus_tag="HG536_0E01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283988.1"
                     /db_xref="GeneID:59326406"
     CDS             218381..220420
                     /locus_tag="HG536_0E01210"
                     /inference="similar to AA sequence:RefSeq:NP_013466.1"
                     /note="ancestral locus Anc_4.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139884.1"
                     /db_xref="GeneID:59326406"
                     /translation="MGETAVDARFVKAFLESLQCERYLDRFVECRLLTPKELRFLDRE
                     VLAALGVTKLGDRLRILHKAKQLNNTKPSKECADELNEVIRKIGSLSTSGPTSNEELI
                     TEKHSVIFILNDGSAKMVNVNGCFNADSIKKRLIKKLPTKGEDDEASAVQSYDVFVVD
                     YVKNVLHLLYDVELVTICHSADRLEKNRLIFVSKDQAPSDKAILTSKKLYLKTLSALH
                     ASSSQAGGRGPVSAIGSTPHLTVENGKEKIRKIFNQRPPSELISTNLAGYFPHADMKR
                     LEKTLKESFRQSARLSTIQGRVPSKESNKVGDILLNHSNAVDFALLHSLDHHSGHKEQ
                     EGLKLTGRSSTRKAESSRTEPQNDDRIKLWSYDSDEKGEEDPDNEIVSLPTKMATPKT
                     WLKGARIGSGSFGTVFLGMNARTGELMAVKQVELQSSAFAAGIVGPPDHKNDFQQEQK
                     LKNASRIHRKMIDALQHEMNLLKELNHDNIVKYFGSSQEGGNLNIFLEYVPGGSVSSM
                     LNSYGPFEESLITNFTRQILIGVVYLHKKNIIHIKGANILIDIKGCVKITDFGISKKL
                     SPLNKLQDKRASLQGSVYWMAPEVVKQAATTEKADIWSTGCVVIEMFTGRHPFPDFSQ
                     MQAIFKIGTSTTPETPSWATDEGKDFLEKTFQLDYKKRPSAAELLQHRWLDTRIL"
     gene            <220679..>221623
                     /locus_tag="HG536_0E01220"
                     /db_xref="GeneID:59326407"
     mRNA            <220679..>221623
                     /locus_tag="HG536_0E01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283989.1"
                     /db_xref="GeneID:59326407"
     CDS             220679..221623
                     /locus_tag="HG536_0E01220"
                     /inference="similar to AA sequence:RefSeq:NP_011572.2"
                     /note="ancestral locus Anc_4.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139885.1"
                     /db_xref="GeneID:59326407"
                     /translation="MRESKRRMDEEKLRRQQKHELKAGRARVDPSIHTPPIGAASNFN
                     GNGTNFQNNYGSYNSPRYDVRPTAPSQMNAYATAGPSSTGSTGSRPRPPSVTAQFPAR
                     ITPPPQRIVSSPPNLSSPATSGSRSSVEAIEDSKDVRIATQLFANHDIKKKGRLTAEE
                     LQNLLQNDDNTHFCISAVDALINLFGASRFGTINQAEFISLYKRVKNWRKIYVDNDIN
                     GSFTISVSEFHNSLQELGYLVPFEISEKLFDQYAEFMNQSVNGKELKFDKFVEALVWL
                     MRLTKTFRRYDLNQEGIATIHYKDFIDQTLYLGRFLPH"
     gene            complement(<222406..>223176)
                     /locus_tag="HG536_0E01230"
                     /db_xref="GeneID:59326408"
     mRNA            complement(<222406..>223176)
                     /locus_tag="HG536_0E01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283990.1"
                     /db_xref="GeneID:59326408"
     CDS             complement(222406..223176)
                     /locus_tag="HG536_0E01230"
                     /inference="similar to AA sequence:RefSeq:NP_013467.3"
                     /note="ancestral locus Anc_4.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139886.1"
                     /db_xref="GeneID:59326408"
                     /translation="MSTEWSAKWWFSRTILQMVKQPAAGTEAVESPISRNAYNFVVEA
                     SSFEKGLGNIKRWCLECPKTTTLRLYIPTFTLNELDFLRYKRKSFVARESLKFIDNIH
                     DHPGANLELIIEFPDIPDILAWSEVLAFVGDNPKDLETLNKLPKRLKDLVKSCLYKCQ
                     FDDGADGLKWILITEDPQVRNLANICRIPWCSLVDADSALTKEMNAKQYKQSKKFNDV
                     IVKSGITEETTKQGQRVVKTNFEKTLYAPRGRGELWSP"
     gene            <223848..>224774
                     /locus_tag="HG536_0E01240"
                     /db_xref="GeneID:59326409"
     mRNA            <223848..>224774
                     /locus_tag="HG536_0E01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283991.1"
                     /db_xref="GeneID:59326409"
     CDS             223848..224774
                     /locus_tag="HG536_0E01240"
                     /inference="similar to AA sequence:RefSeq:NP_011574.3"
                     /note="ancestral locus Anc_4.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139887.1"
                     /db_xref="GeneID:59326409"
                     /translation="MSAVFNNATLCSLIREETYSKTLQNVYQLQPQLNVMEKYWAAWY
                     TYMNNDVLATGLMFFLLHEFMYFFRCLPWFIIDQIPFFRRWKLQPTKIPSAKEQWYCL
                     KSVVLSHFLVEAIPIWTFHPMCEKLGISVEVPFPSITTMVLEIGLFFVLEDMWHYWAH
                     RLFHYGVFYKYIHKQHHRYAAPFGLSAEYAHPAETMSLGFGTVGMPILYVMYTGKLHL
                     FTLCVWITLRLFQAVDSHSGYDFPWSLNKFLPFWAGAEHHDLHHHYFIGNYASSFRWW
                     DFCLDTEAGPEAKAAREERMKLKAESDAKKNE"
     gene            complement(<225052..>229107)
                     /locus_tag="HG536_0E01250"
                     /db_xref="GeneID:59326410"
     mRNA            complement(<225052..>229107)
                     /locus_tag="HG536_0E01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283992.1"
                     /db_xref="GeneID:59326410"
     CDS             complement(225052..229107)
                     /locus_tag="HG536_0E01250"
                     /inference="similar to AA sequence:RefSeq:NP_011575.1"
                     /note="ancestral locus Anc_4.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139888.1"
                     /db_xref="GeneID:59326410"
                     /translation="MSVKILVGPVALPQFRVENLVDGINQYTNSTSVINEVRSCYIHY
                     VDVKGDRELTADDLKLLEALLTYDYALDIENDELSRVLYDAVMGNVSGTGLGDDLYLI
                     RVAPRKGTISPWSSKATNITSVCGLDDRIGRVERGLALLIKTVPGFPLLENLNDVSLK
                     PVFDRMTQHLYLDAPPSAEDIFLHDTPRALVHVPLVSGSAKSSPKETLEKANVEMGLA
                     LDNGEMDYLVGAFSETLKRDPTDVELFMFAQVNSEHCRHKIFNADWTIDGLKKKFTLF
                     QMIRNTHKLTPDFTLSAYSDNAAVLDTGNDAYHYAPDYATKKWTAIKEKVPMLIKVET
                     HNHPTAVSPFPGASTGSGGEIRDEGATGRGSKSKCGLSGFSVSDLLIPGHQQPWELDV
                     GKPSHIASALDIMIEAPLGSAAFNNEFGRPCINGYFRTLTTKVKNSEGKEEIRGFHKP
                     IMIAGGFGAVRPQFVLKNKPITPGSQLIVLGGQSMLIGLGGGAASSLASGEGSAELDF
                     ASVQRGNPEMERRCQQVIDACVSLGENSPIQSIHDVGAGGLSNALPELVHDNDLGAVF
                     DIRKVLSLEPGMSPMEIWCNESQERYVLGVAQKDLAIFEEICKRERAPYAVVGHATAE
                     QRLIVKDPLLNETPIDLEMAILFGKPPKMSREAVTADLQLPEADLSVIPSIDDAVERI
                     LRLPAVGSKSFLITIGDRTVTGLIDRDQFVGPWQVPVADVGVTATSLGPSIIKTGEAL
                     AMGERPISALISAAASAKLSVAESLLNLFAADVKSLKHVKLSANWMSPASHAGEGAKL
                     YEAVQALGLDLCPALDVAIPVGKDSMSMKMKWSDNEVTAPLSLDITAFAPVSDTSKTW
                     TPLLNKNVEDSVLVLVDLAASQKQALMGGSALLQVYKQVGNASPTVHENEVLKGFLTA
                     LLELHKTDIVLSYHDRSDGGLFVTVLEMAFASRCGLTAVVKASSHEDILASLFNEELG
                     AVFQVSQADLEHFKSILEKNGVSNDFVSVVGKPDFRSQTIKVIDTEGKHLYESTRGHL
                     QQLWSSTSFEMQKLRDNPKSAEEEFSAIKDDKDPGLHFSLRFDPTDDLRIGAELSNVR
                     PNVAILREQGVNGQMEMAWAFEQAGFNSIDVTMTDLLEGRVHLDDFVGIAACGGFSYG
                     DVLGAGAGWAKSVLYHEGVRAQFVKFFQEREDTFAIGACNGCQFLSRLKEIIPGCENW
                     PSFERNISQYEARVSMVQISQENDNESIFLNGMTGSMLPIAVAHGEGRATFVSKEQQD
                     AFESQGLCAIRYIDNYGNVTQRYPYNPNGSTNAIAGIKSPNGRVLAMMPHPERVCRLE
                     ANSWYPQDKYEKWGGYGPWIRLFRSARRWIG"
     gene            <229570..>229824
                     /locus_tag="HG536_0E01260"
                     /db_xref="GeneID:59326411"
     mRNA            <229570..>229824
                     /locus_tag="HG536_0E01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283993.1"
                     /db_xref="GeneID:59326411"
     CDS             229570..229824
                     /locus_tag="HG536_0E01260"
                     /inference="similar to AA sequence:RefSeq:NP_076903.1"
                     /note="ancestral locus Anc_4.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139889.1"
                     /db_xref="GeneID:59326411"
                     /translation="MPQKALKVTKKAKDPRRVTKKQKNLRKAAPLQIKSKKKSLQHLK
                     KLNKTASLTESTEKLIASKVGHLELLKGTRRELEKEKGKK"
     gene            complement(<229881..>230834)
                     /locus_tag="HG536_0E01270"
                     /db_xref="GeneID:59326412"
     mRNA            complement(<229881..>230834)
                     /locus_tag="HG536_0E01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283994.1"
                     /db_xref="GeneID:59326412"
     CDS             complement(229881..230834)
                     /locus_tag="HG536_0E01270"
                     /inference="similar to AA sequence:RefSeq:NP_011576.1"
                     /note="ancestral locus Anc_4.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139890.1"
                     /db_xref="GeneID:59326412"
                     /translation="MVVMLIHRIGPRVSIRECLAGNSLGTSISKRKISVFQGVSETLI
                     HIHSASSLPWVVLIPLGTILLRTVTTLPLSVWQRKRIVKQQELRKLVQAIPPVTKLRL
                     AASTASRSENSITSSGSATGELPNGGSTARSRTLTPEQITLLAVKETRKRQKRLFAKY
                     NVQMWKNAVLPLVQMPLWVTLSMGIRSLTEKRLLETNTGQLLNSIVPPTLDLSLPLEP
                     LPMLVPLILGSLALINVEYNGKALSSTRASNAGIVLATDEHSRAAQGMASILNISRFG
                     CIFMMGISSQAPLLLSLYWISSQLYSFTQNLILNWLWPYER"
     gene            complement(<230960..>231268)
                     /locus_tag="HG536_0E01280"
                     /db_xref="GeneID:59326413"
     mRNA            complement(<230960..>231268)
                     /locus_tag="HG536_0E01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283995.1"
                     /db_xref="GeneID:59326413"
     CDS             complement(230960..231268)
                     /locus_tag="HG536_0E01280"
                     /inference="similar to AA sequence:RefSeq:NP_011577.3"
                     /note="ancestral locus Anc_4.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139891.1"
                     /db_xref="GeneID:59326413"
                     /translation="MSSERACMLCGIVLTTNDFSNDGCPNCQGIFEEAGVSTIECTSP
                     SFEGLVGMCKPTKSWVAKWLSVDRNIPGMYAVKVDGRLPAEVVEVLPFYKPRDGSQVE
                     "
     gene            <231633..>231959
                     /locus_tag="HG536_0E01290"
                     /db_xref="GeneID:59326414"
     mRNA            <231633..>231959
                     /locus_tag="HG536_0E01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283996.1"
                     /db_xref="GeneID:59326414"
     CDS             231633..231959
                     /locus_tag="HG536_0E01290"
                     /inference="similar to AA sequence:RefSeq:NP_013468.3"
                     /note="ancestral locus Anc_4.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139892.1"
                     /db_xref="GeneID:59326414"
                     /translation="MVDYVSKVRELIKGHQFFQLSASWCPDCVYANSVWKRFGVEDKI
                     HLFDIGSLPRSEIEQWRQAFQKVTGSRNLPTVLVNGKFWATESELHRFEAAGILKEEL
                     KKINLL"
     gene            complement(<231997..>233802)
                     /locus_tag="HG536_0E01300"
                     /db_xref="GeneID:59326415"
     mRNA            complement(<231997..>233802)
                     /locus_tag="HG536_0E01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283997.1"
                     /db_xref="GeneID:59326415"
     CDS             complement(231997..233802)
                     /locus_tag="HG536_0E01300"
                     /inference="similar to AA sequence:RefSeq:NP_011579.1"
                     /note="ancestral locus Anc_4.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139893.1"
                     /db_xref="GeneID:59326415"
                     /translation="MTVSGPWKRFFPHLRTLPEDDHDFGSSEDTTSIEGEDQPILEVV
                     HDDSKKSSIDSISPDTDTRKDVSLNGSLNELKKDLPYELRDEAGRKWYKCFDEYEYRL
                     NKEYKESRKWYTFLYPNHATQSKAERRLLYKLDIIIAFYFLILNWSKSVDSNNYTSAY
                     VSNMKEDLGMKGNDYIYTSTIANVGAIVFQLPFMYLLPRFPSHIVLPVMDLGWTWFTF
                     ACYRAKSLAELRAYRFILNAFGAAYYPMSQYIMGCWYAPDEISSRVCLFFCGQLLGGV
                     TSGLLQARIFKSLDGVHGLAGWRWMFLIDSIAISLPTVILGFFLIPGIPSKCYSLFLS
                     DEEIRIARARNRRNQINDGVDKSKLKPLWDLNLWKKVFCTPTFWVLVVFDTCSWNNMT
                     AFSGSYTLWLKSNASYSIERVNNLSVLPACLGFIYVFFCAWGADLFRCKWIFMVFAAI
                     MNTISCAILIKWDVSSGAKWFAFLTTYFSVAASPCLWSYINDFLRMDPQVKAITWIAI
                     YSFSQSTYAWIPTLAWQTVEAPRFKTGYTVSIIFGVIYGLWTFVVLYFYKRNEKRLAL
                     QNGIILYDSRKGEEIPTFVRTDMKEKDGYFYVKHE"
     gene            complement(<234118..>234993)
                     /locus_tag="HG536_0E01310"
                     /db_xref="GeneID:59326416"
     mRNA            complement(<234118..>234993)
                     /locus_tag="HG536_0E01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283998.1"
                     /db_xref="GeneID:59326416"
     CDS             complement(234118..234993)
                     /locus_tag="HG536_0E01310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139894.1"
                     /db_xref="GeneID:59326416"
                     /translation="MAVQVSPSQIGPLSRSGEEDSDANEIYYSLQERDASDGNESFYS
                     VRDQDVEDEDAISIKGSEIAGDEGARERTFVGETDTLEANMAEVANESELSDFFSDYH
                     HGSEVKSAKKGPGWFTAQSVLESKRSPAPVELRDDSSKDNKEPFESSRSPSVMMTRKC
                     RPPGGIEAKVDEIEIIELDDCIEERDELIDCDIASNDIEVFGPDSSCVRELPFVEFDG
                     YKKVIIIASDDEADDRPDDEKKILAELTDWVPKRDRSPEAYEPTTDELHQSPVQRKMK
                     KLIELAQKAEKMPGS"
     gene            <235858..>236543
                     /locus_tag="HG536_0E01320"
                     /db_xref="GeneID:59326417"
     mRNA            join(<235858..235990,236284..>236543)
                     /locus_tag="HG536_0E01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037283999.1"
                     /db_xref="GeneID:59326417"
     CDS             join(235858..235990,236284..236543)
                     /locus_tag="HG536_0E01320"
                     /inference="similar to AA sequence:RefSeq:NP_013471.1"
                     /note="ancestral locus Anc_4.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139895.1"
                     /db_xref="GeneID:59326417"
                     /translation="MTRTSVLADALKAIINAEKTGKRQVMIRPSSKVIIKFLQVMQRH
                     GYIGEFEYIDDHRSGKVVIQLNGRINKCGVISPRFNVKIGDIEKWTENLLPARQFGYV
                     ILTTSAGIMDHEEARRKHVSGKILGFVY"
     gene            complement(<236653..>239076)
                     /locus_tag="HG536_0E01330"
                     /db_xref="GeneID:59326418"
     mRNA            complement(<236653..>239076)
                     /locus_tag="HG536_0E01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284000.1"
                     /db_xref="GeneID:59326418"
     CDS             complement(236653..239076)
                     /locus_tag="HG536_0E01330"
                     /inference="similar to AA sequence:RefSeq:NP_011581.4"
                     /note="ancestral locus Anc_4.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139896.1"
                     /db_xref="GeneID:59326418"
                     /translation="MSAVSDNNSGLQKKYACSYCGKPFSRSEHKARHERSHTGVKPFE
                     CKVCQHAFVRRDLLQRHIRTVHREVLLLGKSAKEAEIGHDAKELAAEMANTSKGDILL
                     ELLVNSMIKVNYDNTPDTRDSKCLRSVPKIVGLKGRRRKWKNGPIGELSRRDARAVSI
                     CINKSIGIDRIRLLYRCAVGHVAEHKLFNKAIESHVRDEPPLAASVVCLGLHLGDPDD
                     RIAKDIWHALWNISLERCSVTAANLLIYILVTFAGKTDWSMTSIGDVFSRYERFFIDH
                     LVQYSETFEMNEISLIFHIWVSLLRLSQEPTSLSARIYTWFLQHAFLKDCTLKDLVFQ
                     IMLNNNRWEVPTLDLLADALFGDWLISSRLMESNDPLGASHIFKTGAEFHNTVTIVLK
                     KYAAESGNQEELMRQLRIGELPSKFSFPLSQYLARIQSNSHWRLLETAWCRLIERMKA
                     KQDRSYWFMDSMAEFPTIFLESSMIDETFATCCIPVFTVLESKSDLNANYVPLISDVV
                     VFLIRLFEFEMSINSNKYCPHRLISMLKNPVIQLLLFTGHRLTSSGIHSQQESIAVDH
                     FINRYIVNCNWLVDKHTEEELTHNLFDSQSLGYIGYHQLIQDFLSYLRNSIITEKLMK
                     VPHISHDIKVHLFDFAQQHCHNLHHPTQDVHAARRLTDPWQSSQPGPVWMFSPQSPRS
                     MSIDSTGTEPVSILSTGMSQSNSLDSTMLHDPNVILPPLNETLLLRQQQKSSYYNYGP
                     GSVELQMNRRPSSIVPIFTNPNFSNMDGVFLDKGENESTSPRSNVSTTVRRIGNNSVK
                     LPPPSELFG"
     gene            complement(<239346..>240965)
                     /locus_tag="HG536_0E01340"
                     /db_xref="GeneID:59326419"
     mRNA            complement(<239346..>240965)
                     /locus_tag="HG536_0E01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284001.1"
                     /db_xref="GeneID:59326419"
     CDS             complement(239346..240965)
                     /locus_tag="HG536_0E01340"
                     /inference="similar to AA sequence:RefSeq:NP_011582.1"
                     /note="ancestral locus Anc_4.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139897.1"
                     /db_xref="GeneID:59326419"
                     /translation="MFGLKHAGNGSGRDPLVYFDVRVDSPYKDLVLISGSPLESNPVS
                     MSGRVLFSLSQDMLVKRVTLKLTGKFKLDFLHMGRDKKRSGVTSIVKDQRTIFETRWE
                     NLLVSSKGNTVIGNDTNYVAETGHRESAKRSLSSPVVSRLIKKTTDHILELPTNGVSG
                     TPYKDLYSAPSYVFHLPKGNYDLPFQILLPSEVPETVEGLQSGSILYSFEARIERKRK
                     SSSMTSLLKEDLDALHQNHGPLTSYKYLRIFRTLSPNDMAIQQEIRVGGTCKDKIQYE
                     VSIPSKAIAIGSTTPIQIKLFPFQKGYVLKKINASLLQFFAVRDSTGHIYDDQVVTTR
                     QSMTEFTEFIDNQEGLLTDVTEISPMFAIPDNLKKITQDCDLRAGLIQVRHRLAITII
                     LHSKTTDKNLEIKAAIPVLLYISPLVVTKGRLVLFDNSNGNIHFRSGELVALFHSTAT
                     PAASGPATPPAGAAAVSAPPNYHQRVKDHLVNSENVQHDAQDWQQELPAASSITALFD
                     MTPAASVEVPSYEQSSWQVISQNDEPPPIWN"
     gene            <241095..>242813
                     /locus_tag="HG536_0E01350"
                     /db_xref="GeneID:59326420"
     mRNA            <241095..>242813
                     /locus_tag="HG536_0E01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284002.1"
                     /db_xref="GeneID:59326420"
     CDS             241095..242813
                     /locus_tag="HG536_0E01350"
                     /inference="similar to AA sequence:RefSeq:NP_013472.3"
                     /note="ancestral locus Anc_4.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139898.1"
                     /db_xref="GeneID:59326420"
                     /translation="MNDKQPVASVLPQEIWVAILRHLDHSDLFRLRLCCKRFNQIVST
                     ATVWKSRCWKRWLEHMSHDPFDEEFPSGSDWFYYYRFRNRIDQSLLQLLRKLVNENDS
                     TEYWHLYRLMLRYNPSHTIPFLHGVVRRGFLSSEPFDVVTLCQHLLTSVRHKHVYDLF
                     RVGERASFVHNAEETFFLPLAAMDPSFDRLLHFRSDAHDRVHSLIKAEFNNLQDFLNL
                     PTTLKVDKLISRLFEALDLLDKDRQLFIEDFILLRIYAGETAGHPLLILSMVQYLAST
                     YGVETVLCGSYLIIHDPHVRDGETYLTIASSGIPKIFTKRRLVLSLKRILGSSDYIIQ
                     REILPTILQPLRQQELLATVFKELLPLYNKSKWSVAAPKTMEELQRLFPHSNQPIRPE
                     MINYFLCVFKSMEIRSKTERSISVMLTVTFKEVFQLISRLFPGDLSYAEDLLKCRGAA
                     FSEMDLEYGDWLSQIHNISLRANAEFGNFVVSLRDQQILCVIGVKELNSAGTFYNLMS
                     FAGEFYVEHSSNIRTLDAGEEENVIKRFLTVGFQSDLGLVFKGIDWLSHKLIPNSHVS
                     HIIKTL"
     gene            <243011..>244942
                     /locus_tag="HG536_0E01360"
                     /db_xref="GeneID:59326421"
     mRNA            <243011..>244942
                     /locus_tag="HG536_0E01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284003.1"
                     /db_xref="GeneID:59326421"
     CDS             243011..244942
                     /locus_tag="HG536_0E01360"
                     /inference="similar to AA sequence:RefSeq:NP_013473.1"
                     /note="ancestral locus Anc_4.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139899.1"
                     /db_xref="GeneID:59326421"
                     /translation="MYTSCRESFKASQRWGRRLISSKVIGIDLGTTNSAVAYIRDSRN
                     KQSATIIENDEGQRTTPSIVAYDRNGKAIVGAAAKRQGAINPRNTFFSTKRLIGRSFE
                     DQEVQRDMKTLPYNVVKSELNGQAYVETTNGEVKSPSEIGSLILGYLKKTAEAYLNEV
                     VDKAVVTVPAYFNDSQRQATKDAGKLAGLKVLRVINEPTAAALSFGLDDERNSGIIAV
                     YDLGGGTFDISILDIEDSVFEVRATNGDTHLGGTDFDEVIVEHIIRSFILENQDLDAV
                     MLKQNGKMMQRIREAAEKAKIALSHVKTTTIDIPFIYENRHLHFTLKESELDEMTMHL
                     IKRTIDPVKRALKDADVEPEDVDDVLLVGGMTRMPKVRAVVEEVFGKKPNTSVNPDET
                     VALGAAIQGGVLSGEIQNVLLLDVTPLTLGIETYGGAFSPLIPRNTTVPVKKTEVFST
                     GVDGQTGVDIKVYQGERGLVRDNKLIGDFKLTGITPSPKGVPQIAVTFDIDADGIINV
                     SASERSSGREESITVIANSGLTEDEIQKIVEDANANREKDSLIKKRIELITKADIMIS
                     DSENAFERFKDIISADETYPEVLAELRQVREIINDFKKNESNLDYNVDDVKKATDALQ
                     NRALKLFQSASKKQAAAKK"
     gene            complement(<245020..>245502)
                     /locus_tag="HG536_0E01370"
                     /db_xref="GeneID:59326422"
     mRNA            complement(<245020..>245502)
                     /locus_tag="HG536_0E01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284004.1"
                     /db_xref="GeneID:59326422"
     CDS             complement(245020..245502)
                     /locus_tag="HG536_0E01370"
                     /inference="similar to AA sequence:RefSeq:NP_013474.3"
                     /note="ancestral locus Anc_4.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139900.1"
                     /db_xref="GeneID:59326422"
                     /translation="MVGNIVLLPLNTKFRGPAYPANADYDIIDECLDLFRANSFFKNF
                     EIKSPADRVLIYGILFINECLSSLRPTTSFNEAVKILTNVALDNFSLPGTPGFPLNTV
                     YSVPLSDHNAMELLRTYIQQFRQELAMRLLDRVYRDSKENPSKFWLAFTRRKFMNKSL
                     "
     gene            <246087..>250004
                     /locus_tag="HG536_0E01380"
                     /db_xref="GeneID:59326423"
     mRNA            <246087..>250004
                     /locus_tag="HG536_0E01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284005.1"
                     /db_xref="GeneID:59326423"
     CDS             246087..250004
                     /locus_tag="HG536_0E01380"
                     /inference="similar to AA sequence:RefSeq:NP_011584.2"
                     /note="ancestral locus Anc_4.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139901.1"
                     /db_xref="GeneID:59326423"
                     /translation="MVNSTGVQDRRSIYSEIFGIERRPNTLDPRFREEIEVGHGHYED
                     GELPDKIEDITSLEDVFSGEISDDLVLQESEPAEAKEGYILSHKTHIRKVSDTQSLLS
                     CDDTPRSSPKRAQASVVSPTTTGKTTLARKPPPIPLTTNLEDPKPRSPSTDSFQSTIS
                     NAPHGSKSEAAPRRTPSLPQLSISSLRKQSSFSNSGDNTPTQSKKSPLQGFGFFSRHN
                     SRETNELLGQNHPHQHSQTQTNHHYHSSHPTDQGQNLTSRSMSLNSSALKNLASSLQS
                     KSGSGRKALQKYDSPHSPFQETHSHSFHGGSSGNYASNNKHITSPMGLGIKTRNSSTS
                     LTSKRFTSASGSTVFYDRRSSGSLPSSKPILSASVKKPQVYPALLSRVATKLKGSIQV
                     GEHKKDGLIYRDAFTGQQAVDVICSIIRTSDRNLALLLGRSLDAQKLFHDVVYEHRLR
                     DSPHEVYEFTDSSRMIGTGTTGVVPLNSRDPLMLLPSSSQVNNMPYSASTIVTSGSTS
                     SLSSDQTGTNTSKMQQDPALIHNVNGVFTLLAECYSPTCTRDHLCYSISCPRRLEQQA
                     RLNLKPNGGLKRNISMALDDDEEEKPSWTSSVPEEIWKNLPKKEIKRQETIYEVFITE
                     KNFVRSLEITRDTFMKTLAETNIIPADIRKNFIKHVFAHINDIYSVNRRFLEALSDRQ
                     KSSPVVKGIGDIILRFIPFFEPFVSYVASRPYAKYLIETQRSVNPYFARFDDDMMSSS
                     LRHGIDSFLSQGVSRPGRYMLLVKEIMKSSDPEKDKRDYENLSRAMDALRGFMKRIDG
                     ASGAAQDRHDVKLLKQKILFKNEYVNLGLNDEKRKIKHEGVLSRKELTKSDGTVVGDI
                     QFYVLDNMLLFLKAKSVNKWHQHKVFQRPIPLPLLFVCPSEDMPPIKRFIGDKPDCYG
                     RVLQPEYTQHNPKNALTFLYYGAKQKYQVTLYAAQYAGLQTLLEKIKQEQARIVAETE
                     MINVIKISDKFFDYSNKINSVASCDGGRKLLIATNSGLYMSNIKRQQSKDTGKRSTYF
                     STPVQLVQRSNISQVAVLEEFQSILLLVDKRLLKCPLSLLQAEDNGNGFFKKHHKELA
                     THVSFFAEGDCNGKRLIVTAHSSSHSIKYFEHEHPLLSENSNSSSKSYKRKVTEVVFD
                     SEPVSISFLKANLCIGCKKGFQIVSVSQNAHESLLDPADTSLEFALRDTLKPLAIYRV
                     GDMFLLCYTEFAFFVNTQGWRKKDSHIIHWEGEPHKFAIWYPYILAFDANFIEIRKID
                     TGELVTCVLAEKIRLLQTSSQEILYVYEDSRGYDTVASLDFWG"
     gene            <250368..>251411
                     /locus_tag="HG536_0E01390"
                     /db_xref="GeneID:59326424"
     mRNA            <250368..>251411
                     /locus_tag="HG536_0E01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284006.1"
                     /db_xref="GeneID:59326424"
     CDS             250368..251411
                     /locus_tag="HG536_0E01390"
                     /inference="similar to AA sequence:RefSeq:NP_013476.3"
                     /note="ancestral locus Anc_4.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139902.1"
                     /db_xref="GeneID:59326424"
                     /translation="MDPAVEQVADELIVESAISPLLDLIERIPWIKCHMPSIEHPFGL
                     ELWPIFSKAFDKVVGYPAEDFDFVHNKTFLANGYQAVGIILVYYFVISSGQAILRGVN
                     AAPMRLNFLFQLHNLLLTTVSLVLLLLLVEQLVPMIARHGLFWAICSKEAFAPKLVTL
                     YYLNYLTKYLELFDTVFLILKRKKLLFLHTYHHGATALLCYTQLTGRTSVEWVPIALN
                     LGVHVVMYWYYFLSSRGIRVWWKEWVTRFQIIQFLIDLVFVYFATYTFYAHKYFDSIL
                     PNKGTCYGTQDAAAYGYLILTSYLFLFISFYIQSYRKGSKKTETSPASAAVAGATTTG
                     STTNATRASSRKA"
     gene            <251890..>252912
                     /locus_tag="HG536_0E01400"
                     /db_xref="GeneID:59326425"
     mRNA            <251890..>252912
                     /locus_tag="HG536_0E01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284007.1"
                     /db_xref="GeneID:59326425"
     CDS             251890..252912
                     /locus_tag="HG536_0E01400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139903.1"
                     /db_xref="GeneID:59326425"
                     /translation="MLAMATSAPTSISSSEERKAKTPVSPGAVTATANSSKPAGSLAQ
                     FHQPFVSSPTPFSSSSQVTLPPISSFDNLIRAAEKQYSNSSKVASPGLVSPGILSYQL
                     SATDTACNTTVPRSVMQRPSSVVSKSSSGSPSFSSGEQPYGSKVHKPRKKKQCPICHN
                     FYANLSTHKSTHLTPEDRPHKCPVCQRGFARNNDLIRHKKRHWRDEIVENSPVEHSDA
                     DEHVAGHTHLDEHDQLRSLHQIKGTFKCPFNSALIQLDMEIYPYKSKPLNFETSNCHQ
                     TGVFSRCDTFKNHLKALHFEYPPGTKKRDRTVVPGRCKHCGLKFPNVDIWLNEHVGKT
                     CGYTYH"
     gene            complement(<253066..>254325)
                     /locus_tag="HG536_0E01410"
                     /db_xref="GeneID:59326426"
     mRNA            complement(<253066..>254325)
                     /locus_tag="HG536_0E01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284008.1"
                     /db_xref="GeneID:59326426"
     CDS             complement(253066..254325)
                     /locus_tag="HG536_0E01410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139904.1"
                     /db_xref="GeneID:59326426"
                     /translation="MSTIQSGGGSATATSSEKYAVDTNGNVFKVPDFTIKDILDVIPE
                     RCYERNLAKSLYYVVRDIVCMVSIGLFTHKLAYPWLFQESSSSASVQLAKFVFWLSYT
                     YVQGLFSTGLWVLAHECGHQAFSDYGAVNDFVGWTIHSYLLVPYFSWKYSHSKHHKAT
                     NHMTRDMVFVPPTAEEFKERRGFVGDMLYNHTGDSPLRTLGELLLQQLGGWITYISTN
                     VTGQKYEGVAAWKQNHFYPFSPLYEKKDSLYIFLSDVGIVTQLLVLKLWFDRFGGWSL
                     FINWFVPYIWTNHWLVFITYLQHTDPTVAHYDADEWTFAKGAASTVDRQFGFVGPYIF
                     HDIIETHVIHHFCSRIPFYNAREASDAIKKVMGEHYKSSDENMWKSLWKCAKGCQYVE
                     GDSGVLMFRNVNKFGVGAAADGSKKHN"
     gene            <254784..>255575
                     /locus_tag="HG536_0E01420"
                     /db_xref="GeneID:59326427"
     mRNA            <254784..>255575
                     /locus_tag="HG536_0E01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284009.1"
                     /db_xref="GeneID:59326427"
     CDS             254784..255575
                     /locus_tag="HG536_0E01420"
                     /inference="similar to AA sequence:RefSeq:NP_010234.1"
                     /note="ancestral locus Anc_4.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139905.1"
                     /db_xref="GeneID:59326427"
                     /translation="MIFWGVLLWLAFWADIGLGDVEILFPSDNSGKYDLSRGSAALRV
                     EWTVTDEVPDENEIKSYTFTLVAGSNADLVSMYVFDTMEPSDLEDNKVELQLANTVGT
                     DGVYMLQVLAACESGYTIHYTHRFELTGMVGGKLAPSTSDEVPPEPERRVSEDPLAGG
                     IDSRSFTVPYHLQTGRAKFAPMQLQPPTKLTRSQWTMIHETSALTYYSSYRRFRKQLT
                     TMTPGQSYVLPSGFNYASPAPMPAANGGWHCATRRLSQTPRKTNT"
     gene            complement(<255626..>256462)
                     /locus_tag="HG536_0E01430"
                     /db_xref="GeneID:59326428"
     mRNA            complement(<255626..>256462)
                     /locus_tag="HG536_0E01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284010.1"
                     /db_xref="GeneID:59326428"
     CDS             complement(255626..256462)
                     /locus_tag="HG536_0E01430"
                     /inference="similar to AA sequence:RefSeq:NP_010232.1"
                     /note="ancestral locus Anc_4.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139906.1"
                     /db_xref="GeneID:59326428"
                     /translation="MSSSAEPNSESQSRRGSYAPVEFTAQVKQQCLKQVEFYFSEFNL
                     PYDKFLRMTVAKNDGWVPITTIASFNRMKKFRPVDKVVECLRESKVLEVSDDGENVKR
                     IEPLDFEGAKNARLEQNKRTLAVINFPHENVDDMTALQESLEEFFNKLSEVNQVRLRR
                     DHKKKFNGTVIVEFKTLPKCEEFLKVYSGEDAETLSYEGKKLEVFTKKQYDLQREATR
                     SKNFSGSGQRSRSFTGHRKNMPKSRRSTKSDDNKSESESKEELREEAGKESVPAQAEE
                     HP"
     gene            complement(<256597..>257022)
                     /locus_tag="HG536_0E01440"
                     /db_xref="GeneID:59326429"
     mRNA            complement(<256597..>257022)
                     /locus_tag="HG536_0E01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284011.1"
                     /db_xref="GeneID:59326429"
     CDS             complement(256597..257022)
                     /locus_tag="HG536_0E01440"
                     /inference="similar to AA sequence:RefSeq:NP_013480.1"
                     /note="ancestral locus Anc_4.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139907.1"
                     /db_xref="GeneID:59326429"
                     /translation="MLRNHDDLGFYVMNSTSILNMDGLVNYLLQLNESPKEALMRCRR
                     KDSESKQLAGIVIDNISYLSHDANSYNLLVRTLKMLRKTFGCWILTVSYGLEYYNGVE
                     NALASPHRAGSLTRVPPAFTNEMDAIIIRDTDSTARLCS"
     gene            <257140..>258378
                     /locus_tag="HG536_0E01450"
                     /db_xref="GeneID:59326430"
     mRNA            <257140..>258378
                     /locus_tag="HG536_0E01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284012.1"
                     /db_xref="GeneID:59326430"
     CDS             257140..258378
                     /locus_tag="HG536_0E01450"
                     /inference="similar to AA sequence:RefSeq:NP_010231.1"
                     /note="ancestral locus Anc_4.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139908.1"
                     /db_xref="GeneID:59326430"
                     /translation="MQKPELPRVPTRSCHCAWQLYKLRLRPVELQRFVSKPEQRNLPY
                     WPRLHIPVRVDISGNGSRHPWFGRQICCCSWLEHRTIFCWLCPKMLNLVYKRALLDLV
                     RRLGSILFEPDLAEEMCLLKSLIYYTRTFLAAAIICGGSVFGVVAGLVCTVIGKQYLA
                     QWATARCFYYSMALFFGIDVRVENEHYLKDLPCVIISNHQNALDIFMLGRMFPRGCTV
                     TAKKSLKYVPFLGWFMALSGTLFLERSNRAKSVETLNRGLKNIKEKKRALWIFPEGTR
                     SYTTKLEMLPFKKGAFHLAQQGGLPIVPIVVSNTSTLMNPKLKIYNRGYIVAKVLKPI
                     PTADLKKEDVGKFSEKVREMMVAELQDVGYSPAINDTDLPAEAIEYEKNRQQIEHDDV
                     SEALSSENSTERSTESIKEF"
     gene            complement(<258415..>259446)
                     /locus_tag="HG536_0E01460"
                     /db_xref="GeneID:59326431"
     mRNA            complement(<258415..>259446)
                     /locus_tag="HG536_0E01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284013.1"
                     /db_xref="GeneID:59326431"
     CDS             complement(258415..259446)
                     /locus_tag="HG536_0E01460"
                     /inference="similar to AA sequence:RefSeq:NP_013481.3"
                     /note="ancestral locus Anc_4.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139909.1"
                     /db_xref="GeneID:59326431"
                     /translation="MPTAAQPLKESFDTDIITLPRFLLESQKCAKHATGEFTLLLNAL
                     QFAFKFISQTIRRAELVHLIGLAGASNATGDEQKKLDVLGDEIFINAMKGSGIVKVLV
                     SEEQEDLILFPTANGTYAVCCDPIDGSSNLDAGVSVGTIVSLFKLLPDSSGTIKDVLR
                     NGREMVGACYAMYGASTHLLLTTGQGVDGFTLDTNLGEFILVYPDLRIPPQRSIYSIN
                     EGNSFYWDETIRGFIEKLKRPSDNRKPYSARYVGSMVADVHRTFLYGGLFAYPADRKA
                     RNGKLRLLYEAFPMAYLMEQAGGLAVNDRGERILDLTPEHIHDKTSIWLGSPDEVNQY
                     LAYIGKPEL"
     gene            <259840..>260352
                     /locus_tag="HG536_0E01470"
                     /db_xref="GeneID:59326432"
     mRNA            <259840..>260352
                     /locus_tag="HG536_0E01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284014.1"
                     /db_xref="GeneID:59326432"
     CDS             259840..260352
                     /locus_tag="HG536_0E01470"
                     /inference="similar to AA sequence:RefSeq:NP_010230.1"
                     /note="ancestral locus Anc_4.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139910.1"
                     /db_xref="GeneID:59326432"
                     /translation="MACRTQMALQALWQAVWWIGAHSGSGLLWMSSTMVQNGGVKLTG
                     WAQAAAKALPKQQQQQRPKAAAAGSSAKNGSASVLTASGSAASLSSANGRGKKKPVRQ
                     PYNRDEVRSYMKSLFEEQVAKLGNRETFSTGRGSQRKNGSLDWGAVTSNKYRNKKYGC
                     LNEIAQVLCK"
     gene            <260498..>261886
                     /locus_tag="HG536_0E01480"
                     /db_xref="GeneID:59326433"
     mRNA            <260498..>261886
                     /locus_tag="HG536_0E01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284015.1"
                     /db_xref="GeneID:59326433"
     CDS             260498..261886
                     /locus_tag="HG536_0E01480"
                     /inference="similar to AA sequence:RefSeq:NP_010229.1"
                     /note="ancestral locus Anc_4.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139911.1"
                     /db_xref="GeneID:59326433"
                     /translation="MALSRLERWLSYYVRALLPHVLSKESSYRMAYVFSLVSAMCSGF
                     VTLVALYSKPWHGQLHYSSWQVNLIVSAANLGMYLTPPILGVVADDHGPIALSTLAIG
                     GFIPSYACAGYLFNHPESSSWLAFRVTLVAFLFIGISTSALYFSALLTCAKLYPERKL
                     LSISLPTTCYGISSVIGSQLLRMPFFWSKANLDLGRVFSVFAWLYAAVGLLAWVATGT
                     VSLLHHSEPHDEAAEQEPLLPVPAEERARQKDFFKDHIAYLLAFSMLLALGPLEMFVA
                     DMGSLGSLIVGNSAILSNQLLSVYAVSSTVTRLLTGLATDVFAAKKISPKWILIFHLL
                     LAMASQVLVLLITSTAIAPAEWQVLSMGSMMGAAYGGLYTIYPTVVLIAWGDKLFGTA
                     YGSMMVAPAIGAAISCLSYAKVYDALCTDSSKKSSACIAPVYKVTATQLACSLAVTLV
                     AFRAWKRRNVPL"
     gene            <262067..>263506
                     /locus_tag="HG536_0E01490"
                     /db_xref="GeneID:59326434"
     mRNA            <262067..>263506
                     /locus_tag="HG536_0E01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284016.1"
                     /db_xref="GeneID:59326434"
     CDS             262067..263506
                     /locus_tag="HG536_0E01490"
                     /inference="similar to AA sequence:RefSeq:NP_013482.1"
                     /note="ancestral locus Anc_4.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139912.1"
                     /db_xref="GeneID:59326434"
                     /translation="MSGRLLDLFKPFEAFLPEVIAPQRKVPYNQKLIWTGVSLLIFLV
                     LGQMPLYGIVSSETSDPLYWLRAMLASNRGTLMELGVSPIITSSMIFQFLQGTQLLQV
                     DMQNKHDRELFQIAQKVCAIVLTFGQAVVVVLSGNYGRPGDLGIAISLLLIFQLMFAS
                     FIVLLLDELLSKGYGLGSGISLFTATNIAEQIFWKALAPTTVNSGRGKEFEGAMIAFF
                     HLLAVRKDKKRALVEAFYRANLPNMFQVLATVVVFLFVLYLQGFRYELPIRSTKVRGQ
                     VGTYPIKLFYTSNTPIMLQAALTSNIFLISQILFQRFPSNPLVRLIGVWGVKPGQQGP
                     QQALSGLAYYIQPPTSLKEIPLDPIKTVIYVAFVLVVCAVFSKTWIEVSGTSPRDIAK
                     QFREQGMVINGKRETSVYRELKKIIPTAAAFGGATIGALSVCSDFLGTLGSGTSILMA
                     TTTIYGYYEMAAKEGGFSKNLVAGVSELM"
     gene            complement(<263721..>264647)
                     /locus_tag="HG536_0E01500"
                     /db_xref="GeneID:59326435"
     mRNA            complement(<263721..>264647)
                     /locus_tag="HG536_0E01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284017.1"
                     /db_xref="GeneID:59326435"
     CDS             complement(263721..264647)
                     /locus_tag="HG536_0E01500"
                     /note="ERG25 paralog; similar to Torulaspora delbrueckii
                     TDEL0E01410 Anc_4.230a"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139913.1"
                     /db_xref="GeneID:59326435"
                     /translation="MSAVFQNATFSTLLREESFSRTLQNVYQLQPQLNVMEKYWAAWY
                     TYMNNDVLATGLMFFLLHEFMYFFRCLPWFIIDQIPFFRRWKLQPTKIPSAREQWHCF
                     KSVVLSHFLVEAIPIWTFHPMCEKLGITVEVPFPSLKRIGAEIALFFVLEDIWHYWAH
                     RLFHYGAFYKYIHKQHHRYAAPFGLAAEYAHPVETMTLGFGTVGMPILYVMYTGKLHL
                     FTLCVWISLRLFQAIDAHSGYDFPWSLNKFLPFWAGAEHHDLHHHYFIGNYASSFRWW
                     DYCLDTEAGPEAKAAREEKMKKRATGRVKKNI"
     gene            <265610..>266695
                     /locus_tag="HG536_0E01510"
                     /db_xref="GeneID:59326436"
     mRNA            <265610..>266695
                     /locus_tag="HG536_0E01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284018.1"
                     /db_xref="GeneID:59326436"
     CDS             265610..266695
                     /locus_tag="HG536_0E01510"
                     /inference="similar to AA sequence:RefSeq:NP_010228.1"
                     /note="ancestral locus Anc_4.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139914.1"
                     /db_xref="GeneID:59326436"
                     /translation="MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANA
                     GVTDIVLAVNYRPEVMVETLKKYEKEYGVSITFSVETEPLGTAGPLKLAEKVLKKDNS
                     PFFVLNSDVICDYPFKELADFHRAHGGQGTIVATKVDEPSKYGVIVHDIATPNLIDRF
                     VEKPVEFVGNRINAGLYILNPEVIDLIELKPTSIEKETFPILVEQKSLYSFDLEGYWM
                     DVGQPKDFLSGTVLYLNSLAKNHPEKLAKGDNIVGNAIIDPSAKISPSAKIGPDVVIG
                     PNVTIGDGVRITRSVVLSNSTIRAHSLVKSTIVGWSSTVGQWCRLEGVTVLGDDVEVK
                     DEVYINGGKVLPHKSISANVPKEAIIM"
     gene            complement(<266846..>269182)
                     /locus_tag="HG536_0E01520"
                     /db_xref="GeneID:59326437"
     mRNA            complement(<266846..>269182)
                     /locus_tag="HG536_0E01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284019.1"
                     /db_xref="GeneID:59326437"
     CDS             complement(266846..269182)
                     /locus_tag="HG536_0E01520"
                     /inference="similar to AA sequence:RefSeq:NP_010227.1"
                     /note="ancestral locus Anc_4.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139915.1"
                     /db_xref="GeneID:59326437"
                     /translation="MASNQIYSAKYSGVDVYEFIHPTGSVMKRKSDHWVNATHILKAA
                     KFAKAKRTRILEREVIKEIHEKVQGGFGKYQGTWVPLDIAVRLAEKFDVYDELKPLFD
                     FTQSDGSASPPQAPKHHHASRSDSTRKRAVKSASMSAVMEGNASPTAKSTSLTPGASN
                     ASTVTPRKRGRPSTISRAKKKINTPLQRSQSDLGYPRPAIPSSSIATTELPSIRTSNL
                     ESLAEEEDKQHLPRKHRERFQELDIDDGLSSDIEQHVPNPLGHEEEVSMTNRNDRLMH
                     SHSVSQSSESLATSPSELSDANPFDQRFGSAGTSPVISTIPRYATHSRPQSTDIHDKV
                     NKYLSILVDYFISNEVRSNKSVPAELLLPPPHSAPYIDAPIDPELHTAFHWACSMGNL
                     PIVEALVNAGTNISATNSQGQTPLMRSSMFHNSYTRRSFPRIFELLRDTVFDVDSLLQ
                     TVIHHIVKRKSSTPSAVYYLDIILSKIKDFSAQYRIELLLNYQDQSGDTALHIAAKNG
                     DKTFFNTLIANGALSTITNKDRLSPDEIMNEQYEQIFARSQGNLSNSNQFLTNGKTAL
                     PIGSTTPITAINTSDFMMFSSQAATQISRSIPQVASDMKRLAERFNELYQQREIDLKN
                     MERTLHSMTKTIKGVNIRTMEILGVTETDKFDAIIAKQLEETRILKEEVNGNKNRLLA
                     IIEKQQLLKINRYTKDEEISKMEPSDLDDVETRVKLMTELNMSRLKMKVKLKKIMKLM
                     GDNTKIHKYRKMISEGTELNTEEVDDCLDVILESLAVK"
     gene            complement(<269668..>271563)
                     /locus_tag="HG536_0E01530"
                     /db_xref="GeneID:59326438"
     mRNA            complement(<269668..>271563)
                     /locus_tag="HG536_0E01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284020.1"
                     /db_xref="GeneID:59326438"
     CDS             complement(269668..271563)
                     /locus_tag="HG536_0E01530"
                     /inference="similar to AA sequence:RefSeq:NP_010226.1"
                     /note="ancestral locus Anc_4.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139916.1"
                     /db_xref="GeneID:59326438"
                     /translation="MVLLDEVGIEKVCYEVVTKPPPHIRLESNEQFVYFKHVRYHTAQ
                     GIAAVLSHPKSLQFDTLSDRVQNQHQFELPQHRAALVIHGHQSHKNHPYQTLLASRLS
                     EMGIFVIRIDFRGLGDSEDVKDPDVGRTISQDLEDIDTIYEFLSSPRLCKELCGFQLS
                     LDSIIAHSRGVVSMFEYARANPDKYIPNLVNCAGRFDGQGLLDKRLKASPEWRKEGGF
                     WCDMPRFGAFERTWIPCSETMSAVNVDTSAFKSIDARTWILSCYGANDEIIPLDAAAN
                     YSNLFGGRHTLHIINGANHNFLGLPGDFNETQLPLRKGRVNYGYRVVELIADHLSRER
                     QLDRFYQLTSQIRGTTSNPADIIARWPLPHDFSKVSNFRDLGGYQTMFNNRRIKTGCL
                     YRCANPCDITEEAQDYLMSTLHVTRIFDLRAVGEAADNGIFPDTNLVQNLAFNKNTSL
                     SPDDMAEHYQGLLISSYSFPKAYMIVLKNSTNAIKKFFRYILEGNCHPNSSLVFHCTA
                     GKDRTGILGMLLLSILGVDEDTISKEYELTTIGLKTEVKLIKKLQARGDLYYSMLGKD
                     CEKLTQIYQLTPEKMSKTLLSSSYEAMRFFIDEFNAEFHSIEQYFMNVLQFSTHDIGK
                     LRDLLLE"
     gene            <272369..>273640
                     /locus_tag="HG536_0E01540"
                     /db_xref="GeneID:59326439"
     mRNA            <272369..>273640
                     /locus_tag="HG536_0E01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284021.1"
                     /db_xref="GeneID:59326439"
     CDS             272369..273640
                     /locus_tag="HG536_0E01540"
                     /inference="similar to AA sequence:RefSeq:NP_013484.3"
                     /note="ancestral locus Anc_4.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139917.1"
                     /db_xref="GeneID:59326439"
                     /translation="MTIQSNGSWASDLTQPQKKALKQVWTYLFHFWGIPVNGEAAFRK
                     QQGPSSGPFESSSDAGKKKKGLFGKLQASYYGDDQESSGNDNIEEVESEYVADKIHDS
                     LKELDPEATRDEFWEMLRFEEPDAVILKFIRARKWKVDKALSMIAHSMHWRVDETQVD
                     DILNGGETAIFRNNEQGVIKNLQLQKAFISGRDKQGRPIILARPKLHHSHDQSEAEME
                     KYCILVIEQARLFFKSPVETATILFDLSGFSMSNMDYGPVKFLINCFEAHYPESLGHM
                     FIHKAPWIFHPIWNIVKNWMDPVVVSKIKFTKNLTDLNDYIELDQLPKYMGGESAMDP
                     DAFTKPDESQDAKMQDEAGRAQILSERNDLIQKFVAATVSWIEADDDEESSKCLNEKV
                     TLGSQLTANYSELDPYIRSRSMYDVNGMLKA"
     gene            <273787..>275895
                     /locus_tag="HG536_0E01550"
                     /db_xref="GeneID:59326440"
     mRNA            <273787..>275895
                     /locus_tag="HG536_0E01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284022.1"
                     /db_xref="GeneID:59326440"
     CDS             273787..275895
                     /locus_tag="HG536_0E01550"
                     /inference="similar to AA sequence:RefSeq:NP_013485.1"
                     /note="ancestral locus Anc_4.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139918.1"
                     /db_xref="GeneID:59326440"
                     /translation="MDSDLDFVIDSIVRSNTETPQLLLKSWLDQFYSISATRGLSSPQ
                     LIKMIIFICNSPTLAMTTRLYIAERCLLPNDFISQELIDVVISQLGTATAISDSRSQV
                     PEKIQVSLCRWLVHVFFLVTARDETNALQPSGSIWLHLWQFDYLQHWLTYIVLWTTTS
                     PKDIKRWKVILLGRVGSKPNYRDSQACSTLLLRRFESVGGKSELITRTIADLRCNQRR
                     LKSLQSFQYDKEFITKLRSILLNSSYSNFTDDILNELMTSSLDQLKCLAINEGSRISS
                     LDTSAEGVPLLNTQSLSKLASQWDCIVEPLNAERFLGNVRTSPCHFYLLSLTDEHKFW
                     TIACKWLTIQLGMFFKNPGDMTGVQNIIKICQIYGSLTSFIIREFFSAEYLNANPEGF
                     LLLFDGLFSLPVSFSINQHTFARDAMQVVAISFLNKKMKQTIFPSIANAIVMFLRHSR
                     FGDGKDWAASFSDLIQSIHELLVSTLTNIIENRLTTITLVSTLKSILALQHHSGKYKL
                     KYVIAPPNIIRRQFISDDPLLLDACCYYLVRTKDFLLDENPSNRYVQFQNNYILDLTN
                     YLWRNKMVETKSFAGIPSEFLRAVIDNLYLSDVAMKAKAPFSITGVPALSYAFIAKLR
                     DLQPVHDARIRYFGPLSDESFRALKRSEKFARWLEGVLSLKELKIEVLKAFDETGPYN
                     NVAAFLFTYLKSLSQYSRVI"
     gene            complement(<275936..>278581)
                     /locus_tag="HG536_0E01560"
                     /db_xref="GeneID:59326441"
     mRNA            complement(<275936..>278581)
                     /locus_tag="HG536_0E01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284023.1"
                     /db_xref="GeneID:59326441"
     CDS             complement(275936..278581)
                     /locus_tag="HG536_0E01560"
                     /inference="similar to AA sequence:RefSeq:NP_013486.3"
                     /note="ancestral locus Anc_4.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139919.1"
                     /db_xref="GeneID:59326441"
                     /translation="MLNEVNCFKRLLHTTARTAKTPKLVQICEKWKHKTAEGVPELLR
                     QDRDKDIYILSMFPYPSGVLHIGHLRVYAISDALNRFYQLKGYNVLHPMGWDAFGLPA
                     ENAAIERQVDPSEWTAQNIAKMKEQMKSMLANFNWEREITTCSPDYYKFTQMIFLKLF
                     KHGLAYQKEAEINWDPVDKTVLANEQVDAQGRSWRSGALVEKRLLRQWFLGITNFAAE
                     LKHDLRYLKNWPSKVKSMQNNWIGESNGAELKFATNDPDFPSIEIFTTRAETLFSVQY
                     VALALNHGLVAKYALTDASLQAFIKKAELLPEDSKDGFLLKGVYSRNPLTQEDLPVYV
                     APYVLKDYGYGAVMGCPAHDERDFQFWKTNAAGIPVRRCLDVLPGEEEAGELPFTSKD
                     AVMSDSTLEYRGLYSAEARKQIVQKLHSQGLGRNVIQYKLRDWLISRQRYWGTPIPII
                     HCSHCGPVPVPEEDLPVLLPKVTGLKSKGNPLSQIPEFVDVNCPTCKAPAKRETDTMD
                     TFMDSSWYYFRFTDPENPKLPFGSENANKLLPVDMYIGGVEHAILHLLYSRFIAKFLG
                     SINMWDGGLLKNEPFKRLITQGMVHGKTFIDPESGKFLKPSELRHVSNPEEPVLIKAT
                     GAKPIIRYEKMSKSKYNGANFNDCISKHGADATRAHILFQAPIEDVLNWEESKIVGIE
                     RWLVKLLSLTSTISNRGKFDVNYTTPKDLKQEEADLHATVQKLIKSITESFEVYISLN
                     TVISDYMKLTNALDTAAKKGLVRDALLMHSLKKLVAVIYPVAPSISEEATEIINKAQN
                     WAWNQYRWPTCEPVIEPSTLKYQIVVNGRMRFMLTAEKDFSKCDMETILSRLLSLPEG
                     RKYLTNRKIKKFISKNNIISFMLAK"
     gene            <278775..>282086
                     /locus_tag="HG536_0E01570"
                     /db_xref="GeneID:59326442"
     mRNA            <278775..>282086
                     /locus_tag="HG536_0E01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284024.1"
                     /db_xref="GeneID:59326442"
     CDS             278775..282086
                     /locus_tag="HG536_0E01570"
                     /inference="similar to AA sequence:RefSeq:NP_013487.1"
                     /note="ancestral locus Anc_4.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139920.1"
                     /db_xref="GeneID:59326442"
                     /translation="MARKRSSSRLEVGDEEVDNDLRSLAAEQETAREQQRTRKRRYQY
                     APMTQVDETNARSQSATQDEIGEAIPSGYIKKISLRNFMCHENFQLELGPRLNFIVGS
                     NGSGKSAILTAITIGLGAKASDTQRGSALRNLIREGTHQAKITLHLENGRHGSYNPEE
                     FGREIIVQRTIKSDGTSTFSLQSETGHEISSKKKDVQAVMDYFSLPINNPMCFLSQDA
                     ARSFLTASTAHDKYVLFMKATLLQEVSESLEKAQEINHRAQINMAYHLRNLQDLKDEY
                     EESKRLLQEFNKAADLNERKRLLQGKSLWIDVKQNTEANDRLKAQIKAQEERIRRYMD
                     KIRSKKDRIERFMVDRDAQTGSIDIKVAELSDKAESHKQAERAMQAAESRYEAEREKQ
                     ESLKTAMKECEAKVKSLDALISRTEQELRDEMGGDREQMRQEILKIEADNEELRSKLI
                     SIAEEEHRLKGNEKTLIDRRQADVNNKERSIHSKRNELQQITRENSDLLSNFDRQMPF
                     LLKKIKERATEFKVIPVGPLGIHVTVKSGFENWSRAIQRQLSPWLSNFLVANQEDSRL
                     LRQIIRSCDIRANISITNYSLGRTFRYRKAQTQYPSILDALEFSSTDIEFFFIDLAYV
                     ANIVLIKDRNEARQYLIQRPQDVRLALALRDRSSGYQIVGGRRIDTVTYHSRSLLKVK
                     SSTNSDSTYVNDLIRQEMMELQGIKKRYDVELEHTRSVLRTLRNSYLKFEADLAKNDS
                     TIEVLRRKTNKVVDTGSLESAINEKRKTQEIIASYEATAADLSAKIKMLEEEIKPLKF
                     KFDETRNILKSAQEEVERLRCGVESRSAKIQKWKDDIEDMQREIEESQGLIQSKRENV
                     NSLEKGIREQKANANEFCSQEQADNSDLPNNQQEIRRELDRLSRMILRAEREVGISQQ
                     QAVELFEKSRSKYREAQDKCLEINQTLDMIFKSIQARVLNFQSAQRTTCLDADLDFRA
                     SLRVRRLSGHLSFINTSKQLEIYILTPNDENARSVDNLSGGEKSFAQMALLLATWKPM
                     RSRIIALDEFDVFMDQVNRKIGTSLILKKLKDSSRTQTIIITPQDIGRIADIENSGVT
                     IHRMRDPERQNNSSS"
     gene            complement(<282184..>287169)
                     /locus_tag="HG536_0E01580"
                     /db_xref="GeneID:59326443"
     mRNA            complement(<282184..>287169)
                     /locus_tag="HG536_0E01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284025.1"
                     /db_xref="GeneID:59326443"
     CDS             complement(282184..287169)
                     /locus_tag="HG536_0E01580"
                     /inference="similar to AA sequence:RefSeq:NP_010225.1"
                     /note="ancestral locus Anc_4.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139921.1"
                     /db_xref="GeneID:59326443"
                     /translation="MELIQGLIQPPKVQSVDETIPTLSDRAESATLIGDRRSAVLGLK
                     AFSRDYREAVIASGLKPLLNTLKRDFEDESTLKAILETLLILFIRGDGNTDLTRSWIS
                     QQSRLQNGKYPSPLLMKQEMQQVDQFSLWIADAITQSDEIVHLILELLETENFHIRLY
                     AIQLLEAVVATRPLRSRNAINSLPTGISTLVSLLDDAHDVVRDEAVLLLMAVVNDSPH
                     VQKLVAFENIFDRLFSIIDEEGGLRGSLVVSDCLSLINNILKFNTSNQSLFLETGNLP
                     RLARILDEPLSEEDFLWNDQRIINIKTAMDIVSLTVEPGSTATRNNQTRLLEANILMI
                     VLRLAFYDGTPKRVRPIALLTAACIISGNEVSQREFGKIDVPFFDPASPTSSSAEEAT
                     LVPVVRLLVHWVLFTNSVQVFQIRVASLELIKAYLYDNLAIQEKFLSQQIGAYGEVSN
                     GQEKDDHLNANLLEAILDYDPDLKLNPFKVFFAADLFMFLFQTDNKASDKMRELMLHV
                     KTGTEVDGVEALSSVQALSELLLASLSSEDIRIPISYVTLLIFWLYGDQKAVDQFLSQ
                     RSIVQSLSSFCYQLQDDDATIKCLVTMLLGVSYEFSSQASSFARKDYYEYLTKTLGQD
                     NYLSRINQFKEKSLLNEEQSTGTVLTAAIDETGLPQVYFSPIFIHFFAANSYRIKTAL
                     LHKPEEEPLLKLSFELFEELQNECSAVKKRISSLEEASRAKIDQLTIEYNELEKAYDL
                     CKEQRTAADEKYSFLTQKSDRMEKDLAEAVSTINYLKEQESRLTNWKEEKIKEIKDKE
                     SKLNELKEKSSLLEKDLKNIRTEKEKAENGINKMNRELLKLTKENEKLQKTIDELDKA
                     KNKASKDLEGKQRDLEDMKRQYQILQEQNQKSLVEINEWEGKYRAHDQLVSKLTEKLR
                     SVAESFQETQKERDDLLITVESLQAKHDQSLAKCNEELSALSSKHSDLIHSQEQNVLQ
                     LEQLRRKVKELEDEKKSNSLSLADRESNITKLNQELQSLTNQKQLLEKTNDELKESIA
                     ENESSNKETNGVLARLQKDLQLSEEKVTILESKKQAAENLVQTHQHELEEALKSLKAL
                     QDECKYKAETVTSLENEIKNKQTTHALDIEKYKSELETLRKEGAKISSLVSDLKKTVA
                     GAKQEYAKLEHELQRTKQDQKNQQEKSCKEIAQLNTIIENLKKEAEELRAKLKQTKEQ
                     KDILDKDLRATKEHESSLVTEVVSIKAIMEEKNAALEELEKAQSDALAGMQQPKQNAK
                     RMTKKSGSEVQDQQAALQKTTEGVETKGNICEEGSNSVTEKYSQEISALESKIDKVER
                     EYENAKTQLELYQSNFAQLKSESEKSLKERQDKIQTLGHENANLREKAEKTDQECRKL
                     KEATGKERAELKAKLHALERTIDERTEDNKVLQDDLEKMKGEITKGLDSKVEALKKDR
                     FTLEQKVKKLTADNLEKVQSLQSQLDTLSKDNNGMKAELDGFLNLLTENATIENGNID
                     LKERLKRLKDKVAAGEQISVKHKNVIAEHENQINSLTDRNASLSAELTSKESELSQLK
                     LLLETKSKEADDLQETKLSEMQELREQLVALKNQNEELLNKSKNNNEIDDLMLLVTDL
                     DERNARYRELLKNNGIDLPSDIDEDEDEDEEEEEDEEGGEDSSDSQGGDDK"
     gene            <287547..>288182
                     /locus_tag="HG536_0E01590"
                     /db_xref="GeneID:59326444"
     mRNA            <287547..>288182
                     /locus_tag="HG536_0E01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284026.1"
                     /db_xref="GeneID:59326444"
     CDS             287547..288182
                     /locus_tag="HG536_0E01590"
                     /inference="similar to AA sequence:RefSeq:NP_010224.1"
                     /note="ancestral locus Anc_4.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139922.1"
                     /db_xref="GeneID:59326444"
                     /translation="MSSYHSKPIGYSSTVFSAGPNIDLKELEIQEDWCGRPASSWAVR
                     RIGLLQAKVEQFSYKIYHSSRYGKHHLSRLIPGYVLRQMANEAFGFDGWKMQVLHVEA
                     HEKQSSSAGASVGDEGFKCSVLAEAEVEISLEDGTNTRAGGFGCATLSSKGESYAKAK
                     KEAVNDAFKKALLSFEKIILEHGIKVENNYYVGGVYASDMEKHVQVDNVHQ"
     gene            complement(<288200..>292198)
                     /locus_tag="HG536_0E01600"
                     /db_xref="GeneID:59326445"
     mRNA            complement(<288200..>292198)
                     /locus_tag="HG536_0E01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284027.1"
                     /db_xref="GeneID:59326445"
     CDS             complement(288200..292198)
                     /locus_tag="HG536_0E01600"
                     /inference="similar to AA sequence:RefSeq:NP_013488.3"
                     /note="ancestral locus Anc_4.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139923.1"
                     /db_xref="GeneID:59326445"
                     /translation="MRNLIVLNKGKLRPTGSPYQEVDPEISFKLLSSAFDTLTDSITC
                     VTGALEIGVVEVTQFLKHGAKNVLASINIDTFDDELLSFVHFADLNQVVLVFKQGDII
                     SATYDPARYDPNESVVEIVGTIDNGIEAAEWSPDEETLALVTCDRKVVLLSKLFEPIA
                     EASLAVDDLKKSKHVTVGWGKKETQFRGKGARAVEREALASLKASGLIDNQLRDPTMP
                     YMVDTGAITSMDTHAVNISWRGDCEYFAVSTVETVRTEEKSSEVQRRAIRVYTRDGQL
                     DSASEPVDGMEHGLSWKPQGSLIASIKRVAHLENEQALELIFFERNGLRHGEFDTRLP
                     VDEEIKSLAWNCNSEVLTIVLKDRIQLWTTKNYHWYLKQEVYANNVSFVKWHMEKDFT
                     LMFGDGDEVNIVDFAYKMTQGPTLEPNDNGMSLVIDGKSVGITPLKIANVPPPMSYRE
                     FCAPDNIIDVAVSLLNENYAALHRNGLSLASISNLKDMRKGKHPTVVCELQKSEFASE
                     LDSLRQVAFINDNIIGVLLDSDNLSRIALIDTEDITQPRISCIVDTYDRVVLLRSSFD
                     YNHLVYETRDGTVMKVDAAGQLEQISRFPQLVRDFRVKRVHNVPKLESTAWESESSEM
                     VAFGITSSGKLYANDTQLASAVTSIEITDSFLLFTTAQHNLQFVHLNSLEFKPVPLTE
                     EGVVDERIRAIERGSTLVSVIPSSSAVILQAPRGNLETIYPRIMVLSQVRKDILAKRY
                     KEAFVCCRTHRISLDILHDYAPELFYANLTTFIDQVERVDYLNFFISCLCEEDVTETK
                     YKDTSSSSMSKPFELEPAPLTEMQEYMKKKMFDPSKSKVNRICQAVLKVLLSNSTYRE
                     KYLQTIITAYAFQKPQNLEDALRLIASLDNDETKESAVTYLCFLQDANVVYKAALSLY
                     DVQLAVSVAQKSQMDPREYLPFLQSLYDNKPLRRQFLIDDYLKNFTKALDHLANIDEA
                     AEDVSEETIAYVKNHDLYEHALALYRYDTKKQNTIYNIYAKDLSSKQEYYDAGIIYEM
                     LGKQRNAMECYTSAKKWEEAMAIAATHFPDEVNTLAEELISSLTFEHRYAETAVIQLE
                     FMGNIENAMRDYCLAYQYDTACLIAAKRGKPELIAKVVDPGLGEGFGVIAELLADCES
                     QINSQLRRLRELRTKKEEDPYGFYGQEAPQEDDVSIAPSETSTQESFFTKYTGKTSGT
                     AKTGASRRTAKNKRREERKRARGKKGTIYEEEYLVKSIGRLIDRLDQTRPDAIRLING
                     LCRRSMKEQAHQIQKNFVDLTQLLKDNIKEIYTISEKDRERVDENGEIYYIPEIPTPE
                     IAPFPVSKVVNF"
     gene            complement(<292413..>292796)
                     /locus_tag="HG536_0E01610"
                     /db_xref="GeneID:59326446"
     mRNA            complement(<292413..>292796)
                     /locus_tag="HG536_0E01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284028.1"
                     /db_xref="GeneID:59326446"
     CDS             complement(292413..292796)
                     /locus_tag="HG536_0E01610"
                     /inference="similar to AA sequence:RefSeq:NP_013489.1"
                     /note="ancestral locus Anc_4.241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139924.1"
                     /db_xref="GeneID:59326446"
                     /translation="MEYPSNVILLLLQLLLQRQQTLAHHDKSLDLTQLLREPIIDKEV
                     LAQFQNHKLVKMYSPELCNLHLRALRGLVTDLFTYGIPGAEGLDAQETNVITLANYYY
                     NKRLAELTLTQLPELRQEIKSLLPE"
     gene            <292975..>295613
                     /locus_tag="HG536_0E01620"
                     /db_xref="GeneID:59326447"
     mRNA            join(<292975..292978,293047..>295613)
                     /locus_tag="HG536_0E01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284029.1"
                     /db_xref="GeneID:59326447"
     CDS             join(292975..292978,293047..295613)
                     /locus_tag="HG536_0E01620"
                     /inference="similar to AA sequence:RefSeq:NP_013490.3"
                     /note="ancestral locus Anc_4.242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139925.1"
                     /db_xref="GeneID:59326447"
                     /translation="MDRSIAKGLGDKLYEKRKSTALELEKLVKQCVAEGDYARIDKII
                     DELCRDYAYALHQPMARNAGLMGLAAAAIALGTNDVGNYLNHILPPVLACFGDQNDQV
                     RFYACESLYNIAKIAKGEILVYFNEVFDVLCKVSADTENSVRGAAELLDRLIKDIVAE
                     TASSYISVVHSSARDVPPRVKTDLATGDVYQGDYEQDSTLAFSLPKFIPLLTERIYTI
                     NPDTRVFLVDWLKVLLSTPGLELIAFLPSFLGGLFTFLGDSHKDVRTVTHALLDLLLH
                     EVDRISKLQSDLRRKEAERQKAIEDKAEGSSKKVDGILIAEKKKSLMSALGKLSVENN
                     EHPVETTRQQEEARPQLAEDQNLSLESAAASSLAHLDGEDYIPGQDIRLDFPEIIEIL
                     VNNLASSEAEIQLVALRWIRAILALSPDDFVPFFSKILSLLLKLLSDQDPRISESAQI
                     VNQQLIELCSEYDHLKDPTAISYGSIVNSMTLQFFESKVDARIACLDWLLLIYKKAPS
                     QILEHNDSMFLTLLKSLSDKDGRLIEKALALLSSLCSDSNDNYIKKFLQDLLTLFNRD
                     TRLLKARANFIMRQLCARLSPERIYRVISPLLDSCDGRVFVRMMIQILSTNLVTAPEV
                     EPLRRKLRNGDDGMFFNTLFRSWCPNAISVISLCLVSENYEMAYSVLQAYVNYELSLN
                     DLIQLDILVQLLESPVFTRLRLQLLEQQRYPFLHKSLYGILMILPQSKAFDMLNRRLN
                     SVNSWAWQPSYEKPVYQQRNSSQVSVSCTMDSEASQYSINQRTNNRELLKHFNEACSA
                     NRSMPNDDETYETKLPFLVDSSVKASPSPRAASSDSGSVIHRNSGPKRKSGGDKSLTP
                     "
     gene            complement(<295739..>296986)
                     /locus_tag="HG536_0E01630"
                     /db_xref="GeneID:59326448"
     mRNA            complement(<295739..>296986)
                     /locus_tag="HG536_0E01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284030.1"
                     /db_xref="GeneID:59326448"
     CDS             complement(295739..296986)
                     /locus_tag="HG536_0E01630"
                     /inference="similar to AA sequence:RefSeq:NP_013491.1"
                     /note="ancestral locus Anc_4.243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139926.1"
                     /db_xref="GeneID:59326448"
                     /translation="MSFPIFTCNCCEIQFKSSDLQRYHMKTEWHRYNLKRRMAKLPCI
                     TAAQFAEKLQLSERQRQENEVDEFGFAVLKPKNNARQLLKEKKAKQKHSPLDDRGRRA
                     DIEKQEGSARSSSPTESLASEISRISGFSVDTNTDFGEDTVSEYGFTSESNYDSDNST
                     ADDFSEMGNDRIDIFECIYCGVKHKEIERNVNHMFREHGLYIPERSYLTDLPGLLNYL
                     IDQIVMQKRCFCCNFEGSTLESIRAHMHSKRHCRLPYETKHERERLSQFYDFSSLSED
                     SYESQQSSRNDKEIHFSDSEEDANSESGHTGQEINSNYTTVSVDTTGMELTLPTGARV
                     GHRVGQRYYRQNLPMPSDVSDSRRTVTAADRRMVSGVTEKQYKKGLKKMQQLEKNAVN
                     RQIRQEKTKRVNFQPHYRDELLQ"
     gene            complement(<297140..>299515)
                     /locus_tag="HG536_0E01640"
                     /db_xref="GeneID:59326449"
     mRNA            complement(<297140..>299515)
                     /locus_tag="HG536_0E01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284031.1"
                     /db_xref="GeneID:59326449"
     CDS             complement(297140..299515)
                     /locus_tag="HG536_0E01640"
                     /inference="similar to AA sequence:RefSeq:NP_010223.1"
                     /note="ancestral locus Anc_4.244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139927.1"
                     /db_xref="GeneID:59326449"
                     /translation="MAGHSHRSSIKNGHKGFKSRHSSKGALKRLYKGKVEKAGAEKND
                     NGSSKSNRVLTKLQRKNAAKQLRDQKMASTMEMKKLFEGSNGAEKIVTIIPLASDVSA
                     ADILKGLVSSVESEAEDDTGLVEAPFVKDVHIKSFKSNLKIISPDMGNFMNILDSAKV
                     ADFVVFGLSGTSEVDPEYGEQIIRALELQGIASYMGVVTNLSAVHAKEKFQLDVKQSL
                     ESYFRHFFPSEQRIYNLEKPSDSANALRTLCQKFPRGIQWRDNRGYMVANKVDFIERD
                     ADFGELVIEGTVRGIGFHANRLVHIPDMGDFQISRIERTACSMRRKKGVSDGLSALDD
                     ELHNNFESNQDRETLEEFAPNDAEMEQMPQGEFEYENLEAARYDDHGFLPGREQHTNG
                     VKVPKGTSEYQAKWYLDDTVPMDDEIEDYRTIGGEIDEADNEDMDLDLQDAEEETIED
                     NEQTANEPMFVDLSAEEEARQLSEYRALEKEDREFPDEIELEPTESAIERLRRYRGLK
                     NLHNCNWEVDEKDPQAPPEWGRLLRISNYRNTRAKILKEARNEAQVVAGDRIKLYLKF
                     PKRLLETIRHPNQTALAVYGLLAHEHKNAMVNLSIQRWEEYDKPVPSEEPLLVQYGAR
                     RYRTLPLFSSASNSPNNVHKFESFLQPDTLSIATFFAPVDFTQSPAIYFKESATDPKG
                     LELVGHGSFLNADHTRILAKRVILTGHPFRFHKSVVTVRYMFFHPEDIEWFKSIPLFT
                     KSGRTGFIKESLGTHGYYKATFDGRLSAQDVVAMSLYKRKWPRIAQPLLNM"
     gene            <300055..>300225
                     /locus_tag="HG536_0E01650"
                     /db_xref="GeneID:59326450"
     mRNA            <300055..>300225
                     /locus_tag="HG536_0E01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284032.1"
                     /db_xref="GeneID:59326450"
     CDS             300055..300225
                     /locus_tag="HG536_0E01650"
                     /inference="similar to AA sequence:RefSeq:NP_010222.1"
                     /note="ancestral locus Anc_4.245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139928.1"
                     /db_xref="GeneID:59326450"
                     /translation="MAHENVWYSHPRRFGKGSRQCRVCSSHSGLIRKYGLDICRQCFR
                     EKAADIGFNKYR"
     gene            complement(<300743..>303754)
                     /locus_tag="HG536_0E01660"
                     /db_xref="GeneID:59326451"
     mRNA            complement(<300743..>303754)
                     /locus_tag="HG536_0E01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284033.1"
                     /db_xref="GeneID:59326451"
     CDS             complement(300743..303754)
                     /locus_tag="HG536_0E01660"
                     /inference="similar to AA sequence:RefSeq:NP_013493.2"
                     /note="ancestral locus Anc_4.246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139929.1"
                     /db_xref="GeneID:59326451"
                     /translation="MSIALLHNLVRKNLNFTGELGSSGVIVGPLKEYRTMTTSSYKKF
                     ELDFIKPDLDDRAYRFIQLPNDLKALIIQDPTTDRAAAALDVNIGAFEDPEELPGLAH
                     FCEHLLFMGSKKFPDENEYSSFLSKHGGSSNAYTGALNTNYYFEVNYEHLKGALDRFS
                     GFFTGPLFNQNSTEKEINAVDSENKKNIQNDLWRLYQLDKSLSSSLHPYHKFSTGNLK
                     TLDEIPKSQGVDVREKLLEFYNRCYSANLMKLCILGREDLDTLSEWAYELFKEVPNLA
                     RPLPEYKTSILNEEHLQKLILVKPVKDLRKLEVTFTVPDMDEHWESKPNHILSHLIGH
                     EGSGSLLKCLKELGWANELSAGGHTVSKGNAFFCIDTDLTEQGLENYESVAHIIFQYI
                     EMLKNSLPQEMIYLELEDIARASFKFKQKGSASSTVSSLSKALEKTYIPVQNILSTSL
                     FSKYEPDMITKYVKSLKVENSRIMLISKSLETDLNEKWYGTEYAIKNFSTDLLKKLQH
                     PGLNSKLHLPRPNEFIATNFQVEKLENVEPLEEPLLLEHNQIGKLWYKKDDRFWQPRG
                     FIYSTLKLPHTYASVVNSMLTTVYVQMITDYLKDLQYDASCANLHLSFVKTNSGLDIT
                     ISGFNDKLNILLTRFLEGLKNFRPDRKRFDIFKEKSKQHLKNQLLEIPYSQVSSLYAS
                     LINERSWTIKEKLDVIEKITFEQLENFIPQIYEELYFESLVHGNIKSEEAYQIHSLVQ
                     TLSPNDIRNPQTNNGRIRSYILPLGKAYRFEAELADPENVNSCIQYVIQLGVYDEEMS
                     ATGRLFAQMIHEPCFDNLRTKEQLGYVVFSSSLSNHGTVNIRILVQSEHTTPFLEWRI
                     ENFLEKFGESLREMSDQDFEKHKDALCKSLLQKYKNMKEESNVYTSAIYLGDYNFLHR
                     QRQARIVSQLSKAELIKFYESRIIGPDASKLVLHLKSHIIAGSVDESTLDKALYPKGK
                     LITDIGSFKSQMFIAPARQQPKVYTVHTPKL"
     gene            <303916..>304188
                     /locus_tag="HG536_0E01670"
                     /db_xref="GeneID:59326452"
     mRNA            <303916..>304188
                     /locus_tag="HG536_0E01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284034.1"
                     /db_xref="GeneID:59326452"
     CDS             303916..304188
                     /locus_tag="HG536_0E01670"
                     /inference="similar to AA sequence:RefSeq:NP_013494.3"
                     /note="ancestral locus Anc_4.247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139930.1"
                     /db_xref="GeneID:59326452"
                     /translation="MARLKGFDLLSLGVVSAAGVWMGIRFFEPLVIDRLREDGNLRTD
                     IPVPEYDSNGDPVGSKPMSELRDELVAIQRREKQEADSQPPGSSAH"
     gene            <304357..>306198
                     /locus_tag="HG536_0E01680"
                     /db_xref="GeneID:59326453"
     mRNA            <304357..>306198
                     /locus_tag="HG536_0E01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284035.1"
                     /db_xref="GeneID:59326453"
     CDS             304357..306198
                     /locus_tag="HG536_0E01680"
                     /inference="similar to AA sequence:RefSeq:NP_010220.1"
                     /note="ancestral locus Anc_4.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139931.1"
                     /db_xref="GeneID:59326453"
                     /translation="MGKSNKRSRASKARLNPIGSGRGEQLKDNGLVKKKLQPLLEKLH
                     SAVPNDRAMALGSITVLCEDPYMRKLLLKERLVQTVLSKLLNDNNTDIVVESFGLLRN
                     ISLEEGYDVSTQLWRADIWISIDQGFSKLLESLSALQSAQGQAAKNSSESRRLLFDYA
                     DNLLSLVVALANGSDDILRQVLDRAKLERLFEVIIGLLQYGIAKLPLAVLNTVLDLLY
                     DFSSESFQFIEAVAGNEYLAIFVRSLPDQMNTPGFNELTKVLIQGVYLQFLDMDITFQ
                     QANDIIHAVCNSIKDIDLEQVNKDLSAVCHDEELVKTKDSQVAQKIKHYTAARSNAMM
                     KLQSIEISIDLITAIIEMIASLSEEKKGPLPNPLRETLMVYLPQVFDKLGGEFTSRIL
                     IAWNNLLWLYLTLEINFFKLEGEPYKNLWEFIHSVKEEEIDLKLGKLSVVWALLKTVT
                     MQSEPNGWLSTLQLSNDMDFVNSTIESYNKDMSSSNITREDAIELGQRYCGVLSTYAT
                     FQQQIQINEVIGKFILEQLCSTNLPAVLLADYTNSLFEIYGDENFDYNQPVFVQNNFL
                     DILQTKVVPNLRTQFKLVDKNKDPRTKERCTETFNTLDSFIQYKKNE"
     gene            complement(<306263..>306736)
                     /locus_tag="HG536_0E01690"
                     /db_xref="GeneID:59326454"
     mRNA            complement(<306263..>306736)
                     /locus_tag="HG536_0E01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284036.1"
                     /db_xref="GeneID:59326454"
     CDS             complement(306263..306736)
                     /locus_tag="HG536_0E01690"
                     /inference="similar to AA sequence:RefSeq:NP_010219.1"
                     /note="ancestral locus Anc_4.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139932.1"
                     /db_xref="GeneID:59326454"
                     /translation="MSSLCLQRLQEERKKWRKDHPFGFFAKPARNADGTMNLQKWEAG
                     IPGKEGTIWHSGVYPITIEYPDEYPSKPPKVRFPAGFYHPNIYPSGTVCLSILNEDQD
                     WRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWKAFSRNRAEYERKVAAQAKQYTK"
     gene            <307329..>308240
                     /locus_tag="HG536_0E01700"
                     /db_xref="GeneID:59326455"
     mRNA            <307329..>308240
                     /locus_tag="HG536_0E01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284037.1"
                     /db_xref="GeneID:59326455"
     CDS             307329..308240
                     /locus_tag="HG536_0E01700"
                     /inference="similar to AA sequence:RefSeq:NP_010218.2"
                     /note="ancestral locus Anc_4.250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139933.1"
                     /db_xref="GeneID:59326455"
                     /translation="MTSMDAEEEYDELDDLLDEDPSKLEADSTPEGSSADAGKQANAV
                     EELDDPEVKEMMDDLQKEFSNLMKDGGMKEQEKAEQAANFQKILGMLGDASKTTAKSD
                     GGSKEPQGFKNVVSKTLERLKENGSKVDSNLAKEEKQKNTDDVLSQLLDQLVESGNVG
                     GGQDGEEGVDNAILQILNQMSSKEVLYQPMKEMHAEFIQWLQDHSEDEEHSEKIDTYK
                     KQYHLVGQIIAVFEGDSYTNEANREEITDLLDQLEQLGDSPVSKGFNNANGGNELDDL
                     AKMLEIDGDDKNLGNLDKELQDTCKQQ"
     gene            <308486..>309172
                     /locus_tag="HG536_0E01710"
                     /db_xref="GeneID:59326456"
     mRNA            <308486..>309172
                     /locus_tag="HG536_0E01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284038.1"
                     /db_xref="GeneID:59326456"
     CDS             308486..309172
                     /locus_tag="HG536_0E01710"
                     /inference="similar to AA sequence:RefSeq:NP_013495.1"
                     /note="ancestral locus Anc_4.251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139934.1"
                     /db_xref="GeneID:59326456"
                     /translation="MRTTAVASAVASLALFSRAVLATPPACLLACVAEVNKDSSCDSL
                     NQVVCNGEKNGGAVESCLNSKCPGNDASTAVDAFKQAVSAQGASVGGSSSSSSTASSS
                     STSASSSSSSSSAVSSTSSGSSSVSSAASSSSATSAISSSASSSSAAPSSSAAPSSSA
                     APSSTAAPSSSAAPSSTAAPSSTAAPSSTVSSIYSSSKTSSATIFEGAADMLQVGGTA
                     FVAAAAALLL"
     gene            complement(<309297..>310760)
                     /locus_tag="HG536_0E01720"
                     /db_xref="GeneID:59326457"
     mRNA            complement(<309297..>310760)
                     /locus_tag="HG536_0E01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284039.1"
                     /db_xref="GeneID:59326457"
     CDS             complement(309297..310760)
                     /locus_tag="HG536_0E01720"
                     /inference="similar to AA sequence:RefSeq:NP_013496.3"
                     /note="ancestral locus Anc_4.252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139935.1"
                     /db_xref="GeneID:59326457"
                     /translation="MAPPEVKIDLKPPLNNDFYSTNDRICGSVKIQLKKALSIKTINV
                     ILKGFTETLTKVDPINCYGQHGMMMPVQDNRSYHTLFSYTERVFPPNNVWDAIEGSSK
                     PFKMKPGHYEYEFAFAKIPRQPKCLANHTKGLVCFSRPDETRMPPSYNNLWRDQTKID
                     NLDLYFYSYGKVLYMVQVQMELGKANSWYKPFNKLVREIQLIEFIPDARDLAYEEADE
                     KEEPTNRRQPSTQEVLREEMSGDFNMSPLRWDNDTMTGSVSGNDQTRIYKSSFWIGLP
                     DHRSSVWVEVRSRGLRETYRNDELFCAGSRKFDRVYLVARGDIAELRKWTIVPTKIQL
                     NLLEIATYLSQGVANENFSSLRLASVDNLSKTSPSLLDFENAKVTADKNGSKEGQLEC
                     EIKLRNHPMLKRLKFNEEDYRHRGNRLYSFKTCTIKRVFNFQLLIDWDINGTSRQTEV
                     IIRPMQIFVQTRDNLRNDILPKYIEPPVYSEAAEIAG"
     gene            <310948..>311820
                     /locus_tag="HG536_0E01730"
                     /db_xref="GeneID:59326458"
     mRNA            <310948..>311820
                     /locus_tag="HG536_0E01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284040.1"
                     /db_xref="GeneID:59326458"
     CDS             310948..311820
                     /locus_tag="HG536_0E01730"
                     /inference="similar to AA sequence:RefSeq:NP_013497.1"
                     /note="ancestral locus Anc_4.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139936.1"
                     /db_xref="GeneID:59326458"
                     /translation="MAFGITPGTKRLISTTPASLFVNKFFKNVVDAAPKEHIVRELVR
                     PIGMQTPPTSQTVYSKGNSFREMFDRDKTEKRSQELGVEFSKSGMYELHAFQKHGGKM
                     FISPKSYWRADRALYFPHLKGTSLSGLTKDLEETLKGKTSVVRLFTNKVGDDLSKQYF
                     QNRELDLDYLGKDLEKLATSNTQIVEVSFLENAVKSIIAKLSAYKLRSLIPPLRHANY
                     FQCDRDQLPFTVRESLEINNIYTGYVIVVDPDLKIRWMACGAASEDEFKLLWKCVRGV
                     RKEFAPPSQASEAL"
     gene            <311955..>312155
                     /locus_tag="HG536_0E01740"
                     /db_xref="GeneID:59326459"
     mRNA            <311955..>312155
                     /locus_tag="HG536_0E01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284041.1"
                     /db_xref="GeneID:59326459"
     CDS             311955..312155
                     /locus_tag="HG536_0E01740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139937.1"
                     /db_xref="GeneID:59326459"
                     /translation="MLARFYSSTPIRPKSQPPSRHALLYSRWARPVGKVLMLSIGSYY
                     SLMYLWEYLEKKELEYEKLNRV"
     gene            complement(<312237..>313505)
                     /locus_tag="HG536_0E01750"
                     /db_xref="GeneID:59326460"
     mRNA            complement(<312237..>313505)
                     /locus_tag="HG536_0E01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284042.1"
                     /db_xref="GeneID:59326460"
     CDS             complement(312237..313505)
                     /locus_tag="HG536_0E01750"
                     /inference="similar to AA sequence:RefSeq:NP_010217.1"
                     /note="ancestral locus Anc_4.254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139938.1"
                     /db_xref="GeneID:59326460"
                     /translation="MLSRRFFSTGSVLSKIKVKNPVVELDGDEMTRIIWDRIKNRLIL
                     PYVDVDLKYYDLSVTSRDATQDKITVDAANAIKKYGVGIKCATITPDEARVKEFNLSQ
                     MWKSPNGTIRNILGGTVFREPIVIPRIPRLVPGWEKPIIIGRHAHADQYKATDAVIPG
                     PGKLELVYKPADGSEPKTMEVYDYKGAGVALAMYNTDESIRGFAHASFKLALNKRLNL
                     FLSTKNTILKKYDGRFKDIFQELFDAEYKSQFEAAGISYEHRLIDDMVAQMIKSKGGF
                     IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQHQQGK
                     ETSTNSIASIFAWTRGLAKRGELDNTPEVVNFANLLEAATLNTVQEDGIMTKDLAFAC
                     GRTDRDSYVNTNQFLEAVEKRLQKEINSVE"
     gene            <313816..>314892
                     /locus_tag="HG536_0E01760"
                     /db_xref="GeneID:59326461"
     mRNA            <313816..>314892
                     /locus_tag="HG536_0E01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284043.1"
                     /db_xref="GeneID:59326461"
     CDS             313816..314892
                     /locus_tag="HG536_0E01760"
                     /inference="similar to AA sequence:RefSeq:NP_013498.3"
                     /note="ancestral locus Anc_4.255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139939.1"
                     /db_xref="GeneID:59326461"
                     /translation="MSDGLFNQPFVYCGVCHRQSTREDPLHLTSCAHILCSEHLNTTA
                     CPICKNRDVMAIRLVENKQLPQDIGDLFRPMSTLLENLYIVSQFQSSGLVNQCHYYQE
                     HCIKLREKCARQRQLLCQAKHELDSVARLKSRITELEAVLAKQEDSSGQLKSTETSVF
                     TALKPPDTVDLTADAGDDIAAQRDEHCFLRKLKNSSPLRHKLQRQMKPLKVMPRSSDA
                     GEKTFSADGAIAESTQLNGLTSPSGDYYGNPSNSSLLEGRSRNSAAISNGDCGAKKAN
                     VMNQSQFPSALDKLRVVKRNHTFNNVIGASRGHQGLTPHMRSSSSMQTQTGLLMRSNT
                     SRQRSSGSQSLIGKGTNNRFRRIK"
     gene            complement(<315107..>315328)
                     /locus_tag="HG536_0E01770"
                     /db_xref="GeneID:59326462"
     mRNA            complement(<315107..>315328)
                     /locus_tag="HG536_0E01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284044.1"
                     /db_xref="GeneID:59326462"
     CDS             complement(315107..315328)
                     /locus_tag="HG536_0E01770"
                     /inference="similar to AA sequence:RefSeq:NP_013499.1"
                     /note="ancestral locus Anc_4.256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139940.1"
                     /db_xref="GeneID:59326462"
                     /translation="MLRQQLVRFSTRRAFSSSMRSQVHFKEGVYSNIPVKIHNRKIPF
                     ALIHFGFFSLGFLVPFFASYVQLKKSGIL"
     gene            <315712..>315894
                     /locus_tag="HG536_0E01780"
                     /db_xref="GeneID:59326463"
     mRNA            <315712..>315894
                     /locus_tag="HG536_0E01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284045.1"
                     /db_xref="GeneID:59326463"
     CDS             315712..315894
                     /locus_tag="HG536_0E01780"
                     /inference="similar to AA sequence:RefSeq:NP_010216.1"
                     /note="ancestral locus Anc_4.257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139941.1"
                     /db_xref="GeneID:59326463"
                     /translation="MSAIAPITGTLKKRILADIFIGFALGGAMASYWWWGFHKDVINK
                     RETYYAQLAEQKKLEN"
     gene            complement(<316177..>318177)
                     /locus_tag="HG536_0E01790"
                     /db_xref="GeneID:59326464"
     mRNA            complement(<316177..>318177)
                     /locus_tag="HG536_0E01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284046.1"
                     /db_xref="GeneID:59326464"
     CDS             complement(316177..318177)
                     /locus_tag="HG536_0E01790"
                     /inference="similar to AA sequence:RefSeq:NP_013500.3"
                     /note="ancestral locus Anc_4.258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139942.1"
                     /db_xref="GeneID:59326464"
                     /translation="MSSQWNTRHFSKKLGGSLCKVLREISSEDQILVLQPEMVSVIGE
                     FVTFSQLTSSTPVRKIVVLSDQTITDLSNILASTIAMQLVFLIDVRADLAIPAALPDI
                     LGKLNLESVNLIYCTWETQKANSLLNRGSDDDFKIPHFIQHQLPKGIDVRLHPLAMLA
                     FPQIDDNLLVGNFLFNSDGGNMYSPNTCSMQSATRAILLDNMANCLHTLMKETKSIIT
                     DAIAFGEESEKLLHLLRGRIEAGEDDEEAFIKDTLYGDKYSGIEKDLVVIERDMDPLT
                     PLLTQLTYSGLLDEIYGLSTDGKVNGLEDVALKYRTDEIWDDLKFMNFGALGPQLNQM
                     AKDLQDKYDARHKAESVGEIKEFVESLSSLQAKQKLLKVHTTLSSNVLQEVENNASIQ
                     FNRILELEQNILLGNLDHKSSCDSLLELIYEGEVSLKRILRLICLSSICKYGLRDKDY
                     DLLKRELIDTYGIETCFQLEKLTVSGLFSSKGLLANHSNSAWRKEYRYISTWLDTLPP
                     VEDEGTEVPSRKGGHDAANPRDATFAYCGVIPLVVRFVQLLYDRSVVSKNYASQQPYI
                     ISRRPSLAKIGGLFEQIYGRANVVHEESWLPDLKKNKKRVTIGQKDSKTNDITIIAFL
                     GGVTLGEIATLRFLQNSLQAKNINKRFIFVCDGIINGSRYIP"
     gene            complement(<318400..>320730)
                     /locus_tag="HG536_0E01800"
                     /db_xref="GeneID:59326465"
     mRNA            complement(<318400..>320730)
                     /locus_tag="HG536_0E01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284047.1"
                     /db_xref="GeneID:59326465"
     CDS             complement(318400..320730)
                     /locus_tag="HG536_0E01800"
                     /inference="similar to AA sequence:RefSeq:NP_013501.1"
                     /note="ancestral locus Anc_4.259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139943.1"
                     /db_xref="GeneID:59326465"
                     /translation="MAPKAGSSASSSKKKNSSGASNDGLKASKFKLPAEYIARPLPVK
                     KYGTKDTCTVVVHPNVLKELEISNGSVCVISKLGTAGVVAVAKPGEEDSHPSNVVMIS
                     DTLRAVGNVIFGDRLEIKKIRSQPAYASTVTVGSSVTVEALAEKKIEQLLNDCGIIMP
                     GMTFENFDLGNGATCKLCIADVVDDSLPDLSRCQISDNEDNGIEDSLYLSLPVLYRKG
                     TTEVKLTDNLEPDAKYNLPQALNYDVVGGLAKEVNVLKNTIELPLHQPSLFTQFAVTP
                     PRGVLLHGPPGTGKTMLLRCVANTSNAHVLTINGPSIVSKYLGETEAALREIFDEARK
                     YQPSIIFIDEIDSIAPNRSHDDSGEVESRVVATLLTLMDGMGAAGRVVVVAATNRPNS
                     IDPALRRPGRFDQEVEISIPDADARLDILTKHFSKMSPDRHTLSQDDIKRISLKTHGY
                     VGADLVALCRESVMRTIARGISEGSTESLKVSVEDVEHAMTEIRPSAMREIFLEMPKV
                     YWSDIGGQEELKRKMVEMIQLPLEASATFSRLGISAPKGVLLYGPPGCSKTLTAKALA
                     TESGLNFLAVKGPEIFSKYVGESERAIRDIFRKARAAAPSIIFFDEIDALSPDRDGPS
                     TSAAGHVLTSLLNEIDGVEELKGVVIVGATNRPDEIDPALLRPGRLDRHIYVAPPDYA
                     ARLQILRKCSMKFSHDEKPDYDIEELAQKTEGCSGAEVVLLCQEAGLAAIMENTDTKS
                     VKARHFEKALSGISRGITPEMLEYYQAFAARGGISA"
     gene            <320909..>321532
                     /locus_tag="HG536_0E01810"
                     /db_xref="GeneID:59326466"
     mRNA            <320909..>321532
                     /locus_tag="HG536_0E01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284048.1"
                     /db_xref="GeneID:59326466"
     CDS             320909..321532
                     /locus_tag="HG536_0E01810"
                     /inference="similar to AA sequence:RefSeq:NP_010214.2"
                     /note="ancestral locus Anc_4.260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139944.1"
                     /db_xref="GeneID:59326466"
                     /translation="MPGIVRNVVARAFKSAELPPALRERVLSRQKEGNIQRLEKLAKS
                     LQPGEYHIELQAESELVKCFYPTKFARVELPNGKNYSNKQLEMLGENLLLLNMNKTFL
                     NLFKRSEQDISGFDFNFAAKMDHMSSWKKDSPELIRRFLRNKKLTNLARLPAPSNRIP
                     ERIQHGFDRKAFSAVIGYISVTNELTIVSKFLREKITNPIARAILLR"
     gene            complement(<321587..>325417)
                     /locus_tag="HG536_0E01820"
                     /db_xref="GeneID:59326467"
     mRNA            complement(<321587..>325417)
                     /locus_tag="HG536_0E01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284049.1"
                     /db_xref="GeneID:59326467"
     CDS             complement(321587..325417)
                     /locus_tag="HG536_0E01820"
                     /inference="similar to AA sequence:RefSeq:NP_013502.3"
                     /note="ancestral locus Anc_4.261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139945.1"
                     /db_xref="GeneID:59326467"
                     /translation="MATVFTEKGLDDLFQSLREVSNDDAVEIFENRVSTIRDENLMEQ
                     PSDEAVKERFLKPSNVLPWSLLDTVQSVPQLDFMKDDDQISINKYDYKGLVKIPGPLG
                     RTSYHLRRKGIEGRICGYKEGVNLKEVANANASNSLSLNRSISSHSNTTRGSTSQLPF
                     TPGGISMNAIHGSAQGISLTEKVTKLLHKDDQGLFDVPSGLERGIRPLAPNVKNETKP
                     LSDVKELNDVNNDFNVEEELTNERLRTEKETDYETVSTTPKEQTGGTALPDIDDLLPM
                     GIDFARNVPSTQKKLERKEWAHVVDLNHKIDNFAELVPNPARTWPFELDTFQKEAVYH
                     LEQGDSVFVAAHTSAGKTVVAEYAIAMSKRNMTKTIYTSPIKALSNQKFRDFKETFDD
                     VGVGLITGDVQINPEANCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDQDRGV
                     VWEEVIIMLPQHVKFILLSATVPNTFEFANWIGRTKQKNIYVISTPKRPVPLEINIWA
                     KNQLIPVISPNKEFLDANFKKHKDLLAGEPVNDLKKKESQRGSNQRGPPQRGGRGGRG
                     GRGGSGNGRGGSRGAGAIGSNKSQFFKRSGPSKKTWPDVVNYLKSKDLLPAVVFVFSK
                     KRCEEYADWLEGVNFCNGKEKSQIFMFIEKSVTRLKKEDRELPQILKIRSLLERGIAV
                     HHGGLLPIVKELIEMLFARGLIRVLFATETFAMGLNLPTRTVVFSEIQKHDGTGLRNL
                     TPGEFTQMAGRAGRRGLDEKGVVIVMAYNDPLQSASFKEVTLGIPTKLQSQFRLTYNM
                     ILNLLRIEALKVEEMIKYSFSENSKQTLLPEQEQKIMELQDKLQEIQFYDTADSNADL
                     DGFLYAVVKYRKVTAQMMEELAKTDAIFHALKVGRLIVFRDSNDNARLGFVFRTNMKD
                     NSAVVMTFTEPNALSNGEPNHLPYIAGMTKYTINNFTKFKSTRYSMEEVPLTSIELIT
                     AYTLKISFTSIMKKEEEAMKEFDDEVRIILKISQRLKESLAEKKGSLKVHQKILERNN
                     IKTEIMSLRAVSDPRLAEQFLPKYKAFKIQEEIENLRHLMSDQNLNLLPDYERRLAVL
                     KDAGFIDQNQNVLLKGRVACEINSGYELVLTELILDNFLGDFEPEEIVALLSVFVYEG
                     RTREEEPPIVTPRLARGKKRIEEIYSQMLKVYEAHQIPLTREEAEFLEKKRFALMNVV
                     YEWARGLSFKEIMEISVEAEGTVVRVITWLDEICREVKTASIIIGNTNLHMKMSQAQE
                     LIKRDIVFAASLYL"
     gene            complement(<325688..>327637)
                     /locus_tag="HG536_0E01830"
                     /db_xref="GeneID:59326468"
     mRNA            complement(<325688..>327637)
                     /locus_tag="HG536_0E01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284050.1"
                     /db_xref="GeneID:59326468"
     CDS             complement(325688..327637)
                     /locus_tag="HG536_0E01830"
                     /inference="similar to AA sequence:RefSeq:NP_010213.1"
                     /note="ancestral locus Anc_4.262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139946.1"
                     /db_xref="GeneID:59326468"
                     /translation="MAEYDGGAVVVSDTQQHQHDVEIKGLKVAEEAESMSPTPVVGAA
                     AAAPETPAASSPAQPEAVDAAGGGGEPEAEVNKTEPERVPAPAPPPEPDMDNLPRDPL
                     PKHQQKHAVMTIKAVKRLKDARPFLQPVNPVALNIPFYFNHIKRPMDLSTIERKLNVN
                     AYETPEQVAADFNLMVENCVSFNGANAMISQMARNIQAAFEKHMLNMPAKDAPPVKQT
                     RKKRPIDEEPPVVIRRAQTHNGRPKREIHPPKSKDIYPYETRKPKSKKLQQAMKFCAG
                     VIKELTSKKYASFNYPFLEPVDPVAMNLPTYFDYVKEPMDLGTVAKKLDNWKYQTLEE
                     FERDVRLVFENCYKFNPDGTIVNMMGHRLEDIFNTKWAERPIIDDYESEADSNEYGYG
                     YDYDSDIYDSNDSDSIIDESSITNPAIQYLEEQLERMKHELQQLKKQELDKIRKERRL
                     ARGSRKQRTKRSRRGRLSPGENGQSLNGFKNKKKFKTVVTYDMKKIITERINDLPTSK
                     LEKVIAIIKKSMPHLAEDDEVELDLDTLDNNTVLTLYNTFFREYDTSPNDANGVNGNI
                     ANGLEHSLSPPTNGHARKRRSKALSQEEQTRQIEKIKNKLAILDGASPLSQNGSPINS
                     AYQVNHVNGFSSSDDDEASSESEEE"
     gene            <328343..>328906
                     /locus_tag="HG536_0E01840"
                     /db_xref="GeneID:59326469"
     mRNA            <328343..>328906
                     /locus_tag="HG536_0E01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284051.1"
                     /db_xref="GeneID:59326469"
     CDS             328343..328906
                     /locus_tag="HG536_0E01840"
                     /inference="similar to AA sequence:RefSeq:NP_010211.1"
                     /note="ancestral locus Anc_4.263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139947.1"
                     /db_xref="GeneID:59326469"
                     /translation="MSLYYSLVFGILVVEVVIFSVLALPIPTKFRKPLTLVLLRPFRN
                     EVVQISIKVILGFILLLFVDTINKVYNIDRELAGSSSAAAKGGAVVSSQDRIELLSRK
                     FLAQRNMYLTGMTLFLTFTVARTFGLVQELLQQKDRYRKESPKFDTSESEKENEQRKQ
                     ELLQEIERKDAEIARLKEKAEALQAEM"
     gene            complement(<328932..>330881)
                     /locus_tag="HG536_0E01850"
                     /db_xref="GeneID:59326470"
     mRNA            complement(<328932..>330881)
                     /locus_tag="HG536_0E01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284052.1"
                     /db_xref="GeneID:59326470"
     CDS             complement(328932..330881)
                     /locus_tag="HG536_0E01850"
                     /inference="similar to AA sequence:RefSeq:NP_013505.4"
                     /note="ancestral locus Anc_4.264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139948.1"
                     /db_xref="GeneID:59326470"
                     /translation="MTGQERCADFDQQPTKRQDTSISKGIAQLKAEYIVCSQDAKVVS
                     YDADEEPSSDRILNDVGSNDSGKKRKNKKGKKGQNKNRDNRQVKEAKALCPRYVQGTE
                     NGETCSFGDNCRFVHDISEYLSNKKPEIRSEVFTGCPVYQSIGYCPMGFKCRFLSSHL
                     DGLKLIRRDEEDYRKFLDANHEVNHISGASKLDLVKKRFPFTKSEEVLEIIDAIQQEF
                     RDSMEAAPEEKEAETTDEKAPQVVQRENELRTKRERQRELCLRYKDTRYFAQEKKQLD
                     LRRKKIVSPLTTVGNLPYRRLMRKLGADVTYSEMALSVPLIQGTNSEWALPKAHVTEY
                     PGFGVQIACSKAWQAAKAAEALACHTDGHVSEINLNSGCPIDLLYRQGSGSALLDNPA
                     RMIRCLNAMNYVSGEIPITVKIRTGTKDDHPVAEGLVRRLVYETDVSAITLHGRSRQQ
                     RYTKMADWHYISRVADTLRACEEEYAEKAERERSQRIQFVGNGDVNNFEDWYKHLESN
                     EAIDSVMVARGALIKPWIFEEIDAQQHLDKSSSERLDILKDYAQFAMEHWGTDEYGIS
                     QCRRFFCEFMSFFHRYIPMGICERYPVQLNERPPNWRGRDELETTLGSTNVADWIKLS
                     ELFFGKTDENFVFLPKHKSNSFATA"
     gene            <331588..>333525
                     /locus_tag="HG536_0E01860"
                     /db_xref="GeneID:59326471"
     mRNA            <331588..>333525
                     /locus_tag="HG536_0E01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284053.1"
                     /db_xref="GeneID:59326471"
     CDS             331588..333525
                     /locus_tag="HG536_0E01860"
                     /inference="similar to AA sequence:RefSeq:NP_013507.1"
                     /note="ancestral locus Anc_4.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139949.1"
                     /db_xref="GeneID:59326471"
                     /translation="MDFTSMTMADNATSSAVTTSPTPPSGVSVMSEMGGGGRRNSGSG
                     ASGSVLFAEEGGDAMFQPHQSHNASITGSHNMAKLRRDSIAHSQGMGGVSWGSLTIGS
                     WLRDEVMLHATLKNSRSNSSSKNTTIHLHPTHRNSSPASPPNGTTASIRRPSHFSAGS
                     PPGAHNAYLPSLEKQYCKDYSCCGLSLPGLHDLLRHYEEAHIATSPGSAIPAGNAAYA
                     ASAAHAAASQQKRKSYQGTAPRQAPHTINYSGNRSAVTHQQQHIIQQQPHHRHPGGAN
                     GQTMSQQRMPLSPTATSAAHGGLNIAGVNSSLTDPSGAVAGQAPPQLHLNGNLVDAVS
                     TNDVFLQANASQQNTTHNPQMLRRRGDMATMSAVPNASQNGKIPITAQHSFNAYSLNA
                     ASKSGQRNTNRLHNSSPHMAMSSANKFSHPMQVGMELDFMDEEDMIGGDIDDPAFMRL
                     TNPLAHGANNVFGAHTNVGAARFNTMNMQAIGHPTPPPSTTAGTIPPHVINDEDDEDD
                     DEDDDDDEEAAIGNSAASKTKSTRHNNHRQEGYIDDPARRLYVMDHEEHKPFKCPVIG
                     CDKTYKNQNGLKYHKVHGHQNQKLHENPDGTFSIIDPESNEPYPDGMGYEKDKPYRCE
                     VCGKRYKNLNGLKYHRGHSTH"
     gene            <333728..>334561
                     /locus_tag="HG536_0E01870"
                     /db_xref="GeneID:59326472"
     mRNA            <333728..>334561
                     /locus_tag="HG536_0E01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284054.1"
                     /db_xref="GeneID:59326472"
     CDS             333728..334561
                     /locus_tag="HG536_0E01870"
                     /inference="similar to AA sequence:RefSeq:NP_013508.3"
                     /note="ancestral locus Anc_4.266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139950.1"
                     /db_xref="GeneID:59326472"
                     /translation="MKIDITRPLQLLQWSSYLGILVLVKLFVILPLAAILFNDFYLRL
                     LPPDSSQWVPLSTFDISQDSAENNLVYDQTINRVLIERALPKTIDNGISQKINLRDHI
                     LYKVDLDTKFYCLPTARSKGQTTNIEELEIEIYSSNKPESLIYRRTIPIVCMRPDDSI
                     NIMELYKFGPSRLELFRKEWLNHFKAHDRISITSEMSSVRYVLKVPKSHKLVIQPDSG
                     FRFRMSFEQGLRNVMLRWHKFSYAVGIVIFDLAISSLFVITAFFSFFLIMRRSSDKKD
                     D"
     gene            complement(<334611..>337769)
                     /locus_tag="HG536_0E01880"
                     /db_xref="GeneID:59326473"
     mRNA            complement(<334611..>337769)
                     /locus_tag="HG536_0E01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284055.1"
                     /db_xref="GeneID:59326473"
     CDS             complement(334611..337769)
                     /locus_tag="HG536_0E01880"
                     /inference="similar to AA sequence:RefSeq:NP_010210.1"
                     /note="ancestral locus Anc_4.267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139951.1"
                     /db_xref="GeneID:59326473"
                     /translation="MPLGQNQSAGAIEKDNENAATITGRPTPRHESNQEVRLFHSLNQ
                     FIELVSNEPTRAGTRERRRTSDKYVSNFLRLNLLSYLRQLQQHPESCEGHREVLIQWW
                     VTLLNFLNSDLIPNQAEPRTSSTQLISFPDPLLSIETVSVCLESVSRLMSSLMILPKV
                     RVRHTEIYSHHILLTIHYVTNRLILIAKSSKQPMNTLDNQSFLQFLNSYSSLLRSFLG
                     KLNAYAFFYLPDEFHFDTQALLAITPDVTFQHSEGEKIFSWKKRSFSVPKNARSRLDP
                     KDLDNRDTKFFKIVASYLRNDSVLMAFYWHYWYIVLRYLAKCEPTNDRGLNLDLLPGA
                     SILLEHVTCMFLRNDLNRFTKFVQSTNKTKSSNNAFNVSDTMPDSSAASTDVFMTNEM
                     LNEFVFTNFSILRLWECLRSLAGCFQGDPNMSRLLRLHDLSQLKHVAEISAYDHSMAN
                     VIYNKTLQFVVFQFESYSLADFLNWDIWCRGIVAMLRTLNGNCQVVALLCLFNNWEYM
                     LPAVQNQITTELLENLWFSLTTECDFQLSKVLFFKLLVFRVIPSADHLSKEVLKKRLE
                     SMFDEMCFLDNQLDQVDRDRQQDVLLFYGNRKFFLVQSKPREEEELICRAEREPKSKA
                     KRPYQNFPSVLSTANVRPSLILKGGRYPYDVFDEMVVKAALMLAEKRRRDSETPLPTI
                     EDPSSRSINESTSNDNKSSKSSPSISSALGSWFSKLSTTTDNRIRKLGSSQRRNSEKS
                     AKAGAEQAFEIDVSLPSCHSTDMLSMYSTVSSLATGRTIASDEQLGNSDRNTSEHTSK
                     AASRAAANSEKLQPDQRKKKKLLSPVELKYTSGITGHATVTTLFKALNVPCESMLSKV
                     EKANVKWSVVTAKTYDKPLPKPADMAVETFIEDMRNQSLQSFEDGNIAVERLHSHGKS
                     SNESTLLSNFSDNSFLPRPDYSILALGNENVSTNDSELAARVQKLTLDASLRGDTNCV
                     ADSFCNDREDEKARTLKRNRNMQLETRITKLSTLLRMFNQTVEEYYEHQNFINHGSIF
                     IEFELKAHLGSQYTPDQFKRSI"
     gene            <338174..>340174
                     /locus_tag="HG536_0E01890"
                     /db_xref="GeneID:59326474"
     mRNA            <338174..>340174
                     /locus_tag="HG536_0E01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284056.1"
                     /db_xref="GeneID:59326474"
     CDS             338174..340174
                     /locus_tag="HG536_0E01890"
                     /inference="similar to AA sequence:RefSeq:NP_010209.1"
                     /note="ancestral locus Anc_4.268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139952.1"
                     /db_xref="GeneID:59326474"
                     /translation="MSSEPATKRMKLELSSPKEPLTRQDIIAFQKEALFRRLNEQRAN
                     VESLKTQYDLSKKQCVDISRKLANLMALVVTLARFLTTFCEDEEERELCRQVAEGDET
                     LIVQLSDPFMKLLTKLGVRGSHPDVSRKMEELALGLKNLQDANGALSYENKQLTEEVS
                     SLKKFYQGVLHKYDREDSPTVARVFKRALDEAEGSTGDHDDSKANGTDQESVGNGTIS
                     VKPELETPTEKRSNELIERELQITELKSQLESLHVTVGELEKFKKSNEEELIKLRQQV
                     SAQQLQEPPEVHDRDTLLEKINHLTKENAEISSVNADLLAKFQELTREQEIYTGKVAQ
                     EFQTAQDALKKHNATLEKDLVRIRTTRDELLGKVAILEAETTKSALLTDLQSAINILQ
                     DQWNRMDSRFNSEPQPQDALMKELQDMEVAFKELTNITHKKYSEHLNQESVISKLTVE
                     KTKADQKYFAAMRSKDSILVENKNLTKSLAKSNELINQLKDSDKLLQQKIANLKQQLE
                     ISQTNEKRLIDSNKATNLKVMSINGQLCKLKKALDVAREENHHKIAEVTKVQTQLQDV
                     EADLKSVKIKAANSEAKCQKLQASLLSDGGDNAPLVEELENFRSLVYCSLCSKNWKSM
                     TIKTCGHVFCENCCKERLASRMRKCPTCNKPFSSNDLLSIHL"
     gene            <340329..>341399
                     /locus_tag="HG536_0E01900"
                     /db_xref="GeneID:59326475"
     mRNA            <340329..>341399
                     /locus_tag="HG536_0E01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284057.1"
                     /db_xref="GeneID:59326475"
     CDS             340329..341399
                     /locus_tag="HG536_0E01900"
                     /inference="similar to AA sequence:RefSeq:NP_013509.1"
                     /note="ancestral locus Anc_4.269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139953.1"
                     /db_xref="GeneID:59326475"
                     /translation="MQPRSVCELKKQVVIPKPKLLKPENDPLHIIKTRKITHGRPATI
                     AGPMVRYSKLPFRQLCRQYDADIVYSPMILAREYVRNGNARLADFSTNDEDTPLIVQV
                     GVNNVADLLKFVEMVAPYCDGVGINCGCPIKEQVREGIGCALIYNAELLCEMVSAVKS
                     KYGDSLRLETKIRIHDDYEQTVSLCKSLCDAGVDWITIHGRTRTTRSSQPVNLEAIRY
                     IVEKIQEKKVPVVANGDCFKRADVDAIAEFTKVDGVMAVRGLLANPALFSGYETCPWS
                     CVEKFWYYTLEYGGLPYQLLQHHLYCMLENMNLERRLLKEMMSIKSTGELIDWFDTRF
                     DFKRFGEAGWAEASAVPYRVDK"
     gene            complement(<342016..>342435)
                     /locus_tag="HG536_0E01910"
                     /db_xref="GeneID:59326476"
     mRNA            complement(join(<342016..342300,342379..>342435))
                     /locus_tag="HG536_0E01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284058.1"
                     /db_xref="GeneID:59326476"
     CDS             complement(join(342016..342300,342379..342435))
                     /locus_tag="HG536_0E01910"
                     /inference="similar to AA sequence:RefSeq:NP_010208.1"
                     /note="ancestral locus Anc_4.270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139954.1"
                     /db_xref="GeneID:59326476"
                     /translation="MAGLKDVVTREYTINMHKRLHGVTFKKRAPRAVKEIKKFAKLHM
                     GTDDVRLAPELNQEIWKRGVKGVPFRLRLRISRKRNEEEDAKNPLFSYVEPVFVSSTK
                     GLQTVVVEEEA"
     gene            <343037..>343900
                     /locus_tag="HG536_0E01920"
                     /db_xref="GeneID:59326477"
     mRNA            <343037..>343900
                     /locus_tag="HG536_0E01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284059.1"
                     /db_xref="GeneID:59326477"
     CDS             343037..343900
                     /locus_tag="HG536_0E01920"
                     /inference="similar to AA sequence:RefSeq:NP_010207.1"
                     /note="ancestral locus Anc_4.271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139955.1"
                     /db_xref="GeneID:59326477"
                     /translation="MAMYKHSYDLNEEYRRTQSQIYGLQETILNSAKNASGSGKLKSA
                     ADTLRQRFNEPEHTSVGCDKVLQCVKNKYGPAPSRVLATLEYHPYHSGGPLRKELPAV
                     PAEIQSSFSLAMPRPFLPGFSEEHINQLVTIQVSYEDLRDSYRGTDSPRAQNNEIWGC
                     NIYTDDSDPLLVLRHCGLSISDYNGAHRTPANAENSDNVQGTVPPEGTPFDLEVDILL
                     LPTLQSYPGVKQFGVTSRAWGIDTPTPHDGLSYGIYAIRITSRDTSTRNIDPQHQRVD
                     TSHWETEGPRI"
     gene            <344129..>344839
                     /locus_tag="HG536_0E01930"
                     /db_xref="GeneID:59326478"
     mRNA            <344129..>344839
                     /locus_tag="HG536_0E01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284060.1"
                     /db_xref="GeneID:59326478"
     CDS             344129..344839
                     /locus_tag="HG536_0E01930"
                     /inference="similar to AA sequence:RefSeq:NP_013511.4"
                     /note="ancestral locus Anc_4.272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139956.1"
                     /db_xref="GeneID:59326478"
                     /translation="MIVPDMSERDRGCSRTHREKGLSRTLRKWMVAVRKFTHEALNNI
                     DDRDRGEDRINGLFHGELAPLKSVASVDRESGTSVTPVGASEMRLTTETEESLAENST
                     QANGGAGEGTDDRSPQDDELDHETDSFERFDTYAEYVKLRNESREPFCRGPELWERRR
                     ALWLRPAASQAEETAQQSRRELFATIPQAYHTRIFKKLVMDNKPLREPMNLQDAIQII
                     NAGWIETRKWENAAKGLA"
     gene            complement(<344884..>345207)
                     /locus_tag="HG536_0E01940"
                     /db_xref="GeneID:59326479"
     mRNA            complement(<344884..>345207)
                     /locus_tag="HG536_0E01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284061.1"
                     /db_xref="GeneID:59326479"
     CDS             complement(344884..345207)
                     /locus_tag="HG536_0E01940"
                     /inference="similar to AA sequence:RefSeq:NP_013512.1"
                     /note="ancestral locus Anc_4.273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139957.1"
                     /db_xref="GeneID:59326479"
                     /translation="MSHRNELDQVVDRIFKSTQETEASKTLKEIESNNRYIMNTQLRK
                     LVELHDTSFQQKCVIPVSALYERHSEQVLRDGDLQSCAELIDRDIRIIETAMELIKDS
                     KKSNS"
     gene            <345331..>348420
                     /locus_tag="HG536_0E01950"
                     /db_xref="GeneID:59326480"
     mRNA            <345331..>348420
                     /locus_tag="HG536_0E01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284062.1"
                     /db_xref="GeneID:59326480"
     CDS             345331..348420
                     /locus_tag="HG536_0E01950"
                     /inference="similar to AA sequence:RefSeq:NP_010206.1"
                     /note="ancestral locus Anc_4.274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139958.1"
                     /db_xref="GeneID:59326480"
                     /translation="MLRARLIDSIDSQNVTAVLHSPEARKLLIAKENGDIEVYYREQG
                     KLKLYQAYPKLLQSSQSDETRISGLYESNELSTVFIRCDKSLLLFNSTNLHQYDSIVD
                     RRGIENCWVFEVSLPNNDEKNTFLVYSTRNTGKVRMLIWKGRSYEKIVEATLSKDKEI
                     IKSVIAGNSGILLATDMGVYHWSYGDSVLSRIDKIVRRKYPNDVVRQLAELRSISHSK
                     VDKNDNAMDTLSLLSSSRITKKSSVLNLWSKDRHQTSRSSTLRHLFSPMPSKNVLLDG
                     MTKNLYTLCMTESDLPYMIASDSSQFLDWNSSFSEIQYLSVNLLVLHNSNTIRFVDYE
                     NGFTFLEQRIADGIRLFEKIEQCHFIVLTSNDQLQLYRYNVDDGSDDNLGDEESICGL
                     LYDSDFYQLWRKVLFYEFFLESPNALDLCSSDNPEQSLDFCALKLRDLTVMWCLEIWG
                     RLQADMNLLSRNGRIDARSTNLQNLIVTNLFERLTTFWAPPQLIIVRTFPPEVTRLVT
                     EITGQKHDCITSDGSTSGAYTISQELIRESLLPYLVQTRRRLRYMLRTEKMTWDYAGR
                     QVKVEIDFFSLDKHDSLDVSTLLTLVDTVLFITYLHYFPSMVGPLLSVDSMCDYSTVV
                     RELRNRRMFQELVCFYFQRKEHVEALKFLTDLFDDLQKKVDGEKLQDGVKLLVIDYLK
                     KLPKEYQSLVFQYSDWLFARSDSKGNILESIFINDSPTFADRDHYQIYTYIDKHDRQV
                     ALEYLEFVISTFKLREVKLHTSLIKRYFEDLENYNTRLKLKSILEITSSYEPRTILRL
                     LQEMTDNDNNMLNKDQKCFLDLLKVYPLQKLGNFEEAVDILYDELSDYNSTSVFCDKV
                     YIKDKMQGQKVLEYLFRKIISSSKGDRKPQIARFVQEHGSKLDVIKIYKLLPDDLLLS
                     DLRQVLAQTIKLHAIENDERRIEKGLFQAELVKKSYELNKSLANFVLLDENYKCPVCR
                     KKFLASSTDSALWYTVDSREVIVHYTCGKALEAKIQAKSAKTKLRSSRIVADLKSAV"
     gene            complement(<348466..>351282)
                     /locus_tag="HG536_0E01960"
                     /db_xref="GeneID:59326481"
     mRNA            complement(<348466..>351282)
                     /locus_tag="HG536_0E01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284063.1"
                     /db_xref="GeneID:59326481"
     CDS             complement(348466..351282)
                     /locus_tag="HG536_0E01960"
                     /inference="similar to AA sequence:RefSeq:NP_013513.3"
                     /note="ancestral locus Anc_4.275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139959.1"
                     /db_xref="GeneID:59326481"
                     /translation="MDSGEIAKKRKLEASDRRSATGSKLFAPFRVIGNVSNGVPFAIG
                     TLGSTFYIVTSVGRAFQIYDASNLHLLFVSEKQTSSAITALTTHFHYVYAGFGNQVGI
                     YKRGIQEHLVTLDGPALVRDICVFGSFLCVSTDDSVIHVYKKRSNMNKYATEFYTKLS
                     IGALQGGSVVSLVHLATYLNKIVVVTKTNLLLFNVRTGKLIYTSDELPDQITAAEPAP
                     ALDILALGTASGSVLLFNVRKGRKIRTIKSPNARVTSLAFRTDGSAHLAVGFGSGDLV
                     FYDLERRARIHVLKNIHGESFGGVTKACFLNGQPVIVTSGGDNRLKEYVFDPPLAQQD
                     AAAAVQPARLLRSRGGHSQPPSVITYADSKSHFLLSASRDRSLWAFSLRKDAQSQELS
                     QKQHKRQDGGRVGGSTIKEKFPEIIAMAVENSRLGEWENVITAHKNEKEARTWDMRNK
                     RVGRWTFGTTDDGIVKSVAISQCGNFGFVGSSNGSITIYNMQSGILRKKYKLHKKAVT
                     GIALDGMNRKMVSCGLDGVVGFYDFNQSTLLGKLQLEAPITSMIYHRSSDLFALALDD
                     LSIVVVDAVTQRVVRQLWGHTNRITAFDFSPDGRWIVSCSLDSTIRTWDLPSGGCIDG
                     AKLESVATNVKFSPNGDLLATTHVDGCGICIWTNRAQFKVVATKIIDEEHFAKMLLPN
                     ASTTGGVTLLEGAFEDDSAEVDLQYNSHQSVEQINSDLITLSLGPKSKLNTLLNMDVI
                     RQRSKPVEPPKKPEAAPFFLQLSGEKVGDEASGREDVVRDNDTTQKLMEREAKLKSVE
                     EQLSQFKPNGRLGFESTFTKLLRHGAETRDYTEFLKNLVSLSPAAVDLEIRSLDSFEP
                     YNELVWFIEALTQGLESNQNFELYEAFMTLLFKGHGDVLHANNKDEAIGAALSKWEKH
                     HVAGDKLDELIKYSASVINFLSGV"
     gene            <351548..>355036
                     /locus_tag="HG536_0E01970"
                     /db_xref="GeneID:59326482"
     mRNA            <351548..>355036
                     /locus_tag="HG536_0E01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284064.1"
                     /db_xref="GeneID:59326482"
     CDS             351548..355036
                     /locus_tag="HG536_0E01970"
                     /inference="similar to AA sequence:RefSeq:NP_013514.1"
                     /note="ancestral locus Anc_4.276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139960.1"
                     /db_xref="GeneID:59326482"
                     /translation="MSVEDTRDRSLGERSSKETGGAPDQAAISPLLLDKKTKKAMESI
                     APILEGFIPKTSASENTSLKLPPSQIPYNDDSTEDEDVGVTLQKTLSINSQPGCSTPN
                     ERSREVAEDESGRSSSLMAAADSGGLTDAESAEQHQLAELGQKVSALALAGLESASSA
                     ATRAASPCTTTPNSSTSSRKSSIAASKPQLPKIGKIGVCAMDAKVLSKPCRHILNLLI
                     ENGEFETVIFGDKVILDEKIENWPTCDFLISFFSSGFPLDKAISYVRLRKPFIINDLT
                     MQKVLWDRRLCLQVLAAVNVPTPPRLEISRDGGPHVDPELRSKLLSRGVDVKPIKAPK
                     WRMIDDDTLEVNGQVMSKPFVEKPVDGEDHNIFIYYHSKTGGGGRRLFRKVGNKSSEF
                     DPTLVSPRTEGSYIYEEFMDTDNFEDVKAYTVGEKFCHAETRKSPVVDGIVRRNTHGK
                     EVRYITELSNDEKEIARQVSKVFSQMICGFDLLRVSGKSYVIDVNGFSFVKDNNSYYE
                     SCAKILRETFLQAKKKMDVQNRNLPAIQEEKTQKWVFKGLVTVIRHADRTPKQKFKHS
                     FTSPIFISLLKGHKEEVVIRNVSDLKIVLQALKIAEEENAEDPAKLLVLRNALEKKLE
                     FPGTKIQLKPVLNSANEVEKVQFILKWGGEPTHSARYQARDLGEQMRQDFDLLNKKIL
                     ENIKIFSSSERRVLLSAQIWAQALFGADELGSDEISVRKDLLDDSNAAKDLMDKVKKK
                     LKPLLREGKEPPAQFAWPSKMPEPYYVIKRVVELMNYQQKIMHHNYLTKDVDAMQLKW
                     CCAEDPSLFRERWEKLFKEFHNVEKVDPSKISELYDTMKYDALHNRKFLKKIFDPCDL
                     ADQELGKHSLVDRYPINILAKNNFKIIEGNHNPPSTSSKSGNSVGSLGWVLESGKTSR
                     ATSKSSSPFDDPKFMQFRELYKLAKVLFDFICPKEYGISESEKLDIGLLTSLPLAQQI
                     LNDIDGMKNREEPACVAYFTKESHIYTLLNIIYESGIPMRIARNALPEFDYLSQINFE
                     LYESTDASGQKSHSIRLKMSPGCHTQDPLDVQLDDKHYISCIPKISLTKHLDMDYVQQ
                     KLRNKFGRVSMPQKFTPVNITSPNLTFRNDTSHHVGAPINEAESSTPPLEPLSTPHSS
                     GSIDKELGKDVSSEQA"
     gene            <355347..>356105
                     /locus_tag="HG536_0E01980"
                     /db_xref="GeneID:59326483"
     mRNA            <355347..>356105
                     /locus_tag="HG536_0E01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284065.1"
                     /db_xref="GeneID:59326483"
     CDS             355347..356105
                     /locus_tag="HG536_0E01980"
                     /inference="similar to AA sequence:RefSeq:NP_013515.3"
                     /note="ancestral locus Anc_4.277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139961.1"
                     /db_xref="GeneID:59326483"
                     /translation="MSSAIEMVGNFQGKMSMGGGGSSKEPVCKISMLWNWYTIDTCFI
                     AQSWRNDTKGKFAGSCIGCFALVVIAQWLNRISRQFDIELVKRHKMRYLARYMASNNV
                     HDESSSELSQQELELIGSEPAWKATLIALKITLSHTWYFNFLGRNGDSFEDPVEKALS
                     CCSTVPALEIYPTFFEHFLRAWIFVLQWGLSYIIMLLFMYYNGYIIISCLIGALFGRF
                     LFNYEPLGTCGSGSPFSKTVVAHDKEENDRKCCI"
     gene            complement(<356176..>357462)
                     /locus_tag="HG536_0E01990"
                     /db_xref="GeneID:59326484"
     mRNA            complement(<356176..>357462)
                     /locus_tag="HG536_0E01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284066.1"
                     /db_xref="GeneID:59326484"
     CDS             complement(356176..357462)
                     /locus_tag="HG536_0E01990"
                     /inference="similar to AA sequence:RefSeq:NP_012740.1"
                     /note="ancestral locus Anc_4.278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139962.1"
                     /db_xref="GeneID:59326484"
                     /translation="MRKCKVFVGNSHPELGAQICERLGIEPAPCILKKFANGETSVQI
                     GASVRDDDVYVIQSGSPTVNDHIMELLILVSACRGGSAKKITAVIPHFPYSKQCKMKK
                     HRGAITARMLANLLIMAGADHVVSMDLHASQMQGFFSKPVDNLYGGPSLARWIKENVE
                     DYQDAVVVSKNPGGTKRVTALADTLKINFAMIHTDRRRSKDLYAQNRDLRQLRLRKQS
                     LLKKNKPIVRQGDGPDIEENIILTNGIQTARIRNGHVIDDEEEEDEEEEAILESDSEA
                     GSLTASDSYALGGTFNADDSDDDEGLDEQQQEKLITLVGNVHGRSAIILDDMIDRPGS
                     FVSAAEHLVQNCGAKKVYVVATHGIFTGDCLEQLEQSDVIHQIVVTNTYPITRERLQK
                     SKKLVVIDVSPIFAESIRRDHYGESISVLFDSLGSL"
     gene            <357780..>358583
                     /locus_tag="HG536_0E02000"
                     /db_xref="GeneID:59326485"
     mRNA            <357780..>358583
                     /locus_tag="HG536_0E02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284067.1"
                     /db_xref="GeneID:59326485"
     CDS             357780..358583
                     /locus_tag="HG536_0E02000"
                     /inference="similar to AA sequence:RefSeq:NP_013516.1"
                     /note="ancestral locus Anc_4.279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139963.1"
                     /db_xref="GeneID:59326485"
                     /translation="MGSYKAPGLFQDRLDACRDVIRGSAMLRELREALAPYADSIDKI
                     RCLALGSFHEDVPARYQLALLLEIESFLRDEGKKTISVSLYDPVFTADDIEYIHQRGP
                     NYTVDQSPPNGFQDANSKQILYFLPHAPLDLTEQVLIAEQPRLLLANNIVEHTDRYTK
                     ARLHEKYPMLSKLLHVLERAATVPDSTQANAVDVDDQFKSFVSKKKRRNKKVFKEPVI
                     DYDSVKSYFNNCSIITDFQAGALLRDQPWINSFSDLTFHHIASPPEQLT"
     gene            complement(<358818..>364985)
                     /locus_tag="HG536_0E02010"
                     /db_xref="GeneID:59326486"
     mRNA            complement(<358818..>364985)
                     /locus_tag="HG536_0E02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284068.1"
                     /db_xref="GeneID:59326486"
     CDS             complement(358818..364985)
                     /locus_tag="HG536_0E02010"
                     /inference="similar to AA sequence:RefSeq:NP_012739.1"
                     /note="ancestral locus Anc_4.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139964.1"
                     /db_xref="GeneID:59326486"
                     /translation="MISNAASSSSTRPLILSHGSLEHVLPVPTSCFFAASELLDQFNK
                     SLPEPTENFALDQEPSSPIELLGKFLGFVADFVSEGETKFVDVLDNSLNEFDNGYLQG
                     NAVHAVAANLLDDEDSNTTLEKTKELIRNYVKARYVAKRPFEKSQSALFKSAAQGDSQ
                     IAAIFGGQGNTDDYFEELRELYETYNVVVLDVIKFAATTLRELVRSTHDTEKVFTQGF
                     DILSWLEHPEKTPDTDYLLSIPISCPLIGVIQLAHYAVTARLLGFTPGELRSHLNGAT
                     GHSQGLATAVAIAEADSWDSFFESMKKAISLLFFIGVHCYLAYPNTSLPPSILEDSLE
                     NSEGVPSPMLAITNLTQEQVQNFVDKTNSHLPEEKHIVISLVNGARNLVVTGPPQSLY
                     GLNLTLRKAKAPSGLDQSRIPFTERKLKFSNRFLPIASPFHSHLLASSKKFITEDLVK
                     YNVNFEKKNLKIPVYDTFNGKDIRDHQGTSIAERITDCIVSLPVNWEIATSFPATHLL
                     DFGPGGASGLGVLTHRNKDGTGVRVIVAGTLDNNPEDEYGFKQEIFDVTANGLKKNQN
                     WLKEFQPKLVKTKSGKIFVNTKFSKLLGRAPLLVPGMTPSTVSPDFVAATINAGYHIE
                     LAGGGYFAPEGMTQAIDSVVSQIKKGYSLGINLIYVNPRMLQWGIPLIKELREKGYPI
                     QSLTIGAGVPSLEVATEYIETLKLTHLDLKPGSIDAISQVITIAKAHPKFPIVLQWTG
                     GRGGGHHSFEDFHAPMLQMYSKIRRHPNIILVAGSGFGSSEDTYPYLTGEWSTKFDYP
                     PMPFDGLLFGSRVMIAKEAKTSLAAKELIASCPGVPDDQWQQTYKKPTGGIITVRSEM
                     GEPIHKIATRGVLFWKELDDTIFNLPKNKLQAALDAKKDYIIEKLNADSQKPWFPTVN
                     GEVRELANMTYEEVGKRMVELMYIRSLNKWIDVTLRNFTGDFLRRVEERFTKVKTPSL
                     IQSYSALEEPDKVLETIFNAYPAAKDQYLNAQDVDYFLNMCQRPTQKPVPFVPVLDHR
                     FDFFFKKDSLWQSEFLEAVVDQDVQRTCILHGPVAAQYTKNVNEPIKSIFDGIHEGHI
                     KKLLKEQYGDDVTKIPVVEYFGGEEPVTVDCESAEKPSLSKVTYRANATTDPKNWFKL
                     LAGPTRNWRSAFFSTSRVVQDSLYVDNPAQKVFKPADDLVVEITNLDNPSKSVITLSE
                     PVQGEIKPTAVLKLINDKTIQLELIENRTSDGKPVALPLLYTYNFEDGFAPIAEIMEG
                     RNERIKEFYWKLWLEEPFDLKFDPRKVIKGGDFEITAKSISEFTHAIGNNCEDFVKRS
                     GREQLAPMDYAIVVGWRVIIKAIFPETVDGDLLKLVHLSNGYKMIPGAKPLKDGDIIS
                     THATIKSVVNQPTGKVVEVVGTLTRDGKPVMEVESSFFYRGSYDDYENTFQRSVEPVY
                     QVQIKSPKDIAVLRSKEWFQLDDEDIDLMGKTLTFETETEVTYKNANVFSSVRCSGPI
                     KMELPTTENVEIGVVDYEAGESYGNPVVEYLKRNGSTLEQKVNLENAIPIAVLDLQSP
                     STNEPYARVSGDFNPIHVSRHFANYADLPGTITHGMFSSAAVRALIENWAADSVSSRV
                     RGFNCQFVSMVLPNTPLSVSIQHVGMINGRKLIKFETKNNEDVVVLTGEAEVEQPVST
                     FVFTGQGSQEQGMGMDLYQTSKVARKVWDRADVHFKETYGFSILDIVRNNPTELTIYF
                     GGEKGRKIRDNYTQMIFETIVDGELKTEKIFKDVKEDSTSYTFRSPSGLLSATQFTQP
                     ALTLMEKASFEDLKSKGLIPADASFAGHSLGEYAALASLADVMSIESLVEVVFYRGMT
                     MQVAVPRDSLGRSNYGMVAVNPSRVSPTFTQEALQFVVEKVGKRTEWLVEIVNYNVEN
                     QQYVAAGDLRALDTLTNVLNFIKLQKIDIVKLQASLSLEKVEEHLFEIIDEVAKKSLA
                     KPQPIELERGFACIPLRGISVPFHSSYLRNGVKPFKNFLKKNVVKENVKADRLIGKYI
                     PNLTAKPFEITKEYFQDVYDLTGSEQIKEILDNWSKYEN"
     gene            complement(<365828..>366499)
                     /locus_tag="HG536_0E02020"
                     /db_xref="GeneID:59326487"
     mRNA            complement(<365828..>366499)
                     /locus_tag="HG536_0E02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284069.1"
                     /db_xref="GeneID:59326487"
     CDS             complement(365828..366499)
                     /locus_tag="HG536_0E02020"
                     /inference="similar to AA sequence:RefSeq:NP_012738.1"
                     /note="ancestral locus Anc_4.281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139965.1"
                     /db_xref="GeneID:59326487"
                     /translation="MDEDKPECRLAYVKPTVENVVAYNRYKKTQPMVNGVSMVSVPCL
                     DMPILFGGGRDFDLLLLQHPHNVLAGVDLFILSNAILLWFDHLGCGIEAPYSSVIYHG
                     SVHSPADREGRQLSMLVTLDRDPLLNDQFPPTPNDPGSDSLELLLRPRYSLYDRHYNP
                     EIDTLFNFQDFGVNRGDQMVNNCHEAIATCLEIYNTQDPPPDLEQDEQELLPETIFAE
                     QGTIG"
     gene            complement(<366648..>367982)
                     /locus_tag="HG536_0E02030"
                     /db_xref="GeneID:59326488"
     mRNA            complement(<366648..>367982)
                     /locus_tag="HG536_0E02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284070.1"
                     /db_xref="GeneID:59326488"
     CDS             complement(366648..367982)
                     /locus_tag="HG536_0E02030"
                     /inference="similar to AA sequence:RefSeq:NP_012737.1"
                     /note="ancestral locus Anc_4.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139966.1"
                     /db_xref="GeneID:59326488"
                     /translation="MAGVELQRRLLDNVKLVESCHSPEFLTKNAVECHSETPHLQAHN
                     HIFNALKKRIEAINEETCEPGDENSFFVCDIGEIERLYRNWERELPGIQPFYAVKCNP
                     DVQLLQKMASLGANFDCASKAEIEKILGMGVSPERIIYANPCKASSFIRYAAKKNVLK
                     STFDNVEELHKIKKYHPESQLLLRISTDDSTAQCRLSTKYGCEMENVGQLLAAVKKLG
                     LNLVGVSFHVGSGASDFTALHQAIKDAREVFDRARDLYGLPALQILDVGGGFQLESFS
                     ESSFVLREAIKQFFPRETFQDLSIIAEPGRYFAATAFTLAANVIAKRTLNERESMIYI
                     NDGVYGNMNCILFDHQEPTPRTLFHNNEFHYHDLDSASKQNSGSKHKVSIWGPTCDGL
                     DCITKEYYMKHDLIAGDWLYFPNLGAYTSSAATPFNGFEQSVDTIYIDSSNQ"
     gene            complement(<368256..>369857)
                     /locus_tag="HG536_0E02040"
                     /db_xref="GeneID:59326489"
     mRNA            complement(<368256..>369857)
                     /locus_tag="HG536_0E02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284071.1"
                     /db_xref="GeneID:59326489"
     CDS             complement(368256..369857)
                     /locus_tag="HG536_0E02040"
                     /inference="similar to AA sequence:RefSeq:NP_012736.1"
                     /note="ancestral locus Anc_4.283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139967.1"
                     /db_xref="GeneID:59326489"
                     /translation="MSTAINNYSLSNTPLIGSAGSDPRKKFAFDDLLLLPSVPSTSGL
                     NRNYLCYSAKVSPVLPPIAQEVDVQRKYKTAPASPNHHDYDYLSSVVTPQTSPVFGRA
                     KLAATSTQLPDCCPVNQQENLPSLRHLQLLPDPRIQEYACYYPDTSEHTPIWKRTLVH
                     WCKEKNYQDYTKIVHEISHDRTQLTALLKGSATAGGIPSVLKPKDAFHGLSDHAKDRS
                     TPMTPPMSPLDEMASDQPPEFTPFVSSKLIQTVRQNNRNLSSSKNRHKKTNSFKALQL
                     KKMLNNRDILANDSQTNATKYKISKKASASASSSASASPPSLGDSPGLRKLEISSAAR
                     NLVMLLDAQTKRSSSPSRPSEPIASSSTTPTLVSKAADRRPRSRSLSPVRPATPPNTA
                     ASSGYHRFAYDSPQSPVATLRQGHAGSTKTTPKRRRSSGSSSALRKCVSCHSNDSPCW
                     RPSWSGRKQDQLCNSCGLRYKKTHTRCLNDACRKIPTKSELSIMKSNGLLQEYNPDGT
                     ITIGYKCLFCNSIAETSDADSHSHA"
     gene            <370472..>371026
                     /locus_tag="HG536_0E02050"
                     /db_xref="GeneID:59326490"
     mRNA            <370472..>371026
                     /locus_tag="HG536_0E02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284072.1"
                     /db_xref="GeneID:59326490"
     CDS             370472..371026
                     /locus_tag="HG536_0E02050"
                     /inference="similar to AA sequence:RefSeq:NP_012735.1"
                     /note="ancestral locus Anc_4.284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139968.1"
                     /db_xref="GeneID:59326490"
                     /translation="MSRYGGGNISNASGGNRSQIAELFVKKILAHLDDTDPQKLNQFL
                     NLFNSNNCKVVFNATPFAQLPLFLQMWQNQIVQTQHALTAVDYHVIPGSQTVIFNVNC
                     KVRFDESGKDKMGQDATVSPGEQKLQHQKHRPANRPLWGTYFGVSLQLVVEERLFSND
                     MNGVILAFNYNMIYKPDDSLITVN"
     gene            <371537..>373579
                     /locus_tag="HG536_0E02060"
                     /db_xref="GeneID:59326491"
     mRNA            <371537..>373579
                     /locus_tag="HG536_0E02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284073.1"
                     /db_xref="GeneID:59326491"
     CDS             371537..373579
                     /locus_tag="HG536_0E02060"
                     /inference="similar to AA sequence:RefSeq:NP_012734.1"
                     /note="ancestral locus Anc_4.285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139969.1"
                     /db_xref="GeneID:59326491"
                     /translation="MLLGKQFGLAICALFLFTTFILVIVAICGSTANYKPLTNIYIGS
                     ADISHINVTKVIPQFGPILTIVGTALNSGNSSLETFFPVLHRLVGTPGFAPLLTMLSN
                     AEDTETSVSSLVELAPLALSSNGSAAAAQQLSQVDQLLRYSTNATETLQGLESLVEAS
                     MEDPTSNSSAVVLELLKDSNDSLSSTDALLTLNNMSATEKAQLAPVFALFQVSDNKTV
                     TFDSLATLVSSPVSGDLAQTLFLALNQSSNLTQTLQQLGSIAPENSRPALNAVGALIA
                     SSSSPNTTLSSLRTLIESNVTSSPSAQEAFTSLATLVRNGENDTLVVESVQSLATTNS
                     TSSTEQLVSLKQLLEASNNGTGTLQVMGNLQQGLAADNSTAQYISPLVSLLESSSDPH
                     ATFTSLIAFTAWAQANPATFAPVAGILLSAQENPVPTEEQLNALTPEILQYFHVNTKY
                     QLSIFTLCERDLYNNIQSCSASHAVQDLDFRSIIWNDLVDSDFAPYLVALNVTEDSLH
                     LEGKLLNRQHEYVPAVEATLAFCLISIILSFFLLLAVLYLIVRRRVLGNKPWFAIIFT
                     CLLYTLFTCLAAIIVTAIIGIIKSGTADDNYGVVFTASQAFLGLLWTSFALSLICPVL
                     LIMAWLSDKRERKKAEPVMVENEPSANTSDSLSSSANNANSIPDPEKNNATPIVTN"
     gene            <373976..>376426
                     /locus_tag="HG536_0E02070"
                     /db_xref="GeneID:59326492"
     mRNA            <373976..>376426
                     /locus_tag="HG536_0E02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284074.1"
                     /db_xref="GeneID:59326492"
     CDS             373976..376426
                     /locus_tag="HG536_0E02070"
                     /inference="similar to AA sequence:RefSeq:NP_012733.1"
                     /note="ancestral locus Anc_4.287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139970.1"
                     /db_xref="GeneID:59326492"
                     /translation="MLSLIVRVYQRHRLNILRSSYIILLLTTLNSLSSGTSAKKAIRR
                     IAKGKKNHGDVSSSELSDESIEQHTEGELLEGDKGDKSSEDRIEKQKVKRSADFLLKL
                     ILKDKKCISLFITQALLLVIRTLLSLRVATLDGKLVSTLVKAQYSQFLKILLGQWMLL
                     GIPASFINSLISYTTKLCSISINRKVSGYLISKYLANHHIFYSVAAADSSGEIQDYLT
                     RDIYAFANNSSLLLNQLLKPMLDLILCSFKLLMSNSSMMGEGTLALGLIVYVSNSFLK
                     MIQPNFTRLTMRRSSLESWFRSLHSNLHLNSEEISLLRGQSTELASLDYSFYRLVLFL
                     NREIKARALYDLATSFVIKYTWGAAGLVLCSIPIFFKNQTGIASSTDVTADFITNRRL
                     LLTASSSIGRFVELKRNIQQLRGVWLRLNNFNALLDSSSETGPSQDYEIIEKGEIEYN
                     DSLIRFENVPLITPADQVLIPELNFELKHGDHLLIIGPNGCGKSSLFRILGGLWPLRQ
                     GSRKTKTKLIMPHRSQDNECSIFYLPQKPYMGSRSTFREQVIYPDSVEQFEKRFNGDY
                     AEGDAFLADLLHMLELEDLIAENMALALALRNAKNKGNEDEVSILDSKEAFDLYRNWS
                     EELSIGVQQRLAMARMYYHKPKFAVLDECTSAVSPEMEQKMYATAQKLDISLISVCHR
                     TSLWHFHNHLLKFDGKGGYQFGRFDPKARLANEEKLLELNAILDQQVPVWDKRLKDLT
                     VARTSNLIRKSQTDLRSLGSRQQSSSYPNKRPTSREATAGGTTRRQPTSSQRKPDSKL
                     HTRDGDIDDKGAGETRQT"
     gene            379151..379222
                     /locus_tag="HG536_0Etrna10G"
                     /db_xref="GeneID:59326882"
     tRNA            379151..379222
                     /locus_tag="HG536_0Etrna10G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGA"
                     /db_xref="GeneID:59326882"
     gene            complement(<379728..>382532)
                     /locus_tag="HG536_0E02080"
                     /db_xref="GeneID:59326493"
     mRNA            complement(<379728..>382532)
                     /locus_tag="HG536_0E02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284075.1"
                     /db_xref="GeneID:59326493"
     CDS             complement(379728..382532)
                     /locus_tag="HG536_0E02080"
                     /inference="similar to AA sequence:RefSeq:NP_014112.1"
                     /note="ancestral locus Anc_3.73"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139971.1"
                     /db_xref="GeneID:59326493"
                     /translation="MSTHTYKKFENSEAGELPDKMTIYQDCMSEFNESPINAKRCRLL
                     ISRLLRLLAQGETFPENEATALFFSISKLFQHQNDSLRQAVYLAIKELSGISQDVLMA
                     TSSIMKDIQNGSDLVKPNAIRSLTAVLDESTAFSAERLLKSALVNKHPSISSAALCTS
                     YNLLPIAEVTVKRFANETQEAVADLKSFPHRNLVGDYYPNSTFISQYHALGLLYQLKK
                     NDKMALLKLIRQFSSNNALKNQLAKIELVKLVSELVTRDNQLFSDFQPLLMEWLSNKY
                     ESVQLETAKLVTNFAAHHSRLVSSELIASAITTLQSLLTVPRVSAKFAALRILNRISM
                     VSPERIVVCNPELESLINDPNRNISTYAITTLLKTGTAKNIASLISTITKFIHDVSDD
                     FKIIIIDAVRSLSLNFPNEWKTVLQFLIDVLKNGEGGFKFKNNVVEALIDLVTFIPQA
                     KEMALENLCDFIEDCEFNEILVRILHLLGKEGPSTSNPSLYVRHIYNRVVLENSIIRS
                     AAVIALSKFALTKNDPSLSDSIVSLLRRIANDPDDEVRDRATIALKFIESAKRDQDTE
                     SRKFILSTYSFDFASLESKLSSYISSNTDSFKTPFDVTSVRRLSDGDIKALDLKRKQG
                     KFLKGTLEGSAESTPGIAEEEMLPERLDNSYVGPSVDEHELDMLSTKYAEELMAIDQV
                     KDFGALVNSSKIVPLTEPEAEFVVRGVKHLFKDNVVFQFNITNTLTDTALEGVSVTCT
                     PELEASSLQELFTISIDQLLPSAEAACYVAFKKTEEIVMESFLANLMFTTKEINPETN
                     EPFAGDEGFQDEYDIDSISLNAGDYIKSSYVGDFATAFDGLPNEEVAVFNIKENISLQ
                     ELVDRLVVNTSCLPLEDTQYAPSDSNSHTVKLFGKSALKGSKVALIIRLIKTSKGIAM
                     KAQGRAEDAVLCSDLVNGLM"
     gene            complement(<382744..>383673)
                     /locus_tag="HG536_0E02090"
                     /db_xref="GeneID:59326494"
     mRNA            complement(<382744..>383673)
                     /locus_tag="HG536_0E02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284076.1"
                     /db_xref="GeneID:59326494"
     CDS             complement(382744..383673)
                     /locus_tag="HG536_0E02090"
                     /inference="similar to AA sequence:RefSeq:NP_014111.1"
                     /note="ancestral locus Anc_3.72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139972.1"
                     /db_xref="GeneID:59326494"
                     /translation="MFATQNPYGGEFSQGMVTQNAPQPQQQQQPGQGAHALDDPNVYH
                     WICQLAYGPQREQALLELGRKREQFEDLAVVLWSSFGVMASLLNEIISVYPMLEPQLL
                     SNQLSNRVCNALVLLQCVASHPETKHLFLQAHIPLFLFPFLNTTSRQRTFEYLRLTSL
                     GVIGALVKNDSQEVISFLLRTDIIPLCLRIMQSSSELSKTVAIFILQKILLDDIGLQY
                     ICATMERFYAVTNVLRDMVDQLTLHTPPGRLLKHIIRCYLRLSDNLEARRLLKVALPQ
                     KLRDNTFTEILRDDVGSKRCLAQLLLTLNEDSS"
     gene            complement(<384843..>385649)
                     /locus_tag="HG536_0E02100"
                     /db_xref="GeneID:59326495"
     mRNA            complement(<384843..>385649)
                     /locus_tag="HG536_0E02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284077.1"
                     /db_xref="GeneID:59326495"
     CDS             complement(384843..385649)
                     /locus_tag="HG536_0E02100"
                     /inference="similar to AA sequence:RefSeq:NP_014110.1"
                     /note="ancestral locus Anc_3.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139973.1"
                     /db_xref="GeneID:59326495"
                     /translation="MSEYDKALKVLMKSPVTDEMIRFLTNCTLKVLPTPAQNYPTPPA
                     SPGCNRLPSLMSFVTRLVRHTNVYTSTLLTTVCYLNRLKCILPRDASGIPSTIHRIFL
                     ACLILSAKFHNDSSPLNKHWAKYTDGLFTVNDVNLMERQLVQLLNWDLRVTNDDLILD
                     LRPLLEPIVDDIERTARHRRKLQRHPLRRNCAGAVPYEHQRNVSICSDLSSATLVESA
                     SNSSLRLDKEIWNHHGLELPTSLSSESLVDRSSWTLLENDFNQLLLQHGF"
     gene            complement(<385931..>386947)
                     /locus_tag="HG536_0E02110"
                     /db_xref="GeneID:59326496"
     mRNA            complement(<385931..>386947)
                     /locus_tag="HG536_0E02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284078.1"
                     /db_xref="GeneID:59326496"
     CDS             complement(385931..386947)
                     /locus_tag="HG536_0E02110"
                     /inference="similar to AA sequence:RefSeq:NP_014109.1"
                     /note="ancestral locus Anc_3.69"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139974.1"
                     /db_xref="GeneID:59326496"
                     /translation="MSEVVEAKLDNGLPWVEKYRPTTLDDVCGQNEVVSIVRKFVSEG
                     QLPHLLFYGPPGTGKTSTVVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFAS
                     TRQIFSRGFKLVILDEADAMTNAAQNALRRIIERYTKNTRFCILANYAHKLTPALLSR
                     CTRFRFQPLPKEALERRMNRVLASEHLKMSENARDALLKLSRGDMRRVLNVLQACQAT
                     LDDPQEQEVTEDTVYDCCGAPRPSDLETILASILNDDWTTAYYTLNKLSSAKGLALID
                     LIEGFVDILEGYEMKVQEARIAILTQLSDIEYAISRGGNDRIQGSAVIGVIKSGFEME
                     AAKT"
     gene            <387051..>388739
                     /locus_tag="HG536_0E02120"
                     /db_xref="GeneID:59326497"
     mRNA            <387051..>388739
                     /locus_tag="HG536_0E02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284079.1"
                     /db_xref="GeneID:59326497"
     CDS             387051..388739
                     /locus_tag="HG536_0E02120"
                     /inference="similar to AA sequence:RefSeq:NP_014108.1"
                     /note="ancestral locus Anc_3.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139975.1"
                     /db_xref="GeneID:59326497"
                     /translation="MFLSSTLVRSARRPSGYWSLMWWCLILFVSLALAFEPFDGFGAF
                     QESQNVTIKKDGNLGSALDAKSGSPGIINPGNIYEWTPISANISSGERNVFVFTVDGN
                     STRLGIATSYEILIFLSGNICSQPSGSSDKALRVSYSFDESVQTNSSLGHYATFENGY
                     MQALAVSPLRVSDANATAKYSSLYVVVEPVNTTTNTALSATAEDVWHYKLSISENDLV
                     YQWDTRTWLNVLDTDHNSALLVTGNVTADAQQFSNSSIYDTSLYDLYVYSFEESLKLD
                     SSLNISLCAITNGPYIVSSVDSNNTGDSGHGLERTALGIEKTLTNRMYTYQEQFYVTG
                     LNSSSTYVAYLTKRIGKKGNLSDVGGVLFSKQYFSTRGSNACSLIFGLPFCYGVAYSV
                     PSPSKAPNNKTAIAATYDRVAESLYANFSKALQIIPCDTEMDARYSPVRTCKDCARSY
                     RDWLCAVTIPRCTDTASEYYAFREKNDNRNDYLNNEIQPIADYYEMLPCIDMCYAVAR
                     DCPSDFMFACPSVNDKIDAKFRSYNSLDLDDLLQAVQTCNFIGNATELFRELFP"
     gene            complement(<388916..>390124)
                     /locus_tag="HG536_0E02130"
                     /db_xref="GeneID:59326498"
     mRNA            complement(<388916..>390124)
                     /locus_tag="HG536_0E02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284080.1"
                     /db_xref="GeneID:59326498"
     CDS             complement(388916..390124)
                     /locus_tag="HG536_0E02130"
                     /inference="similar to AA sequence:RefSeq:NP_014107.1"
                     /note="ancestral locus Anc_3.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139976.1"
                     /db_xref="GeneID:59326498"
                     /translation="MNGIFAIDKPSGISSNQFMMKLQHALTNSHVFSKEIQRATAERI
                     KQYQEQTGKKASKRKLRKVSKVKMGHGGTLDPLASGVLVIGIGTGTKKLSEYLSGTVK
                     EYETEALFGTSTTSGDVEGEILSQNSVKQLDFNELKTVEEKFKGALKQTPPIFAALKM
                     DGKPLYEYAREGKPLPRAIEPRQVTVYDLKILPDSLSRSHSYPLLRPISGQTREMVQR
                     LNNGLLNDPLYFSKEYCTKQDWENESVDIKARDLTEEESKQIEIQGDDYRAPLLHFKA
                     KVSSGTYIRSLVNDIGKSMQSSSYMVKLIRLAQKDWSLEKQNVFKLEDFTERDEKVWS
                     KVLQEVLEKGPKVNVIEALVQAEEEFKKEQKIMAQSAAQQAEQQDVGQTDEPVAPKTE
                     LGTRKRKLDE"
     gene            complement(<390254..>391015)
                     /locus_tag="HG536_0E02140"
                     /db_xref="GeneID:59326499"
     mRNA            complement(<390254..>391015)
                     /locus_tag="HG536_0E02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284081.1"
                     /db_xref="GeneID:59326499"
     CDS             complement(390254..391015)
                     /locus_tag="HG536_0E02140"
                     /inference="similar to AA sequence:RefSeq:NP_014531.1"
                     /note="ancestral locus Anc_3.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139977.1"
                     /db_xref="GeneID:59326499"
                     /translation="MDNVLNCPAKASVSPSNSSVDETAANSGATAPVQGPLFFNYHEF
                     AESFYIDIRSDGQFHEHDEEHCIYMTHFPNVYVPQESEEFKTTRIVRIPRRFDTTLET
                     LCFSTCLPGREPAAFTEPEEGQRFVARGIYDNGQLFGCSSVSPLSQYLSQCDFERIMA
                     PINKILSEATATFSWYNILDLILDIFTLGCWHFISKYVVADPLLRLESHVAEVNELPL
                     LKNNNVKIISPRRSGYLSVCCKTYSIEMIDYTNFH"
     gene            <391129..>391728
                     /locus_tag="HG536_0E02150"
                     /db_xref="GeneID:59326500"
     mRNA            <391129..>391728
                     /locus_tag="HG536_0E02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284082.1"
                     /db_xref="GeneID:59326500"
     CDS             391129..391728
                     /locus_tag="HG536_0E02150"
                     /inference="similar to AA sequence:RefSeq:NP_014530.1"
                     /note="ancestral locus Anc_3.65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139978.1"
                     /db_xref="GeneID:59326500"
                     /translation="MSSPELDFVSRFLTLATLSSPALPADYKLPLQQVSNQGIALPPL
                     KYKYDPRRSRNGASGGEARNSSLTLTLKSVRAPKFSVECQFTCKDTVLQVKQRLVEEG
                     KAQGTEDLKLLLKGKVLHDSELLSSLTSDAATINVMISKTAQTATSPPPAHPGLTSET
                     PASGMPWNEIENVLSSRFPDSKEAQKALDRLKRGWELAK"
     gene            complement(<391810..>393693)
                     /locus_tag="HG536_0E02160"
                     /db_xref="GeneID:59326501"
     mRNA            complement(<391810..>393693)
                     /locus_tag="HG536_0E02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284083.1"
                     /db_xref="GeneID:59326501"
     CDS             complement(391810..393693)
                     /locus_tag="HG536_0E02160"
                     /inference="similar to AA sequence:RefSeq:NP_014106.1"
                     /note="ancestral locus Anc_3.64"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139979.1"
                     /db_xref="GeneID:59326501"
                     /translation="MDSQPAQLTINHDGATTDDRSQRNRGIGLPRKSPSTPEVRGSFD
                     NMRRIDAVPLPKHELTRNVSSTLDGSSVDNAEASLSVIDIYGDEVESRRTNDLEAQES
                     NGVSNGGSGTSLAVFSRSRSNGTEEQSFDRYGFKKQSNFISEKEYNEWWQDYSQYCVR
                     RKHKWKLFMEKSGLPLDNDSPYRFPSRSEKLRRYVRKGIPAEWRGNAWWHFARGQEKL
                     NKNRGLYDRLLSQMNEKGKKKAITDLDVIERDLHRTFPDNIHFQREKFQDDEPTMIRA
                     LRRVLVAFSWYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVIITSRYLPGVHNVNLE
                     GVNIDQGVLMLCVKEYLPEFWRFIVPFPNQPGSLSYSQNPSLGKNEFLYKLPPITLCT
                     ASWFMGCFVGVLPIESTLRVWDCLFYEESHFLFKTSLAIMKLSEQELSKGKPLRALRQ
                     YSMSNGNENSREIQSSQDEAEMEIFQIVQTFPKRLLNPNDIFDKIIFKKRIPLNKLDQ
                     NEIDRCRKYVAAQRQKYKNFHEIMGNDRTNSGNSLSGTADLANNRNFEMNVEDNGLRI
                     RSSDLDSDKTASELINSALSSEVYGFKRGLSGVHWNNSIKEKVRQMRKKKVISDEQLK
                     SSN"
     gene            <393916..>395448
                     /locus_tag="HG536_0E02170"
                     /db_xref="GeneID:59326502"
     mRNA            <393916..>395448
                     /locus_tag="HG536_0E02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284084.1"
                     /db_xref="GeneID:59326502"
     CDS             393916..395448
                     /locus_tag="HG536_0E02170"
                     /inference="similar to AA sequence:RefSeq:NP_014105.1"
                     /note="ancestral locus Anc_3.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139980.1"
                     /db_xref="GeneID:59326502"
                     /translation="MAGYNPWRIVPEEVYDSCKRQYLGNGLLIGGVLPLSFAEGVQFQ
                     DFCEDGAPVYNAAKIKSPYLHYSALKVQDWKSYTSESSIEDLNGSFAYGIYPVILCFT
                     ANFVITVFLTLLTFINIKGKRYRHAARLLKAGSMISSVNIVVFVTRALKQLSKEHEVY
                     GVTTTAGIMELFTTNFVFSILDVISVFLLQLCQVMIVIRLFHRNSEKRMVFFLGVLLV
                     LIANVLWGVAHLAGPNHENDEHWEIMSPFVYLFRIAVAASYASIIISYGIKKRRFCFA
                     SAQMAILTALTALVLLLQPALFLADVSNVWLSGVGELFNSTCYVGSTSIVWEWLGRLD
                     ASGRREEARSILGRPIYVDDQQDYHIAKYALRIQHALTQKSFENSDDGSGIDMEQMSN
                     SSPQLDAASRSNQITSSGGTAVGSGSIEQESVCQVRFKQKQPFRDAARHKISTACERM
                     LYFADQVMLKSLGTLSLSSKSTDSFSRGEEMVKKRIGLDRPNQVYVYTTKDVHFESDE
                     DI"
     gene            complement(<395582..>396979)
                     /locus_tag="HG536_0E02180"
                     /db_xref="GeneID:59326503"
     mRNA            complement(<395582..>396979)
                     /locus_tag="HG536_0E02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284085.1"
                     /db_xref="GeneID:59326503"
     CDS             complement(395582..396979)
                     /locus_tag="HG536_0E02180"
                     /inference="similar to AA sequence:RefSeq:NP_014104.1"
                     /note="ancestral locus Anc_3.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139981.1"
                     /db_xref="GeneID:59326503"
                     /translation="MLKNVGCGVIHTRLFIFKRYQSNRSSATAKNHKRKPSTRNVSEK
                     GPENLQRNKLEANGKGYFVPRVPSTDYIPSKDVQTEGLFAGYRPLFLGNSSIRAETSV
                     NALDNFFTSFASVKITSDSKSSGEIDMQDVLEDLRRDHAQMNLKNSKGKNRKPIIPWD
                     ASISGLVYNDRPFRDVPKDVVSKLKPFKMVRLERINESNKRIAPAPKMIRLKFHNSNV
                     SDEPEMVNLLNVLKSRKYSHSSNAVVSEADHNLFMRSRSNYEKELKTLAFKHKFIKSD
                     RKVFKSESDKLNRMLAKEFYRQTKLSIRTEFSDSVLPLYIYVNKSFLSKRLFRSFLRK
                     WLMEHVEPVLSTILASYDNEERAKRFHAKVKLKIENMVHEVSKHIPSVYFTGDSVDCV
                     VQSSPVPGFKRMHWLKPTKRNTLFWGKNADKDYLFTLDGSYNITRSGVKYMRYPNNLT
                     WRTFDDAFSEWDYHA"
     gene            <397337..>402199
                     /locus_tag="HG536_0E02190"
                     /db_xref="GeneID:59326504"
     mRNA            <397337..>402199
                     /locus_tag="HG536_0E02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284086.1"
                     /db_xref="GeneID:59326504"
     CDS             397337..402199
                     /locus_tag="HG536_0E02190"
                     /inference="similar to AA sequence:RefSeq:NP_014102.1"
                     /note="ancestral locus Anc_3.61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139982.1"
                     /db_xref="GeneID:59326504"
                     /translation="MTAASVEFNTFWKQLNSELQILSSEAKKRSAAIRVASDRSLEIL
                     RSVRSYEELSRHSEFVTPFVMSCSSKNAKLTTISMQCLQRLSSTPCLPSDRLSDVLDA
                     FVLATQLALDLKLKVLQVLPIFFKNYAYHICGPLCVKILKCCSDLLQSSNKSPMVVGT
                     ASATLQQLMDEIFERLIPRKAENATQAENEKIYDVLVGNNESIKVDVYRHDANVLFSD
                     LCSSFEVSDSPSKIGREPQLDMRNLPIDYGLEILESVLKNSTSLFLTYGDLQFLLRTK
                     TVPFLLRCIQSSMNFAIVVRSYRCIKLLIRKEYLSVLELELEVVLSLMIHGISVESET
                     PIWKKVLSLEVFSEMARNFDLLCAIFMTYDNYSDKKHILTSLLWECHRLLCQEDIRNC
                     LCESPIIQRMELPIVTGEAFNSRTQLIHMLDKASPPPVSYIYLVWLILSISNEWSYGF
                     SLAALELPGDSAKNHGPESEDLQTIYKGTFPELFSISKKFLYSTALDVSLFHSVVRAF
                     QKLAHAAGILSLAEQLNQCVAIFSISIVKNTEGWPEVPQIAQPQQALAPNSAIKSEEA
                     SYAVAEKVYQGARSKLPYRNINQAQLSLFRALISLSVSLGQTLPPSTWTYILKTWQWI
                     SYYVNGPSADFMEGFYLEDVPSPPLISKNDLVTIENTTRKLLETTISYSDSGFKTLVE
                     KLISESNDILASCTKGRSKEDSSQASIPACRYNKTFFISELGELTVCNLDRFANSRSG
                     REYWLSISNYLTSLIADRNVSTVAIRLYASKTLTDIIRKACIKIGEVEDPTARNKKFQ
                     SFECLVIDPLMNSIEALKNLDITKDAIYSGLVRAESEILLQSLSTLKNILNEFGDIMT
                     ETWPTVFKIINSPFYWNSESIDNMLSADEDDSSLVNGIAQKHIEMIQVSYDVFKLVSD
                     DFLQTLPLEVIKCVIDTIVHFVTQKQNLNISFSSLSQFWSLGDYFRMQESANQNAWLG
                     IDSSRFVDNITKGKLMDVIVAKDSTPFEVHCGLWLYLLKELTGCSEDERKEVKNGAIQ
                     TLFRIIDSHSAYFPSWKLIFLEVIKPLLSTKRDANQLLNDVEFWNHTLEGLVKLYPVH
                     FGNFSDEGSAREEWITLLNFLQLLLNSGLPEVSYVAIVNYRTLLKAMVNLKKVPQEVL
                     AKCVSIWSGYDVVYNDMPSSNSPIQKNGYDCIHELITSFPYLYEIVTTYQKMSVEFVE
                     ITLNLFNSAVRYPLLPEHTKDNLKPSSLQSAVLSGLEIFRPSHDDDVDTLILYQLSVI
                     VTLPFETREKIEKKLLPKLPNSSKARLPTFGAVSASALEIFNKRLLNGKVDSWGPLKE
                     KYTIKMFKNLGEVIRRKSLIRNAGNESPIYTAACEACAILTNRIFGLFSTSKMSVQVQ
                     DNFFDVFIEIASSPLQRIDMVTDSETEHFDANAYSMLRNIFIRQDVIGLFKQAQIEKI
                     LSSVWAGSFLYEKDEIEMEIMNRNQSLRDLAKGLANFDFDYIAASTVETTVLSKSECA
                     LICLRDLVHFVRFSEEQFETLRKLCAPYLVCRIAFVLRRFISHESLRRMAPIPKIRKL
                     ELQILIHGLHGIVEDLLIGSNSSKDAICNDLKLLHPLILRAMPLSHMLENLQKELLDL
                     SLGLTKLTSN"
     gene            complement(<402373..>404898)
                     /locus_tag="HG536_0E02200"
                     /db_xref="GeneID:59326505"
     mRNA            complement(<402373..>404898)
                     /locus_tag="HG536_0E02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284087.1"
                     /db_xref="GeneID:59326505"
     CDS             complement(402373..404898)
                     /locus_tag="HG536_0E02200"
                     /inference="similar to AA sequence:RefSeq:NP_014101.1"
                     /note="ancestral locus Anc_3.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139983.1"
                     /db_xref="GeneID:59326505"
                     /translation="MSLSAAANNISDNEFQNIGPAPRPPGLGKSSSGFNQTQPLTKLA
                     SQIDIQRSMGAGSGSQSSMHLKKRTGWVSYKDDGLLSFLWQKRYMVLNDSYLALYKND
                     KVADDPVLQIPLTSIVSVSRNQLKQNCFEIVRSNERLSSSSNSSASTGSSGSGNTGDS
                     GSRKSIFISPKTEQELHSWLDAIFAKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMP
                     SNWEKLLKHSRITGEDWNNDSAAVIQVLRFYQEYNGISGNASNPSINNASQHPPLNAA
                     KSGSSLKSSSNNIYKNLNASNSSVGPTGLLAQRHAPSPPNTKVSRVPEKATLPLLKTN
                     TPSPQHFTPYQQQTQHPRHTQQAGSGHSPNSPYGQRNLPHANFQQQSHQQQQHGQQTS
                     YQSTGYRPHHNNVNPYAKQPTTYASKSSEQNTRDISPQQGTAIPPRLHPQRAAPQPPS
                     AVRTAQKNVQTSNLGSSSTQAHYERSEDQRPSPTTHRAEQQPLQPLRQAPKKPLTEQK
                     SHAGVTKQRKPTKPSMSNAEIMAKLNTVALNLDPSPYFNMIEKAGQGASGSVYLAQRI
                     MLPPKLTEEELDNNQERSQAGDKVAIKQMILSKQPRKELIVNEILVMKDSRHKNIVNF
                     LEAYLKTEDDLWVVMEFMEGGSLTDIIENSPSNGSMNSPLTEPQIAYIVRETCHGLRF
                     LHDKNIIHRDIKSDNVLLDTRARVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVK
                     QREYDEKVDVWSLGIMGIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPETLSLEIK
                     RFLSVCLCVDVRYRASTEELLHHTFFNMACGPEDLTPLLSWKK"
     gene            <405361..>405969
                     /locus_tag="HG536_0E02210"
                     /db_xref="GeneID:59326506"
     mRNA            <405361..>405969
                     /locus_tag="HG536_0E02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284088.1"
                     /db_xref="GeneID:59326506"
     CDS             405361..405969
                     /locus_tag="HG536_0E02210"
                     /inference="similar to AA sequence:RefSeq:NP_014527.1"
                     /note="ancestral locus Anc_3.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139984.1"
                     /db_xref="GeneID:59326506"
                     /translation="MDSLYGARNWFCDVWFLEELRSMLRGVSFLFKRQLSSSYSPAGE
                     CSESLELAKQWLRQLNVHSVPLKLFSVRYDRSSGPGGQNVNKVNSKCTLVLYSFSSCS
                     WIPEAVRDQLKEKNMRYYAKGSDSLVIQSDESRSRESNRQICVEKLVKEIKKTCKFPG
                     KASEETLEKWDTIKDKANESRMRKKKLNSDRKKLRGKNNFTY"
     gene            complement(<406022..>408067)
                     /locus_tag="HG536_0E02220"
                     /db_xref="GeneID:59326507"
     mRNA            complement(<406022..>408067)
                     /locus_tag="HG536_0E02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284089.1"
                     /db_xref="GeneID:59326507"
     CDS             complement(406022..408067)
                     /locus_tag="HG536_0E02220"
                     /inference="similar to AA sequence:RefSeq:NP_014100.2"
                     /note="ancestral locus Anc_3.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139985.1"
                     /db_xref="GeneID:59326507"
                     /translation="MGRKSPSLPSDRNRSNGAGSKKPSGSSDSRNRKKRIVKRMRKSS
                     LSKAEKQFQVFNQVDEHVNKYENLDLDASDIETRSPRKKKSHVSNDILVIDEEDNDDG
                     YDDYDGHYDSPRPSVPVVDVESEHEETVSSGQSPQLSVATSENGLEANEDFIALSNSS
                     EEEPEPELSGEDQDHPHGAGAEGQLSPSKRATTNTDYPWILNHDHSKQKEIADWLTME
                     IKDFVAYISPNRQEIEIRNRTISRIRAAVKDLWPDADLHVFGSYATDLYLPGSDIDCV
                     VNSASGDKENRNSLYSLASFLKQRKLASQVEVIAKARVPIIKFVEPHSQIHIDVSFER
                     TNGLEAAKLIREWLEETPGLRELVLIVKQFLHSRRLNNVHTGGLGGFSIICLVYSFLH
                     LHPRVATGEIDPRDNLGVLLIDLFELYGKNFGYDDVGITVQDGHPAYIPKREWKDLQP
                     GRSPFTLAIQDPGDPTNNISRGSFNLRDIKKSFAGAFDLLTDRCFELDMATFKDRVGR
                     SILGNVIKYRGKPRDFNDERDLVENKAIIENENYHKKRTRIVHEEVFTDYSSDEGLNG
                     KGEDAYHVEEPARKKRATKPKNSPKDSRSEKKKQSVDSLMGISTNDDGEGEDDYNPLD
                     ARESSGTTEKENTEDAEVGASGKPEAALKKITVDAQTRRDYWLGKSNALSNASADHS"
     gene            complement(<408232..>409386)
                     /locus_tag="HG536_0E02230"
                     /db_xref="GeneID:59326508"
     mRNA            complement(<408232..>409386)
                     /locus_tag="HG536_0E02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284090.1"
                     /db_xref="GeneID:59326508"
     CDS             complement(408232..409386)
                     /locus_tag="HG536_0E02230"
                     /inference="similar to AA sequence:RefSeq:NP_014525.1"
                     /note="ancestral locus Anc_3.57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139986.1"
                     /db_xref="GeneID:59326508"
                     /translation="MDQGEVRLNERVINLERQISMFERMVHMLSGNLDEHFKRYDMIL
                     VAQQQQISDLNAVVSTLLNDQNRQAEVLREKLSGALHGISSTAASVNETIHSIPRLSG
                     RALEPESFFDEILGSGGPAAVKPKVSQPIDHGVSYGHRFGESNDNDRNNDNENETHNG
                     RIGDNSMKQQGPRGPGDHGSDERQFGSSIIPYDDFSPLNNPHSHPPGTGQSTNPSSIS
                     EHPLYQNPNGAPNPAAAGVNNEVHQPHHNGTAEVENGLTEEQYLTVTGRKRKRSLFVG
                     NFQFMKSPHSVMEVWKEYTEGINGQPSIKEMELIYQTGWRRDPAVNKRYSRRKVLCKA
                     IETGLAKGYALDYTVNLLEDYRFIDREKGLKQPIGWLCQGQNIPDELRGS"
     gene            <409857..>410372
                     /locus_tag="HG536_0E02240"
                     /db_xref="GeneID:59326509"
     mRNA            <409857..>410372
                     /locus_tag="HG536_0E02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284091.1"
                     /db_xref="GeneID:59326509"
     CDS             409857..410372
                     /locus_tag="HG536_0E02240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139987.1"
                     /db_xref="GeneID:59326509"
                     /translation="MATTSAPIAAPSPAAATFWLAASPSNELSPWLVEELLFLAVVAF
                     GRLLNEVLNVVVVYGVDVDSVVETMEVVTSGVVVTSTYETLSAVAREAADAMAAMVTV
                     AKNFIFSESECTVWLYASYDASYSFLRTIGLFISVAVGTWPAKTELESLLATRNVSRI
                     SHVNRRPTASW"
     gene            complement(<410484..>412367)
                     /locus_tag="HG536_0E02250"
                     /db_xref="GeneID:59326510"
     mRNA            complement(<410484..>412367)
                     /locus_tag="HG536_0E02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284092.1"
                     /db_xref="GeneID:59326510"
     CDS             complement(410484..412367)
                     /locus_tag="HG536_0E02250"
                     /inference="similar to AA sequence:RefSeq:NP_014524.1"
                     /note="ancestral locus Anc_3.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139988.1"
                     /db_xref="GeneID:59326510"
                     /translation="MSDEEDGNANYDDFMMSDEEVDIVEMEEETDEEDGCFTGESEFN
                     VEASTNEILGALDERELERLCDEALSFMEDQDFKRSRDLLQEVQHNTDKHKTELTAIV
                     WRWRLLSQIARSWLFEIHYNGIDDRTFRGTLDAFRALVDHLDRTELLNGDLVRRTLTD
                     LLHELCPSSKRDFLFAVELIADDSMAWKMQLRLQCIALLQASPRLGEATLTDEVRDTI
                     ELKRITAKVWSDRLDKGHIDLRDIQKIQESCCETSIEEATNDQHYADKIGLVLQCHIF
                     NYLSGHGDLPRDLFSRLIEQLELFSSNSLSVSQHLGLMIQLSTVRALVMLSGLGRDES
                     RIELPLFYRDIRALREQFWSCLQQMEEIGGSRQNFSSLFEQFILSGFIFCSMILHRRM
                     HDQINPFDLEQLKVALEAPSIRLLRTIYHNFLQLDLRKLHEAIQQLSGVRELLKRLID
                     NIYYLGQLAKLWEQIAPVYSCISLKDIQNMLEIDATLRVSRDELLTVLMTSILNNTAK
                     IYYKLDLTRDLVYFGDEYRVQLCSHPKKSFVNKTVVTESGVKLSHLEIANNIGVFDQP
                     CSLKGLDSCAFFDKIQRSRDHIQAAERQDHSKLHVSGARCSEKYEELASLATELLTFS
                     DIK"
     gene            <412807..>413361
                     /locus_tag="HG536_0E02260"
                     /db_xref="GeneID:59326511"
     mRNA            <412807..>413361
                     /locus_tag="HG536_0E02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284093.1"
                     /db_xref="GeneID:59326511"
     CDS             412807..413361
                     /locus_tag="HG536_0E02260"
                     /note="ancestral locus Anc_3.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139989.1"
                     /db_xref="GeneID:59326511"
                     /translation="MLQLYRNAVSRIAAARTFRTFGPALFKTGDKIPTGLGGLRENSP
                     GNSVDLGLEVASGKYVIVGLPAAFSPACSATHVPGYIKHLPQLKEKGIKQVFVTTVND
                     PFVTAAWGKSLGVPSDIRIIADTEGTFAKAGGHLFDSKKVFGNDRSVRFAAIVKDGKV
                     VTELVEPDKTGVDVSSAENILKHL"
     gene            <413609..>415117
                     /locus_tag="HG536_0E02270"
                     /db_xref="GeneID:59326512"
     mRNA            <413609..>415117
                     /locus_tag="HG536_0E02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284094.1"
                     /db_xref="GeneID:59326512"
     CDS             413609..415117
                     /locus_tag="HG536_0E02270"
                     /inference="similar to AA sequence:RefSeq:NP_014522.1"
                     /note="ancestral locus Anc_3.53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139990.1"
                     /db_xref="GeneID:59326512"
                     /translation="MAMLPFNVILRPAKIFFSKSRGSENLQSLELRSLPSQSYPATSG
                     FAPNGDQEEYILTKNNNVVEVGASKLSNVRSRDFIDETTLDDESEFPDRGLQAWLAVF
                     GSFIGLLPVFGLLNSLGAIESYISRHQLASVPASTVSWIFSLYLSMSFLSGIFAGGFF
                     DRNGGLAPMCTGTVIYVGGIMCLANCYTVWQFILAFSILCGAGTGVLMTPLVSVLATW
                     FLKKRAIATSIATMGGSVGGAIYPMMLKKLYKEVGYAWAIRITGFVCLACLIVSTTLC
                     RERELVKQEPFKSKTELMKWYVSSSLNWRYFLEMKFLFAALGAALAEVSLTTSSTYLA
                     SYSLARGNTESTSFALITAINAIGALGRYIPGYVADRYLGRFNVYIIAVTISGLCNLI
                     IWLPFGGYTGALWVYACIYGFSSGSILSLTPVCIGQISRTEDFGKRYSTAYFLQAIVT
                     IPMLPIAGVIINKGTVPEYNKFIVFVSVLMLAGAACNMVTRYICVGTKLRKF"
     gene            <415372..>416237
                     /locus_tag="HG536_0E02280"
                     /db_xref="GeneID:59326513"
     mRNA            join(<415372..415483,415789..>416237)
                     /locus_tag="HG536_0E02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284095.1"
                     /db_xref="GeneID:59326513"
     CDS             join(415372..415483,415789..416237)
                     /locus_tag="HG536_0E02280"
                     /inference="similar to AA sequence:RefSeq:NP_014098.1"
                     /note="ancestral locus Anc_3.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139991.1"
                     /db_xref="GeneID:59326513"
                     /translation="MGIDHTTKQHKRSGHRTAPKSDNVYLKLLVKLYSFLARRTNAPF
                     NKVVLKSLFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTVA
                     ALRFTAGARAKIIKAGGEAITLDQLAVRAPKGQNTLILRGPRNSREAVRHFGFGPHKN
                     KAPRILSTGRKFERARGKRRSKGFKV"
     gene            <416829..>417547
                     /locus_tag="HG536_0E02290"
                     /db_xref="GeneID:59326514"
     mRNA            join(<416829..416848,417133..>417547)
                     /locus_tag="HG536_0E02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284096.1"
                     /db_xref="GeneID:59326514"
     CDS             join(416829..416848,417133..417547)
                     /locus_tag="HG536_0E02290"
                     /inference="similar to AA sequence:RefSeq:NP_014097.1"
                     /note="ancestral locus Anc_3.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139992.1"
                     /db_xref="GeneID:59326514"
                     /translation="MPGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSAGNE
                     MPPQDAEGWFYKRAASVARHIYMRKQVGVGKLNKLYGGAKNRGVRPHKHVDASGSINR
                     KVLQALEKIGVVEISPKGGRRISENGQRDLDRIAAQTLEEDE"
     gene            complement(<419255..>420991)
                     /locus_tag="HG536_0E02300"
                     /db_xref="GeneID:59326515"
     mRNA            complement(<419255..>420991)
                     /locus_tag="HG536_0E02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284097.1"
                     /db_xref="GeneID:59326515"
     CDS             complement(419255..420991)
                     /locus_tag="HG536_0E02300"
                     /inference="similar to AA sequence:RefSeq:NP_014518.1"
                     /note="ancestral locus Anc_3.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139993.1"
                     /db_xref="GeneID:59326515"
                     /translation="MNSDDEDFNDIYGEESTSVTTVVDNKDEQKKDITTEKTSTPPKE
                     SNNSATSSLDQLAALQALSSNLTQASAANTNTNTSASTNANNNNYDTNSDNQSNTNNS
                     TDNRSGTDSTATDKPNAPTGMSWEQLQQTMSQFQPQATNAAPRQSVGPVKADLSRDIC
                     KMFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFEEPSSVDEVV
                     KTQHILDGKVIDPKRAIPREEQDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQLM
                     LDKDTGRSRGFGFVTYDSPDAVDRVCQNKFIDFKGKKIEIKRAEPRHMQKQQQAGDVG
                     GVQGFAGMANPMAQMYQNPMMAGFNPMFNPQAMAEYYQKMQEYYQQMQQQTGMDYTQM
                     FQQQMQQMSMMMPGFSMRGMGTPGAPSDSGTPNQGDDGASSGNAASSVQTVGGETSEA
                     KASSNESSDSGENKLQINLPRGPRGPPSSSADQSSHSYGRERRERGDRGDRGERGDRR
                     DRGERGERGERGERGERGERGERGERGERGDRDYHYRNGNRSGYRGGSGSGYRGRGGY
                     SRRNNGYHPYNR"
     gene            <421740..>423044
                     /locus_tag="HG536_0E02310"
                     /db_xref="GeneID:59326516"
     mRNA            <421740..>423044
                     /locus_tag="HG536_0E02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284098.1"
                     /db_xref="GeneID:59326516"
     CDS             421740..423044
                     /locus_tag="HG536_0E02310"
                     /inference="similar to AA sequence:RefSeq:NP_014517.1"
                     /note="ancestral locus Anc_3.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139994.1"
                     /db_xref="GeneID:59326516"
                     /translation="MATKYLVYMVQVHTNFRKAELESLAELYGIKSIDFTKHDEQSPF
                     FLVELEGDQQARDWIKRSILTRGIYEYWGEGATLEELHENVQSQPFFEHYKDTYKNDS
                     FKFEFESYKGTSKANRVKQIESFAYLDFRGKIDLKSAKQTYTLIEEYKPLSDNVPGTV
                     PIHLYFGRLVQRSDRLAVEKYDLKKRPYKGTTSFEAELSLVSANIAQVKPGTIMYDPF
                     AGTGSFLCAGGHYGALVVGSDIDGRMIRGKGAAQNINSNFRHYKENNRFLDVLTMDFT
                     HNSLRSNLVIDTILCDPPYGIREAIKVLGAKDPQRFVGKENVEIDGQKAYLRRDYIPT
                     KKPYSLDSLLDDLLQYASERLPIGGRLAFWMPTANDENIETIIPLHSNLELKYNCVQE
                     FNKWSRRLLVYINRGPDFHGKTNHGSSRSRSNFRDRYFKNFN"
     gene            complement(<423082..>424350)
                     /locus_tag="HG536_0E02320"
                     /db_xref="GeneID:59326517"
     mRNA            complement(<423082..>424350)
                     /locus_tag="HG536_0E02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284099.1"
                     /db_xref="GeneID:59326517"
     CDS             complement(423082..424350)
                     /locus_tag="HG536_0E02320"
                     /inference="similar to AA sequence:RefSeq:NP_014095.2"
                     /note="ancestral locus Anc_3.47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139995.1"
                     /db_xref="GeneID:59326517"
                     /translation="MTQLYTKLPRIGENLTTAVSSMSGRKRYSVHVPVSPLSPVLPIH
                     ASAVDGSQAFGSASSNASTPRAVYHESSSFYRIPSKYDQISMDSMSHKASNLKLLLIG
                     DAGVGKTAMILGYCNELPTKSQLKIMSAASTPVKNKPEQDKGGPRNQKKIDMRKRYSL
                     NDYEELFHKRQKFGGLMIGTNQSSDEFIPEVQTDDDSDEFVLDTRSTIGVDIKTSIIN
                     IDNRFFKCILWDTAGQERYRNAMIPLLYKGANGIILAYDICNLKTFQSCCDHWLREAL
                     DNFDTRDLAKVRFYLIGSKIDLYKDRQVTHEQVLRAIETIKSRFNVSISGNFEITCKW
                     PHVVERTINLIIKDLVENGCYENVDSLQERTPSLDTSPTSSELASECEDGENRLHCRN
                     KGSRSQPSRKDSSIDLSKPLNDIKASSCCV"
     gene            complement(<424600..>425841)
                     /locus_tag="HG536_0E02330"
                     /db_xref="GeneID:59326518"
     mRNA            complement(<424600..>425841)
                     /locus_tag="HG536_0E02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284100.1"
                     /db_xref="GeneID:59326518"
     CDS             complement(424600..425841)
                     /locus_tag="HG536_0E02330"
                     /inference="similar to AA sequence:RefSeq:NP_014516.1"
                     /note="ancestral locus Anc_3.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139996.1"
                     /db_xref="GeneID:59326518"
                     /translation="MPGASKCGFYMSQKRRYCGMTTKSGSSYCLEHLDVSNGTQGEKR
                     RVPCPLDPNHTVWASNLGRHVKKCNKLKLLHANDNEPFYVRDCNLLRAGETGCGDPPH
                     PNELVIQSIPVLERIYAEGFSDLPLQCKSNEYMESHRCAELASNRKHALQQSSLIQHM
                     LDRKLLQDTRFIEFGCGRAELSRYINQVALQQHAGAPPTFTLIDRASNRMKFDSKFRE
                     DFEKLRGGPADAAITRRCKIDIRDLKLDPLLEADRDFVAVSKHLCGVATDLTLRCIAN
                     SERLNRDGGLKGVCIAMCCRHVCDPDQYVNRPFVESLLRGESGLSYRDFFNSLRKMCS
                     WATSGRREGLSDDDVGGHFTNLPLGRRERLGLMARRVIDEGRKQWICENLTNRDYEVQ
                     LIKYTTPDVSLENVAMLMYTK"
     gene            <426182..>427285
                     /locus_tag="HG536_0E02340"
                     /db_xref="GeneID:59326519"
     mRNA            <426182..>427285
                     /locus_tag="HG536_0E02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284101.1"
                     /db_xref="GeneID:59326519"
     CDS             426182..427285
                     /locus_tag="HG536_0E02340"
                     /inference="similar to AA sequence:RefSeq:NP_014515.2"
                     /note="ancestral locus Anc_3.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139997.1"
                     /db_xref="GeneID:59326519"
                     /translation="MPHPVETDTIKIAVLGAAGGIGQSLSLLLKTQLTAFSNRRHVHL
                     ALYDVNADGVRGVAADLSHVDTPITLSSHSPADSADALRDCLINAALVLIPAGVPRKP
                     GMTREDLFAINAKIVGQLGGAIAQHCDLSRVFVLVISNPVNSLVPVMVETLYASAPAA
                     SAGVERRVFGITHLDLVRASTFLHEQTITSNLTERSDIMPYVPVIGGHSGDTIVPLFS
                     LASEQHHIPQQQLESLVHRVQYGGDEIVKAKNGQGSATLSMAHAAFQVVKNFVLLLTG
                     AADTLSGIFYVSLLDRAGQPVCPGAGKLLALIDGCTYFAAPVTATRAQGVVDVDYGIL
                     AKISAYEREKLLPLCLPKLKAGIEAGRKAGTTV"
     gene            <427431..>428306
                     /locus_tag="HG536_0E02350"
                     /db_xref="GeneID:59326520"
     mRNA            <427431..>428306
                     /locus_tag="HG536_0E02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284102.1"
                     /db_xref="GeneID:59326520"
     CDS             427431..428306
                     /locus_tag="HG536_0E02350"
                     /inference="similar to AA sequence:RefSeq:NP_014094.1"
                     /note="ancestral locus Anc_3.44"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139998.1"
                     /db_xref="GeneID:59326520"
                     /translation="MSSDPPPYQNYESLDHAAQGPVTVDPNVRRHELPDDFKYSTTII
                     SCEFPVRQRFMARVYSILSAQLLLTLAFCYAATTSGRLQLFLLRHTALYVVAVIAALV
                     SCVWLALAPRAEDYETEPADPLLGRRAAAVPWYCLGRRGQWTLLAVFTVAESYCLGGS
                     VMFESRQIVLNALLVTAVVVVGVSLMAFSGRFQIALESAASIYYWLNLALLLLIGIGL
                     SALLFGGMGSWLNYVYGWVGAVVFSVYLFVDTQLIFRKMYVGEEIRCAMMLYLDIINL
                     FLSILRILSSQNNDD"
     gene            complement(<428384..>428812)
                     /locus_tag="HG536_0E02360"
                     /db_xref="GeneID:59326521"
     mRNA            complement(<428384..>428812)
                     /locus_tag="HG536_0E02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284103.1"
                     /db_xref="GeneID:59326521"
     CDS             complement(428384..428812)
                     /locus_tag="HG536_0E02360"
                     /inference="similar to AA sequence:RefSeq:NP_014514.1"
                     /note="ancestral locus Anc_3.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037139999.1"
                     /db_xref="GeneID:59326521"
                     /translation="MAPSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLARAP
                     KYASKAVPHHIRLDSYKIIEQPITSETAMKKVEDGNTLVFQVHMKANKYQIKKAVKEL
                     YEIDVQSVNTLIRPNGTKKAYVRLTPDHDALDIANRIGYI"
     gene            complement(<429246..>429893)
                     /locus_tag="HG536_0E02370"
                     /db_xref="GeneID:59326522"
     mRNA            complement(<429246..>429893)
                     /locus_tag="HG536_0E02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284104.1"
                     /db_xref="GeneID:59326522"
     CDS             complement(429246..429893)
                     /locus_tag="HG536_0E02370"
                     /inference="similar to AA sequence:RefSeq:NP_014093.1"
                     /note="ancestral locus Anc_3.42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140000.1"
                     /db_xref="GeneID:59326522"
                     /translation="MLGRSGFNSLRGLRETLLIGVRYRSSGPVSFSSITDSISSEKDI
                     SNLVTPSSAAVGNSKRGGKLRPQLVPVKYVLNCLFAKNNTHFTFSAVVEDVNYLRNNP
                     DISYNEAFLYYLKLPQKVKFALSTGVLGFRKAARGEYEAAFQTSAKVFQMIQDKKLMN
                     KDIEIVMREFGKGRAAFVAALNGKEGAAIRSHVTRISDKTPLKFGGVRAPRVRRL"
     gene            <430313..>431443
                     /locus_tag="HG536_0E02380"
                     /db_xref="GeneID:59326523"
     mRNA            <430313..>431443
                     /locus_tag="HG536_0E02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284105.1"
                     /db_xref="GeneID:59326523"
     CDS             430313..431443
                     /locus_tag="HG536_0E02380"
                     /inference="similar to AA sequence:RefSeq:NP_014092.1"
                     /note="ancestral locus Anc_3.41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140001.1"
                     /db_xref="GeneID:59326523"
                     /translation="MSNGSGKCDEFVADDVTSNRSNNTRRMLIKEYRKIGHGAFGTVV
                     QAFITPDREKWYGPFAIKKVPAQTEYKSRELQILRIADHPNVVRLEYFFTHLSPQDGK
                     VYQHLAMECLPETLQIEISRYATNKLELPMKHVKLYSYQIARGMLYLHAFGICHRDIK
                     PSNILVDPTTGVLKICDFGSAKKLEQSQPSISYICSRFYRAPELIVGCTQYTTQIDIW
                     GLGCVIGEMLIGKAVFQGQEPLLQLREIAKLLGPPDKKFVFFANPSYDGPLFSKPLFS
                     GSRQQRFEKHFSHAGPDEIDLLMNVLVYEPQMRLSPRRIMAHRFFDDLRNEEYFFPRG
                     QTEPVRLPNLFDFSEFELQVLGEFVDKIRPNKDKQPSETEAK"
     gene            complement(<431581..>432132)
                     /locus_tag="HG536_0E02390"
                     /db_xref="GeneID:59326524"
     mRNA            complement(<431581..>432132)
                     /locus_tag="HG536_0E02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284106.1"
                     /db_xref="GeneID:59326524"
     CDS             complement(431581..432132)
                     /locus_tag="HG536_0E02390"
                     /inference="similar to AA sequence:RefSeq:NP_014512.1"
                     /note="ancestral locus Anc_3.40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140002.1"
                     /db_xref="GeneID:59326524"
                     /translation="MEADQNARLFRLPFKFPSFAGLRRISVYLSGVLYAVGFWLFLDA
                     VIYSKHANASDVHVTFVDWIPFLCSTFGMLIVNSIEKNTLLQGALSGGGMSSFAGSDL
                     DSSMAWQARVVLFFGFALLAGGLSGSIVVLIIKFLAKNYNTYPTVGMGVNNVLGNFFI
                     LMSCVLLWIAQNMEDEYSYSLTL"
     gene            <432348..>434042
                     /locus_tag="HG536_0E02400"
                     /db_xref="GeneID:59326525"
     mRNA            <432348..>434042
                     /locus_tag="HG536_0E02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284107.1"
                     /db_xref="GeneID:59326525"
     CDS             432348..434042
                     /locus_tag="HG536_0E02400"
                     /inference="similar to AA sequence:RefSeq:NP_014091.1"
                     /note="ancestral locus Anc_3.39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140003.1"
                     /db_xref="GeneID:59326525"
                     /translation="MPRKKSNAKKAREAARKLEQGVVPAEEGSDDKATLPAHVEGQDE
                     EGSEEEESSSEEEDDYGDLITEEVEDGIKNVLRAIRENDKEKLLDPKVRFFEDPEKAV
                     EKMTRSERHKPVYLKDYHRMNILSGNTFGDDEEEEKTVDGRESYVSQQQAERSQLLDE
                     IKNAFGDEGNEAEDEGEEDFLKKKAPSTKTAEPSLQLPDPEQDGEKFLEEFVNNQAWI
                     PRKGDKIVSLDRDPNMQEDDDEFDEAVEKFENAYNFRYEDPNAATIVSYARNQATLRR
                     SENSSRRRKREDEKQKKEQEKTEKEKTIQKKKSEKVHKLTDVLEQLKKEYGAEINQEI
                     VKKITDTLLNNDFKDDEWDTVLSELFDEEFYQQEGKPSWDDDDDIMADFHADQDKEDE
                     ESDAAFEATEVSAKKSRKDKVKEKKLKKKGKRELEEMVEDAVEQNKLKIIEEVEKEQE
                     ERKSRARTKEEQDLKFRYREVSPESFGLTTRDIFAADDTQLNQYIGLKKLAPYRSKEQ
                     KAKDKRKVTKAKRLREWRKEIFRGEDQLDVQSDEIKIPVDKAKKTSHKKKKHKSST"
     gene            complement(<434178..>436607)
                     /locus_tag="HG536_0E02410"
                     /db_xref="GeneID:59326526"
     mRNA            complement(<434178..>436607)
                     /locus_tag="HG536_0E02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284108.1"
                     /db_xref="GeneID:59326526"
     CDS             complement(434178..436607)
                     /locus_tag="HG536_0E02410"
                     /inference="similar to AA sequence:RefSeq:NP_014511.1"
                     /note="ancestral locus Anc_3.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140004.1"
                     /db_xref="GeneID:59326526"
                     /translation="MMSGDQSSNSGHSNLSPTTSLTSSLVSMNTEDHNELYDHRQHRD
                     SMFRNAGNQQVPVGSPTIPQPARVRGSSIANARPSRLGQYLAHQGSFFDEDNPRNVVS
                     GNSSSPSGRRGSKVASVGEAPNAKVNSAMSSQTLQKIGHASSGNAHGGTTSNDQRSRA
                     NSVASAGSANPKTLLTKTLSHLNGSGKQARRASFDSGDSKASRESQETEEDVCFPMPP
                     QLHTRVNGIDFDELEEFAQASIEQNQYVALKNQQPCKEPAQNVTSMWKHGGSSSSTTT
                     SVSSAAIRYTPKPSDDAASPSSQEEALAQAPGISFGANKVEEDEPQEKYTKRPYGEQA
                     GVGSRNPPQNYASESYQPEFAVPNRFSFFSSESEETVHATDIASLVKPGEHFSELFRD
                     GQPTWWLDCSCPTDDEMRCIAKAFGIHPLTAEDIRMQETREKVELFKSYYFVCFHTFE
                     SDNESQDFLEPINVYIIVFRSGVLTFHFGPISHCANVRRRVRQLRDYVDVSSDWICYA
                     IIDDITDSFAPVIQSLEYEADAIEDSVFMARDLDFSVMLEKIGESRRKTMTLMRLLSG
                     KADVIKMFAKRCQDEANGIGPALTSQINIANLQAGDGEVRFACPTLSQPQTQQIAQPR
                     GDIALYLGDIQDHLLTMYQNLLAYEKIFARSHATYLAQLQVESFNSNNKVTEMLGKVT
                     MLGTMLVPLNIIPGLFGMNVKVPGGGQETLGWWFGILGVMICLALTAWFAASYWIKQI
                     NPPKTLNEAAESGGKSVISSFFPKSSRQHQHANAHFSDPRFPVQKYPRGPLPSSNRSA
                     ASLPSKYSRYD"
     gene            complement(<437011..>438090)
                     /locus_tag="HG536_0E02420"
                     /db_xref="GeneID:59326527"
     mRNA            complement(<437011..>438090)
                     /locus_tag="HG536_0E02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284109.1"
                     /db_xref="GeneID:59326527"
     CDS             complement(437011..438090)
                     /locus_tag="HG536_0E02420"
                     /inference="similar to AA sequence:RefSeq:NP_014090.2"
                     /note="ancestral locus Anc_3.37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140005.1"
                     /db_xref="GeneID:59326527"
                     /translation="MTMLNGASSQEEAQMSPEKEQEIANRILKRAELAQMTRQLKMKL
                     GKVPTSREASPVKVRKRRGDGGCDEEIKEAIAKVSPVKKGCVETKAGEEDHGSRSPVK
                     QLKGWSTPPPAPPASSSSLLPDRRNQQEIPTTPRRVKGHHHTVPPAITSSSSGEDVNS
                     RTMALLATPKNRSLGRKLGTSESDVGADLLMYLATSPYLSAATAGHQPASVPSTPRNY
                     MSSGVALEDSHDAIRFSHMKHQTSSPQSTFKAPTHFVRHGTYSQGHAAQFPPSSSELL
                     MDSPAIYMAASSSPQKRRQLAVQPPTNVPTTPSRELRSSSHLWKTPNFNMGDYVHALF
                     SPSPRVTSSATSRPSSTHDMRSSKS"
     gene            <438265..>438825
                     /locus_tag="HG536_0E02430"
                     /db_xref="GeneID:59326528"
     mRNA            <438265..>438825
                     /locus_tag="HG536_0E02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284110.1"
                     /db_xref="GeneID:59326528"
     CDS             438265..438825
                     /locus_tag="HG536_0E02430"
                     /inference="similar to AA sequence:RefSeq:NP_014089.2"
                     /note="ancestral locus Anc_3.36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140006.1"
                     /db_xref="GeneID:59326528"
                     /translation="MLPRLVARRPIGSLSCVLRANTTALKSPLVCLLQRYTFTTSSAI
                     LSQQEEGNGAPDGSQKLGSFKVDKPMLMIAFTCKKCSTRSSHTMSKQAYTGGTVLITC
                     PSCKNRHLIADHLKIFRDDRVTIEDILKAKGESVSSSTDDLVFEDIPKDLQSVIGHHA
                     RDAPEDLRRKLDNETIHALPENRKTD"
     gene            <439042..>441258
                     /locus_tag="HG536_0E02440"
                     /db_xref="GeneID:59326529"
     mRNA            <439042..>441258
                     /locus_tag="HG536_0E02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284111.1"
                     /db_xref="GeneID:59326529"
     CDS             439042..441258
                     /locus_tag="HG536_0E02440"
                     /inference="similar to AA sequence:RefSeq:NP_014088.1"
                     /note="ancestral locus Anc_3.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140007.1"
                     /db_xref="GeneID:59326529"
                     /translation="MKRLQLFSSSKYFSLSSKSSDEGTPRGRSPARTRPKRYQPVRKG
                     AERRPRLHLLSLPSKILSQIIGQLDVNTLLSLCQVNSELYELISNEFLYRRITLDNKL
                     SLLKFNALIHSEFRTSSALAEQNCCKQASQNVRFLVRSIEFRNPQCQDSLLKYSKYYR
                     SNASGQEFLAGSYGFENDLTPTISNSKSRTSTISENSANSSRRHSDKLDHAVSEKYRN
                     LYKLECQFSQYTYIELMLDIIDYLPNLSQIVLDNVQPGFKVPLWYSVLNDGSRDFFKK
                     IISGQQSMTCKDLRTFEISADFASKYEDRFHLLPRVKRLEIRAALDKRTRRQVLLKPN
                     LLCCFGIIDELILQNVIIDTESLEAPLEFVPFHLRLEPSGVYDLHSTIRSLTLKSCEI
                     IPGNGILTRFYDYFKCVRELRLLEMISKFDMLLCNCFASLTELTIDCSSPCFTSEKVV
                     NDDYYYEKEDLLDSSEQDLDSDQLSVPETLFDQPINYYVAAPPPTSPVVLAMQLKYLT
                     KPMVQSQAGARKAAQVTRSQNDFFKSSRVPEFHRFFHYNKKLWDRLPRKNINISIVNI
                     PFTNVFPMSPQLYCEKLLKPLEDDQQTLLPPRASLLADDQDKEHYWDCALKECLLDSV
                     RDSTAIASYYDSNVEDLINDMDTGLLNNLENFKMFQDIPNLNAWFFLKSLSEFKSVRM
                     HMLKQWLFCTPRSRFDWEILLKPVLNVSVPVEVRDRDGVVLYSYGSKKLPKKRAST"
     gene            complement(<441315..>442796)
                     /locus_tag="HG536_0E02450"
                     /db_xref="GeneID:59326530"
     mRNA            complement(<441315..>442796)
                     /locus_tag="HG536_0E02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284112.1"
                     /db_xref="GeneID:59326530"
     CDS             complement(441315..442796)
                     /locus_tag="HG536_0E02450"
                     /inference="similar to AA sequence:RefSeq:NP_014509.1"
                     /note="ancestral locus Anc_3.34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140008.1"
                     /db_xref="GeneID:59326530"
                     /translation="MREIRQHLLSFLLLFLGCACVARGYVNPIEVEGKHFIDSVTKQP
                     FYIKGVDYQPGGSSDVTSDKDPLSDPDTCVRDIVLFQELGINTIRIYSVNPDLDHDKC
                     MSLLAAAGIYLILDVNSPLENQHLNRYEPWTTYNEIYLEHVFKVVEQFSHYNNTLGFF
                     AGNEIINDEESAKRAPPYVKAVVRDMKDYIKAHSARPIPVGYSAADDLDYRVPLSSYL
                     ECCENVDEDISVDFYGVNSYQWCGTQTMESSGYDKLVEAYKNYTKPVFFSEFGCNKVL
                     PRQFNEIEALYSKEMYAVFSGGLVYEFTQESNNYGLVELDSDGAVRLLKDFDMLKKHY
                     DNTKLPTADDVTKAAAADSSVLGQKDALEKVPICEKSYKNLGISGKVADGLASDFIKN
                     SVDIMKGHYVNLEENDFTTTYDIFDSNGNNWAGSKTIRQVNSIDATEPQTKPGGSSSA
                     SDGGSSSEASANGANGKKNAGSAPVSPVTAIAISAFLILINFF"
     gene            complement(<443054..>443689)
                     /locus_tag="HG536_0E02460"
                     /db_xref="GeneID:59326531"
     mRNA            complement(<443054..>443689)
                     /locus_tag="HG536_0E02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284113.1"
                     /db_xref="GeneID:59326531"
     CDS             complement(443054..443689)
                     /locus_tag="HG536_0E02460"
                     /inference="similar to AA sequence:RefSeq:NP_014087.1"
                     /note="ancestral locus Anc_3.33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140009.1"
                     /db_xref="GeneID:59326531"
                     /translation="MELHHVCFVGVIRNIIDEANGIKVTVEDGTGQIDAKRWSQDPED
                     IAASQDEELKKHHTSNLAQQFQIGTYVKVFGALREFGGDRKIQFALVKNIESFNEIIA
                     HHLEVIKCYATATGRFITSKAGAEKQGAPSLFVKDTDSNDTGNPLQRILAFCRQQCAD
                     KDPNHFAVPVPLIMQTLNLDETTVVDCCHTLTEQGFIYPTRNEREFFAMNA"
     gene            <444171..>446882
                     /locus_tag="HG536_0E02470"
                     /db_xref="GeneID:59326532"
     mRNA            <444171..>446882
                     /locus_tag="HG536_0E02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284114.1"
                     /db_xref="GeneID:59326532"
     CDS             444171..446882
                     /locus_tag="HG536_0E02470"
                     /inference="similar to AA sequence:RefSeq:NP_014086.1"
                     /note="ancestral locus Anc_3.32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140010.1"
                     /db_xref="GeneID:59326532"
                     /translation="MEVLLHSYLLLSANPTALDANCAEICDEGTIDLAREILNGQSYS
                     VVEKLAASFPKSPVLAASIDEESLLVSLRQFLDDCFTNNESYALLFAIASLQTFIQNN
                     YTGPLAPGNVQDLLFKQNDVPESVRTLAVSLLGSGGQPAYDLVKDPLYLILALLLLER
                     LTKQQTSFADDFDAERDTCDISATHTPGLRAVAHWWYARALLARLSLLREPAGNGPAI
                     ASSIFSSIDLAHAITKDLPPETSTSLKSDIYTMFYLENVKCSLAINTEHLCLPSLTKV
                     KKLTNFQFVLTGARAKRTKFQQKSFSGLIILAKSSSTAAVQESSDRNPDHIVLESDIL
                     LEKPHFEDIASEPLDEQIVKKQKLAEGDALEEDKLLPVAIRQENIPAELRSLDPNEQP
                     QLTGYDNVQLLLRLYVLRQTSPAKDPLVEEELGAIISRVIYQNGMKDWTIFSRALWER
                     SIVETCKAKTIERGLLQMQSLVEELGIKIQTRLIPSSYDAQNNERLKYVHQLPFIPHW
                     ELEATLAEKYMSLGVLKSAVEIYERLQMACEAALCYAAVGDEKTAEEILLKRVAEQPK
                     DARAYSILGDIRQDPELWQKSWEIGKYVNAKNSLGKYYYNPPASSGLSRNYNLVLKHL
                     NDSLRQYPLNFETWYFYGCAGLECGKFDVAAEAFSRCVSLDQTHAMAWSNLSAAYVEL
                     DKLKEALSCLKRAVASDSQKNWRIWENYMIVGAKLNEWNDVLLACRRLISIKRDKVGE
                     ASIDLPIVEKLTELLVSTDYSTDDSHKLTHFQRSCIELVCDTLPSVITTNARCWRLVA
                     KVELWRKRPWAALECHEKAYRAVSHNPDIEIDEKAWSETVDACEDLVAAYESLGELEG
                     RHGPGSLVCKDWKYKSRATIKGLLSKGKGRWDDSDGWERLMEMRKQI"
     gene            complement(<446985..>447833)
                     /locus_tag="HG536_0E02480"
                     /db_xref="GeneID:59326533"
     mRNA            complement(<446985..>447833)
                     /locus_tag="HG536_0E02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284115.1"
                     /db_xref="GeneID:59326533"
     CDS             complement(446985..447833)
                     /locus_tag="HG536_0E02480"
                     /inference="similar to AA sequence:RefSeq:NP_014085.1"
                     /note="ancestral locus Anc_3.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140011.1"
                     /db_xref="GeneID:59326533"
                     /translation="MGEMSLAVDDCILLKLMDKYKPHLKPYAYRQDAWYRVLEDYNEK
                     TGNLYRQIRTLKTKFNRMKVLCNDENSGIAVGDLELLRKLVGESDSATTHRARRKRRT
                     RSPALEIDSQQDALDAIERSEVVCGDEGHPSDHDDDAAELAEEANDATQPPPLDSITM
                     GFSLANTNNTSSPSLGLASGQPPVEAGERTSADAVGDLKPFGSSGQNYDAEIYKHLIT
                     SLTGILSRKRCMSEVVTNQDLVTVDKLYTELREYQRTEQQFREEVLHRLDTIIAHLGN
                     RENFPD"
     gene            <448147..>449109
                     /locus_tag="HG536_0E02490"
                     /db_xref="GeneID:59326534"
     mRNA            <448147..>449109
                     /locus_tag="HG536_0E02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284116.1"
                     /db_xref="GeneID:59326534"
     CDS             448147..449109
                     /locus_tag="HG536_0E02490"
                     /inference="similar to AA sequence:RefSeq:NP_014084.1"
                     /note="ancestral locus Anc_3.30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140012.1"
                     /db_xref="GeneID:59326534"
                     /translation="MSFLARRLRYKIASPFIQTRLASLVSYDIYLQRRPKQSYSTAPI
                     DKYQEKLLKKAKEQGFDSVGEFLESAKADIDKKKKDFNRIDPLKELEDYEQRMKMSAN
                     NAGMTSARGPIDASQAKVPFKTLDSFLNVEKIKELSKQEVEFLWRAKWMSKDDALCAV
                     VPVNIFDRMMTNAKSNPIFVLPLPRAAADGKEAPDQTQSVELHYIQWQFVGPNTVHCI
                     MTSLAEFKLHNEYAKPHTTFQFHLEMAKEKKIVLMNGQVEPDINVSLQDAQLLLLNVQ
                     RFWGAMGEETPIAKQRLKLLRDFTRGSTDFNVDLLISLSQSMEN"
     gene            <449272..>450264
                     /locus_tag="HG536_0E02500"
                     /db_xref="GeneID:59326535"
     mRNA            <449272..>450264
                     /locus_tag="HG536_0E02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284117.1"
                     /db_xref="GeneID:59326535"
     CDS             449272..450264
                     /locus_tag="HG536_0E02500"
                     /inference="similar to AA sequence:RefSeq:NP_014083.2"
                     /note="ancestral locus Anc_3.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140013.1"
                     /db_xref="GeneID:59326535"
                     /translation="MTVANSATPIAALFLGPEGTYSHQAALQQFGDHPQAKFIVADSI
                     PECLERLENDSNIDFAAVPFENSTNGQVVFTYDLLRDRMAKQSDGGDGLNRVIPELEV
                     IDEQYVSVSHCLVASSPLNLESLPRYKRIRIYSHPQVWGQVDKYLQKLKNRCPQTVVE
                     RIDTPSTSEAVRRTVQVESQSGERSELNLAIASNAAAKVHNAHIIDQGINDKQGNTTR
                     FLIFRKRSATTVQLPDSRTKVSLLTFTIKQDNPRSLVDVLAVLKNHPVNMCSISSRPL
                     KEEPKGRKWQYIFFIEYYCDSNKIDWDAFYQEISASCSLWCLWGTFPRNELYSS"
     gene            complement(<450355..>450711)
                     /locus_tag="HG536_0E02510"
                     /db_xref="GeneID:59326536"
     mRNA            complement(<450355..>450711)
                     /locus_tag="HG536_0E02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284118.1"
                     /db_xref="GeneID:59326536"
     CDS             complement(450355..450711)
                     /locus_tag="HG536_0E02510"
                     /inference="similar to AA sequence:RefSeq:NP_014508.1"
                     /note="ancestral locus Anc_3.28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140014.1"
                     /db_xref="GeneID:59326536"
                     /translation="MSEEDKMEVDSDVVEQRSSEVPQATKTKPKRFEIKKWTAVAFWS
                     WDIAVDNCAICRNHIMEPCIECQPLAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRD
                     ACPLDNQPWQLARCGR"
     gene            <450939..>451640
                     /locus_tag="HG536_0E02520"
                     /db_xref="GeneID:59326537"
     mRNA            <450939..>451640
                     /locus_tag="HG536_0E02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284119.1"
                     /db_xref="GeneID:59326537"
     CDS             450939..451640
                     /locus_tag="HG536_0E02520"
                     /inference="similar to AA sequence:RefSeq:NP_014506.1"
                     /note="ancestral locus Anc_3.27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140015.1"
                     /db_xref="GeneID:59326537"
                     /translation="MSTAETNEISSLYPPPPPYIKFFTQENLEKLPEYLKNKTNRDNQ
                     GSATGGAAEQPECALDFLIPPPLPPTSQYRAFGSVWQLKDQLPDLKTMGLTQLYKKAS
                     DEDTNNYQYKIKELHRLLKSLLLNYLELVNILSIDPSQYEQKVDHIRTILVNIHHLLN
                     EYRPHQSRESLIMLLEEQLEYKRKEIKEIDQVCQQLRDKLANLDRPTTEPDVEKPDDA
                     KQSATSYDGTIERRG"
     gene            <452083..>453549
                     /locus_tag="HG536_0E02530"
                     /db_xref="GeneID:59326538"
     mRNA            <452083..>453549
                     /locus_tag="HG536_0E02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284120.1"
                     /db_xref="GeneID:59326538"
     CDS             452083..453549
                     /locus_tag="HG536_0E02530"
                     /inference="similar to AA sequence:RefSeq:NP_014505.1"
                     /note="ancestral locus Anc_3.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140016.1"
                     /db_xref="GeneID:59326538"
                     /translation="MESLQPGPRNGLSFIRFSLDTLIFFLLFSFLPDLKVIVYKAQTF
                     QSVLSYNTDSGVSERVLSRAGSQMGSPNFISRNGSLKSNQTSANSLFSLGKKNYSNLL
                     LNKSSYYYQNDEIDDDHDGLIPLPDMLLSNLSIDDFSELSRVDSGSPLSFNTPRDNRR
                     RSVVKESTGGKRSKFIFILVGLPAVGKSTISAQLIRFIQSNPATHSLRCLVYNAGKVR
                     RKMSFKNLGKLSMELANNSSDDLFNPKNSEKKEKYARITLDKLLKELDRDVCDVGIFD
                     ATNSRVQRRQFVFEEICAYNENPESNFRVTPMVLQITCDEPNFIRYNVHQKSFNEDYF
                     DKPYEYAVRDFARRLKNYYSQFTPFSCEEFNSLVKLINDRGLGHGVFAYNIVNTGLVP
                     SKHLNNNHFPTNFSREIVQMVNLMESFVEHYTRMFGYTYIERVKEFFNEEMKNVEAKP
                     TPGGLNYLSTLGSILDEEYFGELQQLLRRNLENINIGH"
     gene            complement(<453727..>455082)
                     /locus_tag="HG536_0E02540"
                     /db_xref="GeneID:59326539"
     mRNA            complement(<453727..>455082)
                     /locus_tag="HG536_0E02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284121.1"
                     /db_xref="GeneID:59326539"
     CDS             complement(453727..455082)
                     /locus_tag="HG536_0E02540"
                     /inference="similar to AA sequence:RefSeq:NP_014082.1"
                     /note="ancestral locus Anc_3.25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140017.1"
                     /db_xref="GeneID:59326539"
                     /translation="MEDGNIQDQSQKRYLTQRRTVDISSPFEKLYFYRKHGIQLPTIE
                     PESSYTTDIMPPCAYRSRDRVINVTSKFTHLSSNKVKHVIPAIKWTPEGRRLVVATYS
                     GEFSLWNGSSFNFESIMQAHDSAVTTMEYSHAGDWMVSGDSDGTIKIWQPNFNMVKEL
                     DRAHTECIRDVAFSSNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPE
                     MGLIASASKDNLVKLWDPRVGQCISTILNFKHTVLKTRFQPTRGHLLAAISKDKSLRV
                     FDIRHSLKELMVVRDEVDYMTLLWSPINESMFTVASYDGSLKDFDLVQDLDAPIHTIP
                     YAHDKCITSLSYNPVGHILASASKDRTIRFWTRAKPLDPNAFDDPTYNDKKVNAWYFG
                     INNGINAVREKSENGAAPPSADGTDGYSLPPLSSSSNTSSLPGIDLVPSKTSSLPGLS
                     I"
     gene            complement(<455517..>456974)
                     /locus_tag="HG536_0E02550"
                     /db_xref="GeneID:59326540"
     mRNA            complement(<455517..>456974)
                     /locus_tag="HG536_0E02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284122.1"
                     /db_xref="GeneID:59326540"
     CDS             complement(455517..456974)
                     /locus_tag="HG536_0E02550"
                     /inference="similar to AA sequence:RefSeq:NP_014504.1"
                     /note="ancestral locus Anc_3.24"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140018.1"
                     /db_xref="GeneID:59326540"
                     /translation="MAPRKDDGKDDIPIEMVSLLDQSMEQDEGFTRDEVYTSKGWIED
                     VEWKGKKVKTYPLDYNKVGLVRMQIVTNLIVFLVFGLNDQTTGSLIPTLTRSYGISKV
                     VVSNIFLVQVFGYVLACLLNEKLHKRWGMRGAVNLSAGLFILFFAVLALQPSSFFIYM
                     ACYLPIGFALGILDSTGNVLIGNLEHHKNEWMGAIHGLYGAASMVTPPVVSHFVKYGR
                     WANFFCIPLGLSVLALAIAVPAFRHETAAKYDYVCNVNEVETELVEEDKSGGLTVVAL
                     LKNPAVSLYAIYLFVYLGAEVSTGSWLFSYLLSTKSDDKIAMSYVTSSYWTGLTVGRF
                     LLGFITKRVFASEYVASLAYSLMCLFFYSVLLAVGTINTDAGWYIVVLFFVLFFCGVF
                     VGPLFPNASIVAMQVLPRHLHVGGVGLAVAIGGSGNALLPYLVGVTLHFAGMNWFPLL
                     CWTMVVGFTLIWSIYPKYLPIPLHTYFRHELDTIS"
     gene            <457511..>459031
                     /locus_tag="HG536_0E02560"
                     /db_xref="GeneID:59326541"
     mRNA            <457511..>459031
                     /locus_tag="HG536_0E02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284123.1"
                     /db_xref="GeneID:59326541"
     CDS             457511..459031
                     /locus_tag="HG536_0E02560"
                     /inference="similar to AA sequence:RefSeq:NP_014081.1"
                     /note="ancestral locus Anc_3.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140019.1"
                     /db_xref="GeneID:59326541"
                     /translation="MSYSPGNRVVESSNLNSTKRVGTSAFSESIRERRALKLPIMLCC
                     SVSFGGFIFGWDVGTIGGITNMDSFNQHFGTIRNPFTGARRLPDTLIGLIVSIFNVSC
                     AIGGLTLAKAGDYKGRKFGIYVALVVYCAGLVIALTNDTNWIQFLFGRIFAGLGVGST
                     AVLVPIYLSEISPLRIRGAMVGSYQLLITLGILTGNVTNYGCNQMFFNDLSNMAWQFP
                     ISLGFLWALIIAVGLTFTPESAPFLISRRNAITEAKESFAKMNAVSTSDYRTTDFIER
                     SVRERYIRKKEAKNQDIFEWARGKPMLGVRLLIGISVMSFQQLSGINYFFYYGTTIFE
                     RTSMDPYAVTMILSSVNFIATFGGLYTVEAFGRRTCLLAGSIGMFCCMLIFASVGNFA
                     MNSDAAYAVMITSTCVYLIFFATTLGPVTFALVSELFPMRTKATSMAVCTSFNWMFNF
                     LISFLTPIIASRIGFLYGYFFAGCLLVSAIFAWVMVPETKNMTETDIDALYYTMNW"
     gene            complement(<459961..>461370)
                     /locus_tag="HG536_0E02570"
                     /db_xref="GeneID:59326542"
     mRNA            complement(<459961..>461370)
                     /locus_tag="HG536_0E02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284124.1"
                     /db_xref="GeneID:59326542"
     CDS             complement(459961..461370)
                     /locus_tag="HG536_0E02570"
                     /inference="similar to AA sequence:RefSeq:NP_011954.1"
                     /note="ancestral locus Anc_5.382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140020.1"
                     /db_xref="GeneID:59326542"
                     /translation="MSHRSDGSGGYYPQSNATFTGQNHRFNAMRMGANKGDQRQALNH
                     SRNTQLFMGDLDPSWDETAIREIWKSLGEGNIDIKMMWNNRNGSRTNMGFCFIQFPSQ
                     EHASNALLKNGAQIPGHPSKTLRLNWSSSSYSNSQESGEISVFVGDLAPNVTEADLFE
                     VFIARYASTSHVKVVYDPVTGVSKGYAFVKFGNREDQQRALQEMAGTFVKGRAIRIGS
                     AGHQTQRNRGGLMTDNKSRKLTGTLSNTKSSKVNAISASQFMFPTQQIPPLNCFTDPN
                     NTTILLKDLSPSVSEKELRASLQPFGQVVYAKMLPDKRCGVAQYVDRVAAEAALRKLQ
                     GFRIRGSKITVSWSKPVRQMNELPSQYQAHPSLKEPTYGYIPPSSDRMLSSLPGKDLH
                     PNQNINDGEIALLPGCSTFQYTQFPARASGVQNVFEQDPGETATPEPRIFQDTDVFIQ
                     SALCSMDRIEDGSNGHLFA"
     gene            complement(<461659..>462657)
                     /locus_tag="HG536_0E02580"
                     /db_xref="GeneID:59326543"
     mRNA            complement(<461659..>462657)
                     /locus_tag="HG536_0E02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284125.1"
                     /db_xref="GeneID:59326543"
     CDS             complement(461659..462657)
                     /locus_tag="HG536_0E02580"
                     /inference="similar to AA sequence:RefSeq:NP_011953.1"
                     /note="ancestral locus Anc_5.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140021.1"
                     /db_xref="GeneID:59326543"
                     /translation="MSKSKKQKLKVKDFQKKKLKVGKAKPKPSNVTDTSFVSKTISIR
                     SQHLAHDDDLSKRLPLLKHHNSTVRRETLQTFHKMIPKIINTRLMTPLLNQSIPLICD
                     DSRQIRTSLMELIEEIGVRDSQVLKLHCKVFILYLNMAMTHIMPSIQTDSTKFLKVLL
                     RFCGPEVCSQSFTKMLLGSFSILGWSRSTKNQSANVVHDSKRDSRQIAAHLEALSELI
                     KHGCTEEAVDQDLEGGAEMSNIQPNQYLIPECPQPYEHLKLFTRQLQNKQEQSNADSA
                     ISGFSSQDVRARQTIVKEQFLEDMRKHCDSLIKDGGEPGKWANTLNQLLEATFKEM"
     gene            <462851..>464974
                     /locus_tag="HG536_0E02590"
                     /db_xref="GeneID:59326544"
     mRNA            <462851..>464974
                     /locus_tag="HG536_0E02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284126.1"
                     /db_xref="GeneID:59326544"
     CDS             462851..464974
                     /locus_tag="HG536_0E02590"
                     /inference="similar to AA sequence:RefSeq:NP_010620.3"
                     /note="ancestral locus Anc_5.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140022.1"
                     /db_xref="GeneID:59326544"
                     /translation="MSSRALRKLQNDEELLESLLKTSGSKEASPAAAKTATPKVNMFA
                     LMNDEDADECLEDGEDEIDGDSCYDKQVEQVEVQLPTKSQRKKMKKNKKRGKKTNSRE
                     IEQNDAKNDIEENELDEIIQQFRKKDVQKYGLQDEEISDEFHTAYESEDDEIARAVTM
                     GDLIGDSGFSNFPRKGLRSYQRFFNADFKKLDPHYEFKLLFGDLSTKSLEDIDSMTTS
                     HVSPQQLKQLQRMKRLIKNWGGKDHRSVPNGPGSSAHRLQFTKVREDWLPTPRGELAL
                     KALTLNDLREWQMWQRPRDWKDVIDEDIQEMKKSIAFYKFEPLSPDVNRKAMTEFYLS
                     TILHPDHEALIHLISSKYPYHVPALLQVALILIRQGDRSNTNGLLQRALFVFDRALKS
                     GIQFNSLSCQLPYIYFYNRQFYFAIFRYVLALAQRGAVATASEWCKVLWSLSPLEDPL
                     GCRYFIDHYLLLNNDYQYLIDLSKSALVTSYKQWCTLGLALSAVLSYLRVGLPEEARK
                     ALRNSFNLHINSYSMMFIEKLSGDPSLTAGAELKITSSELIETKAYMARFATVWSKPE
                     EITFLRDEMASLYKIIREGKADFMQVSVAECHDCDGENPLFIKGMPVNLLRFAILSEE
                     PSVMGSLPPQIWEDNEVYEFDVLPPTPTSKESIEVLETVKNFIEEKELITHEMERMQD
                     EEILNQVRQMSLEQFLEENPNAGVE"
     gene            complement(<465117..>467207)
                     /locus_tag="HG536_0E02600"
                     /db_xref="GeneID:59326545"
     mRNA            complement(<465117..>467207)
                     /locus_tag="HG536_0E02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284127.1"
                     /db_xref="GeneID:59326545"
     CDS             complement(465117..467207)
                     /locus_tag="HG536_0E02600"
                     /inference="similar to AA sequence:RefSeq:NP_011952.1"
                     /note="ancestral locus Anc_5.379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140023.1"
                     /db_xref="GeneID:59326545"
                     /translation="MKICTSSSRTEEVLKNEINEDGFLPESSRENIEESLRLIDDLKF
                     FLATAPVNWQENQIIRRYYLNNDQGFVSCVFWNSLYYITGTDIVKCCMYRMQKFGREV
                     VQKKKFEEGIFSDLRNLKCGVDATLEQPKSEFLSFLFRNLCLKTQKKQKVFFWFSVPH
                     DELFADALERDLKRESLNQPSTTRAITEPALSFTFDILSNKTLNEQLTRYLKAKSEEI
                     LGSEPVISSRMVVQEQDMKFKTEDNTKSTLKDIIQDDTGFGIHIDSSTDTQQDLSSPD
                     TSADFEPQKLVVEPSNLELNNSDIHKDDVDTIDEADRGDFPLDYFPVEIEYPHQEREF
                     ESLNMRTATAHLPPFYDNRYEEEMVPPTATFAFFPPYAMHTPFAVPLSGTRSQFLVNS
                     NRYWTSQPQERSPTSSGEESPKDKIPEQADLSDSLEKNNSSFSDQQQQPLYQSQAQYL
                     NPYSKAFNGGTFHGYHPQADMTMYPSEALSYGYDDLPPSQEVYDQGYLLQPELPNWGF
                     VPPQAMQPPASGTGFVPRPFTPSFRSTPVTGRTPYLSMAQNAWPQSISSPHGPRSTSA
                     TTKTHSGASMHQQQPPTSFTHRRQPYPGNVATAKNVSKHSKVVKPSHLRTNSQLRKQQ
                     ASNVKAKPTQPKASAEGNDRVNSDVGQRFSIPTPESNTLVAQVNDGASAGPPEEYLNA
                     DDLQPQLQNREESE"
     gene            complement(<467696..>468676)
                     /locus_tag="HG536_0E02610"
                     /db_xref="GeneID:59326546"
     mRNA            complement(<467696..>468676)
                     /locus_tag="HG536_0E02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284128.1"
                     /db_xref="GeneID:59326546"
     CDS             complement(467696..468676)
                     /locus_tag="HG536_0E02610"
                     /inference="similar to AA sequence:RefSeq:NP_011951.1"
                     /note="ancestral locus Anc_5.378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140024.1"
                     /db_xref="GeneID:59326546"
                     /translation="MPSFFSVPGPIKTIFDSFPLAIYPAISKQDDSMSGEISRRKFAF
                     QGSNARQDTPNNTFMLGVYNVFAELESGCLLATDPLCLYAQFALCKKNALGLPNGSTC
                     EGRGYPHSIALLSHAASAKESLPILVEGFSKRSIRSAEGIDEILRTRVSHDAEQLMYI
                     TMLDHVVYDCWIIQVLYHTTEEEFLRLYSHDPKSTTALLGHLAIGNMKLALVKRNEFH
                     LRHKELVKNIESPLNVYKARSLNHLLKPIFDKCKKTLLQFQDIMSDPSLRSTKDVSPT
                     YLELKIASYILCILNLDEMAPLRAFVENQCQGLTKQAKLTVQKLQKAALN"
     gene            complement(<468799..>470757)
                     /locus_tag="HG536_0E02620"
                     /db_xref="GeneID:59326547"
     mRNA            complement(<468799..>470757)
                     /locus_tag="HG536_0E02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284129.1"
                     /db_xref="GeneID:59326547"
     CDS             complement(468799..470757)
                     /locus_tag="HG536_0E02620"
                     /inference="similar to AA sequence:RefSeq:NP_010619.3"
                     /note="ancestral locus Anc_5.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140025.1"
                     /db_xref="GeneID:59326547"
                     /translation="MIRELVKWCRSAVRHSSTVQLRDYQQHVIDRCIDRIVKREGPRV
                     RIGVSLATGGGKTVIFSNLVKQLSEKHGFARTLILAHRRELVMQAAGTVRKCIPHSSV
                     QIEMGKCVASLDRSAGRVEVVIASTQSLIRRLDNHPRDYFDLIIIDEAHHAVANSYLK
                     ILDHYDGAVPVVGFSATFERADNKALSTVMDEIVYHRGILEMISDKWLCEGKFTTVNI
                     DCDLSKVELSSGTKDFKLDKLSSALNTEQLNEVVLNAYLHKRAANGFKSTLLFAVDIK
                     HVESLYQLFRDRGVTAGYVTSNTPTEKRDQIVRDFRAGRIEVLINCGIFTEGTDMPNI
                     DCILLCRPTRSRSLLIQMIGRGLRLHHSKDHCHIIDFVGASNVGVVSVPTLAGIEHFQ
                     GTLQDATMSDLLKIKEEIELERNRQLEKEEAYQESFHAWLNEIDSFDLTLSTFDNFRS
                     FYDQQQTTSAVTDMALDERTFFPTSVYPWVKFAKDGWGFSLHNGHHLRLYKQNIKGNA
                     VEYVLRLYREIPHYLRDKTGVRFIPRELIKTGEFSKAISKVAEVIEILSKTTEDNSSV
                     KNFTRFAKWRKQPATVKQKNSIKRKLQSRLNTDGSSYPSLSPIDIATFADRLNKGEAS
                     NILFATSLASVYPIKSLLKVLEYKKAKL"
     gene            <471305..>474127
                     /locus_tag="HG536_0E02630"
                     /db_xref="GeneID:59326548"
     mRNA            <471305..>474127
                     /locus_tag="HG536_0E02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284130.1"
                     /db_xref="GeneID:59326548"
     CDS             471305..474127
                     /locus_tag="HG536_0E02630"
                     /inference="similar to AA sequence:RefSeq:NP_011950.1"
                     /note="ancestral locus Anc_5.376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140026.1"
                     /db_xref="GeneID:59326548"
                     /translation="MSLDYEVYKEGGLLNDRYQKIEDISEGSYGYVSLAKDIERKKLV
                     AVKFIFKLEKEPSVDEDGAAGEEEGARDCDDVVKSANSSVEKRVQLAKHRESMISSNV
                     RSRLSENICFEAAYEIEIQRMIGNEHRNVVKLLDFFDSYIILEYCSGGDLYEAIKGDL
                     IPRKTREITHILTQIIEAIQYVHSKGIYHRDVKPENILISNLFDWTIKLSDWGLATTH
                     PTSLDRSVGSERYMAPELFESNLDLAERKEPYQCDKVDVWSIGIVFLNIVFSKNPFSV
                     ANQTDKAFCYFAANREALFDVFSTMSLDFFQVLRYSLTIDPANRDLKKMRRELDNLSE
                     YTLDDEYYNSLQDNDVAIYDEEPRHAPAYVPPSSAPAPVSLPTPPSSSTGKNGKRLQS
                     ASSSIPKQTDSFVHAEQNIVDKKSSPIAASTTNGKTEEKEKERARSVPKFKFRKRSHV
                     QRNDSPNQNQPHSYANGKTIKNRNYNHYNNFSHFGNNYNYNQKNYFFNGADKPKIVKH
                     SRKPLGIPTPNTYINNYFNDYHKNKEQHGSESNDYNGFNTRDFFTPPSVNNRYMEGIF
                     SHNYVNKHNNNNNNNNNSSNNNNNNNNTNKNHYFPQFGTSGSKGKQPRRPSSGNRVAA
                     PKTKNPNTSTTSTSVPAYHSPGKYIPPNVRNHYTNQYQSHVPNISAVLDTHTYHEQYA
                     NADNGKNETTSKGDLDDVLFTLEESDDFLRDINDLSLHDAPVSSHGTDLHGALQNDLP
                     DLLKSPEPPRLQLTGAENPFAAQILNGGNDGKPLVANQHLNAGTSEHKYKPGIYVPPH
                     HRKSFSSTTAANEVTLSVGQNMYDYSALSDSRRPSASIQQYQAPFMPSLKNHSTTTTA
                     LQDKDVFAQTDNDAIIFSEDESDDNGEDSRGMKTVFGPYTIYNNGEMSYNTVRAGRKS
                     STVQSEAVGSLEQYKNNWLMLQQQQD"
     gene            complement(<474375..>475580)
                     /locus_tag="HG536_0E02640"
                     /db_xref="GeneID:59326549"
     mRNA            complement(<474375..>475580)
                     /locus_tag="HG536_0E02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284131.1"
                     /db_xref="GeneID:59326549"
     CDS             complement(474375..475580)
                     /locus_tag="HG536_0E02640"
                     /inference="similar to AA sequence:RefSeq:NP_010618.1"
                     /note="ancestral locus Anc_5.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140027.1"
                     /db_xref="GeneID:59326549"
                     /translation="MLCSWKHSIALLLTVLGPFIGLVHAQHTNNWAVLVSTSRFWFNY
                     RHMANVLSMYRTVKRLGIPDSQIILMLSDDVACNSRNLFPGSVFNNQDHAIDLYGDSV
                     EVDYRGYEVTVENFIRLLTDRWSESQPKSKRLLTDENSNIFIYMTGHGGDDFLKFQDA
                     EEIASEDIADAFEQMYEKKRYNEIFFMIDTCQANTMYSKFYSPNILAVGSSEVDESSF
                     SHHSDVEIGVAVIDRFTYYSLEFLEQIEKNSSLTLKDLFDSYTFEKVHSHVGVRTDLF
                     KRDPKDVLITDFFANVQNIVPDNVDANGYIYESTDNDTFVQNVLNLALERTTDENEDD
                     QHERNQFFHQHFTRTSDLTQEIELVPIAGIRSRVWAVGMILISTVTYFLLQGKHSKPA
                     RRELFSSLN"
     gene            complement(<476012..>477505)
                     /locus_tag="HG536_0E02650"
                     /db_xref="GeneID:59326550"
     mRNA            complement(<476012..>477505)
                     /locus_tag="HG536_0E02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284132.1"
                     /db_xref="GeneID:59326550"
     CDS             complement(476012..477505)
                     /locus_tag="HG536_0E02650"
                     /inference="similar to AA sequence:RefSeq:NP_010617.1"
                     /note="ancestral locus Anc_5.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140028.1"
                     /db_xref="GeneID:59326550"
                     /translation="MSQDQIDSFIAITSAENGELAKHFIEMAGGDLQTAIALFFEHGG
                     NSQLRRQAGSSDQTGTDVDRNNDEDVAQRLQAEAYRNEEEFVRAPDQARHETLAETHI
                     FPGTYGGIGGSFNPLRQARDMFDDSRPAGVFNQRLNDDFIADGSASDSDSDDSAASSE
                     DDDAYEYVEEPVIELDEDGNVREYTKLVKRPKAMSRERRLALLFRPPFDLMTKLNLSS
                     AKVRARKKSKWMMVNIQDSGVFQCQALNRDLWSSKEVKKLIKSNFVFLQYQYDSPNAQ
                     PYINFYGIRSKDSLPHIAILDPMTGERLKQWNKTVPMPDSFIKEVNEFLGSFSLDPKA
                     ANPTVKEPTPEIDPTTLSEEQQMKLAIEQSLGKSFSEPIALDEPEHQQDLSEMAAEKD
                     DNRAPSAFEAIKAVKHEEPPNRPGITTRIQVRTGDGRRVVRRFEVRDLVRNIYEVIKS
                     EIDGFEQCHFTLSNHQRENLIDKLDMTIEDAGLKNSSLLVEKAYASD"
     gene            complement(<477885..>478511)
                     /locus_tag="HG536_0E02660"
                     /db_xref="GeneID:59326551"
     mRNA            complement(<477885..>478511)
                     /locus_tag="HG536_0E02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284133.1"
                     /db_xref="GeneID:59326551"
     CDS             complement(477885..478511)
                     /locus_tag="HG536_0E02660"
                     /inference="similar to AA sequence:RefSeq:NP_011949.1"
                     /note="ancestral locus Anc_5.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140029.1"
                     /db_xref="GeneID:59326551"
                     /translation="MSTSLCKESTYQDPFSAIVVCRELPLMEDVEKIKPYISHLNKQL
                     NSLKVDLDKLTSKSLDEQLLSLKDERAKLELTNRYAYALSSLMFSYMKVLNVKDLSPI
                     KAELDRVKSYMNKAKAIDGKDEREERLQQEEQERAKRVINNALDGRQTGPAISKHNFQ
                     GKHTRFDDLAEDQDKQNLDVKEISQKVADSRRKKPRVDKQKVSKRRSK"
     gene            <478609..>479127
                     /locus_tag="HG536_0E02670"
                     /db_xref="GeneID:59326552"
     mRNA            <478609..>479127
                     /locus_tag="HG536_0E02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284134.1"
                     /db_xref="GeneID:59326552"
     CDS             478609..479127
                     /locus_tag="HG536_0E02670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140030.1"
                     /db_xref="GeneID:59326552"
                     /translation="MPKNDEVSRGLTLSIQKLQAALKSYEAGEISQEKVARLKELQGA
                     LSSGIQEISELVKSEPISGAPALADKQQDSRPSFSRKRFYSSDSPYLNRMDLSRSYRL
                     VPPMKVRKATASPQPKRVSPSEFLLSSLQLLENITNLQRLEKKTSTRDGHSKGSLAAK
                     ATVSQLDQSAET"
     gene            <479587..>481011
                     /locus_tag="HG536_0E02680"
                     /db_xref="GeneID:59326553"
     mRNA            <479587..>481011
                     /locus_tag="HG536_0E02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284135.1"
                     /db_xref="GeneID:59326553"
     CDS             479587..481011
                     /locus_tag="HG536_0E02680"
                     /inference="similar to AA sequence:RefSeq:NP_010616.3"
                     /note="ancestral locus Anc_5.372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140031.1"
                     /db_xref="GeneID:59326553"
                     /translation="MSSGSVSSRSLFQRHRGKVLTSVGIVATLFTAGSVCMYLVKRWL
                     YKQQLKITEQHFIREQIRRRFTQTQEDSLYALYELIPVFAMVLAKKLDLEELVIALRD
                     KKLSKTGSQKARIGDNDVLSSGISTSVTEVDTSTANVANKSEGKTQKTKAELWNELKT
                     KSLIKMVTISYTISALLLLTRLQLNILTRREYLETAIRVAVEKESSLSDGKSVVSWIW
                     GLWKGDDTKSAVSEAIEDSKAKPTPVSKNSYINEQAFLSLSWWLLNRGWQDFEAIVEE
                     NVEKQFGQLNPRDTLSITEFSEKLTEVFRDTNKQLFPDATNEQNGTGRLQTILLPRPD
                     LEDFVLKQTLDPEAFNILNEDKTVFGQLILETAKCLESTVSSIVLETLVNESFQYIME
                     QVETNVSKKKNKQKTAKESDCVEDSDAKYQMAVFTISCKDCCNEILKSGVVSMDNEFL
                     ARLDSVVILDDLSASVYSNFGFQD"
     gene            <481211..>481789
                     /locus_tag="HG536_0E02690"
                     /db_xref="GeneID:59326554"
     mRNA            <481211..>481789
                     /locus_tag="HG536_0E02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284136.1"
                     /db_xref="GeneID:59326554"
     CDS             481211..481789
                     /locus_tag="HG536_0E02690"
                     /inference="similar to AA sequence:RefSeq:NP_010615.3"
                     /note="ancestral locus Anc_5.371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140032.1"
                     /db_xref="GeneID:59326554"
                     /translation="MAGSKSRNVVLVSGEGEKFTVERKIAERSLLLKNYLNDMHDSQL
                     QDDSSDEEEDKGNKGGDADEDEDDEDDEIVMPVPNVRSSVLQKVIEWAEHHKDSNFPD
                     EEDDDSRKSAPMDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRS
                     PEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR"
     gene            <482733..>486674
                     /locus_tag="HG536_0E02700"
                     /db_xref="GeneID:59326555"
     mRNA            <482733..>486674
                     /locus_tag="HG536_0E02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284137.1"
                     /db_xref="GeneID:59326555"
     CDS             482733..486674
                     /locus_tag="HG536_0E02700"
                     /inference="similar to AA sequence:RefSeq:NP_010613.1"
                     /note="ancestral locus Anc_5.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140033.1"
                     /db_xref="GeneID:59326555"
                     /translation="MTTDDKGTKKTFLNKLFKRRKVNGKLKKDERRNISFSIANNGNG
                     SIAKRKINGERPRTSGNQLELPEIISIRSNSLFDSEEEGEEKQESHDAERGSRNLLYA
                     PNRALRNSSKITGTSSSSPAKTNDLKPIKTDYLKVSDNRPAMKHETGSSAEYDEELEH
                     PSTILGTLAAFARNATARMPKINVRDVDEAASPISPYSPLTSAQGHRESENNDQAVPH
                     SNDKGYDTFLGKNDDTLDETNLNHTVVHHQDSNDHRSDSFLRNLDFLLSSPSPLDNHL
                     SIKSPMDLTKSYSRNDSRSTSLMGKNESMFSMNGANKVKFEPLTTKSPAISTFGKGDL
                     NLDEFEDSPESRPSLPTTQRESSENMSITARRLSTDEMKRHSSSNAAKLTEASKFSAS
                     DTDVARTRERSKTLPDAELARNSGMQSYNNRNSRYSKLEDEVDNLDESDRRPRRMSKK
                     FLSRRSFSPTNIGMKVLPGMALRSPVVKIRNSADHSSVAGAANVSNPNNGRLDYLTNG
                     DGSIRTRASTSVAPIEVSSGEADDFHLKGMKFANEKKNSEFHTLFKGTDVTQEEKLIA
                     DHNCALSRDILLQGKMYISDQHICFYSNILGWVSTVVIPFKEIVQIEKKTTAGIFPNG
                     IVIDTLHTKYIFASFISRDATFDLITDVWNQIILGTSKIRNAGTRSSSYIGADADSNS
                     FYSEKDMTDSGFEEEDESVIDSTELTSSDGSVDEDLHNRQKPSMVAPAGPVKHAPTQV
                     DYTPSEGEKLIRKATINAPLGKVANILFGDDVSMIASILKAQKNYDISEIPRILDSKE
                     REYDYTKPLPGGFGPSKTKCKITERLEEYDLEKCVKAVQISKTPDVPSGNSFSVKTTF
                     LLSWAENSCTNLAVYVSIDWTSKSWIKGAVEKGTFDGVTESTDILINELNKLAKPSSS
                     KKAGAHDLEVLSNLPKMGPAAHKVTDYDYKKDKDDVIIEQDADIPAPLGTTFQLLFGN
                     DTKYFKRIIEKQKNFDLSEIPKFTNNVREYSYTKPLNGSVGPKQAKCFITEKIEHMDV
                     ENYIMVKQTSKCPGVPFGNNFVVNTRIYLSWSDHDTTKMFVVTNIVWSSKTLLKGTIE
                     KGSIDGQKESIGIMVDELKEIIASSGSVRRKTRKRGKSFKGPKASTEAAGRDLTTASL
                     PQKIFSFISSLFENFSLTSIPIITIIIALLIIAAFFVRFIFMSHTERQEVTILGSGRL
                     IIDGNEYNYVPSFKTLYKVYENNVRESSRQKSALKGHNLVLEAENDLWGWLNDRGDIT
                     PQLNSNAYNELSTDIESKLDTRKLLQLRETIQATENQLNDMKQLLERKGIV"
     gene            <486841..>487198
                     /locus_tag="HG536_0E02710"
                     /db_xref="GeneID:59326556"
     mRNA            join(<486841..486956,487033..>487198)
                     /locus_tag="HG536_0E02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284138.1"
                     /db_xref="GeneID:59326556"
     CDS             join(486841..486956,487033..487198)
                     /locus_tag="HG536_0E02710"
                     /inference="similar to AA sequence:RefSeq:NP_011947.2"
                     /note="ancestral locus Anc_5.369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140034.1"
                     /db_xref="GeneID:59326556"
                     /translation="MHAISQSQISNSRREVAELKEHYERLQKQFDSLSAELDLSLTAK
                     QVMDLHIKRLKEYNELRDAGLRLAQLVADEKRCRMKDVFEEMGYSMKDD"
     gene            <487501..>490914
                     /locus_tag="HG536_0E02720"
                     /db_xref="GeneID:59326557"
     mRNA            <487501..>490914
                     /locus_tag="HG536_0E02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284139.1"
                     /db_xref="GeneID:59326557"
     CDS             487501..490914
                     /locus_tag="HG536_0E02720"
                     /inference="similar to AA sequence:RefSeq:NP_011946.1"
                     /note="ancestral locus Anc_5.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140035.1"
                     /db_xref="GeneID:59326557"
                     /translation="MHMEKIRLRLILQLLFVSFCFGAGLWADQNGLESMGSNATSPAL
                     QANQPTTGIEYHTVIPTALRKQKTGQTSSLSPEITVAIPSGDSILSQSLLGQAAEGHD
                     RHIISSHERPAKVQVHRERSLENLSLSNLLLATDLEGGLHGIDRKNGKTLWSIDSSFF
                     EPLIEITGRGSSTMNETLIVEPYNDGNIYYFSPFQGVQKLPVTINQLVASSPMHLKTD
                     IVVDELGTVIQDEKIYTGSRSTSMYTIDLLTGEIISAYGLGTKNKKYSRDKETCITSG
                     FESTQCHNSIVVGKSTYRLEIHSLDGIAYNVSYSKWQQNSLDTHLATQNFLSQDGIYI
                     APFRDKTVLAISDDFKIARWISATFPGIINGIFDIYQDETKGENILVPHPLKSPYEKL
                     SNNEKVYLDQNQHGTWFALSSHNFPSLVEVAPMSKYSLNERWKAPSIFQNEDLTRTAL
                     QGVHELTNMRFQQIFEGGREQNDILSLPEKNSPLLIDPPADHILDPTSQKVKSIDRYI
                     SPGELEAYKLKVQEQIAQEIMQKAQGSFLRTAARFVYRVVESGFVLLFALFILLILQK
                     FRIIMPLPVLLEKLGLIPTKDITLKDVEITNLDNDKMSNRNAAKKSEVADVEDKGQTA
                     VMSSSSSADIEQEDIRMLGDIHDKNGTLIVDKRKRKRGARGGKKAKKKLLAQETNQDG
                     EDLELEHDLKTLTVSDKILGYGSSGTVVFQGSFQGRPVAVKRMLLDFCDVASREIKML
                     TESDDHPNVVRYFCSEFTQKFLYIALELCSATLEEVIEPNKGSNETVEFELNEKVDWV
                     DVLKQVASGVAHLHSLKIVHRDIKPQNILVSGPKKPVIGQNNMDGNIRVLLSDFGLCK
                     RLEADQSSFHPTNTNKASGTSGWRAPELLDESKKKVIDSIISDEQEEAGSFSSFYDKS
                     TKQRLTRAMDIFSMGCVFYYVLSNGNHPFGSRYVRDANIIRGNFDLSALRRNLSDKSL
                     IIEANSLITQMLKNDPLERPTAAAVLNHPLFWSSAKKLEFLLKVSDRFEIERRDPPSP
                     LLLKLEAGAKLVILNGDWTTKFEKDFMDNLGKYRKYSGSKLMDLLRALRNKYHHFMDL
                     PEDLAAAMSPIPAGFYNYFALRFPNLLMTTYSIIKNNLEDDQILSKFFA"
     gene            complement(<491023..>494034)
                     /locus_tag="HG536_0E02730"
                     /db_xref="GeneID:59326558"
     mRNA            complement(<491023..>494034)
                     /locus_tag="HG536_0E02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284140.1"
                     /db_xref="GeneID:59326558"
     CDS             complement(491023..494034)
                     /locus_tag="HG536_0E02730"
                     /inference="similar to AA sequence:RefSeq:NP_010612.2"
                     /note="ancestral locus Anc_5.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140036.1"
                     /db_xref="GeneID:59326558"
                     /translation="MSGGANNEDDVNTKIFHSIAEVFQKGQSAYAGHRKHVAVLKKIQ
                     SKAVSQGYESAFNYWFSTLVTKILPLKKTEVIGDRIVKLIAAFVASLDREVHIARNKQ
                     QEEVFSRFVDQFVRHILRGIESKDKNVRYRVVQLLAVIMDNIGELDESLYNLLTWSLG
                     KRVYDKEPNVRIQAVFCLTKFQDEEAEEGELDTEGATQILMKVVQNDASAETRRAAML
                     NLVNNRVTQPYILERARDVNLVNRRLVYSKILRAMGKNCFDQVDSRIIDQLILWGLED
                     REESVRKACSRLISHDWLNLMEGDLIAFLERLNVTESSVAEKAMECLFENRPDIITKV
                     KFPEDIWKEFTVEIAFLLKSFYLYCADKNLLEVIETNFPEAASFADILHYYIEQRFAK
                     DAEPVLKTDHRSLDFIIEQLLTTANRYDFGDEVGRRSMLTVIRNMLGIFDLSENVIKA
                     GLQVLKTLSINENDFVTMAIEIINDLRDDDIERQEQEERGRALANAASKGDSDDDDND
                     DAALESFHRNVEEMVGGQTAPSEGDAMKNLTSEKELEPKTVVACLTRSSHMLELVNMP
                     LEQNILITSLIDTLITPAVRNTESQIRELGVKNLGLCCLLDVQLATSNMFILGMCVSK
                     GNASLKKIALKVIVDIFSVHGSDVVDGEGKVDSISLHKIFYKVLKNDDLPDCQVVAAE
                     GLCKLFLADVFTDDDLFETLVLSYFSPANTTNEALIQAFAFCIPVYCFSHSSHQKRMA
                     RIAADVLLRLCMLWDDLQSSEDLKADPESMMKPNAIFQQLLHWTDPRKLVHQSENDAR
                     SDSVQLEFVLDVTKILSRIDKKEIKKMLVTNINAAYITSYQDFDKLKLIAEHVEDVME
                     NETLDSVSTNSLEKFKKTLTCVLDEAYERRLSKSTGHCSDLGDEEQDTSGGNLTGQDR
                     ASAVEQLSVDHSGSTDAVQEPDSSSEVSRKRGRSELENIVPSSEQNTDSSGKTVDRQE
                     NQSLAQPAEFESSSDQMSIDSYDVSLMTEEV"
     gene            <494309..>496546
                     /locus_tag="HG536_0E02740"
                     /db_xref="GeneID:59326559"
     mRNA            <494309..>496546
                     /locus_tag="HG536_0E02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284141.1"
                     /db_xref="GeneID:59326559"
     CDS             494309..496546
                     /locus_tag="HG536_0E02740"
                     /inference="similar to AA sequence:RefSeq:NP_010611.3"
                     /note="ancestral locus Anc_5.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140037.1"
                     /db_xref="GeneID:59326559"
                     /translation="MTAQENMIVHRSRFVEFSAGNITALAFSHKSDAQKLTPSELRLA
                     LGRSDGSIEIWNPRENWFQELVIHSGRDRSIEALCWRNVPGEALRLFSIGGSTAVTEW
                     DLATGLPLKNHDCNAGVIWSMAINECQDKLAVGCDNGTVVIIDVSGGPGCLEYDTILT
                     RQEARILTLAWNKDDYVIGGCSDGRIRVWSALKGADDRGRIIHTMKVDKSKKESTLVW
                     SVLYLPQSHQIVSGDSTGSVKFWDWDHATLTQSFKTHMADVLTLTRDVAGNSVFSAGV
                     DRKIFHFQRNHNGAQKDAKWVNTSNRLIHGNDVRALCSYQSKGADFLVSGGVEKCLII
                     NSLSAFADGKYRKMPLLASISKNMIINREQRLVVSWYASTVRIWHVGQDFDGNNNYRL
                     VCKMVLKDEQNITTCAISPDGQVLVVARPSLTKLFHLQPLETKLKVTKLDNSLLLRTG
                     CSLVQFIDNSRIAACSTDGELFTVDLESDQDDEMSLIELPEVPQTKSSAKIPYMNKIN
                     HLVVGGDLLVVGRTCGAVDIVNQTTNESRPLVRLMNFITAMLLNKERESIILVTAENK
                     IYEFNLKSGKQHSSLLTDWSKNNTDNLPMQLQKSTDKVLGISYTESDPNMVWFWSSSW
                     ISRINFSQDLPLSNRRKAKKHDRDGLTITDDSNFMDDLADVEDENNLELTEALQFLSS
                     HTRRFKPEGTSKSKDEKSFFFTDKYKLIYHADLIAEKELIIVEKPSQAVGPHHKAVDL
                     PKLLF"
     gene            complement(<496728..>498302)
                     /locus_tag="HG536_0E02750"
                     /db_xref="GeneID:59326560"
     mRNA            complement(<496728..>498302)
                     /locus_tag="HG536_0E02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284142.1"
                     /db_xref="GeneID:59326560"
     CDS             complement(496728..498302)
                     /locus_tag="HG536_0E02750"
                     /inference="similar to AA sequence:RefSeq:NP_011945.1"
                     /note="ancestral locus Anc_5.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140038.1"
                     /db_xref="GeneID:59326560"
                     /translation="MEDFFMVLFLTASATAIYRWSFTVLWFKVGSLFEIGAESSSKQD
                     ATLPKLAIDDSTFLSKLYSEYSVPSHKVLQAMRILFSAAMVIYTITIEITLWQIKTAD
                     VQQTADFITKWVWPLVSMLLSALLILVQPLFIVMSLLNKFFEEKFDLDRLVILSCGIV
                     ALLIMVLNYIALGPFHHAESMLTRLSVAGVTIMANLAGVASTSSLYSTFCTVKRRFSP
                     KYSKQRKQYFTESLLWISDKSLQEQIELYQREIQHTIETLKNMEQYPEESATVTKQQL
                     AEGVGSLRMEIGRLEERLRLPPHVKFAKKASHVVFLFYCIHKTVTVFTRTIPHLFSTS
                     SKDTEWTTDPLAISIANIMDLLLFRFQYQYEVDSLTKQISLILSISLFVCSLSTVATT
                     ISFLIALLPNRIRVLAMYVMQNSTNFEELPSYNKRPSKRSQKKSPSIIKNLIVSELAG
                     IYVVATLLSIRSNLPFDVSEKVNELLDERFTVANVVIDKWFELIYAISCISTFVCIKL
                     AERTASLPHSWARTSA"
     gene            <498535..>500082
                     /locus_tag="HG536_0E02760"
                     /db_xref="GeneID:59326561"
     mRNA            <498535..>500082
                     /locus_tag="HG536_0E02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284143.1"
                     /db_xref="GeneID:59326561"
     CDS             498535..500082
                     /locus_tag="HG536_0E02760"
                     /inference="similar to AA sequence:RefSeq:NP_010610.3"
                     /note="ancestral locus Anc_5.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140039.1"
                     /db_xref="GeneID:59326561"
                     /translation="MMTSERRSETASEVQGEVTEKLSCPICFQAFGKLGPLNDHLDKD
                     HGFGGPEVKAGGNSNGRASRKQHKRERGPKSHHRALEIGLSQCNECHQRLKRGEEAQN
                     CMKCGELFCKKHCQNVMKLDGKGQYEPTQGKWRICCYKCYSERPGYNDYGAVKDLTNS
                     FQKLRNLKSEDKQLQILHLENRLVRLIDGIAFILRSHEESLWGNLTTNSEVARYERTV
                     TSWRQDKEASNCYVCNQPFGIMLRKHHCRLCGNVVCDNETANCSNRIPISNLVNAADD
                     IPFTEPRSDLLKRTISVRICSRCTHSLYFGRKFKKDQAKPLSPLLSQCEKIHNVSRSI
                     LNLLSLLTASLEEIERLRSSEQTQYQASIDESARLRAKLFRTIASYTQLAKSIATLLP
                     RNTAERKIQQSIRMASSIFINEKLVHMKSLPVPSSDADQPHLQADQVAKPFKLVYNNL
                     SIKEVKRFREELMVLKEQRFLVESMIENCKKQRNFDEITILSSNLQELDSRIAAIQLG
                     LGDQGFV"
     gene            <500734..>503571
                     /locus_tag="HG536_0E02770"
                     /db_xref="GeneID:59326562"
     mRNA            <500734..>503571
                     /locus_tag="HG536_0E02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284144.1"
                     /db_xref="GeneID:59326562"
     CDS             500734..503571
                     /locus_tag="HG536_0E02770"
                     /inference="similar to AA sequence:RefSeq:NP_011944.2"
                     /note="ancestral locus Anc_5.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140040.1"
                     /db_xref="GeneID:59326562"
                     /translation="MHQRFNTRFTQEVFGLFLNNFTNPGEDTLSEKEELSRANRLKCN
                     LRVFIELYLVGLFTNVDNLSSKEALPAFLQRSMAKKEPIILRLMKESLNYKFKRGLST
                     GIATSVLKRFPFFFNNQDTRLNVCIADDNLKELLQALFKLYGDAVIARAVELDSRTKK
                     LFKEHQSCQFRTGKLTDEYIEEYNQCMPIYETFKAASEVFADFFNLDKPSFDQSVSEQ
                     KDEQASLSPVITNAVALPGQRLWENEETRKFYEVLLDIGDLYRASLQSEVEANGEVIN
                     DFFSNLEKTESKEEIDALTVQYWSENLDNKATKKRLIKFLIETQDWSKIRVFTRFLAT
                     NAKYFPDVIDEFTSYLDSGFRSQLHTNRINVKNIIFFSEMVKFMLLPTYMIFHKIRTL
                     IINLQVPNNIEILTVFFEHLGIFLINKPEYKPHMEKMVELIRENKKDRQINMNLKGAL
                     DNLINLVYPPSIRSLNAESKALSPEQKFYRILIRRELENFEYRHTVKLLRKASWRNQG
                     VYHTLFELFTKPEEISYQNIPFLARILKDLYAYQRNFVLKAIDELLENIERGLELNDY
                     SRNMHRISQVKYLTDLYNIELIKPQVLIDTLYNIINFGFSAQDVQLFSPNSIDPTDNY
                     FKIQLITTVLLNVTKRVRIFKDRITMFLMFLDYYVLAKAQPLPKTVKFSVEATFDKYA
                     PETGIRRSDTAQESFMRLTQFLKIKVKAQINGSTAVVDSAVNLSEVEEEMANDNDGID
                     EADKDYPESGMSAAEEYEDNAEHNEDIVDEDEMDEDESLEQSDSEDGDESFNNAESDY
                     DDIYGDVDADRDIEKRRMYEEFQKRLKDDEERRIEAEMEKQFQQILLESADSRKNEKS
                     TGGKIPSMSSTGETSKPRLLRPEFQDRGHDRQPQKVAFTFLSKSGKKTQSRVLGLPSN
                     VEFVSGVLEEEERLKNEREKIKEIVLQRTFD"
     gene            complement(<503614..>504720)
                     /locus_tag="HG536_0E02780"
                     /db_xref="GeneID:59326563"
     mRNA            complement(<503614..>504720)
                     /locus_tag="HG536_0E02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284145.1"
                     /db_xref="GeneID:59326563"
     CDS             complement(503614..504720)
                     /locus_tag="HG536_0E02780"
                     /inference="similar to AA sequence:RefSeq:NP_011943.2"
                     /note="ancestral locus Anc_5.362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140041.1"
                     /db_xref="GeneID:59326563"
                     /translation="MFVSAGLRGGAGRGASAAIWHSMFLFVVVPVVLMAVVGYVLIPT
                     GAIDAGGVSNQFFRVSKRCFFSGNGGRYYNGDAASGGSPTNFSYKMAVAYQPKDREDG
                     VYRRLKTAVESPTGEDNYFMAVNAPGDAYAGVADGVGGWAEHGYDSSAISRELCLAMN
                     EFSSVAGSQKDGGVSPKQLIEMGYRRIRDEQTVKVGGTTAIAAHFKPNGSMEVANLGD
                     SWCGVFRNAKLVFKTEFQTVGFNAPYQLAIIPEEMLKEARRKGGSFIQNSPSDADEYN
                     FQLAKGDVVVLATDGVTDNISYEDIQLFLRDNEQKISSDLLAVSQDFVSKVAKLSKDP
                     NYPSVFAQEISKLTGKDYRGGKEDDITVVMVRVE"
     gene            complement(<505083..>506117)
                     /locus_tag="HG536_0E02790"
                     /db_xref="GeneID:59326564"
     mRNA            complement(<505083..>506117)
                     /locus_tag="HG536_0E02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284146.1"
                     /db_xref="GeneID:59326564"
     CDS             complement(505083..506117)
                     /locus_tag="HG536_0E02790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140042.1"
                     /db_xref="GeneID:59326564"
                     /translation="MFKRAISQLLRSNQQSTRTMATENKHYPIKIAAAAQDSTLKVSV
                     TCLSVKNPTRSIEFYKKHFGMTFLGTKDYPDMKFSLHFLTFPKEVAKTEQGQPEIFGT
                     SGVLELAHTWGSENDSEFKIYNGNEEPHRGFGHICFSVADIKKTCERLEAEGVSFKKR
                     MADGRQKDIAFALDPDGYWIELVQYIKDTEEAPRKDIGDKFNHTMIRVKDAEKSLEFY
                     QNVLGMKLIRKSEHENAKFTLYFLAYGVPSGQNSWSTEGVVELTHNWGTENDPDFKYH
                     TWDWKTPGYGHVTISCNDPTALCNEIEQRYGDKIGWGVKFNQGMVKNGAFIKDPDGYS
                     IEIVPSDLVL"
     gene            <509593..>509877
                     /locus_tag="HG536_0E02800"
                     /db_xref="GeneID:59326565"
     mRNA            <509593..>509877
                     /locus_tag="HG536_0E02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284147.1"
                     /db_xref="GeneID:59326565"
     CDS             509593..509877
                     /locus_tag="HG536_0E02800"
                     /inference="similar to AA sequence:RefSeq:NP_010609.1"
                     /note="ancestral locus Anc_5.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140043.1"
                     /db_xref="GeneID:59326565"
                     /translation="MSTVNVLRYSGLALGLLFGLKNDLSLKSAASKKEEQRAYEAKMK
                     LVEEAKAEYAKSKEPVKSEAESGRGKEVNLEDPNVDFAAVILQAVDSMKS"
     gene            complement(<509972..>511039)
                     /locus_tag="HG536_0E02810"
                     /db_xref="GeneID:59326566"
     mRNA            complement(<509972..>511039)
                     /locus_tag="HG536_0E02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284148.1"
                     /db_xref="GeneID:59326566"
     CDS             complement(509972..511039)
                     /locus_tag="HG536_0E02810"
                     /inference="similar to AA sequence:RefSeq:NP_010608.1"
                     /note="ancestral locus Anc_5.360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140044.1"
                     /db_xref="GeneID:59326566"
                     /translation="MLTRSIHTSRALGQAKVWSSLAENSRSLRIRSESIRKCILEGTF
                     PGGPPSLKRRFNRLKYNSPEKIDETFKICYDFLQSKANQVYDQLSRTEHPKEIERLLV
                     KAELDNPEVQYNFQYNEKVDNDPDVIDYEQPVYRFLGKKHWEAGPQMLLMQRLETLAI
                     IPDTLPTLVPRAEINLKFPFSTGVNKWIEPGELLSSNTTSFPPAIKIQEYELLDPKKQ
                     YYTILVVNPDEPDLENDSFRTTLNYGLVNVQVSYNDNVVDARKCDASNVIADYLPPVP
                     EKNAGRQRFAVWVFRQPSAVQPQRCVLNRDAFDIRQFAKQHSLLPVGAHAWRSEWDSN
                     VANVRDKYALPKGRVFARTRS"
     gene            <511613..>512746
                     /locus_tag="HG536_0E02820"
                     /db_xref="GeneID:59326567"
     mRNA            <511613..>512746
                     /locus_tag="HG536_0E02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284149.1"
                     /db_xref="GeneID:59326567"
     CDS             511613..512746
                     /locus_tag="HG536_0E02820"
                     /inference="similar to AA sequence:RefSeq:NP_011942.1"
                     /note="ancestral locus Anc_5.358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140045.1"
                     /db_xref="GeneID:59326567"
                     /translation="MEDHDLRRKIALKQLKQAKIASAEEEETDIVQELPSRARHSVEF
                     QETLLNERDGQPADVLGWEQFFEHNERYSLSERNFEFNTYFTLPKSCAGASIPIFVFH
                     HGAGSSGLTFANLSKQLVEKLEGKCGVFSFDARGHAQTRPIDLKKEVTYELEAFIYDF
                     VTLVDLFYKRHLEQLAVQKLSFIFVGHSLGASICTFAYARQTAAIKEHTLGVCMLDIV
                     EEAAIQALQKVHSFLASTPNVFNNYREAVDWHVQRGLSSCRESAQVAIPALFAAAKSQ
                     KIVRITNLNDFRPYWHTWFQHLSHSFVALPTNKLLLLAGNDNLDKELIIGQMQGKYQL
                     VVFQDSGHFIQEDVPRKTAITLIDFWKRNDSRSAVIKTNWGKN"
     gene            complement(<512855..>515002)
                     /locus_tag="HG536_0E02830"
                     /db_xref="GeneID:59326568"
     mRNA            complement(<512855..>515002)
                     /locus_tag="HG536_0E02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284150.1"
                     /db_xref="GeneID:59326568"
     CDS             complement(512855..515002)
                     /locus_tag="HG536_0E02830"
                     /inference="similar to AA sequence:RefSeq:NP_011941.1"
                     /note="ancestral locus Anc_5.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140046.1"
                     /db_xref="GeneID:59326568"
                     /translation="MSQLITLATCNLNQWALDFEGNRDRILESIRIAKERGARLRVGP
                     ELEITGYGCLDHFLESDVSLQSWEMYAQIIKRSETHGILLDIGMPVLHKNVRYNCRLL
                     SLDGQIMFIRPKMWLANDGNYREMRFFTPWMRECVVEDFILPPLIQKITGQKTVPFGD
                     AVISTLDTCIGAETCEELFTPRSPSINMSLDGVEIITNSSGSHHELRKLNKRMDLIIN
                     STSRCGGVYLYANQRGCDGDRLYYDGCALIAVNGKVVAQGSQFCLKDVEVVTATVDLE
                     EVRSYRGSVMSRGLQSSSSEMRYKRIHVPVQLAPAPMRFDQSIVASKAREVFYHLPEE
                     EIALGPACWLWDYLRRCNGSGYFLPLSGGIDSCATAVIVHSMTRLVLKEIKEGNKQVI
                     RDVRKVARSSDPDWLPKDAKELAGKIFHTCYMGTGNSSKETQDRSAQLAKEIGAYHVD
                     LKMDNVVSSIVTLFEVATGKRPVFKIFGGSHTENLALQNIQARVRMVLSYLFAQLLPW
                     VRGIPNTGGLLVLGSANVDECLRGYLTKYDCSSADLNPIGGVSKTDLKKFIAYASVEF
                     DMPILESFLLATPTAELEPITKDYVQSDEIDMGMTYEELSIFGYLRKVEKCGPYSMFL
                     KLLHEWSPKLTAAQVAEKVKRFFFFYAINRHKQTVLTPSYHAEQYSPDDNRFDLRPFL
                     IDPRFAWASKKIDLVVAQCEGKSSNSLDVMSID"
     gene            complement(<516054..>517178)
                     /locus_tag="HG536_0E02840"
                     /db_xref="GeneID:59326569"
     mRNA            complement(<516054..>517178)
                     /locus_tag="HG536_0E02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284151.1"
                     /db_xref="GeneID:59326569"
     CDS             complement(516054..517178)
                     /locus_tag="HG536_0E02840"
                     /inference="similar to AA sequence:RefSeq:NP_010607.3"
                     /note="ancestral locus Anc_5.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140047.1"
                     /db_xref="GeneID:59326569"
                     /translation="MVNDSLEITTICDDVGHSKFTIESGSSEIERPACGTPIYQHRSL
                     PRIKILGTGGTIASKGTDSSQTAGYHVDLTIEELLDCIPDISSVCELEYEQLCNVDSK
                     DLNEELLFKIYKGVTDSLQTFDGIVITHGTDTLSETAFFIESSVDTGELPIVFVGSMR
                     PSTSVSADGPMNLYQAILIAANPKSRGRGVLVSLNDQISAGYYITKTNANSLDSFNVR
                     QGYLGNFVNNEVHYYYPPVKPQGCHKFKLKLAPGATTLKFPPVCILYGHQAMSPDLID
                     LVVDHYDGIVIATMGAGSLPNEVNQKLLSLNKPVIYSKRSMDGMIPTANLPKPLAGTS
                     NIIASGYLNPEKSRILLQLALAENYCMEETRRVFRGVYGG"
     gene            complement(<517394..>520153)
                     /locus_tag="HG536_0E02850"
                     /db_xref="GeneID:59326570"
     mRNA            complement(<517394..>520153)
                     /locus_tag="HG536_0E02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284152.1"
                     /db_xref="GeneID:59326570"
     CDS             complement(517394..520153)
                     /locus_tag="HG536_0E02850"
                     /inference="similar to AA sequence:RefSeq:NP_011940.1"
                     /note="ancestral locus Anc_5.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140048.1"
                     /db_xref="GeneID:59326570"
                     /translation="METIDIQSRSFVVRWVECSKGDVISYQVRPLKKSIELGIYKKPK
                     GGVDRNCESAVHIAPDTRALLSYTTKSFLHRNSATSVDESANSSSTSVNSVPGSYDSR
                     KLHGSLSLSNIQQQSQEIPLREKLTASGFTMVQWIGHVAGSEMQQGLLEVRDDDYYYA
                     FILDNTSAKNAKKKILFNAKTVRDNELQSLNKNQYPLSPATTPKARSLKSQPNDDLLS
                     VDRGRYLQGYLLKKRRKKLQGFTKRFFSLDFKYSTLSYYLNEHNQTCRGEIVINLATV
                     SANKKDRLIIIDSGMELWVLKAKDTGAWSHWVDALQSCFDRLKMNKATANQNRKKEDG
                     VDELNEALESVKTGKQNPTMANMPFVAITPNEFTASLPRFTCNELITNLKLIQQRVEY
                     CKKESLNYVPTEGYDNQRRYRNASSSSADLKVAHGDSCESAQSLTISPDNEATEHPLH
                     SRLSELETFLAQFIHQSRTLLNDALDQSLEKRISSISAFSDEEFFDAEDGISHGVILL
                     DNDERLEEPTLNKTVEYESVSEEMTCDSSTNDIYPLPWGKSVKRRNDVRAAVASPPSL
                     LSFLRKNVGKDLSSVAMPVTSNEPISILQLISETFEYSDLLNKAIESTSKAQVLTYVS
                     AFAISCLSIHRDKTRALRKPFNPLLGETYELVREDMGFRLIAEKVSHRPPVFAFHADH
                     PQWECSYTVSPLQRFWGKSVELNNDGTVRLKFKNQKDSFEWVQPTTMLKNLIAGERYV
                     EPINEFEVNSSSCGSSTIAFQSAGIFGGRSENLTLTIDPVDGAKKTLHGKWTESIIDD
                     STSAVIWQAGKLVPDSRKKYGFTVFTANLNEITEIERDNLPPTDSRLRPDIKAYEEGN
                     VQKAETLKLKLEQAQRDRRSKGSDVKPKFFEKSKNDTWKLIQGPNSYWERRKRRDWSG
                     ITALW"
     gene            <520716..>520934
                     /locus_tag="HG536_0E02860"
                     /db_xref="GeneID:59326571"
     mRNA            <520716..>520934
                     /locus_tag="HG536_0E02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284153.1"
                     /db_xref="GeneID:59326571"
     CDS             520716..520934
                     /locus_tag="HG536_0E02860"
                     /inference="similar to AA sequence:RefSeq:NP_710144.3"
                     /note="ancestral locus Anc_5.354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140049.1"
                     /db_xref="GeneID:59326571"
                     /translation="MENPYEQDQMNILSRIVANIDRLNQSVTTLNQELENINRRNKNL
                     EIMGQMCENYQNSMQFNLQATGNRKPPL"
     gene            complement(<521006..>521182)
                     /locus_tag="HG536_0E02870"
                     /db_xref="GeneID:59326572"
     mRNA            complement(<521006..>521182)
                     /locus_tag="HG536_0E02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284154.1"
                     /db_xref="GeneID:59326572"
     CDS             complement(521006..521182)
                     /locus_tag="HG536_0E02870"
                     /inference="similar to AA sequence:RefSeq:NP_058135.1"
                     /note="ancestral locus Anc_5.353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140050.1"
                     /db_xref="GeneID:59326572"
                     /translation="MHLMYTLGPDGKRIYTLKKTTDDGEITKSAHPARFSPDDKYSRQ
                     RVTLKKRFNLLPSQ"
     gene            <521413..>523173
                     /locus_tag="HG536_0E02880"
                     /db_xref="GeneID:59326573"
     mRNA            <521413..>523173
                     /locus_tag="HG536_0E02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284155.1"
                     /db_xref="GeneID:59326573"
     CDS             521413..523173
                     /locus_tag="HG536_0E02880"
                     /inference="similar to AA sequence:RefSeq:NP_010606.1"
                     /note="ancestral locus Anc_5.352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140051.1"
                     /db_xref="GeneID:59326573"
                     /translation="MSDPFADLLSSFKKGDAAVKKDATVAPSGSVPQAGKAGDNGTNS
                     SWLSPRESSPEIHDDFGKLFGSNVSPIAGAKQQQVAEDEFDAAFKAFEQDQKVQQPWE
                     DEPELVVDEVKDMEVAKLMSLDLSIGQATSYYERGILYEELVRKRREEEAIKAQRTRV
                     TSPVRREEPVGFFGVATGLLEKGRQLVDQFTTFPQEQDRLSDRLRQYSEYVEPQEWSA
                     AASSAQPEVASEELPAQFTQSLLLEEDTLFSPEKSPTPPPPPESTLLDFDHEETVSHG
                     IRDSGTKIAISHLELSGYNEFKDRATSFFKGGDYVRACEEYEKCLNSLPKDHTLRIVA
                     YSNLVASLLKIGEYKRCISDTEIALNLFPEDPEMWSQSIPNAEPRRTFKEMWSKIVAR
                     RAEAFEHTEKYQEALKSYQSLIEKGCSNDKIMEGKRRCQKVLSPSQDKPVQSKGGSVR
                     TNGPPASVPASAQTYASVQRVKEDNKKEEALENQKAALYDKVFNQIETWKGNKGDDIR
                     HLLANLSQVLTWCDWKPVSPTELVLPKKVKIGYMKAVAKTHPDKLPASLELEAKMLAE
                     NVFSTLSTAWEKFKSENDIK"
     gene            complement(<523200..>525395)
                     /locus_tag="HG536_0E02890"
                     /db_xref="GeneID:59326574"
     mRNA            complement(<523200..>525395)
                     /locus_tag="HG536_0E02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284156.1"
                     /db_xref="GeneID:59326574"
     CDS             complement(523200..525395)
                     /locus_tag="HG536_0E02890"
                     /inference="similar to AA sequence:RefSeq:NP_011939.2"
                     /note="ancestral locus Anc_5.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140052.1"
                     /db_xref="GeneID:59326574"
                     /translation="MVQFYSEELKLERTDPTLWRLRTDELGRETWEYLTPERAKNDPQ
                     STFTQWLLMIPDFPTPAPDKHYGCTDFTAADACRNGASFFKLLQDPESGIFPCQYKGP
                     MFLTIGYIAVNYIAGTKIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTVVCY
                     VGLRLLGLSKTHPVCVKARKLLMKLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETW
                     LLPYSLPIHPGRWWVHTRAIYLPVSYLSLIRYSCPLTDLLEELRTEIYTRPFETIDFS
                     KNRNTVCGVDLYYPHSTVLNIANTAMVFYEKYIRPSWLSKMAKRRVYDLVKKEIANTD
                     YLCIAPVNQAFCALVTLIEEGVDSPQFKRFQERFKDALFHGPQGMTVMGTNGTQTWDC
                     AFAIQYLFVAGLAEQPQYFDTICAAYKFLCRTQFDTECVEGSFRDKRVGAWPFSTKTQ
                     GYTVSDCTAEAIKAIIMVRHSPIFSHLRDEISDEKLCKGIDVLLSLQNIDSFEYGSFA
                     TYEKIKAPLSMEKLNPAEVFGNIMVEFPYVECTDSSVLGLTYFHKYYDYRKEEISQRI
                     KLAIGYIKKNQQEDGSWYGCWGICFTYAGMFAMEALHSVGEDYSNSEVVRKGCDFFVN
                     RQLPDGGWGESMKSSELHTYVDSVDSLVVQTAWVLIALLLARYPNKEVIDAGVELLKK
                     RQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYCKIYDDDAI"
     gene            <525730..>526500
                     /locus_tag="HG536_0E02900"
                     /db_xref="GeneID:59326575"
     mRNA            <525730..>526500
                     /locus_tag="HG536_0E02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284157.1"
                     /db_xref="GeneID:59326575"
     CDS             525730..526500
                     /locus_tag="HG536_0E02900"
                     /inference="similar to AA sequence:RefSeq:NP_010605.1"
                     /note="ancestral locus Anc_5.350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140053.1"
                     /db_xref="GeneID:59326575"
                     /translation="MLTFAAICGRAFIVYPIELCLGIVIAWCMGKYTLEIQREQYYLL
                     SSKSFINEIFAYKGNLVWTVLFVCLAYVQIATKCRNYVILPQYQGNVPNYPMRGLLKQ
                     YASKFILKNVLLMLIFWVIDGIFILTGGSCLTRADTYSAEKCKASGAQWVGGFDISGH
                     FCFLVNISMILWLELSQYWKYVEQDAVVLPASRLIKVCLIITVSVLVIWIAMLMITSI
                     YYHTVLEKVLGCLMGYICVTVMYWLIPRSPFCNKLFYC"
     gene            complement(<526491..>527294)
                     /locus_tag="HG536_0E02910"
                     /db_xref="GeneID:59326576"
     mRNA            complement(<526491..>527294)
                     /locus_tag="HG536_0E02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284158.1"
                     /db_xref="GeneID:59326576"
     CDS             complement(526491..527294)
                     /locus_tag="HG536_0E02910"
                     /inference="similar to AA sequence:RefSeq:NP_010604.4"
                     /note="ancestral locus Anc_5.349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140054.1"
                     /db_xref="GeneID:59326576"
                     /translation="MKRRTAETVARTPKKQRIAENGSSPVIYHQLLDPTIAKFINMEN
                     LISPSKRSRSLKQKDGNKSIYDSVLLENAYRMFGISSFPVVDPSDLKLNEETKEIQIT
                     REMIGIRLEVFNESLSKYEKPYYVLLKKKMKSDSWTLFKHTVPQYIDVRALFNNTNGG
                     IITSHNSIYLFARDLYKQLVALSMRVQYLEELANSKLVDDLDIDLEAAAVSFTRNGAL
                     FKLLLRGDEVVSCSIRSNFIEASLRPRHEALFLGPINELALKLKHMDQQ"
     gene            complement(<527768..>529030)
                     /locus_tag="HG536_0E02920"
                     /db_xref="GeneID:59326577"
     mRNA            complement(<527768..>529030)
                     /locus_tag="HG536_0E02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284159.1"
                     /db_xref="GeneID:59326577"
     CDS             complement(527768..529030)
                     /locus_tag="HG536_0E02920"
                     /inference="similar to AA sequence:RefSeq:NP_010603.3"
                     /note="ancestral locus Anc_5.348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140055.1"
                     /db_xref="GeneID:59326577"
                     /translation="MAINIDRSVLVKQFTDHLLLFGSTGLVGSLTLNELRKINFHLNN
                     SQDIQQKLDSCQRPEVVNFRFDKFIYCINRKIKQFCNAGDGQFTETHGFQILKYNKKE
                     YSLSKIKKLPPGVSTVSDKSPIGDDLSISKTISIKGDYIEEILNFCIDKQRYQVDYVS
                     DSAERISLTFNIYAIQIASPDSRKWTGLLPLIFSGCVNIKSKAANGIMETRLPPLDEI
                     PTMICALGSSSSGHPNKTVDRNYADHELTFQLVRVFNNCERKRLVIITTFNNVLISRI
                     FPYFRTKSKLEYDLQYKLSPRLGQLVLLRPGPLVGDHTDLKERRVTVKHSSNLLKQIL
                     YYKKCCFQCKLLLFKECRRTGFRTKASEIIAKSMYRKPGSWILGYCLPASKVAHTAAL
                     KAVEPPADGTKHLVEIITSEEMDNSVPS"
     gene            529466..529560
                     /locus_tag="HG536_0Etrna5F"
                     /db_xref="GeneID:59326892"
     tRNA            join(529466..529503,529524..529560)
                     /locus_tag="HG536_0Etrna5F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:59326892"
     gene            complement(<529642..>530283)
                     /locus_tag="HG536_0E02930"
                     /db_xref="GeneID:59326578"
     mRNA            complement(<529642..>530283)
                     /locus_tag="HG536_0E02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284160.1"
                     /db_xref="GeneID:59326578"
     CDS             complement(529642..530283)
                     /locus_tag="HG536_0E02930"
                     /inference="similar to AA sequence:RefSeq:NP_011938.1"
                     /note="ancestral locus Anc_5.347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140056.1"
                     /db_xref="GeneID:59326578"
                     /translation="MVSRVLKEANLVMVDTNDLDRRLAYQTPPYEQWKSTLCSASPGP
                     LSSDTLVSRIGMALCERTSKISTDKIRNEAGSVSSFVREVLRRSKSNTRSTVLAFAYF
                     NKVYDGQSVKDKLPEFARCSKRVFLSCLILANKFLNDNSFAMKTWHMISGLRQKDLCL
                     MERWCLDRLDYKLLVTETEYAVFENRLFVASNKRMRCENESVRDLSYKKLRTI"
     gene            complement(<530861..>532348)
                     /locus_tag="HG536_0E02940"
                     /db_xref="GeneID:59326579"
     mRNA            complement(<530861..>532348)
                     /locus_tag="HG536_0E02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284161.1"
                     /db_xref="GeneID:59326579"
     CDS             complement(530861..532348)
                     /locus_tag="HG536_0E02940"
                     /inference="similar to AA sequence:RefSeq:NP_011937.1"
                     /note="ancestral locus Anc_5.346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140057.1"
                     /db_xref="GeneID:59326579"
                     /translation="MRAKSAKAALRNLATMSAPGISFKYKPPVDRNMRTLDRSFFVSK
                     VPLCVVRFPDPKNISIFSKKFKESILRVPRIPHVVKLDQAEGSRRSDGKSLACDNGIV
                     TKGVLLADTISSIDEARTRLSPDAMSFLDETEAEILPYEYKMDYDFWKAEEILRAVLP
                     EQFLDEIPTGFTVVGHIAHLNLRQEFKPFAALIGQVILDKNNKIETVVDKVSSIATQF
                     RTFPMQVIAGRDSDLVVEQKESNCTFRFDFSKVYWNSRLHTEHERLVSQFFQPGQVLC
                     DVFAGVGPFAIPAAKKDVIVLANDLNPESFKYLRENIELNKVSPLVEALNLDGGEFIS
                     KSFELLSQWRERTKGKISVPLKLSHHERKRQKKQPVQGIPATRELEIPLHINHFVMNL
                     PDSSISFLDKFIGLYHNLHVQTMPHIHLHCFEKYGIDEEPTMEELHDRVHSRILSSLR
                     TSEKILPKDRLSFHLVRKVSPTKPMFCVSFQLPKEVASANPVYTT"
     gene            <532594..>533664
                     /locus_tag="HG536_0E02950"
                     /db_xref="GeneID:59326580"
     mRNA            <532594..>533664
                     /locus_tag="HG536_0E02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284162.1"
                     /db_xref="GeneID:59326580"
     CDS             532594..533664
                     /locus_tag="HG536_0E02950"
                     /inference="similar to AA sequence:RefSeq:NP_011936.1"
                     /note="ancestral locus Anc_5.345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140058.1"
                     /db_xref="GeneID:59326580"
                     /translation="MSEVITVVRRKGAFQQFGEIVEKLDEEDVDIEMTEASESGLEGE
                     KSGLQVVTPGELVSENPGWMRGHGTYFLDNMTYSSVAGTVSKVNRLLSVIPLKSRYSP
                     ETGDHIVGRIAEVGNKRWRVDIGGRQHAVLMLGSVNLPGGILRRKSESDELQMRSFLK
                     EGDLLNAEVQSLFQDGSASLHTRSLKYGKLRDGMFCQVPSSLIVRSKNHTHNLPGSVT
                     VVLGVNGFIWLRKTSKMDSARDAPSGASMGSTGGPTGAKSLRADTVSITRLEEESSWQ
                     IYSDQNDPSITSSIRQTICRYANVIKALAYCEIGITQERIVSAYEASMAYSAVGSLIE
                     REVMESLGDDVLNAEKMRGSPF"
     gene            complement(<533711..>535057)
                     /locus_tag="HG536_0E02960"
                     /db_xref="GeneID:59326581"
     mRNA            complement(<533711..>535057)
                     /locus_tag="HG536_0E02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284163.1"
                     /db_xref="GeneID:59326581"
     CDS             complement(533711..535057)
                     /locus_tag="HG536_0E02960"
                     /inference="similar to AA sequence:RefSeq:NP_010602.3"
                     /note="ancestral locus Anc_5.344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140059.1"
                     /db_xref="GeneID:59326581"
                     /translation="MLARGLKATARLKRQSASLYAGSVWIRCASNVKTYIPKPTTRVR
                     RPKTEKELAREKFEEQLNSPNRFIRWGAIARSERFSKGMTKYLIGAYILFLGYGLYFM
                     KKVYAKDKELEKLRNKEKSGNINEYEHLRIKELTGKLRRRDELKLITYNKMIEEGVRD
                     FDNVKLENNDQNKLNEKILPARDTTAFYEGKAEEYDDDVNFEERAIFMGRRRKWLMRH
                     CEGDVLEVACGTGRNIKYLNPERISSITFLDSSEKMVEITYKKFKEKFPSFQKAAFVV
                     GKAENLVDLAKGNKVDQSDLKSSNENLEAIQKDETKVKYDTIVETFGLCSHEDPVKAL
                     KNFAILLKPEGRIVLLEHGRGSYGFINKILDDRAEKRLRTWGCRWNLDIGEILDDSGL
                     EIVEEARTHLGTTWCIVAKKKGATKKKSEVGFFEKYLGSSIRNKLEALDDSNEKTK"
     gene            complement(<535254..>536417)
                     /locus_tag="HG536_0E02970"
                     /db_xref="GeneID:59326582"
     mRNA            complement(<535254..>536417)
                     /locus_tag="HG536_0E02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284164.1"
                     /db_xref="GeneID:59326582"
     CDS             complement(535254..536417)
                     /locus_tag="HG536_0E02970"
                     /inference="similar to AA sequence:RefSeq:NP_011935.1"
                     /note="ancestral locus Anc_5.343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140060.1"
                     /db_xref="GeneID:59326582"
                     /translation="MSKANEKLPDLLADAVLKESVPIPDDFVKVQGIDYSKPEATDMR
                     ASDLIDAMKTMGFQASSLGQACEIINSMRSWRGRHKDELEEHEKKGSFDDEGYQKTTI
                     FMGYTSNLISSGLRETLAYLVKNRMVDAVVASAGGIEEDLIKCLAPTFLGKFSLKGAS
                     LREQGLNRIGNLLVPNDNYCKFEEWIVPILDKMLEEQDEYVAKNGADCLEANQDVDSP
                     IWTPSKMIDRLGKEIDDESSVLYWAHKNKIPVFCPSITDGSIGDMLFFHTFKASPKQL
                     RVDVVADIRKINSISMEASRAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFD
                     GSDAGARPDEAVSWGKIKATARSVKVYADATIVFPLVVAATFASGKKLDKTSD"
     gene            <536573..>537406
                     /locus_tag="HG536_0E02980"
                     /db_xref="GeneID:59326583"
     mRNA            <536573..>537406
                     /locus_tag="HG536_0E02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284165.1"
                     /db_xref="GeneID:59326583"
     CDS             536573..537406
                     /locus_tag="HG536_0E02980"
                     /inference="similar to AA sequence:RefSeq:NP_010601.3"
                     /note="ancestral locus Anc_5.342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140061.1"
                     /db_xref="GeneID:59326583"
                     /translation="MKVVGEGNANILIDYGNANWLYRCCVRFKDSLKRNNEYSIENLQ
                     YIETSVKAFLGDLLCPMELKELPLKGLESILGRYVANLDDTKVIVFEMPNLKPRYLEK
                     TAYADRFTQIYTSADSSCVVLELKPKWLYNPSAYCRNCSHSKLKGREHRYCYSKLNQD
                     PLHLTELLAGAGDLPPKFERDLASYLARSTNVLAVLYAAQRELKHEALSRIESVADVT
                     SSMSLAMTLRDVTCFIEWSSDGDQLGVNVVDVDLKPKEKFLHWRETQLRLDNLEDKCY
                     H"
     gene            complement(<537400..>538206)
                     /locus_tag="HG536_0E02990"
                     /db_xref="GeneID:59326584"
     mRNA            complement(<537400..>538206)
                     /locus_tag="HG536_0E02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284166.1"
                     /db_xref="GeneID:59326584"
     CDS             complement(537400..538206)
                     /locus_tag="HG536_0E02990"
                     /inference="similar to AA sequence:RefSeq:NP_011934.1"
                     /note="ancestral locus Anc_5.341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140062.1"
                     /db_xref="GeneID:59326584"
                     /translation="MNEVVKDVINPHHLEKFSGLIRGRIPGKLSSHSLAIGDHLLFFN
                     ALNRTIGRDGYFDHQSPKNLLKDPRYEYLRRVWAKGQIELLRPLSLGQEYACRESLKF
                     IKRIRGDHYVCLERLIVGSNGESLLRELRTLAYTNSPPRTRNATETAVRNGASLGTFT
                     FRDLDIIIYGQLSCNPHRIHWDRRYSQAVEGYRDIIVQGPFALQVLLKFAEDAIGSSI
                     TKVEYRNYNYIYPDTEVEVNLLPGQGQYRVCMNDARRPEVMFVQAVVSCQ"
     gene            <538668..>539537
                     /locus_tag="HG536_0E03000"
                     /db_xref="GeneID:59326585"
     mRNA            <538668..>539537
                     /locus_tag="HG536_0E03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284167.1"
                     /db_xref="GeneID:59326585"
     CDS             538668..539537
                     /locus_tag="HG536_0E03000"
                     /inference="similar to AA sequence:RefSeq:NP_010599.1"
                     /note="ancestral locus Anc_5.339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140063.1"
                     /db_xref="GeneID:59326585"
                     /translation="MADDGNFINSFANWQPDEDMQSCLNCHAPFSFLMRKHHCRCCGG
                     IFCAACSERLARYDTKRVKVVKRHTNDDDEYPPFRTCDSCYDNLLHLKLLLSPWGRPL
                     ELSDRSAVFHNERTAANNDRASPQRATQASEVVKPAAGTERTREVGQSRSSSVRRARI
                     DDDNYCPICNYDLATLATEEAAQNHVEECLRKASDIQQHLGSPEETESPAFQNRMLVY
                     KVAPTENGQYRECPICFEDMAAGEKVGRLECLCMFHHKCIKGWFNKKAQRMKSKDIQY
                     IGKNFCPLHDAIF"
     gene            complement(<539651..>540991)
                     /locus_tag="HG536_0E03010"
                     /db_xref="GeneID:59326586"
     mRNA            complement(<539651..>540991)
                     /locus_tag="HG536_0E03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284168.1"
                     /db_xref="GeneID:59326586"
     CDS             complement(539651..540991)
                     /locus_tag="HG536_0E03010"
                     /inference="similar to AA sequence:RefSeq:NP_010598.3"
                     /note="ancestral locus Anc_5.338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140064.1"
                     /db_xref="GeneID:59326586"
                     /translation="MAKRRTKKRTHVQQPPEDQKQIPKSMVIRVGQTSLSNHSLNQLV
                     KDFRQIMQPHTAVKLKERKSNKLKDFVVMCGPLGVSHLFIFTQSEKTGNVSLKIARTP
                     QGPTITFQVENYSLNKDVKKFLKRPKSLNNEDLLQPPLLVLNGFNTMRNKKEGASDSD
                     EANVEKVVVSMFQNIFPPLNPARTQLNSIKRVFMINKDQETGEISMRHYSIDIREVEI
                     SRNLKRLYRAKQKLNKAVPNLYRKEDISSLILDHDVGSYTSESEVEDESIVKVVDRKD
                     IKARRLTNKEADADIATSDQPAEPLVTPKKKAVKLTELGPRLTLKLVKIEEGICSGRV
                     LHHEFVKKTSAEVKALEKRHMEKMRLKEQRRKEQEANIAQKKAAKEAKKQRKLERRKA
                     RQQLASSHEDGDNSDVSMGEDEESGSDSESASDNERYNDLPEDLDSDLFSEVDE"
     gene            <541295..>542800
                     /locus_tag="HG536_0E03020"
                     /db_xref="GeneID:59326587"
     mRNA            <541295..>542800
                     /locus_tag="HG536_0E03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284169.1"
                     /db_xref="GeneID:59326587"
     CDS             541295..542800
                     /locus_tag="HG536_0E03020"
                     /inference="similar to AA sequence:RefSeq:NP_011932.2"
                     /note="ancestral locus Anc_5.337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140065.1"
                     /db_xref="GeneID:59326587"
                     /translation="MTAEKKARNGAVKKSKASKSSELSSLAAKIKAKALENQKKLQNR
                     EDSDSESAEEDKKAVRDVQTDSKGTQEETRDEDEVLESFADLNVVPELLQACKNLNFT
                     KPTPIQAKAIPPALEGKDIIGLAQTGSGKTAAFAIPILNKLWHDQSPYYACILSPTRE
                     LAQQIKETFDSLGAIMGARTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK
                     GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKILPTQGRTTYLFSATMTSKIEKLQRA
                     SLTDPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFVGKTIIVFTRTKANA
                     ERISTLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGLDIPSVDI
                     VINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKLPKESVD
                     KDMIMSLRNSVDKANGEVIMELNRRSKEKAARGGGRRARMAAKMDMDKEER"
     gene            complement(<542873..>544705)
                     /locus_tag="HG536_0E03030"
                     /db_xref="GeneID:59326588"
     mRNA            complement(<542873..>544705)
                     /locus_tag="HG536_0E03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284170.1"
                     /db_xref="GeneID:59326588"
     CDS             complement(542873..544705)
                     /locus_tag="HG536_0E03030"
                     /inference="similar to AA sequence:RefSeq:NP_010597.3"
                     /note="ancestral locus Anc_5.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140066.1"
                     /db_xref="GeneID:59326588"
                     /translation="MSHSGAASYDKTAGILTIDEDCSPAELKWRSPDGTKSLTVVLNT
                     VDRLQATPATSDKMRLRLLGKVDESKKQKDNEGNIVSPKPRIHTFTFNNRTVLDNIKV
                     TLQHIISRYKDDEVYEEKRRKEEASANSKASPSVTPPAGNLVNTVTLDDSLSKAKLIT
                     NLKLQQSLLREDKSLMRSFQETVINAGLPPYEFWSTRVPMLRAYALSISQKVGPYNVL
                     STIKPVASSDNKVNVNISREKILSIFQNYPIVKKAYMDNVPKNFKEPEFWARFFSSKL
                     FRKLRGERIMQNDRGDVIIDRYLTLDQEYDRKDDSALLHAVKKTIDIDGNIQDDPVRK
                     GNKPDFTMQPGVDVNGNSDGTTDILKGMNRLSEKMVMSLENQYSRSNLQQEDLDREER
                     DEIELNDLQESYREDYAVINLKNQREEGSSEAKVFIEKSKEKQKHIDKKKVNEQISLV
                     LDSLSKKLDLTQVAKSSDYNSEINQRVISAVKINAKQARYHNVDSALGTFVGNRTDES
                     EAASKLPLDLLESCRMLHGTCCEFLKHFYIHFYSTEAKRQKMAKKLSKSLKDCSEKIT
                     ELLDDVEKGDGENMSSICRSYLRPVMVSIDRAIEKFNDFTNEKP"
     gene            <545293..>546921
                     /locus_tag="HG536_0E03040"
                     /db_xref="GeneID:59326589"
     mRNA            <545293..>546921
                     /locus_tag="HG536_0E03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284171.1"
                     /db_xref="GeneID:59326589"
     CDS             545293..546921
                     /locus_tag="HG536_0E03040"
                     /inference="similar to AA sequence:RefSeq:NP_011931.2"
                     /note="ancestral locus Anc_5.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140067.1"
                     /db_xref="GeneID:59326589"
                     /translation="MSSPIIGITFGNTTSSIAYVNPKDDVDVIANPDGERSIPSVLSY
                     VGSDEYHGGQALQQLIRNPKNTIINFRDFIGLPFDQADISKCAGGAPAVEVDGKVGFV
                     ISRGDKDETISVDEVVARHLRRLKLAAEDYIGSKVSEVVLTVPTSFTAEQKDALKAAA
                     SKAGLKIIQFINEPSAALLAHIEQFPFDNDVNVVVADFGGTRSDAAVIAVRNGIFTIL
                     ATKHDTNLGGDNLDNELIEYFAKDFEKKTKCNPRKNAKSMAKLRASASVTKKTLSNAT
                     SSTISVDSLADGFDYHTSINRMRYELVTNKVFSQFSAFIDDVIAKAELDPLDISAVLL
                     SGGVAFTPKLTTNLEFMFPESVQILGPASKQATNQPNELSASGAALQARLASEYDASE
                     LADALQPVVVNTPHLPKAIGLVGSQGEFYPVLLPETSYPVQKKVTLKQAQGDLLISVY
                     EGEHHVVERTVEPTEKDQKPEEDDDNEEWSDSEDDEPELIREKLYTLSTKLMDLGLKG
                     VTKGVEIVFNINKDGVLRVSARDLQSGQVVKGEL"
     gene            <547077..>548207
                     /locus_tag="HG536_0E03050"
                     /db_xref="GeneID:59326590"
     mRNA            <547077..>548207
                     /locus_tag="HG536_0E03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284172.1"
                     /db_xref="GeneID:59326590"
     CDS             547077..548207
                     /locus_tag="HG536_0E03050"
                     /inference="similar to AA sequence:RefSeq:NP_011930.1"
                     /note="ancestral locus Anc_5.334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140068.1"
                     /db_xref="GeneID:59326590"
                     /translation="MTTSAKPVIHILGLGAMGALLAVDLLRFTNATVVPLFRSQERLH
                     RFQNDFNSTLAVRKLFEKDQPLLSCKLECSESPETFAGEMIKNLIITTKTYQTAEALQ
                     PYLRFIGRDTNLILVQNGLGVAEMLKEKVFTDPETQPQLFQGVISHGGFHDQGFTFNH
                     AGLGDLKIARLPWDHSKPIQSEEDASKDRRENELVKILTEPAFAENFQTTQMTYQEML
                     LGQLYKFLVNACINPVTSIVDCVNGELADDSADIFSLIIDECLRVLKVAYTPLFEYET
                     RYHGREGYPPVPVLSVLNTENMVKEVIRLGCVVNRHNSSSMRQDTLYLRDTEIDYING
                     YIVKLADKYQLNAKVNRTIQSLVDLRLALNRKRKLEGDMRSK"
     gene            <548619..>551156
                     /locus_tag="HG536_0E03060"
                     /db_xref="GeneID:59326591"
     mRNA            <548619..>551156
                     /locus_tag="HG536_0E03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284173.1"
                     /db_xref="GeneID:59326591"
     CDS             548619..551156
                     /locus_tag="HG536_0E03060"
                     /inference="similar to AA sequence:RefSeq:NP_010596.1"
                     /note="ancestral locus Anc_5.333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140069.1"
                     /db_xref="GeneID:59326591"
                     /translation="MIRRIDELPIGNGTIRDVGKGNGLGGKKEESKGNNGVGMFDNSI
                     NVLSKEVGTMSEEIKSLEKMFVSRDSTTTASIEQLFATLKTLSHNQTVLENKVDDALK
                     NQLNTDVMVNSINARMNQLSSALSNLSKAVPPGSQGGVMNDSQSSTANSTGNQSRPHS
                     VRRGPGRPRKDGSVGRAGDSSGGRIQVNPVKVSLPTGAVQVSKSKRYFIDPSASSESV
                     SAVKTEAAGKKAVPAIPVKRKRGRPPKKRTVEAVILNHQNASNADEEQVLKTEEEEKS
                     VDNKEEEQEEQNHELPSQESAPAVGSALISPSLSASPPSMSRSSSPSTPIPNLIPSAA
                     VTAETTDIPENEPEEVAQIPAENPIITTRIIGPLARKRLLGAAADSDNITIEMSSSSV
                     APDNNTADNNNPDVSRQQRELDKRRDAREKMLVNMKYNDREKAKSFMESNKQLLKAMR
                     EEERRKRMTALINAPPSTTNVQVQQYGSSSAAATTPSTEFAFKTEELSQQHRKVGISS
                     MLNNEGSALIQESEERLARKRSNENDDQDDYDDLDDDEYDDDDQQDRRLRKRRSSNFA
                     LSPSAPLLEKSPSSEKETGGANKRQEDQASLLLASPIELLCRDGFFYQRDHPKVPITT
                     GSYLRFKFKSKEEELVGLSISQKDFVDSTRHERMNAHFLKPEIDVETEQAFTILSKTT
                     LTEKYVNSLEYFLMEFRWENKLVGLGLKLRESKRTWQRRKALFTLFEFWRDQSREKRN
                     FENYTILHAVKEMENYRIFINRSVSWFYNHITLLKMILYDLCDNVDTQWREWMFNKGE
                     ALPILGVNGVNEDNINEAIDNVLTLDFLDDGTENNQVKSSKVVPPKN"
     gene            <551368..>552261
                     /locus_tag="HG536_0E03070"
                     /db_xref="GeneID:59326592"
     mRNA            <551368..>552261
                     /locus_tag="HG536_0E03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284174.1"
                     /db_xref="GeneID:59326592"
     CDS             551368..552261
                     /locus_tag="HG536_0E03070"
                     /inference="similar to AA sequence:RefSeq:NP_011929.1"
                     /note="ancestral locus Anc_5.332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140070.1"
                     /db_xref="GeneID:59326592"
                     /translation="MLVDLNVIWPQQSFRDEVTPKQVAKVRETLSTLHALGYTHVALN
                     FTVNHSDKFPTNAKEMNPMKISERFGDLIEATGLKIYSRITLVIDDPSRGQSLAKISQ
                     HFDIVAALPVSERGVTLATTNLDIDLLTFNYGQRLPVFLKHKSICSCVKRGVKIEIVY
                     AYALRDLQSRRQFVSNVRSVIRSSRSRGIVVSSGAQTALECRNILGVTSLVKILGLPS
                     DKCSRAMGQLASLVLLNGRLRNKSYKQTIVVGGGGAGCDVVNDLQGIDETRTIKLIKR
                     TSINNSSDDDSTDRDPKRVKI"
     gene            <552782..>553822
                     /locus_tag="HG536_0E03080"
                     /db_xref="GeneID:59326593"
     mRNA            <552782..>553822
                     /locus_tag="HG536_0E03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284175.1"
                     /db_xref="GeneID:59326593"
     CDS             552782..553822
                     /locus_tag="HG536_0E03080"
                     /inference="similar to AA sequence:RefSeq:NP_010595.1"
                     /note="ancestral locus Anc_5.331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140071.1"
                     /db_xref="GeneID:59326593"
                     /translation="MATAGTFNLPQMKSIWLDEDEEAEKLYGLQVQQFMGPDDEDDLA
                     ITMVNSDKPLLSNKKNIDLAALGKNIKTSKFLSTSALTPSRKKASIKKKGFFALFKNK
                     EHHVLKDTAKISSPFAFQHISHADVRTGFEEERQEEQSAQAENQPKSRPLSRAFVTHS
                     TTDSSSGSGEVNERKRASARMSVSTTGSSRYSRFSTTGRIASSSTMATSILHESSSPH
                     RAALISGMDKLTLRERKNRESSDSGSSISFLRDYDFPALIEVQSATECPKTPTKRDTM
                     GDSKRLASSPNRLKRAKSSSQLLRTPEIENRWFNEETPASRKSLDDVLLCYHQPSNSA
                     TPSQITPVKSSA"
     gene            complement(<554005..>554547)
                     /locus_tag="HG536_0E03090"
                     /db_xref="GeneID:59326594"
     mRNA            complement(<554005..>554547)
                     /locus_tag="HG536_0E03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284176.1"
                     /db_xref="GeneID:59326594"
     CDS             complement(554005..554547)
                     /locus_tag="HG536_0E03090"
                     /inference="similar to AA sequence:RefSeq:NP_011927.1"
                     /note="ancestral locus Anc_5.330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140072.1"
                     /db_xref="GeneID:59326594"
                     /translation="MDEDADYLELLRLLSRYDLLLEQLQKTMGEGFQNLGRANYHNKN
                     ALRGRYGSDYWDECYEGQIAVERQNDGSVSIVKLALADESEEMPDEDEKVDEKLHEEA
                     LLRRRNQAKQRKLQKTRHREPLTMFGGIFSVPTSLRQCQTSFKGAIPLVEELINCKLA
                     TKRLLDNLEERNGVGDISRH"
     gene            <554691..>555143
                     /locus_tag="HG536_0E03100"
                     /db_xref="GeneID:59326595"
     mRNA            <554691..>555143
                     /locus_tag="HG536_0E03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284177.1"
                     /db_xref="GeneID:59326595"
     CDS             554691..555143
                     /locus_tag="HG536_0E03100"
                     /inference="similar to AA sequence:RefSeq:NP_010594.3"
                     /note="ancestral locus Anc_5.329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140073.1"
                     /db_xref="GeneID:59326595"
                     /translation="MTDRLTQLQICLDQMMEQFCAALNYIDKNHDFEPANETEMKMSD
                     RHATVAPPEEFANTIDELSTDIILKTRQIIKLIDSLPGVDVSAAEQLHKIDALQKELV
                     KVENDKVEAVIRKEKLLEDVSSMIEFFVGGIAESRQALVSSNDSAIEK"
     gene            complement(<555158..>557143)
                     /locus_tag="HG536_0E03110"
                     /db_xref="GeneID:59326596"
     mRNA            complement(<555158..>557143)
                     /locus_tag="HG536_0E03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284178.1"
                     /db_xref="GeneID:59326596"
     CDS             complement(555158..557143)
                     /locus_tag="HG536_0E03110"
                     /inference="similar to AA sequence:RefSeq:NP_010593.3"
                     /note="ancestral locus Anc_5.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140074.1"
                     /db_xref="GeneID:59326596"
                     /translation="MSEQAGKKSTVRKDDVVELAQGPFREYQPVDTYWSNEVGKVKLL
                     DAILSLTIAVSFGLFMIKSQPGGFTRDISEREQEIVDALEYFQLGKFDLNILPSLGIQ
                     LLSLFPLQIEVLRKISVGVASLTLSFLFLTLRRVNTSFPFAISGAIALGSLPIFQIEA
                     ASVSIYVIQWFFLSMASYLWQSAKCSRHFTKAWFSNLLLLAVTLGLGASTRYIGLLTW
                     VWVSIVSMKEFWNVLGDTTLTSRYLTKYVAVKVIILGIIPFAVFMSSLSLQMLSWTHD
                     TPELSQYMSPNFKAYLRGPFEHPEYLYYGSVITLRHHESLGGYLHSHNHTYPSGSGEQ
                     QVSLTQQEEDYNNKWCIEPPRPHSDENGSLRKVNDFGKVRLRHCATGKLLRASSAKPP
                     VSEQEYNSEISCTGDADYVGNSDELWTVVSVGDPLHSALRPLKSLVKFLNEGQGCTML
                     AHDTRLPNWGFHQQEVLCLRSPTESRTLFEIETEQLNATDKIEYRTFTGDARKVIGFV
                     KLLVELVQRQYKWNYYENKFKKHSEPTVEKWPFQLFQQKYVTHIWISSVLYPLCFVIY
                     QAVQMLPWRRPAIRKASKTLNTIIHVDFAVECLLGWFLHYRPFVASPHADQKMSSYVS
                     SLFFGQLLVWKAVDSWCKTRLLYGALICIYIAYILHG"
     gene            557538..557610
                     /locus_tag="HG536_0Etrna9V"
                     /db_xref="GeneID:59326900"
     tRNA            557538..557610
                     /locus_tag="HG536_0Etrna9V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUG"
                     /db_xref="GeneID:59326900"
     gene            <557765..>559120
                     /locus_tag="HG536_0E03120"
                     /db_xref="GeneID:59326597"
     mRNA            <557765..>559120
                     /locus_tag="HG536_0E03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284179.1"
                     /db_xref="GeneID:59326597"
     CDS             557765..559120
                     /locus_tag="HG536_0E03120"
                     /inference="similar to AA sequence:RefSeq:NP_010592.1"
                     /note="ancestral locus Anc_5.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140075.1"
                     /db_xref="GeneID:59326597"
                     /translation="MGNKCRPKKVKAPYRKYVAGQGHSRTYGFTPTTSPAVEEIYGEE
                     CITEFARDNDVEGIDKVQEHCSNRKSTDSIVHFKARQNESMGSLDPFRKTSDEEKENL
                     GDMRLPWEIQALILKFSDEPFDPSYLLVCKVWYLLCLPLIYRHPALNCRNFNSFVDAV
                     ISNRKKKIGGYVEELNLASIMQSGRNSFVSRLLRRCSPSLQKFTAPQTSFGYAPLISL
                     KSCLQLKYLDLGLVSETVKLEQLFAAIKNFKHLTHLAFPRSSINCDGFREFQWPENLQ
                     YLKLSGGITNEFVRETQWPRSITTLEFSYCPKVDEHAVYRVLSQIGDNLQHLYFHYPM
                     PSLHENALDYVFRYSSRLISIQLMVDYCSRWVFSEHMLASLVYPRPLRTIYLECSGSL
                     GLASKIHPDDFTIAIMESRLPCLKNISVSSKLGWDMNSDDVSDLVSVFEDQGGSLYLS
                     Y"
     gene            <559230..>559769
                     /locus_tag="HG536_0E03130"
                     /db_xref="GeneID:59326598"
     mRNA            <559230..>559769
                     /locus_tag="HG536_0E03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284180.1"
                     /db_xref="GeneID:59326598"
     CDS             559230..559769
                     /locus_tag="HG536_0E03130"
                     /inference="similar to AA sequence:RefSeq:NP_010591.1"
                     /note="ancestral locus Anc_5.326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140076.1"
                     /db_xref="GeneID:59326598"
                     /translation="MSGPIYFYKYVVTPQVFFKSKYTYALVNLKPLVPGHVLIVPLRT
                     QVVRLSDLTPDESTDYFNTLQLIQKFISWHFKADSLNIAIQDGPEAGQTVPHLHTHII
                     PRYRTNNIGDQIYDKLDDWRFQSWDERRSEYLAIGGREGRKKLAKPDDQRIARSQEEM
                     AQEAMELERQLAEFTVTSA"
     gene            complement(<559811..>560188)
                     /locus_tag="HG536_0E03140"
                     /db_xref="GeneID:59326599"
     mRNA            complement(<559811..>560188)
                     /locus_tag="HG536_0E03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284181.1"
                     /db_xref="GeneID:59326599"
     CDS             complement(559811..560188)
                     /locus_tag="HG536_0E03140"
                     /inference="similar to AA sequence:RefSeq:NP_011926.1"
                     /note="ancestral locus Anc_5.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140077.1"
                     /db_xref="GeneID:59326599"
                     /translation="MLCRRFVSTTSPLLRLSRTLNRVIPKPTDQIPDVATFLTRIGRK
                     CDEAAEIYENKWENLFVWDSRDLKEKGVSVQQRKYILHQVEKLRKNEPIVEIKKGKKS
                     FFGGERKRKENIAKWKAEQRSKE"
     gene            <560342..>561187
                     /locus_tag="HG536_0E03150"
                     /db_xref="GeneID:59326600"
     mRNA            <560342..>561187
                     /locus_tag="HG536_0E03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284182.1"
                     /db_xref="GeneID:59326600"
     CDS             560342..561187
                     /locus_tag="HG536_0E03150"
                     /inference="similar to AA sequence:RefSeq:NP_011925.1"
                     /note="ancestral locus Anc_5.324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140078.1"
                     /db_xref="GeneID:59326600"
                     /translation="MNTPLDELQWKSPEWIQAFGLRTDNVLDYFAESPFFNKTSNNQV
                     IKMQRQFSQVPGEPVQTQEGKPRPNDLEVIGAGPGQQQDQDEFAYADPVRRSLLARYP
                     VHAMLERELARMKGIEYVLAYVREPDFWVVKKQERLAAQRIRVLQDYYIIGANVYQSP
                     TVFKIVQSRVMSASYHLSETLGQLHSLTQFQPSQGVRFKRLQNTTSANPGAANGATGS
                     QDSAPATATANELPSTTNTGQTAQTARTDQLDNNGASASRDVLTPEMMQKLMYISARS
                     TPEYV"
     gene            <561296..>561928
                     /locus_tag="HG536_0E03160"
                     /db_xref="GeneID:59326601"
     mRNA            <561296..>561928
                     /locus_tag="HG536_0E03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284183.1"
                     /db_xref="GeneID:59326601"
     CDS             561296..561928
                     /locus_tag="HG536_0E03160"
                     /inference="similar to AA sequence:RefSeq:NP_010590.3"
                     /note="ancestral locus Anc_5.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140079.1"
                     /db_xref="GeneID:59326601"
                     /translation="MQLLAFALSFVLFFKAIVLAADPQITRKVYFDIQHGDKEVGRIV
                     VGLYGATTPKTADNFYELTISQDPAMGYLGSIFHRVIPQFMIQGGDFTDGTGVGGKSI
                     YGASFPDENFDVKHDRPGRLSMANRGKDTNGSQFFITTVATPWLDGRHVVFGEVLEGM
                     DVVHYIENVPRDSRDAPLEKVVIAACGEAETVPLDNQTVQHAQEKARDEL"
     gene            <562372..>564861
                     /locus_tag="HG536_0E03170"
                     /db_xref="GeneID:59326602"
     mRNA            <562372..>564861
                     /locus_tag="HG536_0E03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284184.1"
                     /db_xref="GeneID:59326602"
     CDS             562372..564861
                     /locus_tag="HG536_0E03170"
                     /inference="similar to AA sequence:RefSeq:NP_010589.3"
                     /note="ancestral locus Anc_5.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140080.1"
                     /db_xref="GeneID:59326602"
                     /translation="MDIRGRKMKKPPACVQCRRRKIGCDRVKPICGNCLKNGKTDCFF
                     PDVPGQYVSSNSSQSSAKYDHVRESGAELHHNPELASMEQIREYNTRLQLLNAQQHRA
                     SPGAVETAQFIPRTVPSFENKPVSSANGSALHLNWVQGPAIFDIMTSPYTQEEVLLKE
                     MEFLKSRLLELQEITGNKIGMELWKAGELLSNGNSGGRGDGGRSGSGKDANDIAIPEL
                     KRLQMSLKGDGMSINEFRDLDPEFLESKQVFDVLAVSNPDNLTELNPLSDAPNCIFSV
                     RFLTIRDEYLAQFYRKINEVVSTHFNDQLANWRQQKSKGPATFKNDQAIRFPPRGVTQ
                     EIITKYLATVADTNSLIPILKPRELMTAVEQLFGREPIFSPNKLDLPQIATLGQITVC
                     LLLTYETLSSSVLIPLKDEQLALFHQLRDWVPSFRTNLHLIKSEIDRRDNNSYTVTVL
                     NFIALWKYYQSISDTCDNDSIDGDEDVHLARQLSLNHETKNQLHMLLWNFIFKNYCWR
                     HLFRGEVPSMVVGSELNSATVIDPLLNIDYALLNFQIDMLKYLQTRDSMLSLKKVLGL
                     RDLFKVKLHEQNKKCYTTAAIVNSVVDSLIYRNAMLYLNYFLLMQYERFKDASDFVDY
                     YKDFLQLVQETLFFVFSCLANLKFAGYEFIFAKKSFLTLESICHMILGLYQRSYIRST
                     KVSASAMADDSTRPDAQQSETLTLLLNKVLMLLQDYARNRKVASPLIFKLVCKLRTTL
                     EYIALCESGTMTTLNHVAGKAPVLYGVPNAFELIDEPNLSKVTAKLRAISESLIKSDF
                     YSQRKPYEPTNPQTLGLTPENFTDIFNSFYC"
     gene            <565158..>566009
                     /locus_tag="HG536_0E03180"
                     /db_xref="GeneID:59326603"
     mRNA            <565158..>566009
                     /locus_tag="HG536_0E03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284185.1"
                     /db_xref="GeneID:59326603"
     CDS             565158..566009
                     /locus_tag="HG536_0E03180"
                     /note="ancestral locus Anc_5.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140081.1"
                     /db_xref="GeneID:59326603"
                     /translation="MPSMIWRSSSVGPVSRFLSLRQVRFRSNIGTCISDFAIKKKGTG
                     TGCFIELPDFVPLQDSILVKIPSSCEIYGKMNKINAISSDASVQNEPLLAQESVGTVG
                     FSRIVTGEHPANLIMASPTPMSNIAVVKIDSGENDGMYVPEFDQSVLCYSGNLMLRNN
                     NQITGYGVVALAGRGPVYQVILREGEHMVVASESILAYDSQAQIRLIRLQSPYRSPSA
                     MYSFFSRYFQRYYDQVLMKLNKSFATGRVFSKIQGPGTFFLQTQFVPGSRKYLDEELL
                     QITKSEA"
     gene            complement(<566054..>566701)
                     /locus_tag="HG536_0E03190"
                     /db_xref="GeneID:59326604"
     mRNA            complement(<566054..>566701)
                     /locus_tag="HG536_0E03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284186.1"
                     /db_xref="GeneID:59326604"
     CDS             complement(566054..566701)
                     /locus_tag="HG536_0E03190"
                     /inference="similar to AA sequence:RefSeq:NP_010588.1"
                     /note="ancestral locus Anc_5.320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140082.1"
                     /db_xref="GeneID:59326604"
                     /translation="MAVKNRGAVRKTVSFSDDNTLTNRNNKRKHVDHEDPPVYVRKTI
                     LTIPWHLIGLIYYYTCVSEGYDSWKLLFALIPLQVLYLKYQFNKSTIYGNKILKLKGS
                     LAIISACATLLLTVPAVVITILFGAPATEKWRETWIFSLHCCYLAYPAIYQVFNGDFK
                     VGLWKKYFIMIVIGAWCSCVVIPLDWDRDWQAWPIPVVVGAYIGAFLGYSFGSRF"
     gene            complement(<566903..>570898)
                     /locus_tag="HG536_0E03200"
                     /db_xref="GeneID:59326605"
     mRNA            complement(<566903..>570898)
                     /locus_tag="HG536_0E03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284187.1"
                     /db_xref="GeneID:59326605"
     CDS             complement(566903..570898)
                     /locus_tag="HG536_0E03200"
                     /inference="similar to AA sequence:RefSeq:NP_010587.1"
                     /note="ancestral locus Anc_5.319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140083.1"
                     /db_xref="GeneID:59326605"
                     /translation="MNVYDDVLDPTVVSHSIVGHFTTSDYQELLTVRTNILTVYSVRE
                     DGKLNWTNEFKLHGKIADLTLIPQANSSLDCLLLCTSIAKISVVKFDVLSNSIETSSL
                     HYYEDKFRDVSILDLAKESKLRVDQGKRCVLLFNNDAMALLPLRGINLEDDDEEHETD
                     AGNGRVNKRVKTDTDKVSFPSKIFSAQELGKDIRNVVDVNFLHGFSKPTIAILHETKL
                     AWAGNRQLNPLPMSYTVFTLDISADEKVTRMSTTTIGKVSELAWDFHSLLPVSNGCVI
                     VGTNELAFVDNSGSLQSIILLNTFTDKINRQGRIIDASKQQILLNEPIVHYWSPPTNP
                     RQNDETLLLMDTESNFYYVQLESEGRLLVKFDIIALPIVNDTFKRNTGCSCISRLNRK
                     ASNEDQDLFIGFKSGDALVVRLNSVKSAVETRDHHKQLSEAVEDLYYQDEDEDYLYSD
                     GGSEGGKANNDNDLIVETVNPFDIELLSSLRNVGPITSLAIGKVCSVEKYVRGLSNPN
                     RNEFSIVATSGNGSGSHITEIQGSVRPLVELALKFISITQMWNLKIKNKDKFLVTTDS
                     NKSKSDIYRIDDNFALHKEGRFRRDATTVYMSIFGGGKRIVQVTTNNLILYDTNFRRL
                     TTIKFDYEVVHVSVMDPYILVTVSRGDIKIYELEPKHKKKLLRVDLPGVLKEMVITSG
                     VISKSNICNEFFNDLNDPEEEQLLFTFATADNQIIFFPKMHNDRVFQLNGIDKLKESL
                     YISTYQLPDEIIPDPFIKQVMLNKLGHGNKEEYLTILTFGGEVYQYKRSSSSNRFYRN
                     TTSSDIIITGAPDNAYAKGVSDIERIMYFIPEFNGYSVILISGSVPYIIIKEDDSSPR
                     LFRFGNIPLVSLTRWGKSSVMCVDDIKNARVYTLDCREIYYGNNLPIRRIDVSDALED
                     FMTLTKVTYHEKSQMFIVSYARNIDYEALGEDGDKLVGYEEGVPHAKSFQSGILLINP
                     KTWNIIDRKDFPANTLINDVRSMMIQLDSRTRRKKELIIAGIAVIGTEDLPPSGSFIV
                     FDVTEVVPEPGKPDTNFKLSEVFQEEVRGTVSTICDISGRFLINQSQKVIVRDVQEDN
                     SVVPVAFLDIPVLVTDAKSFGNFLIIGDAMQGFQFIGFDAEPYRMIPLGRSILKMETI
                     SLEFLVNGGDIFFAITDTDNILHVFKYAPDEPNSLSGQRLIHCTSFNLHSTNTCMALL
                     PKNEEFAPAESQIRTFQALGGQMDGSLFKILPLKEDAYRRLYVLQQHISEKETQLAGL
                     NPKMERLANGHYKTAHVMRPMLDFNVIEKFKVLSIERRKQISQKVGKRAQFDIWRDLI
                     NIEFSMRSLCG"
     gene            <571320..>572582
                     /locus_tag="HG536_0E03210"
                     /db_xref="GeneID:59326606"
     mRNA            <571320..>572582
                     /locus_tag="HG536_0E03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284188.1"
                     /db_xref="GeneID:59326606"
     CDS             571320..572582
                     /locus_tag="HG536_0E03210"
                     /inference="similar to AA sequence:RefSeq:NP_010586.3"
                     /note="ancestral locus Anc_5.318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140084.1"
                     /db_xref="GeneID:59326606"
                     /translation="MSKTYTIVIKLGSSSLVDEETREPKLSIMSLIVETVVMLKRAGH
                     KVIIVSSGGIAVGLKTMNLTKRPKRLAEVQAIAAVGQGRLIGRWDGLFAEFDQRIAQI
                     LITRNDIADWSQYKNAQNTMNELLRMGVVPIVNENDTLSVSEIKFGDNDTLSAVTAAL
                     IGADYLFLLTDVDCLYTDNPRTNPQATSILVVPDLSKGLPGVNTSSGSGSEVGTGGMQ
                     TKLIAADLATNAGVHTVIMKSHAPANIIKVVDYIQSLDIDGDKPVYTDDLESLQKEEL
                     KKLQELHVPLHTKFIANDNQRHLNNREFWMLHGLITNGAIIIDEGAYAALTRKDKAGL
                     LPAGVIDVEGSFHELECVDLKTGKRLPNGELDASVPLVTVGRARSNYTSAEVKRIRGL
                     QSDQIEEIVGYAGSEYVAHRQNLAFPPH"
     gene            complement(<572618..>573637)
                     /locus_tag="HG536_0E03220"
                     /db_xref="GeneID:59326607"
     mRNA            complement(<572618..>573637)
                     /locus_tag="HG536_0E03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284189.1"
                     /db_xref="GeneID:59326607"
     CDS             complement(572618..573637)
                     /locus_tag="HG536_0E03220"
                     /inference="similar to AA sequence:RefSeq:NP_011899.1"
                     /note="ancestral locus Anc_5.317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140085.1"
                     /db_xref="GeneID:59326607"
                     /translation="MDFMLRPVDEKATSVITLEPTPGFVVKSRLITTEGRPNHLLKLQ
                     NGSKVFINICHHEKVPKPEIDFDAIVVYPLVMNNQWEIPIITSPVREDKDKKGALCYV
                     WDCCINSVCMSWINEDLQLREILVEWCLEACEISDVVGICRDHIAFPKMKKKGDFIPH
                     LEVRANELTSDYRKEIAKMAEKDDSSPSRILELRRNLLEEPEGLSGITDEELPPLMPA
                     GRSSKPLIEEIDNLSIDSLKNDKPAIPKELPEPQFEVRMRKTKKADKYRLRIEIESQV
                     HSASDLRLRYNSQQNALEVSNVNLTVYKEKKLQIPLPHIFTEADAAHLEALFTKADRK
                     LTVFI"
     gene            complement(<573796..>575334)
                     /locus_tag="HG536_0E03230"
                     /db_xref="GeneID:59326608"
     mRNA            complement(<573796..>575334)
                     /locus_tag="HG536_0E03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284190.1"
                     /db_xref="GeneID:59326608"
     CDS             complement(573796..575334)
                     /locus_tag="HG536_0E03230"
                     /inference="similar to AA sequence:RefSeq:NP_010585.3"
                     /note="ancestral locus Anc_5.316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140086.1"
                     /db_xref="GeneID:59326608"
                     /translation="MGRFVADEISELANRPANKDYDIEDGDAGVFEHREVGSSDDEVY
                     ETTEANSEEKAHYAAVGKSRLRDDRIELDDDKYQGAVGSREEVFGEDSENEVEGESES
                     DAVSLRTDSEDELISEESESEAEEVSEAEDAQYKRERLAKLIQQETSNAVKKLSETTR
                     KDAAKGLCILEQNRLFENIIDVRIKLQKALNSANSLPVTTESWKYLKSDKTDSLVKES
                     QKLLTKVLNQMIDFRNEFHIKDHISQESEKAERPQKRSISDLTKETDRLDDELSVYRS
                     AVLNKWSTKVASASGSHALTSSKFKAINQPADVQVRNQLADTERLLKRTCLSRRGITP
                     FRFHDDLNNGKLDQIAAKETQDDDAEDADLDIPRNYDPRKKDNNAFDTAENPYIFDDE
                     DFYRVLLNDLVDKKISDARTANGTSANIAITSRSTKLKKNVDTKASKGRKLNYSIQEP
                     IANYEAPRESGYKWSDEQIDEFFAGFLGQRIDFAEHEETALEEDGDKAEQELIKKDDI
                     QIFG"
     gene            <575869..>576489
                     /locus_tag="HG536_0E03240"
                     /db_xref="GeneID:59326609"
     mRNA            <575869..>576489
                     /locus_tag="HG536_0E03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284191.1"
                     /db_xref="GeneID:59326609"
     CDS             575869..576489
                     /locus_tag="HG536_0E03240"
                     /inference="similar to AA sequence:RefSeq:NP_010584.1"
                     /note="ancestral locus Anc_5.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140087.1"
                     /db_xref="GeneID:59326609"
                     /translation="MMFGRVFVRSLASSTKAVKPPVQLFGLDGTYATALFTAASKNSS
                     IEAVSKSLNSLSQTIEKDPKLKDILANPALSSQDRNVVVKTLSEQPNVDSTVVNLLKV
                     LAENNRLDIFTKVNSQFTTLTDAYNGLVKGTVITAQPLDSKSFKRIERALAQSNLVGQ
                     GKTLKLENSVKPEIQGGLIVEIADKTVDLSIASKIQKLNKVLDESI"
     gene            complement(<576588..>577565)
                     /locus_tag="HG536_0E03250"
                     /db_xref="GeneID:59326610"
     mRNA            complement(<576588..>577565)
                     /locus_tag="HG536_0E03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284192.1"
                     /db_xref="GeneID:59326610"
     CDS             complement(576588..577565)
                     /locus_tag="HG536_0E03250"
                     /inference="similar to AA sequence:RefSeq:NP_010583.1"
                     /note="ancestral locus Anc_5.314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140088.1"
                     /db_xref="GeneID:59326610"
                     /translation="MNSTAAFDQIYVSKSPYGFMHAAVEPPVVVNARKNLLPYVSDGI
                     LALIAPVVAYWTFSLFFHLIDTLCLAEKYRIHPSEEIASRNRAGRIEVLCEVIFQHII
                     QSAVGFAFLLFDEEPTTGFEQNAMWVLRQQIPAAVPDAVVYYLYTYGLSFVKLLVGFA
                     IIDTWQYWLHRLMHTSTSLYRKFHSRHHRLYVPYAYGALYNAPLEGFLLDTLGTGIAM
                     TVTGLTHREQIVLFTFATLKTVDDHCGYALPFDPFQIIFPNNAVYHDIHHQHFGIKTN
                     FAQPFFTFWDTLFGTNFKGFEEYQKSQRRVTIDKYKQFLAERKSAKVTK"
     gene            complement(<577924..>578595)
                     /locus_tag="HG536_0E03260"
                     /db_xref="GeneID:59326611"
     mRNA            complement(<577924..>578595)
                     /locus_tag="HG536_0E03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284193.1"
                     /db_xref="GeneID:59326611"
     CDS             complement(577924..578595)
                     /locus_tag="HG536_0E03260"
                     /inference="similar to AA sequence:RefSeq:NP_010582.3"
                     /note="ancestral locus Anc_5.313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140089.1"
                     /db_xref="GeneID:59326611"
                     /translation="MTGVGNLAVRKFRPASWLQKAGYAPQVFVFRNLESGQVVYSQFP
                     NFTQKQVDTLFQRPNWENKKPSTRRDVWKCMCVVDMPDYESSVKLYQNLRRLRYLRDV
                     RMPKEAQSLRKKNDDGNVWYSAQYRPTYAQEAVADLIESLSKTLRHTKEKEATLHWED
                     PWRMGDKAKYWSPALPTVKHTVMSRLGNSAREQSSILRELGEKAKQEFLKFKEQQKQA
                     DSISL"
     gene            <579125..>581176
                     /locus_tag="HG536_0E03270"
                     /db_xref="GeneID:59326612"
     mRNA            <579125..>581176
                     /locus_tag="HG536_0E03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284194.1"
                     /db_xref="GeneID:59326612"
     CDS             579125..581176
                     /locus_tag="HG536_0E03270"
                     /inference="similar to AA sequence:RefSeq:NP_010581.3"
                     /note="ancestral locus Anc_5.311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140090.1"
                     /db_xref="GeneID:59326612"
                     /translation="MLPSQLVRPVFFTIGILKFLCSVSLLDEVSVDQILYSSRNRRKL
                     SAMSTDGLRQSNVSYLLVDLTSFQKDLVEILISLHASSLKQEIEAADDKINNGDEKMY
                     PQLSAKQMMYIFDSNFRAVANHPCLLVDHYMPRQFLRMEPNENLVNNSDKFRKLQQIL
                     CGIIERDRVEFPQVLRICLISHSVRELDLLEGLILGQRVRIKRLSGTSLYDEKHIYVR
                     DDSEGGDACESKDGTPCNDSGANKYTGYSRDDYDYSVKRQKRASTCDDDWLFLTTTAH
                     LINDPSLMEDYDADCIISFDPLLDPSLPALEVLYRRASKQPPIIKFLVADSPDHYILE
                     NCTQGGCTPYSELKNSIDHYLRTRHKSRGELCNLDYKEVVKSLLKGEQLTEMLPDVRL
                     SPVATDVDPYQPRMTELNSPGSQLRIDEAVFDMKSYQSELMKRAVGRLRAIQEDCKHN
                     REKLLNRRLEETARQNSLDAIKATIATTFKRFQECEKTANDSEKRLERSQTESDKLEQ
                     RVQSLRKTQTELAKLVSLEDSSDIDKALLLYTEKSNIMQAELEALQQTNEDKSKRNNE
                     LRSEYQQKSSLAAELAQNLSALRDSDQMLKKEVAGPAPRLNSDALKRRENRLKAELEE
                     HRRRSKFLKAFISKLTSSYDLKLNGDGRSQNSSSSSLNGRASGHGTRSRLTRSNTPTY
                     I"
     gene            <581995..>583701
                     /locus_tag="HG536_0E03280"
                     /db_xref="GeneID:59326613"
     mRNA            <581995..>583701
                     /locus_tag="HG536_0E03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284195.1"
                     /db_xref="GeneID:59326613"
     CDS             581995..583701
                     /locus_tag="HG536_0E03280"
                     /inference="similar to AA sequence:RefSeq:NP_010580.1"
                     /note="ancestral locus Anc_5.310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140091.1"
                     /db_xref="GeneID:59326613"
                     /translation="MKVDICTGCLSPTWAKNESLIAIYHYGYIYVSSKSWIELFKDLL
                     LVLFALRIFRFVLFNLKVYGMVGCVHNLYRTVAGRLFRWLLKSRFFRASVDAEVSKVT
                     RHMEKELIKNDACLNDFEKLPAVGLPEQSVLNELGLLESKIPHTEWKDGKVSGAVYHG
                     GEDIIHLQSLAFEKFCVANQLHPDVFPAVRKMESEVVSMTLNMFNAPKDTGCGTTSSG
                     GTESLLLACLSAKMYAYHHRGVTEPEIIVPVTAHAGFDKAAYYFGMKIHHAKLDPRTY
                     KVDLSHVRKFINRNTVLLVGSAPNFPHGIMDDIEGLGELASRYKIPLHVDCCLGSFII
                     AFMEKAGYDNLPAFDFRVAGVTSISCDSHKYGFAPKGSSVIMYRNRDLRMHQYYVSTD
                     WTGGLYGSPTLAGSRPGALVVGCWATMIRMGENGYIESCKEIITAARKLKKAIESEIP
                     GLRILGDPKLSVISFTSDRYDVYELGDRLSARGWHLNALQKPPALHLAVTKPSVASID
                     DLVATLKELTKELEQEGKSASSADGTSALYGVAGSVKTTGVADRLVIGFLDTLYKLKP
                     TE"
     gene            <583926..>585326
                     /locus_tag="HG536_0E03290"
                     /db_xref="GeneID:59326614"
     mRNA            <583926..>585326
                     /locus_tag="HG536_0E03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284196.1"
                     /db_xref="GeneID:59326614"
     CDS             583926..585326
                     /locus_tag="HG536_0E03290"
                     /inference="similar to AA sequence:RefSeq:NP_011901.1"
                     /note="ancestral locus Anc_5.309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140092.1"
                     /db_xref="GeneID:59326614"
                     /translation="MEQFSSLSLDDKFHREAVCEEDPIGISKLSLSDQTNRITPQVLS
                     KYMPHFPALPSPLRNSFSYVETTNDEMDIDEYDKECVPSDSQEMEEVETKDVNSTTKV
                     TFAVPEVRKKSKPSIDEVSADKAPVAPKEEEMERENGCNAVKKDGTDSTAVIKALLSP
                     TSLGVAAAAKIEGFPLPDSPTAPKEITFEDDCPSIADRKDYQSIDIDSLKQDLRNRSK
                     HQPIQVSINNHHHYYQDPAGYLTMQRCTVPDLQNSKQMQPQLHGGDRYQLPVPWSSEA
                     RPLSRGSYMFMSYLQLFLNGITVTAVFTVLTAFFRTLKTDIKSSWEHRRLELAYESSR
                     CKIQYLTNKCNLGGRPALQEKCQAWEQCMNRNNDIFFRARSTLSAKLFGEIVNSFIEP
                     IGWKALLVILMAVVIWCFCSNFLLGFARAKSYYGDASQQTLMRQQRRLKRPLFLTQDG
                     QKHDDPSELSSDLQEL"
     gene            <585614..>587353
                     /locus_tag="HG536_0E03300"
                     /db_xref="GeneID:59326615"
     mRNA            <585614..>587353
                     /locus_tag="HG536_0E03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284197.1"
                     /db_xref="GeneID:59326615"
     CDS             585614..587353
                     /locus_tag="HG536_0E03300"
                     /inference="similar to AA sequence:RefSeq:NP_011902.1"
                     /note="ancestral locus Anc_5.308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140093.1"
                     /db_xref="GeneID:59326615"
                     /translation="MLSRARICQASRQGARFVAQLSTVNIPKQITNEAVKPFGLTDTK
                     DWDLLRASLMKFKSSSLEVPLVINGERRYYNDQTKRGFFAQTNPAHHQQVLATVTQAT
                     REDVKDAIQAAKDAKKKWLEMPFYDRAAVFLRAADLVSTKYRYDMLAATMLGQGKNVY
                     QAEIDCITELSDFFRFNVKYAYELYSQQPIESSPGVWNKAEYRPLEGFVYAVTPFNFT
                     AIAANLVGAPALMGNTVVWKPSQTAALSNYLLLTVLEEAGLPKGVVNFVPGNPVEVTE
                     EVLSDRDFAALHFTGSTAVFKQLYGSIQQGVVSGIYRDYPRIVGETGGKNFHLIHPSA
                     NLPHAVLSTIRGAFEFQGQKCSATSRVYIPKSRSEEFLKDMAGTLQQHKISPVNTSAG
                     SISGGDLHGFMGPVIHEQSFDKLASAIEEAKQDSELEIVYGGKCDKSSGWFIGPTIIK
                     TTNPSHKFLTTEFFGPILTVYEYPDDQFTQVCQLIDSTSAYGLTGSVFAKDRDAIIQA
                     SEALRYSAGNFYINDKCTGAVVAQQWFGGARMSGTNDKAGSGNILNRFVSVRNVKENF
                     YELTDFKYPSNYE"
     gene            <588122..>591892
                     /locus_tag="HG536_0E03310"
                     /db_xref="GeneID:59326616"
     mRNA            <588122..>591892
                     /locus_tag="HG536_0E03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284198.1"
                     /db_xref="GeneID:59326616"
     CDS             588122..591892
                     /locus_tag="HG536_0E03310"
                     /inference="similar to AA sequence:RefSeq:NP_010579.1"
                     /note="ancestral locus Anc_5.307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140094.1"
                     /db_xref="GeneID:59326616"
                     /translation="MANHGPGSGNRGQANPMYVTTTGGKNNPKQIHVAHRRSQSELTN
                     LMVEQFTLQKQLEMVQAKQQQLWIQQQQLAQQTGQFLGQPGNSNPSGNSGFLPPHPHF
                     NNGNNSPTGNSGYRSRSHSRNNSGFYDNNNSNSGHKKTGSQSSIYGHARRHSIGLNEA
                     KKAAAEEQAKRVAGNVTVKIESSSPTIGSNEGGDQKTFDSQQSYKFPASGSAQSGHRR
                     TNSSNQSSSFKFPATQSQYNQKENDNEGDDFIPTPTGHRRSRSRNNEYSPGINSNWRA
                     QSQSLSQGQGQSQQPSPFNHRTSNSRDFGYNSFNSLEPPAVFQAGHKHRTSNTSVHSF
                     NSQNNPNARKSLFAPYLPQANIPELVQEGRLVTGILRVNKKNRSDAWVSTEGVLDADV
                     YICGSKDRNRALEGDLVAVELLVVDDVWGSKKEKEEKKRRKDASSQHDYISLNSSDDY
                     HNDASATATITSNTTSTGAASSSSSSVVGDESGQLEAKSAGDSEDQSPSKPGVRRKNS
                     LKQRPTQKKNDDVEVEGQSLLLVEEEEINDDFKPLYAGHVIAVLDRIPGQLFSGTLGL
                     LRPSQQSHSDNNKPQQAPKIVWFKPTDKKVPLIAIPTELAPKDFIENADKYADKLFVA
                     SIKRWPITSLHPFGILVSELGEINDPDTEIDSILRDSNFLSNEYLDPKNPSLEKASFQ
                     ALPMADESLQNRRQFVDQETYEIFSIYESSHFSDFAVHVRENIDETGSIELGCHVVDA
                     TAYIEENSSLDRRARKRSTAVFMPQKVVDLLPQAVNASLTFAAGKKSATISVVYTLDK
                     KTLKVKSTWIGESTVQPFAPFVVDKLTSASPGSAQANFASILGKIASTFYAERIRMQG
                     AELEVYLPLMASLDDEKVNVDLNILERPLGSTIISEIRTKVDSSVAEKIYTKLGDYSF
                     LRRQVQPVHTKMMSFQKKVQKFGYDIDISSSDALIQSILQIKDEDVRTGVEILLFKTM
                     PRARYFIAGKVDPDQYGHFALNLPLYTHFSAPLRRYADHVVHRQLKTVLSGSPYNEDL
                     ESLKITSEYCNFKKDCAYQAQEQAVHLLLCKTINDMGNATGQLLTMATVLQVYESSFD
                     VFIPEFGIEKRVHGDQLPLIKAEFDPANRILELHWQPGVDSATFVPADEKNPKSYRTS
                     IKNKFRSTTAEIAAMEFEKKAKGEPLVSEILTKELSRLGLKVPKLRLPALKDNEDPLD
                     CFLSTAVTSKKNDNCIQEIHELQKVPVLLRAEVGMALPCLSVRALNPFLKKE"
     gene            <592334..>593050
                     /locus_tag="HG536_0E03320"
                     /db_xref="GeneID:59326617"
     mRNA            <592334..>593050
                     /locus_tag="HG536_0E03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284199.1"
                     /db_xref="GeneID:59326617"
     CDS             592334..593050
                     /locus_tag="HG536_0E03320"
                     /inference="similar to AA sequence:RefSeq:NP_011903.1"
                     /note="ancestral locus Anc_5.306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140095.1"
                     /db_xref="GeneID:59326617"
                     /translation="MVQRQFGMLAIQSLCRSLSARRGFQSSAQLLKKNSNNRKNGKDL
                     KEKEEVDVVDLSQYVKQAQAEFTKTLDLHKKKLHETRQGVADPRMLDDLRMQDGKPLK
                     TVASTSMKGKNALLVTVYDPKDTKHVVSSILAADLNLTPVRIPNNEQQLKIALPPPTT
                     ESRLKMCKSLKAVFEEYKNSSAKYSLGHIRAEILKDMKSFSKKDDKVRKVIQDVEKIH
                     KEYVNKLEEQLKQAEKSVMS"
     gene            complement(<593125..>595068)
                     /locus_tag="HG536_0E03330"
                     /db_xref="GeneID:59326618"
     mRNA            complement(<593125..>595068)
                     /locus_tag="HG536_0E03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284200.1"
                     /db_xref="GeneID:59326618"
     CDS             complement(593125..595068)
                     /locus_tag="HG536_0E03330"
                     /inference="similar to AA sequence:RefSeq:NP_011904.1"
                     /note="ancestral locus Anc_5.305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140096.1"
                     /db_xref="GeneID:59326618"
                     /translation="MPEVYLNSDMLNQLNSTVQEYLAEWVKKQQSLLNSQSQIVVTQI
                     QGNPKTAATTSILAGLFTFYVFYKLLWANSVSEDYKPVKFSVPVPDAAQTHWKGKRLH
                     PTSVFDPTKPGTIQAYCPATGQYLGSFTSKTCDDVDNMISKASKAQQEWGTSSMNRRL
                     RILASLQAYVLQNQELIAHVACRDSGKTMLDASMGEILVTLEKLQWTIQHGSNVLQPS
                     RRPGPTNFFMKFYKGAEIRYEPLGLISSIVSWNYPFHNLMGPVIAALFTGNAIVVKCS
                     EQVVWSSEFFIGVVRKCLEACGEDPDLVQLFYSLPPSDSDDTANYFTSHPSIKHITFI
                     GSQPVAHHILKCAAASLTPVVVELGGKDAFIVLDSAKDLEALSSIIMRGTFQSSGQNC
                     IGIERVIVSENNYDALVNILNERLTNNPLRLGSDIDHLEDVDMGAMISDNRFGQLEGL
                     VKDAVSRGARLLYGGSRYSHPNYPQGHYFEPTLLVDVTPDMEIAQNEVFGPILVVMKA
                     RDTEHCIQLANSAPFGLGGSVFGSDTKECNYVANNLKTGNVAINDFATFYVCQLPFGG
                     INGSGYGKFGGEEGLLGLCNAKSVCFDTLPFVSTQIPKPLDYPLRSNRKAWTFVKSFI
                     TAAYAMSTWQRVKSIFTLARNAN"
     gene            complement(<595417..>595870)
                     /locus_tag="HG536_0E03340"
                     /db_xref="GeneID:59326619"
     mRNA            complement(join(<595417..595758,595868..>595870))
                     /locus_tag="HG536_0E03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284201.1"
                     /db_xref="GeneID:59326619"
     CDS             complement(join(595417..595758,595868..595870))
                     /locus_tag="HG536_0E03340"
                     /inference="similar to AA sequence:RefSeq:NP_011905.1"
                     /note="ancestral locus Anc_5.304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140097.1"
                     /db_xref="GeneID:59326619"
                     /translation="MSQQNGIATLLKAEKEAHEIVSRARKYRQDKLKKAKSDAASEIE
                     AYKAQKDSELKELESKNEVGVGALEKEAESKVEGELKEIEQIVSKKQKDVVKLLVEAV
                     TKPVAEKHVNAN"
     gene            <596135..>597175
                     /locus_tag="HG536_0E03350"
                     /db_xref="GeneID:59326620"
     mRNA            <596135..>597175
                     /locus_tag="HG536_0E03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284202.1"
                     /db_xref="GeneID:59326620"
     CDS             596135..597175
                     /locus_tag="HG536_0E03350"
                     /inference="similar to AA sequence:RefSeq:NP_011906.1"
                     /note="ancestral locus Anc_5.303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140098.1"
                     /db_xref="GeneID:59326620"
                     /translation="MEDVCEVCGDREFKYKCPKCLKKSCSLACSKKHKVSDDCSGVAH
                     DPSVYVSSEALKNEDDEKHEMNVVVQRDYNFLTQMKRAVELQKRDGKLKNKRMLNMQH
                     AGPKRPRYNENSCQRVIRRGVNCLVLPKGMQRSSMNKSKWDKALDLFVWSIEWTLFPV
                     QGTDSEPFAHVSHRIKETDSIAESMGKIIYDKCCDMYQLQRSATSDEGQETKEDRTKN
                     LVNSRLLFYTKWFPYNTTDVVDSRKLVRLEPSGKSIAEQFRNKTVIEFPTIFVTKQET
                     DIPQKYTIVDERDARETPSTASAASDTSSSEEPPEESIKPSRPSDDAPADDSESDSDG
                     YDPGVTMDFLAN"
     gene            complement(<597225..>598817)
                     /locus_tag="HG536_0E03360"
                     /db_xref="GeneID:59326621"
     mRNA            complement(<597225..>598817)
                     /locus_tag="HG536_0E03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284203.1"
                     /db_xref="GeneID:59326621"
     CDS             complement(597225..598817)
                     /locus_tag="HG536_0E03360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140099.1"
                     /db_xref="GeneID:59326621"
                     /translation="MDDGIPEFDFSDLVIDAKRDAEEEHLVVADAEEEDIVLVGKSSL
                     EDTEISGSLQSLPRISKKKDPHVVHLLKRISLQSTITCILIPLFSLFKITISPPRDGN
                     LSLLYFFGFYMILSQISLFGGYHRFFSHQSFHAHVGHQVAYAVLGGSCGLGSVLQFSS
                     QHLAHHRHQDTERDPHSYSVYGWLFSIWGHRLFLGNRKSRKAISECRDTILSTSKMVR
                     GKLQESERDQLVQPPNHDILKIQDDNYVLLLLLTLLVFPCLVASYCNVPFLTSIFYLG
                     FVRMSLIQQQWLLLGTIAHLKNFPLASQPFSDIRSAINVPLSFVSQFILFGEANHNFH
                     HEFPSDYTNGTRWYHWDPSKWSIWLCYQLGLVDHLHRTEKQQVEKCRIQQQQKLLDKE
                     RSKLKWGIPIESLPSMTCEQFTELAKQQYLMNRRALVAIEGIVHDVTPFIHNHPGGTA
                     LVKLSIGKDATQAFNGAVYLHSQAARNLLATMRIAILTSSEQVQNTVWETKMLQKSQD
                     RQRRNNRQVTYTQKNHYAAGAA"
     gene            <599367..>601190
                     /locus_tag="HG536_0E03370"
                     /db_xref="GeneID:59326622"
     mRNA            <599367..>601190
                     /locus_tag="HG536_0E03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284204.1"
                     /db_xref="GeneID:59326622"
     CDS             599367..601190
                     /locus_tag="HG536_0E03370"
                     /inference="similar to AA sequence:RefSeq:NP_010578.3"
                     /note="ancestral locus Anc_5.302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140100.1"
                     /db_xref="GeneID:59326622"
                     /translation="MLEQFAIFTPQGEILYQFNCLGRKFAETQINRFVSQYISSRTSI
                     GASYKKYSVLDVSGAADGAGLKSSRSFCCMFHISKQPELFYVVTYAEQSLELNDEAAE
                     VLKLGVTLWDSLQLNDGIVRNLSGRGHRNEHNYVEVTEGLEETIAKFDTYLRAKYEAY
                     ARRSEASKPVLETESVENNPKKKSSELKSKKKSSSGGQQGRKWGRDGMMDEIGHSDPT
                     KLDFSEASSASSSNVALVDKESFGKRTVEGEFLIREIDDLLVSQRDRVKSTAQASNTN
                     AAFSFLKKHILGNKTISEEDLKSVLDKLQQKLISKNVAPEVARHLSQQVSKDLIGSKT
                     ANWTSVENTARESLIKALTQILTPGVSVDLLHEIQKRTSQKDSEGKKHPYVFSIVGVN
                     GVGKSTNLSKLAFWLLQNNFNVLIVACDTFRSGAVEQLRVHVENLAQLTDESHVRGSR
                     NRRGKSGNDHVELFEAGYGGSDLVAKIAKQAIKYAKDQNFDVVLMDTAGRRHNDPTLM
                     SPLKSFAEQANPDKIIMVGEALVGTDSVQQAKNFNNAFGKVRNLDFFIVSKCDTVGEM
                     LGTMVNMVYATGIPILFVGVGQTYTDLRTLSVKWAVDTLMS"
     gene            complement(<601286..>604516)
                     /locus_tag="HG536_0E03380"
                     /db_xref="GeneID:59326623"
     mRNA            complement(<601286..>604516)
                     /locus_tag="HG536_0E03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284205.1"
                     /db_xref="GeneID:59326623"
     CDS             complement(601286..604516)
                     /locus_tag="HG536_0E03380"
                     /inference="similar to AA sequence:RefSeq:NP_010577.3"
                     /note="ancestral locus Anc_5.301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140101.1"
                     /db_xref="GeneID:59326623"
                     /translation="MEDRSSSAKRVKKETELVEFDRLRSFFFRLNTIYTFLSCRKHVV
                     PTFETLRKPIEASLKWSISELDFAKIVALLPRDCVFKYIDENQIITETKVFDFNNGGY
                     QQKDNDIFKLKDVEDEFRDGRSTQILLFEFVDGVMRYSWVNGDRKRQVKMPEYSAEEM
                     KKMISKRKVAFENTVDKFIAEQKSRGADPMEVLIKMAQGYLPKKKEYEDPIEAMMKSK
                     ETKDEKLVVDEETGMGRPTIEGMLKSLQKSEMYNNQIKEHFVIPEKTATFKELDFNLS
                     PEVYQALEHERFYTHQAEAINAIHNGENAIITTSTSSGKSLIYQLSAIDLLLKDPEST
                     FMYIFPTKALAQDQKRSFVALASRIPELSGIVVDTYDGDTEADKRVFIRKNARIIFTN
                     PDMIHASLLPNHPNWRHFLYHLKLVVVDELHTYKGLFGSHVALVMRRLLRLCRYFYQN
                     DKVQFISCSATLKQPVDHAKRMFGIEDVHLIHEDGSPQGVKHLVIWNPPTLSQHLRKR
                     ENFIQESAKILVQLIVKNVRTIAFCFVRRVCELLMKEVRRIVEEMGREDLLTEVMSYR
                     GGYSASDRRKIEREMFHGNLRAVISTNALELGIDIGGLDCVLMCGFPVSMANFHQQSG
                     RAGRRNKDSLTLVVASDAPLDQHYVAHPQILLDSTNPDSYQELILDFDNVLILEGHIQ
                     CAAFELPIKIDRDKEYFKEQHLTKICRERLNYNSDGYHTHNRFLPWPAKLVSLRGGEE
                     DQFAVIDITNGRNKVIEEVETSRTSFTLYDGGIFIHQGCPYLVKEFNPDERYATVQRV
                     NVDWVTSQRDFTDVDPEEIELIKSFETSDTPVYFGKIRITIIVFGFFKIDKYKRIMDA
                     VETHNPPVIIDAKGLWIDIPRQALELCEAKKLSLAGGIHSAQHGIMGQLPRFVVAGAD
                     EIQTECKAPEKEFAERQTKRKRPARLIFYDSNGGQYGSGLSMKAFEHIDDLMLGTIQR
                     LEDCPCEDGCPECVLAGHCKENNFVFSKRAALILLHCIMGHEVSSFADRIPDGPEAGM
                     PEIKVETVVPVSSHVNFAPDFQIIDVRSIDNGLNKDEKMVKSEDDS"
     gene            <604672..>605742
                     /locus_tag="HG536_0E03390"
                     /db_xref="GeneID:59326624"
     mRNA            <604672..>605742
                     /locus_tag="HG536_0E03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284206.1"
                     /db_xref="GeneID:59326624"
     CDS             604672..605742
                     /locus_tag="HG536_0E03390"
                     /inference="similar to AA sequence:RefSeq:NP_010575.1"
                     /note="ancestral locus Anc_5.300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140102.1"
                     /db_xref="GeneID:59326624"
                     /translation="MSFSSEQFVSKLGSLEDSQESIAGASKWLLSQYREATQVAECWR
                     DYMKKKSVNTRRKLLGIYLANHVVQQAKGRKIGQFQEAFDKVAAEVIREVYPDLPRDL
                     KKKVKRVADIWTERGIFSAQVLKEIQATFKSEGSTVSEEAVPLELRKLVSSWGDLSKV
                     EQYKQTMRARFDKAAESLDPSSVVYEENLKTVTRIGQSSKDATSQAIKMREARISALQ
                     ELLREEEKVLDEERSGMSEIDIILQSKNPRDSNQASEDQDLLPTYETGNDGDDDEDSS
                     DNDSSDESKDGISTAKRQSEETTIDGLAIKRSKIASEDAIEIPQEGYEPQNQSTGQTA
                     EEYEGSPVVTSSIQDLLSKLAN"
     gene            complement(<605801..>606274)
                     /locus_tag="HG536_0E03400"
                     /db_xref="GeneID:59326625"
     mRNA            complement(<605801..>606274)
                     /locus_tag="HG536_0E03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284207.1"
                     /db_xref="GeneID:59326625"
     CDS             complement(605801..606274)
                     /locus_tag="HG536_0E03400"
                     /inference="similar to AA sequence:RefSeq:NP_011907.1"
                     /note="ancestral locus Anc_5.299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140103.1"
                     /db_xref="GeneID:59326625"
                     /translation="MCSITFSHYERRTVLIKNRLALVTTSAPNDVPKELMASDCCAGT
                     PESIDAILSGRLSNIWTQRQSIKGEAGETFETTSLLVRAINLFSYTGFKGLVIELHSA
                     ENATEEDFKKGVDVTRNILKELGMTDIKVSGEQLDPLQSDFISDLAYQYVRVLEF"
     gene            complement(<606659..>611599)
                     /locus_tag="HG536_0E03410"
                     /db_xref="GeneID:59326626"
     mRNA            complement(<606659..>611599)
                     /locus_tag="HG536_0E03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284208.1"
                     /db_xref="GeneID:59326626"
     CDS             complement(606659..611599)
                     /locus_tag="HG536_0E03410"
                     /inference="similar to AA sequence:RefSeq:NP_010569.3"
                     /note="ancestral locus Anc_5.298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140104.1"
                     /db_xref="GeneID:59326626"
                     /translation="MSRSHLTLDQYYEIQKNEIQAIESIYMGDFVDLTKKRSAWDKQP
                     QFIFEITLHSTEKEPAGCSLTLHICLTPLYPYSAPDISFKNVNNVMDRQLQTLKDGFR
                     TIHKESKGQEMIFDVTSFVQEKLDEFQHSANTQSLEDERLQRIKENKEKVKREEEEQQ
                     QQIQEQRLTEQKFIDEIVQKELEKRQDDDLYFEHNSSIDLLPPQEWISSGQAIVFNKV
                     IKAKLPNNSLYKFRAVVNPKPITLAADLFCFGQQYLVKPFIPPESALAEALMTSEMME
                     NFQYLLTEVKLNNAYFNTSSGKKEISNLEKELESVLKNSHDNVNRLLAYTVERMGHNS
                     STFVWNIKLLTQYSRSYAIGDIVDSVGFVNLATARVWMIRILEGLESLHKLGISHKCI
                     SLQTVNLVKDADFGTTIPKLMHPSYGFTILDMISRYPNNNGAQVEMPDCPWPAPELVK
                     FKNSKPQRMTDIWQAGVLLLQIINGVDTVLNYSSPQDFLDSMSMDDSLYDFLEKMLKP
                     DSKKRLSPLELLPMKFLRTNIDFALNKLSLGQNSSTSLSRKSFTGSLSVKSRTASQSS
                     GRRRSFNVGSRFSFTNPAARSRYASDFEEIAVLGEGAFGQVVKARNALDSRYYAIKKI
                     RHTEEKLSTILSEVMLLASLNHQYVVRYFAAWLEEDIDDSVFDEQDDESSENDDSDDD
                     LFNQSSLYRTNQSEVRENDWDFISGSGYPEIEFANSDDNQETSENDDANGFTSECSGS
                     DSSSDENDELEIPIKPSIQVNRRGSNKAKKRSTLFIQMEYCENRTLYDLINTENLSSQ
                     RDEYWRLFRQILEALSYIHSQGIIHRDLKPMNIFIDESRNIKIGDFGLAKNVHKSLDI
                     LRLDSQSQIGSAENLTSAIGTALYVATEVLSGNGQYNEKIDMYSLGVIFFEMIYPFST
                     GMERINILRNLRLSNIEFPADFDDTKFRTEKKIIKLLLDHNPMKRPGAQSLLDSGWLP
                     VKHQDETMKEALKSLADPSSPWQQRVRETLFLQGYSLTNDILYDNSQSSTTPFGQILR
                     SKMTEEVVKIFRKHGGVENNEPPRIFPKAPIYGIQNVYEVLDKGGTVLQLQYDLTYPM
                     ARYLSKNPNCVSKQFRLQHVYRPPNNTKSSLEPKKFGEIDFDIISGSSADSPYYEAES
                     IKIIDEILTVFPLFEKTNTLIVINHADILESVFNHTNIDKAQRPYVSRALSQVGFAKS
                     FKDIKRELKSQLNITSTSLDDLELFDFRLDFEAAKKRLHKAMMDSPFWGKVEASLLHI
                     SKVINFLKPLDVTRNVVIAPLSNYNSGFYKGGIMFQAVYDDGASRNLVAAGGRYDTLI
                     AYFSRPSGERSSNTQRAVGFNLAWETIFGIAQSYFKLAKGSKVKKRNRFLKGSAVDWK
                     PSRCDVFVSCFSNSILNTTGVEIISQLWKKGIRADFLRNCYTVDDVVSGAQRDGVEWI
                     ILIKQQTYTLPNHKRKYKPLKVKKIDTDVDVDVTLDEFFCLYQQGSNADGSTDAFLVS
                     ESMDDAKRWDDGSSGGSQNGEDVDHLTGPVKQKIVYVPNPATRSKKASKREKWVYEDD
                     ARTASNAIINSLTSAPVITVDVLRDETLEMISITSLAQKDEWLRKIIGTGSNSTPRSF
                     ATNIYNSLSKEASKGTKWAIVYCHKTGKSCVADLQR"
     gene            complement(<611968..>612837)
                     /locus_tag="HG536_0E03420"
                     /db_xref="GeneID:59326627"
     mRNA            complement(<611968..>612837)
                     /locus_tag="HG536_0E03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284209.1"
                     /db_xref="GeneID:59326627"
     CDS             complement(611968..612837)
                     /locus_tag="HG536_0E03420"
                     /inference="similar to AA sequence:RefSeq:NP_010570.1"
                     /note="ancestral locus Anc_5.297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140105.1"
                     /db_xref="GeneID:59326627"
                     /translation="MNVNRLTFSLSPSSFFNTSQKWRKGDLVVLLVAVILLYPVYYQE
                     PFERQFTINDLTLSHPFAKHERVSDTMLFVYSFVIPLIAIMLILAIFADPRHRMYLMY
                     ISILGLCLSVSLTTLFTNFIKNWIGRLRPDFLARCEPKKGLPIDTLFYASDVCTTKNR
                     ERLLDGFRTTPSGHSSQSFSGLGYFYLWFCGQMLTENQRISLWRKILAFIPLLGAALI
                     ALSRTQDYRHHFLDVILGSVLGYVIGRFIYSRYFPPISSPLPFKPLLDDSDVTLEVDV
                     QPAQGAEIEPLTA"
     gene            <613779..>616259
                     /locus_tag="HG536_0E03430"
                     /db_xref="GeneID:59326628"
     mRNA            <613779..>616259
                     /locus_tag="HG536_0E03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284210.1"
                     /db_xref="GeneID:59326628"
     CDS             613779..616259
                     /locus_tag="HG536_0E03430"
                     /inference="similar to AA sequence:RefSeq:NP_010571.1"
                     /note="ancestral locus Anc_5.296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140106.1"
                     /db_xref="GeneID:59326628"
                     /translation="MSNFFRDSSMGFKPRSNIFSKLRIKEAEVHVDDSLTDADSSLSE
                     DIPVQSSHGRSEHLSTTVVDDSGLQNTHAKFQLGCSTPKASKKPGTGKGESKDEFDLE
                     ITEVRDVLGRNNSNGKSGDDGFPDCSSAKMTGIHERTTIAGAKTKVEEAQCADTSSND
                     VLLEAFNNTQKICSNLKQELQRQQSENSKLKSQIHSYQVDNEKLSARFVDMKQLLTDL
                     SDKSAALFAQKGVTDANLEEIKGDYERLKKKVEKYRSDITELKVNLSGLQTMKSNSDA
                     ELSNRAKEIDYLKRELNDRSGQLSEEKLKNSSLIQEIGKTRDGLKEFFSRLFADGQVE
                     LSSRFDTIGADVITKIKPDLESFLKNYTEESEKILTANLSNLSASFHAALQQSDRESA
                     EILTVQLGKVQEQIANHTTKQIQSNQRNLLSKLGEKLASQDVHMEGELEKFYKEQQNL
                     MESNGQLLEQFQKLTRDFDCYRNQLRKCEEYESRLNEFQSQITSLNLQKGQALSSLGV
                     KEAQYEDLMKQVGLQNSELSKCKDLKNKLRAKVDSLVEDLGLMKSRCSNLAEENITLK
                     ANSENKIIVQGELLKGLQSENESLKQRNKQLDDMRKQFETDNTSHVDKTQRLNDHLQK
                     LNVEMVQIKAHELELEEANRKMKYQLEQDKTSYEEATDDFKRLRQRVIVLEGEKQDNV
                     REKIELQDKNDELRESIKILKQNLNKLQKLEPQIEKQDTQNIVHRQDNEEERRSEAIV
                     TPNQAAKKDCSIPEKPANENDEFDLSSSLNDDLELTNPSPIQVKPLKTKRGKSKSMKP
                     PNCSRKKLLLPDEDESTQLRHRWKKRRA"
     gene            complement(<616333..>616767)
                     /locus_tag="HG536_0E03440"
                     /db_xref="GeneID:59326629"
     mRNA            complement(<616333..>616767)
                     /locus_tag="HG536_0E03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284211.1"
                     /db_xref="GeneID:59326629"
     CDS             complement(616333..616767)
                     /locus_tag="HG536_0E03440"
                     /inference="similar to AA sequence:RefSeq:NP_010572.3"
                     /note="ancestral locus Anc_5.295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140107.1"
                     /db_xref="GeneID:59326629"
                     /translation="MNRGFRLPIQLNPHNQSADQATRQETLVDSQFMSLRSVRSLHSS
                     LRLYYSSDLKLTLFSKDNCGLCDKAKDVMGKVLKDNQELERKAVYTIVDIDDPANKDW
                     WEKYCFDIPVLHIEDSTRQGSLLKIFHRLDEKDVVDKINSFK"
     gene            <617273..>618163
                     /locus_tag="HG536_0E03450"
                     /db_xref="GeneID:59326630"
     mRNA            <617273..>618163
                     /locus_tag="HG536_0E03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284212.1"
                     /db_xref="GeneID:59326630"
     CDS             617273..618163
                     /locus_tag="HG536_0E03450"
                     /inference="similar to AA sequence:RefSeq:NP_010574.1"
                     /note="ancestral locus Anc_5.293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140108.1"
                     /db_xref="GeneID:59326630"
                     /translation="MSPRDELQGGTPNKTTLVAGKLVRFIMSVAESQNTTISRSRLQK
                     RAKEISEKEECGSVSFNEVLKEVNRMLGDIYGYELKNLPPRSVNLTGRQAATQDQSAS
                     KPQHYILLDNKRPMTNLDDLIFSQQVNNYMQMIQDGQYIGGRLNYETTHTLNNKLGCD
                     SDIALKGLLCIILCVVLFSKNHVLQQELCEHLESFGVATDGSNIPIVNLSFPELLRLF
                     EKQEYLIKEVERSGPELDVEIYRIGRRTQVEFPLESLVHLVMDLMSVTDEQAPGLRQD
                     IERNIADSYATTPDGANSNQ"
     gene            <618492..>620558
                     /locus_tag="HG536_0E03460"
                     /db_xref="GeneID:59326631"
     mRNA            <618492..>620558
                     /locus_tag="HG536_0E03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284213.1"
                     /db_xref="GeneID:59326631"
     CDS             618492..620558
                     /locus_tag="HG536_0E03460"
                     /inference="similar to AA sequence:RefSeq:NP_011908.1"
                     /note="ancestral locus Anc_5.292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140109.1"
                     /db_xref="GeneID:59326631"
                     /translation="MALGMDNTDLGVLCALVVAVAIYLKRNQLKELFASNDDSITASS
                     SGSRDVVQVLRENKKNYLVLFASQTGTAEDYAKKYAKELAAKFSLNVMCADIEQYDFD
                     NLNELPENVFMTLFISTYGEGDFPDGAVQFEDFLSNASEGDLSSLKFGLFGLGNSTYE
                     FYNGAAKKALDYLKSAGATLVGDFGQGDDGAGTTDEDYMTWKSNSFEVLKEKLNLDEH
                     EQEFEASFVLEKLGSVDDTVSLGEPSPHYLPSKKLVYNSEKLQVGPFDLSQPYVAPVI
                     RSYELFKDTDRNCIHTEFDMSGSNIKYSTGDHLAVWPSNANEKVEKFLKVFNLDPKMV
                     FNLKPLDPTIKVPFPTPTTVGAAVRHYLEICGPISRQVFGQLVQFAPNEEIKQKLSEL
                     STDRDQFAIEITAKYLDLADALLRLSDGKPWDSVPLEFLIETIPHLQPRYYSISSSSS
                     HEKQTVHITSVVENFPNPSEDMQGNVVGVTTNLLRNIQLAQNNELNKASLPVHYDLNG
                     PRNLFAGYKLPVHVRRSTFRLPSNPATPVIMFGPGTGVAPFRGFIRERVKFLETQENV
                     TLGKHILFYGSRNTDDFLYQDEWPEYAKKLGGAFEMIVAHSRLPNSKKVYVQDKLLER
                     EDDIFDLINIGAFIYVCGDAKGMAQGVHAALVDILTRKKSIKKEDATEIIKMMKTTGR
                     YQEDVW"
     gene            <620929..>622152
                     /locus_tag="HG536_0E03470"
                     /db_xref="GeneID:59326632"
     mRNA            <620929..>622152
                     /locus_tag="HG536_0E03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284214.1"
                     /db_xref="GeneID:59326632"
     CDS             620929..622152
                     /locus_tag="HG536_0E03470"
                     /inference="similar to AA sequence:RefSeq:NP_010568.3"
                     /note="ancestral locus Anc_5.291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140110.1"
                     /db_xref="GeneID:59326632"
                     /translation="MLLSRFHLPKSASLPAWRRNVQVTTRCLSRDSFFPREKEVKKSE
                     LNLRTMKPPSGTQDSSRYLRRTFAPKYQRSRSTIEDELEHVLTGSLTVKPCTTVSTGE
                     RYDFEKCIQLLHSKGLRAVSLIPNEILSFRYQANGYRGDVMILIQNGTIVNWGFDETF
                     VSQNILHLVEDARINPLPHESFETEDMDFVEVESVEQYEGIQTSVSQTSDIATTLAKY
                     AGTSFLAGDLIVINSTDSDSGMLDKAAFSSGLARSTNLAVLEKALEAHISQTRIITEK
                     ISKGMKLKLGEGEALKLIGRLFLIRGKLNLYSELIETPDLYWSEPQLERTFKQTSKYL
                     DIGPRISILNTKLDYSTDECRALMSVLSERKSTFLEWIIIYLITFEIVFELYHFYERY
                     CVDSHKFANKDDTVA"
     gene            <622646..>623104
                     /locus_tag="HG536_0E03480"
                     /db_xref="GeneID:59326633"
     mRNA            <622646..>623104
                     /locus_tag="HG536_0E03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284215.1"
                     /db_xref="GeneID:59326633"
     CDS             622646..623104
                     /locus_tag="HG536_0E03480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140111.1"
                     /db_xref="GeneID:59326633"
                     /translation="MVSDNYPLVHQTKSSELSANMQSLQWSILSKAIEFFCFWFIVII
                     IVYGFATAVLLYSRNEEAIRRIKESMDSGSNAVNSSNQHTLCDGELYPTIRLSGGHEC
                     HYLMKVDHNSLTAQQTELRPAKIAYAVEEQLSMRPGKRSDIVEDAPDISN"
     gene            complement(<623145..>624062)
                     /locus_tag="HG536_0E03490"
                     /db_xref="GeneID:59326634"
     mRNA            complement(<623145..>624062)
                     /locus_tag="HG536_0E03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284216.1"
                     /db_xref="GeneID:59326634"
     CDS             complement(623145..624062)
                     /locus_tag="HG536_0E03490"
                     /inference="similar to AA sequence:RefSeq:NP_010566.1"
                     /note="ancestral locus Anc_5.289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140112.1"
                     /db_xref="GeneID:59326634"
                     /translation="MAKDIEVSTSEAKFTLEALRQNCRLDGRAFEEFRDVEISFGKEY
                     GDATVKMGNTIVQCRISCQITQPYEDRPLEGLFLISTENSPMAGPQFENGNNTGEDEV
                     LCARIIEKAVRRSGALDVEGLCIVAGSKCWAVRADVHFLDCDGGFIDASCLAVMTALL
                     HFRKPDISVLGDKVTVHPFDEREPVPLGILHIPICVTFSFFNPQDTEENIKGESNAEI
                     AIIDATLKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALSLMENCHKAYAITERLT
                     DQILEAVKKDDERRNKFAKMLSAENARET"
     gene            complement(<624213..>625265)
                     /locus_tag="HG536_0E03500"
                     /db_xref="GeneID:59326635"
     mRNA            complement(<624213..>625265)
                     /locus_tag="HG536_0E03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284217.1"
                     /db_xref="GeneID:59326635"
     CDS             complement(624213..625265)
                     /locus_tag="HG536_0E03500"
                     /inference="similar to AA sequence:RefSeq:NP_010565.3"
                     /note="ancestral locus Anc_5.288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140113.1"
                     /db_xref="GeneID:59326635"
                     /translation="MTICEGAKDMLMILPASMASQQGPHSLFSLPHSSNNASKKRVTL
                     IEPKAGEIYELRRHQFSKGSSFNTQSDLAAEKYHYTANQEPLKSTFLTNEADRKDGRV
                     MEAGDIHFATRFDLSYCLIGYYYGDSTSQDEKEYEQDSEAESAVARGRMNCLTVRDYH
                     DHLVDNHDSQWANVSLESLEMALRKVAEPTEEAGSTFYKLTEGKIIEYLANKVTRLAQ
                     NLPKSLNISADLPADILECAKVTLAADLLVSLIPKHTYFRLKRFSPAAGAEHIADIKN
                     SCDRYETYKRSVKQSVEEKELLVKAAMTVGLPTGKTKTSVVKKVTKKSVVVRKQKGSI
                     DGFFKPAKRANPSANP"
     gene            <625732..>627402
                     /locus_tag="HG536_0E03510"
                     /db_xref="GeneID:59326636"
     mRNA            <625732..>627402
                     /locus_tag="HG536_0E03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284218.1"
                     /db_xref="GeneID:59326636"
     CDS             625732..627402
                     /locus_tag="HG536_0E03510"
                     /inference="similar to AA sequence:RefSeq:NP_011911.1"
                     /note="ancestral locus Anc_5.287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140114.1"
                     /db_xref="GeneID:59326636"
                     /translation="MDWLLWIKVLVTVALVVFGANWLFGVLYLNANRDFTSVALSQQS
                     NVGSVRKENETAHYRNFLVPLGFPLITGLSLSLKYKIRNGNFGDVWKAVMEVSNRNFV
                     QFTNDERRYSLDAINGMALHILKTQFPEDTKKIGIVVPPSSLQGFVIALASMMGSIKT
                     SCQPNFLSSVPRTRDDDLDVLVIESWSAYRMLNGSDRWYKLVVVLESGPLHDMPSNAK
                     TWEQLVEDYKEITVFDYVPPEDNSDDTKLWAYTTSAWNATTSFTQGCLVSGIASFVQN
                     FPTGHELSNKDHLTVVSRLGDSSSAIHLWHKAFAVLLHGGSLSFLSEALALSDLRDTS
                     LLFIESKDLMRILQQIKVSSSSIIKRVGFAWATTLLSEGVFSKLGQYSSPSVNNLRCV
                     FLAEFVRDAQLVSSFPRAMPKFKPGASKQLFTSEMLNFARAHLGARVVVELYCPSIIM
                     SPLCQTNFYDYRVLPASVTSKFFCYGPLATNLEGKMVRIEQNSEFDITKRQGLLCVRG
                     FAIGKPVEADRLKNAMHLSEEIGGGEGWMPLAGLYGIWGHDGCLYIYK"
     gene            complement(<627469..>628362)
                     /locus_tag="HG536_0E03520"
                     /db_xref="GeneID:59326637"
     mRNA            complement(<627469..>628362)
                     /locus_tag="HG536_0E03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284219.1"
                     /db_xref="GeneID:59326637"
     CDS             complement(627469..628362)
                     /locus_tag="HG536_0E03520"
                     /inference="similar to AA sequence:RefSeq:NP_011912.1"
                     /note="ancestral locus Anc_5.286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140115.1"
                     /db_xref="GeneID:59326637"
                     /translation="MNMTLDLFSIENFLSELAVTRVGPIIKSKSGTQQEYDLKTGARA
                     VDIVTAIDKQVESLIWETLKKEYPDFKFIGEESYVKGETVISDEPTFIVDPIDGTTNF
                     VHDFPFSCTSLGLTVNKEPVVGVIYNPHLNLLVSASKGNGIRLNGKLFDHESKIKSMG
                     PLALNKSVVALQPGSAREGSNFETKMATFQSLLACDGGFVHGFRNLGSSAMTMVYIAL
                     GNLDSYWDGGCYSWDVCAGWCIVKEMGGKIVGANPSEWSISVDNRTYLVVRGTNDPSG
                     KDQRKYIEDFWSNVKGQLKYD"
     gene            complement(<628574..>631165)
                     /locus_tag="HG536_0E03530"
                     /db_xref="GeneID:59326638"
     mRNA            complement(<628574..>631165)
                     /locus_tag="HG536_0E03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284220.1"
                     /db_xref="GeneID:59326638"
     CDS             complement(628574..631165)
                     /locus_tag="HG536_0E03530"
                     /inference="similar to AA sequence:RefSeq:NP_011913.1"
                     /note="ancestral locus Anc_5.285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140116.1"
                     /db_xref="GeneID:59326638"
                     /translation="MSSAAATAKREVLPTNVTPLHYDLRVEPNFETFKFDGAVKIELK
                     VNDRKVNTVQLNSIDIDIHSAKIGCHDATEISYDKDSQVSTFKFADEVLSESDRAVLE
                     IDFTGVLNDNMAGFYRAKYEDKATGETKYMATTQMEPTDARRAFPCFDEPNLKATYDI
                     SLVSDASLTHLSNMDVKSEEIIEGNKKLTRFNTTPKMSSYLVAFIVAELKYVENNDFR
                     IPVRVYATPGNEKHGQYAADLTAKTLDFFEKSFGIQYPLPKMDNVAVHEFSAGAMENW
                     GLVTYRVVDLLLDKENSTLDRIQRVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFAT
                     WMSWYSCNAFQPEWKVWEQYVTDTLQHALALDSLRSSHPIEVPVKRADEINQIFDAIS
                     YSKGASLLRMISKWLGEDVFVKGVSQYLSKFKYGNAKTEDLWDSLSEASGKDVRKVMD
                     IWTKKVGFPVISVKEDGNKITFTQNRYLSTGDVKKEEDETLYPVFLALATKDGVDNSL
                     VLSERSKTVELKDPSFFKANGAQAGIYITSYSDDRWTKLGKQADLLTVEDRTGLVADA
                     KALSASGYTSTTNFLNLIAQWNKENSFVVWDQIINSISSLKSTWIFEPQEVKDALDAF
                     TRELVGEKTHSLGWIFDSSDSFATQRLKVTMFGAAAGAKDEKVEKAALDMFAKYTAGD
                     KKAIPALIKPTVFNTVARAGGVEEYEKILDIYKNPVSNDEKLAALRTLGRFKNPELLQ
                     RTLSYLLDGTVLNQDIYIPMQGMRGHKEGIEALWKWTQANWDELVKRLPPGLSMLGSV
                     VVVATSGFTSSEAIKDIEKFFSGRSTKGFDQSLAQSLDTITSKAQWVTRDREVVNKYL
                     KDNGYYK"
     gene            <632076..>632792
                     /locus_tag="HG536_0E03540"
                     /db_xref="GeneID:59326639"
     mRNA            <632076..>632792
                     /locus_tag="HG536_0E03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284221.1"
                     /db_xref="GeneID:59326639"
     CDS             632076..632792
                     /locus_tag="HG536_0E03540"
                     /inference="similar to AA sequence:RefSeq:NP_011915.1"
                     /note="ancestral locus Anc_5.283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140117.1"
                     /db_xref="GeneID:59326639"
                     /translation="MTVTNPRLLFLHGFLQNAKVFSEKSSGIRKLLKKSNVECDYIDG
                     PVELEREDLPFELDDEKWQACLDTQVNKAWFYHSDVSSELNLDAAIKYVADYIKDNGP
                     YDGIVGFSQGAAVAAIVTNRIRELVPKHPDFKLSLLIASYSFTEPDPAHEGLLRIAEK
                     FQNDFKPRSHSRTRMLFIYGSADQAVPATRAQYLANLYKKALGPEQVKEFEHQGGHMV
                     PNKKDIIRPVVDEINEALAA"
     gene            <632987..>634537
                     /locus_tag="HG536_0E03550"
                     /db_xref="GeneID:59326640"
     mRNA            <632987..>634537
                     /locus_tag="HG536_0E03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284222.1"
                     /db_xref="GeneID:59326640"
     CDS             632987..634537
                     /locus_tag="HG536_0E03550"
                     /inference="similar to AA sequence:RefSeq:NP_011917.1"
                     /note="ancestral locus Anc_5.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140118.1"
                     /db_xref="GeneID:59326640"
                     /translation="MGNSLYQPLQERADDDLQAEEPGSKSPNRNLAILRMLKKYAQFI
                     GPGLMVSVSYMDPGNYSTAVAAGSAHRYKLLFSVLVSNFMAAFWQCLCARLGAVTGLD
                     LAQNCRKHLPHGLNVALYILAETAIIATDLAEVIGTAISLNILFGLPLALGVVLTVGD
                     VLIVLMAYRTNGSLKLVRCFEMFVAALVAATVVCFTIELFYADLGSAREVFSGFLPSR
                     AAIEGDGLYLSLAILGATVMPHSLFLGSGVVQPRLRDFDMKNGYYVPDEDDIDNNHEN
                     YRPSIAAIESTLSYTMAELLISLFTVALFVNCAILIVSGATLYGATDTTGSGEADLFS
                     IYNLLSQSLSKTAGTIFVLALLFSGQSAGIVCTLSGQMVSEGFLNWTISPSIRRSATR
                     AVAITPCLILVLVAGRNGLSGALNASQVVLSLLLPFVSAPLLYFTSSSKIMSARITPD
                     NDNYELQDLSEAEPQRPAEHEQEVVRYKDMSNGIVTKVLALLTWLVISGLNFYMLISF
                     SSGQDVHL"
     gene            <634612..>635205
                     /locus_tag="HG536_0E03560"
                     /db_xref="GeneID:59326641"
     mRNA            <634612..>635205
                     /locus_tag="HG536_0E03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284223.1"
                     /db_xref="GeneID:59326641"
     CDS             634612..635205
                     /locus_tag="HG536_0E03560"
                     /inference="similar to AA sequence:RefSeq:NP_012763.1"
                     /note="ancestral locus Anc_5.281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140119.1"
                     /db_xref="GeneID:59326641"
                     /translation="MAGVTNTIIVTSNADNVLDKTEPLKRWLSDKVLTNIPITSRNPV
                     EMVVLRDFQRVMIISPTREASQEILRALQNGGTPFCLAYAYSQTDTCDRDSPDYLTVP
                     KSEKMFLISPPSSPPPEFDYARCEQPPPPSHVQGLPHAEGSEFLTLLDNKIASIALQL
                     CDTEQPPGPRTSSYRRTARPPQSSRPPGGPSDLRPPL"
     gene            <635415..>635882
                     /locus_tag="HG536_0E03570"
                     /db_xref="GeneID:59326642"
     mRNA            <635415..>635882
                     /locus_tag="HG536_0E03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284224.1"
                     /db_xref="GeneID:59326642"
     CDS             635415..635882
                     /locus_tag="HG536_0E03570"
                     /inference="similar to AA sequence:RefSeq:NP_011918.1"
                     /note="ancestral locus Anc_5.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140120.1"
                     /db_xref="GeneID:59326642"
                     /translation="MISRVVFKSLSRSVVSRSALTSSVARPCVQPLRLTSFGQIRKYS
                     SEHDEETFEEFTARFEKEFEEAYDLFEVQRVLNNCFSYDLVPAPVVIEKALRAARRVN
                     DLPTAIRVFEALRYKVENDGQYNAYLDELSDVRKELGIPLKEELFKPSADASH"
     gene            complement(<635974..>636417)
                     /locus_tag="HG536_0E03580"
                     /db_xref="GeneID:59326643"
     mRNA            complement(<635974..>636417)
                     /locus_tag="HG536_0E03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284225.1"
                     /db_xref="GeneID:59326643"
     CDS             complement(635974..636417)
                     /locus_tag="HG536_0E03580"
                     /inference="similar to AA sequence:RefSeq:NP_012762.1"
                     /note="ancestral locus Anc_5.279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140121.1"
                     /db_xref="GeneID:59326643"
                     /translation="MGKRKKSTRTPAKKVVLKLDTMFNCLFCNHDKSVSCTLDKKNSI
                     GSLQCKICGQSFQTRINGLSQAVDVYSDWFDAVEEVNSGRGSESEDADDDSASDYESD
                     SDAEARKRATVVDSDEEELDDEDSSGARRTARAVVDSDEDDDDDE"
     gene            <636646..>637800
                     /locus_tag="HG536_0E03590"
                     /db_xref="GeneID:59326644"
     mRNA            <636646..>637800
                     /locus_tag="HG536_0E03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284226.1"
                     /db_xref="GeneID:59326644"
     CDS             636646..637800
                     /locus_tag="HG536_0E03590"
                     /inference="similar to AA sequence:RefSeq:NP_011919.1"
                     /note="ancestral locus Anc_5.278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140122.1"
                     /db_xref="GeneID:59326644"
                     /translation="MGKKSRSNSKKSTPVASPAGTPAGTPTKKLKAKQKTKSLLKKAV
                     PSLTSVPRERILNSVQQLRKFQDASKNSDSRNLLDDSEELNESIQLIVVNNTSFSGSE
                     KNFKLKLIDVKHSLYRPWNEASETSVKDFKVLLILKDSDVSKVSVDDFVLSGDERDVP
                     VELICGRDLKTKYKAYEARRAFISEFSLILADDNVVTTLPKLLGGKAYSKLETTPIGV
                     RAYANKQFSKKTLINSFLKVYSSRLPVKIPRGTTANVHLGKLQWFKDEELVDNIEQVL
                     KTFLDGYKIRSVFVKCNDSPVLPLYYNQKVLEEISATKDVAANGAAEKQLVEIGGVPV
                     ELSTFDKALLEIANPDEVQDIFAKNINAAKRKKSPEEEEPESNVVKKAKN"
     gene            <638007..>639146
                     /locus_tag="HG536_0E03600"
                     /db_xref="GeneID:59326645"
     mRNA            <638007..>639146
                     /locus_tag="HG536_0E03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284227.1"
                     /db_xref="GeneID:59326645"
     CDS             638007..639146
                     /locus_tag="HG536_0E03600"
                     /note="ancestral locus Anc_5.277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140123.1"
                     /db_xref="GeneID:59326645"
                     /translation="MTQVAASKIESCLPIRTKGTIRRGLVKMLMNLDDIMKSFKSRVD
                     RLAQDWEAINSSPTHLGANEDELKLFKMKLDMVQEQNAAIMIDLDYIKKILALDEYSP
                     SNPFTLLSTNSDNLHIPTTPATELQRPPSTPQSEPTPRRHRNFASTRSSFFAHNQLAG
                     LPTQHPGPNVNAIDDLSIATNLEGELRAFRKPLVMPTTAVNVPLESQISEELVQNVEM
                     TIPTYEDLHPQDESVSPRDTSQQIITGKFHNSIVKDGAMANLGAPESHEAEHYDLKVI
                     DNPSSVAEVYHEYTTSLKAQIEEFERLFGKGQLSKLPKIRTYQRRRALVTEIDKYATT
                     YDKSTHEAIEFFEKVRKSKKRTVPGLYNNLGKILKELERSEFNND"
     gene            complement(<639216..>641015)
                     /locus_tag="HG536_0E03610"
                     /db_xref="GeneID:59326646"
     mRNA            complement(<639216..>641015)
                     /locus_tag="HG536_0E03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284228.1"
                     /db_xref="GeneID:59326646"
     CDS             complement(639216..641015)
                     /locus_tag="HG536_0E03610"
                     /inference="similar to AA sequence:RefSeq:NP_011897.1"
                     /note="ancestral locus Anc_5.276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140124.1"
                     /db_xref="GeneID:59326646"
                     /translation="MTNQFTHSSMGDRRSSIVYSTSVGKAGLYTPADYIASEVNEVLG
                     EEGEEEGEEDDGSGLRNYNEHNEGEYQSLLDANNARTLQREAQQLLEEERDLLVDNKL
                     LKESRKAAGNGTRYNSVEDSAEIIDTWEQAIENGKAISTSYNREVQVLGVNALPLIFT
                     FILQNSLSLASIFSVSHLGTEELGGVTLGSMTANITGLAAIQGLCTCLDTLCSQAYGA
                     KNYHLVGVLIQRCAVITMLSFLPIMYIWLFWSETILSWMIPERQLCELAARYLRVAAF
                     GVPGFVLFECGKRFLQCQGIFHASTIVLFFCAPLNAIMNYVLVWDKRFGVGYLGAPLS
                     VAINYWLMAFGLFLYTIFTKQDIRPLKCWNGLIKPNQVFKNWKKMLSLALPGILMVET
                     EFLGFEILTVFASHLGSTSLGAQSIVSTVASLAYQVPFSISVSTSTRVANFIGASLYK
                     SCIITCKVSLLLSFACSSFNMLLIFNFRTQIAKMFSTEPDVVDLVISALPVLAFMQLF
                     DAFNASTAGCLRGQGRQKIGGYINMIAFYCIGLPMAYLLTFRFNMNVSGLWLGITCAL
                     IMMSVCQGFAVFHCDWLEIIRAARSRNTETARV"
     gene            <641274..>643307
                     /locus_tag="HG536_0E03620"
                     /db_xref="GeneID:59326647"
     mRNA            <641274..>643307
                     /locus_tag="HG536_0E03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284229.1"
                     /db_xref="GeneID:59326647"
     CDS             641274..643307
                     /locus_tag="HG536_0E03620"
                     /inference="similar to AA sequence:RefSeq:NP_011896.1"
                     /note="ancestral locus Anc_5.275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140125.1"
                     /db_xref="GeneID:59326647"
                     /translation="MLGGGNDGTRGKPVLRQKTLNSFFIAAKKTEARVPPSAVATNAS
                     LPPKVTKSDSLCSISRKSALFDSQGSFDESDLDSELKKLINPPKLNNLKKGPVLKRAP
                     LQKSESFLGTSQGEWDVGSQMTSSLSSSTSSFSSEDGGTGSLKRSLPPRPLQGLKLNA
                     SKRIRPLTRKLSNVGKAEATISLTEEQQTVLDLVLKRRASVFYTGCAGTGKSIILRTL
                     IAKLHGLYGKEAIAITASTGLAAATIGGTTLHKWSGVGIGTGTGDQLVKRLEKQHNQL
                     AVWRNTRVLIIDEVSMIDGHLLDKLELVARRLRKNEKPFGGIQLVLTGDFFQLPPVQK
                     RDSQQGEMAVFCFESEMWKTCIHRTILLTKVFRQQDDELVCMLNAIRFGEVTPQLTQT
                     IRYLSRAVSYPDGIAPTELYATRREVESSNARQLASLPGEAYRFHAVDAAPKEYVTLL
                     DSSLMVEKIVTLKVDAQVMMLKNKPESELFNGSLGKVLFFITERLERVMKEFYRLVDD
                     DVILDMRIVSRAIGNPLIMESLDFKQDLNSRPMSRLPALETMINHAKKTSSKEPVYPY
                     VRWSLDNNNRFHHELMLPERFPVDLPGAKTGLERNQLPLMLCWALSIHKAQGQTIQRL
                     RVDLRNIFEAGQVYVALSRAVSKDTLQVLNFNPKRIRANEKVKEFYRNLEVLS"
     gene            <643582..>645033
                     /locus_tag="HG536_0E03630"
                     /db_xref="GeneID:59326648"
     mRNA            <643582..>645033
                     /locus_tag="HG536_0E03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284230.1"
                     /db_xref="GeneID:59326648"
     CDS             643582..645033
                     /locus_tag="HG536_0E03630"
                     /inference="similar to AA sequence:RefSeq:NP_011895.1"
                     /note="ancestral locus Anc_5.274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140126.1"
                     /db_xref="GeneID:59326648"
                     /translation="MSDKIERHTFKVFNQDFTVDKRFQLIKEIGHGAYGVVCSARFTE
                     AAEETTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGQFA
                     GLYLYEELMECDMHQIIKSEQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLL
                     VNADCQLKICDFGLARGYSENPEENNQFLTEYVATRWYRAPEIMLSYQGYTRAIDVWS
                     TGCILAEFLGGKPIFKGKDYVNQLNRILQVLGTPPDETLRRIGSKNVQDYIHQLGFIP
                     KVPFADIFPQANSQALDLLERMLAFDPLRRITVEEALEHPYLSIWHDPADEPVCSEKF
                     EFSFESINEMEELKQMVMQEVQDFRHYVRQPLLEEQERQQQRQDKRGQQAQQQSSPVR
                     SEIVSDGDFTSHMVEAAGQYSQIQDSFVGIDSRDLPDHGTDFPPRPQENLLASPIALK
                     SNRDGTTPSASQSGYGEFLDLEKELEFGLDRKF"
     gene            <645236..>646117
                     /locus_tag="HG536_0E03640"
                     /db_xref="GeneID:59326649"
     mRNA            <645236..>646117
                     /locus_tag="HG536_0E03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284231.1"
                     /db_xref="GeneID:59326649"
     CDS             645236..646117
                     /locus_tag="HG536_0E03640"
                     /inference="similar to AA sequence:RefSeq:NP_011894.1"
                     /note="ancestral locus Anc_5.273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140127.1"
                     /db_xref="GeneID:59326649"
                     /translation="MALKLPFLQVDVFTSSPFKGNPVAVVNCMGIDESLVSDQQLQAI
                     ANWTNLSETTFLFKATTDRCDYKLRIFTPTMELPFAGHPTIGSCKAFLQFTGQKNAKS
                     LMQECQLGIVSLTISDEGKISFKAERADVEEIPQDAIDEYRKSLQIDCLAAPKLLQVG
                     PAWVVYLAADAESCYNANPDFAQMAATNTRYGHSGIILAGKKPGSSQDYEMRAFAPTD
                     CVLEDPVCGSGSIALIRYLQDLHRFSETTNVSITQGGRLKRQGQIFCQIKANGDGKFS
                     YISEGNAIIVIEGSINI"
     gene            <646728..>649229
                     /locus_tag="HG536_0E03650"
                     /db_xref="GeneID:59326650"
     mRNA            <646728..>649229
                     /locus_tag="HG536_0E03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284232.1"
                     /db_xref="GeneID:59326650"
     CDS             646728..649229
                     /locus_tag="HG536_0E03650"
                     /inference="similar to AA sequence:RefSeq:NP_011893.1"
                     /note="ancestral locus Anc_5.272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140128.1"
                     /db_xref="GeneID:59326650"
                     /translation="METNDENREDRDVERIPDETFRHRNGNKWERLLKPGVILVLLVW
                     GSVLLAKTISNLERCNNNGEDVDSGYRVPNSSHTEDGSLKVSLRNVRNGTFVPSLKSL
                     QWISTPDSHVADKGLFSTVSNETHVVRSVFDEGFSQVLLEGNSFKFEGESYKVDLLVT
                     SPDLTRLLIRTETVSNWRHSTFGSYFVYNNATSQFDKIGDNLSLAIWSPNSVDIAYVQ
                     DNDIYIYSCKDRRTVRRVTDDGSSQVFNGRPDWVYEEEVLEDDRALWWSPKGDYFAFY
                     KIDETAVGEFVIPYYVQSDEDVYSQLRSIKYPKSGTPNPKVGLWIYDLKDGYAYSVDL
                     GYDEKDPESSLLVTEVTWVGESKLITKTTDRSSDTLTVFFVNVSTRSSEQVRKTSSDG
                     GWWEITHNTLYVPQNVSSGRHSDGYVDVMPINGFNHLVYFSPANDTEPRALTEGKWEV
                     VNGPAAFDYEMNIVYFFGTKKSSTERHLYAVNLAEPKKLIEVTDTSKSGVYDASFSAG
                     GRFALITYKGPGIPYQKIVDLRSLKTDKVVAGNVIGKTLYYLEKNQELKEVLRKYAVP
                     CKKFQELNLGADDNGDDVVVNSYEILPNDFNETKKDYYPVFFYAYGGPNSQQVLQNFA
                     IGFNEVIASQLDAIVVVVDGRGTGLKGTHFRSLVRDRLGDYEARDQISAAAQYGARSY
                     VDADKISLFGWSYGGYLTLKTLEKDAGTHFKYGMAVAPVTDWRFYDSVYTERYMHTPQ
                     ENPEGYEMASVANVTAIAHAKRFLLMHGTGDDNVHFQNSLKFLDLLDLHSVENYDVQV
                     FPDSDHSIRYHNANTIVYDKLLSWAKLAYTGQFID"
     gene            <649455..>652361
                     /locus_tag="HG536_0E03660"
                     /db_xref="GeneID:59326651"
     mRNA            <649455..>652361
                     /locus_tag="HG536_0E03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284233.1"
                     /db_xref="GeneID:59326651"
     CDS             649455..652361
                     /locus_tag="HG536_0E03660"
                     /inference="similar to AA sequence:RefSeq:NP_011892.1"
                     /note="ancestral locus Anc_5.271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140129.1"
                     /db_xref="GeneID:59326651"
                     /translation="MVEEADRREEEAHEQVAHLSKEEKPRKDNNKEEEEQLSDEDLKL
                     KTNLEQLVEKLKGDDKSLYEPSLNELKESIKSSTSSMTAVPKPLKFLRPFYPSLCGLY
                     DKWSDGALKASLAEVLSVLAMTYSDNEKHDSLRYALLAGAKNIESWGHEYIRHLALEI
                     GEVYNDQMEKDGSTKENSEELEGESSKWTSQKFSKGEILDLSLEIVPYFMKHNGETDA
                     VDLLLEIEAINKLPQFTDENTYERVCQYMVACVPLLPPPEDVTFLQTAYSIYLRENQL
                     TEALCLAIRLGDESLVRAVFDATSDAVVHKQLAYILSFQKSSFEYESVQDIIGNTKLS
                     EHFLYLAKELNLTVPKVPEDIYKSHLDSSKSVFSGTGLDSAQQNLAAAFVNGYINLGY
                     CNDKMIVDNDNWIYKTKGGGMTSAVASIGSIFQWNLDGLQQLDKYLYLEEPEVKAGAL
                     LGIGISACGVHDGDVEPALLLLQDYVTNSNTSISSAAILGLGIAFAGSRNEEVLGLLL
                     PIAADTSLPLETSAIASLALAHIFVGTCNGDITASIMDNFLERSSGDLKAEWVRFLTL
                     ALGIVYMGQGEQVDDVLETISAIEHPMTSAIEVLVSASAYAGTGDVLLIQDLLHRLTP
                     KASKKENAEDAEEEDETAQANAISDFLNDQTNAEEKKTPADHDMQADSGEEGANEEVK
                     KTEETEEATEGEEAGDDADEKNRVIADEASYAVLGIAMIALGEDIGKEMSLRHFSHLM
                     HYGNEQIRSMVPLAMGLVSVADPQMKVFDSLSRYSHDADLNVSMNSIFAMGLCGAGTN
                     NARLAQLLRQLASYYSREQDALFITRIAQGLVHMGKGTMTLDMFNDASVLNKVALASL
                     LTVLVGLVSPSFMLEHHQLFYMMNSAVRPKFILTLNEEGEPIKVNVRVGQAVDTVGQA
                     GKPKTITGWITQSTPVLLNHGERAELETDEYISYTSHIEGVVILRKNPDYEKEE"
     gene            complement(<652506..>653150)
                     /locus_tag="HG536_0E03670"
                     /db_xref="GeneID:59326652"
     mRNA            complement(<652506..>653150)
                     /locus_tag="HG536_0E03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284234.1"
                     /db_xref="GeneID:59326652"
     CDS             complement(652506..653150)
                     /locus_tag="HG536_0E03670"
                     /inference="similar to AA sequence:RefSeq:NP_011891.1"
                     /note="ancestral locus Anc_5.270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140130.1"
                     /db_xref="GeneID:59326652"
                     /translation="MVVLKESKDDSLVGKFSFWKFVNWLILTVVLIYVFYKVFTGHGT
                     DINIGKFLARSSPYMWANLGIGFCIGLSVVGAAWGIFITGSSIIGAGVRAPRITTKNL
                     ISIIFCEVVAIYGLIIAIVFSSKLTVASSETLLSKSNLYTGYSLFWAGITVGVSNLIC
                     GVAVGITGATAAVSDAADSSLFVKILVIEIFGSILGLLGLIVGLLMAAKAGDFQ"
     gene            complement(<653414..>654487)
                     /locus_tag="HG536_0E03680"
                     /db_xref="GeneID:59326653"
     mRNA            complement(<653414..>654487)
                     /locus_tag="HG536_0E03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284235.1"
                     /db_xref="GeneID:59326653"
     CDS             complement(653414..654487)
                     /locus_tag="HG536_0E03680"
                     /inference="similar to AA sequence:RefSeq:NP_011890.1"
                     /note="ancestral locus Anc_5.269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140131.1"
                     /db_xref="GeneID:59326653"
                     /translation="MTRSFKITVPASSANIGPGYDVLGIGLSLFLELEVSIDPKQAHE
                     TNEDANNCKLSYTPESEGYDSVPLQSDANLITRTALYVLRCNNIRSFPCGTKVRVHNP
                     IPLGRGLGSSGAAVVAGVMLGCEVGKLNYSKQRMLDYCLMIERHPDNITAAMMGGFCG
                     SFLRDLTPQEVERREIPLSEVLPEPSGGEDTGLIPPLPPTDIGRHVKYQWNPKIKCIA
                     IIPAFELSTADSRGVLPKAYTTPDVVFNLQRLAVLTTALTMDPPNPDLIYPAMQDRVH
                     QPYRKTLIPGLTEILSSVTPSTYPGLLGICLSGAGPTILAVATENFEDIALEIINRFA
                     KKNVQCAWKLLDPAYDGATVEEL"
     gene            <654922..>656373
                     /locus_tag="HG536_0E03690"
                     /db_xref="GeneID:59326654"
     mRNA            <654922..>656373
                     /locus_tag="HG536_0E03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284236.1"
                     /db_xref="GeneID:59326654"
     CDS             654922..656373
                     /locus_tag="HG536_0E03690"
                     /inference="similar to AA sequence:RefSeq:NP_011889.1"
                     /note="ancestral locus Anc_5.268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140132.1"
                     /db_xref="GeneID:59326654"
                     /translation="MLRNATKRAFSKLSSSTFQLSKLPNGLKVATSGEPGHFSALGLY
                     VGAGSRFESRNCKGCTHILDRLAFKSTKNIDGRTFAETLELLGGNYQCTSSRETMMYQ
                     ASVFNQDVEKMLNLMCETVRYPKITQEELAEQKLTAQYEIDEIWLKPELALPELLHTT
                     AYSGETLGSPLICPRELVPSISRYYLMDYKNKLYTPANTVAAFVGVPHDLAVQYAEKY
                     FGDWESSHPPRNHVPSIYTGGETCIPPGPVFGNLPELAHIQIGFEGLPIDHPDIYALA
                     TLQTLLGGGGSFSAGGPGKGMYSRLYTHVLNQYYFIENCVAFNHSYSDSGIFGISVSC
                     IPQAASEAVRVALEQFTNTFANEKLRLTEEEVSRAKNQLKSSLLMNLESKLVELEDMG
                     RQVQLHGRKVPIQEMIANVEKLTPQDISRVAETVFTGKVNNNPASSGKATIVMQGQRE
                     LFGDVQAQLTEFGLGNSTRLSDTKSTIKKSRWF"
     gene            complement(<656568..>662117)
                     /locus_tag="HG536_0E03700"
                     /db_xref="GeneID:59326655"
     mRNA            complement(<656568..>662117)
                     /locus_tag="HG536_0E03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284237.1"
                     /db_xref="GeneID:59326655"
     CDS             complement(656568..662117)
                     /locus_tag="HG536_0E03700"
                     /inference="similar to AA sequence:RefSeq:NP_011888.1"
                     /note="ancestral locus Anc_5.267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140133.1"
                     /db_xref="GeneID:59326655"
                     /translation="MANRDQETVVWVPDEAKIFIRGTLLRTKIVKDKGNRDKQVGVVR
                     LLETNEEKEYAILDVSPVNPPTFDKVDDMSELTHLNEASVLYNLENRYREDMIYTYSG
                     LFLVAINPYCNLKLYSQEYINLYHGSPREDNKPHIFAIAEEAYQRLLSDKRDQSILVT
                     GESGAGKTENTKKILQYLASITSEDKLISSGSESFELKILQSNPILESFGNSQTVRNN
                     NSSRFGKFIKIEFDERGKINGAHIEWYLLEKSRIVHQNPLERNYHIFYQLLSGLSSQE
                     LRKLELDSRSITEYRYLRNSNASIPGVDDSQNLQELLTAFKIVGFDNDEVFEIFKIIS
                     IILHIGNVEFVSEKTEQASIKNDLTRLCKLLGVSEADLKAAILKPKSKAGKEWVSQSK
                     NAAQARFILNSLSRSLYEKLFASIVARINRSLDHGSMTANFIGLLDIAGFEIFNFNSF
                     EQLCINYTNERLQQFFNHYMFVLEQNEYLKENIQWDYIDYGKDLQSTINLIEQRGPVT
                     GILPLLDEESILPKSTDETFFSKLMSTWDQNSSKFKRSKNPACFVLTHYAGDVEYNID
                     GWLSKNKDPISDNLLNVLKASSNQLVKAFFDDAQNKRGGSFRTSSARHREQLNSLLDQ
                     LSSTQPHFARCIIPNNKKKSKDFDRRLILEQLRCNGVLEGIRIAREGYPNRIFFKEFF
                     QRYKLLSNDFAISNNSKKNCEFLLSSLHLDPSIYKVGSTKLFFKAGVLAELETKKEKI
                     IDQILVKLTSQVRAYQVRNGTERKLKQLTAARVLGNSFRIYNKLLENPWYNLYLKIKP
                     LLSSCQDIAKTKRIAEQVKTLEAKVQEIEGERDYFKNQNVSKSKELEELHVLLTTEKK
                     NLEAQLRQLTEAKDRYISLQGKLEEADEQIKKYEEEKAEMQKLHEIAISEVSRIKRMS
                     DEDEAKLNQLQEDKRSLQTRVKELERTIAEKEQIITALSEAKQKLDRDVDQLKNVESA
                     KQDEINNLKQKLNNSEQNLDSKLATLEKNCNAAMGRLQALVSENNDLRQRLNVLEKEK
                     QGASRDLKARESDLHRLESKVKSLQEELNTISSRRDYTVAEHAKVVSELKSTRAHASS
                     LKITIQELEKKCEQLQKQSTDVKVQGEKNGNENTAIKDLKRRLAEEISLNRYLNQKIS
                     THVTDGRISKETENGPILSHDSQNENLIRNEDLRIHLKQLNRKLDEAIEEKKDLLSRL
                     RFTETRLASSSFDSQIAHSQVKTLKKIIWDAKLPVNLEAELGQLKPSEINTEKLLLEV
                     DHLKRQLELETKSRYDAENVAAALHSKFTQIQRSESSHDIYRLKYEASEERAKSLENR
                     LRSFPLRDKTNTSGDIFINRESVSKYADEVRFHKLENYKLQEILADTEKKLAALNREA
                     KQSSAKESLLSEQIERLQKDLEATERQNELMTVTVKQQKHQYESCLNDLHINEARSRE
                     YLHNLQEAEADVQNMAEVIEKLKIQIKQKDRQLWESDTERSNLDIQLQETLLELKKVQ
                     EINKVLNEDLRHLKERLAQEEDNSRYFDEIDNLKQQINLYMKSETDLKKEVAALKYDL
                     QTASNDCEAKISDLLSQINHYEKLVGKLSDAKNAADATEDGLSKELNAAKEHVRTITT
                     NLDVLSAQKSHLEQEIERLKQQYQSTSEALEKVSGEKSDLADRVKYLEETSRLYGEQD
                     KRNESLVKQLHSDVDTLKKYLKEEKQKNIDLYEENQSEVKKNSLLSSKIDDLTAQLAD
                     SSEKEAWLSRIHELETLVSSESELKYEEKKKTRNLERIIEELNRKSSSDAQNLEAAKE
                     GKKKTEEQLLQYVEQISMMERRIAQQELTLRKTVRDNTNLQEKIEDQEKESLYWRQKY
                     ESLAGAK"
     gene            <663405..>663963
                     /locus_tag="HG536_0E03710"
                     /db_xref="GeneID:59326656"
     mRNA            join(<663405..663407,663718..>663963)
                     /locus_tag="HG536_0E03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284238.1"
                     /db_xref="GeneID:59326656"
     CDS             join(663405..663407,663718..663963)
                     /locus_tag="HG536_0E03710"
                     /inference="similar to AA sequence:RefSeq:NP_011885.1"
                     /note="ancestral locus Anc_5.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140134.1"
                     /db_xref="GeneID:59326656"
                     /translation="MVLVQDLLHPTAASEARKHKLKTLVQSPRSYFLDVKCPGCLNIT
                     TVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK"
     gene            complement(<664143..>666254)
                     /locus_tag="HG536_0E03720"
                     /db_xref="GeneID:59326657"
     mRNA            complement(<664143..>666254)
                     /locus_tag="HG536_0E03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284239.1"
                     /db_xref="GeneID:59326657"
     CDS             complement(664143..666254)
                     /locus_tag="HG536_0E03720"
                     /inference="similar to AA sequence:RefSeq:NP_012767.1"
                     /note="ancestral locus Anc_5.264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140135.1"
                     /db_xref="GeneID:59326657"
                     /translation="MLKATRIRCVNTIRFSSKLHKGKFDDVDIDLQPQSTSQRSFGVV
                     LEENDDTANVIDRTELMSQQLQSPYRRKSGAPLHGRNAHEARLLPETLQARTFRDQID
                     LNPIVKQAISNNILSLQIPSNVRRSAANYFVDLYRRKLHKPAKTEMEVDAHIASVFVQ
                     NYGSIYQSLAELRKRVGWEKFNPKRILDVGYGPATGIVALNDLMGKDFKPELKEAVIL
                     SSLEMQKRAKIILSRQLNEIVDPVSTEAKSKEEMESNDDDLVEGKDLIGAVMTKKIKI
                     KTKLSKSIPGSSQYDLIILTHQLLKHEERFPIQIDSNLEHYLKLLSPGGHIVIIERGN
                     PLGFETIARARQVMIRPENYPDEHGKIPRPYQRGSAAMLADLRESNGNETNEEAKKIM
                     EEITSRYGEIEPQDLEFEPEILREMEKNSHPEQSYHLKIIAPCPHQRRCPLQVGNPRY
                     YEYEEGKRLKFCNFQKSIMRPKFTIELKKGKVLATPWQEPTDGVGKPGLAKAGTGRPN
                     GRNYEILNYSYLIAERALTDIETISEIDRQRQESKALYDVGSLGDNTEQTWPRIINQP
                     IKRKGHVTFDLCGSSGQLEKWVIPKSFNKEIYHDARKACKGDLWGLEGKTKMRGAAAL
                     KVEKFEKLEKERLKKIKRDLKKQDREISRKYNEIQVEQSARIEDEVENLAVIFGHDFT
                     TDSKRKDKLYSKRKHDINDQL"
     gene            <666386..>667183
                     /locus_tag="HG536_0E03730"
                     /db_xref="GeneID:59326658"
     mRNA            <666386..>667183
                     /locus_tag="HG536_0E03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284240.1"
                     /db_xref="GeneID:59326658"
     CDS             666386..667183
                     /locus_tag="HG536_0E03730"
                     /inference="similar to AA sequence:RefSeq:NP_012768.1"
                     /note="ancestral locus Anc_5.263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140136.1"
                     /db_xref="GeneID:59326658"
                     /translation="MVQSGLEMFSNSVLLALILVLLTSSFLLILQRNTGKLIWNAKSG
                     SKNRQPTFIIAGPSGSGKSCLYNLMTTGKLKTTVTSQETSVASGFKLSESVKVRLMAF
                     PGHLKLRGKLFDEIRDSTNIKGLVFVIDATVDPKQLTKTAEFLFQILQLTERRKDGVD
                     ILLACNKSEMFTARPALKIREVLEQEIEKIIIRKQKSLETVTGPIAGHHQSNENHEIG
                     QEDAVDFATGNGFSFDVLEGNVDAFEGSVLKRDIEKWECWMEERAVN"
     gene            complement(<667210..>667425)
                     /locus_tag="HG536_0E03740"
                     /db_xref="GeneID:59326659"
     mRNA            complement(<667210..>667425)
                     /locus_tag="HG536_0E03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284241.1"
                     /db_xref="GeneID:59326659"
     CDS             complement(667210..667425)
                     /locus_tag="HG536_0E03740"
                     /inference="similar to AA sequence:RefSeq:NP_001032579.1"
                     /note="ancestral locus Anc_5.262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140137.1"
                     /db_xref="GeneID:59326659"
                     /translation="MNRFLLLTALLIYYAIWLLLPVLELDGKLRAFPLPSIYAVFLPI
                     ALLIIGFTIVGSFLGMMLLLDSKEYST"
     gene            667668..667739
                     /locus_tag="HG536_0Etrna7R"
                     /db_xref="GeneID:59326895"
     tRNA            667668..667739
                     /locus_tag="HG536_0Etrna7R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:59326895"
     gene            667755..667826
                     /locus_tag="HG536_0Etrna7D"
                     /db_xref="GeneID:59326893"
     tRNA            667755..667826
                     /locus_tag="HG536_0Etrna7D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:59326893"
     gene            <668131..>673122
                     /locus_tag="HG536_0E03750"
                     /db_xref="GeneID:59326660"
     mRNA            <668131..>673122
                     /locus_tag="HG536_0E03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284242.1"
                     /db_xref="GeneID:59326660"
     CDS             668131..673122
                     /locus_tag="HG536_0E03750"
                     /inference="similar to AA sequence:RefSeq:NP_012495.1"
                     /note="ancestral locus Anc_5.261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140138.1"
                     /db_xref="GeneID:59326660"
                     /translation="MNWSSAKFESLYNGIESAELDRKLFDEILPDLQDLNLNHDKCKN
                     SSSRSQLEKGEVTFSDGSTYKINQEFMIAAIAVSDELNLDEIVVCEMMINDTGARSSE
                     TGEELSLINRAKVNYFMRRQFILQLTAFLINCVEEDNPIYVDLLANGKLVVNVLKAFR
                     FIHSQLADIKQLISKARILDNYHALEKRNVKFKRDFLLKEYDILGQILCGLMVKGDFL
                     SREHLMNLINHVCEMHSNDFFIVYYLPAIFCAFGNLDKLPDKDVRSIHDQFIKDLRSE
                     EIYTNPIKVSLIFVFLSYFIGWCKSDPSERANTMDFTVAVDEPMTRAVEYGAMELLLI
                     FAAETSMVEKDASFGLYYDVRSLLERHLPRLIPIQLLDSDTTIQQQQSQLHNNPSDST
                     YTAPNSHDTKDRAFECISLSEGTESFFLTMFHDVLRSIIADCAFLLTKIKDAEEDSLL
                     SGEDLNLDEIALRADLERFFLTIYYFYSFRPEYGKLFWEDKESNAYGFIEWSAKCHDS
                     LMKSCFYLMISSLSCGLENSLSVYHYFVANNDVTWDLMAQCIKNYIVKICNLTARVQQ
                     RQLKRDSEEVDSSLVALEDGLNEEAVIFISSLFTLIGSVANNIEEDIKTKLSKLYTEP
                     LFEFAKLETPLIGACFKTLSHLVPFSEIERSSFWYSLDSFIFKTGQPTMVSDSYRSIF
                     MSKFTNFSEVVGFLSLFQKLLVTGPKKEYESYMAFGKLAFPSNLGRGYRKVGINPYFD
                     YILQEVLVNSGQLHDSLKTRCIQSQILHIMEEALLSFDYNVILNSIAASANLDKLVSV
                     GNFATYIQECPATIVFNYIFTEKVYKSIFDIVSIGIDDIHIELDGGNEQLKLINLSLK
                     VLNIILDFQGPYIEEFVPVINKQENTSYYIPKDFGLHGLRSFYDAIFFHLSVVAHLGL
                     YVGLNNFDVALNSVRLLGKLAARNPGESSPFAAKNTLLTIFDSVDESARIKDAFISQI
                     ERTIDCEEALTLKIEILDFIRMNLPATEADVTISHLLLGFQVSNVISTGPNLSTFINS
                     DNSLLNSVVNLMEASLHNVDRSCINYAPMRLAALSLSIIMVLCRNSLTSRLALDYFVE
                     HRLFELLVSLDPQADVNTLWNGRMFNLRQEEEFKQSESLGALLSFLSFRTELLQYLSL
                     SIHRLASSGRGSQIRAHTDLLISNTLYSARVFSLISSLNYGDMLHQTVHLDGLKFFKD
                     LPIKLDLVTTTKSCLGHIYDLSAVDSLAGLSWRVKSNHYTDCLSSSPEAMEELDVIHT
                     KITSVLARQSFVKGQLSILHSWAQLVEIIASDGELSCMDRSNFILEVFGAIIPKINDY
                     IEFDVSFSEELVSLAVTLFEVYQKDRMSVDGFQTIDNRLYNLFKTCIHGINSPLSSFS
                     IRSNFYLLANSYLVHALGDTKLARQILQDLKMGSEVLVEVISKDAIYGQGTNRITSIF
                     LLDSLVRLGDINKENFILDFLMKKTQLLLIIRSLKNINVFLTSPQNNVSIDDLLYELT
                     AFKSVTYLLIRIAENRNGAHALIQNKLFQVIEDCSALQLDPDLGLDLVINELSAQNSG
                     LLSINVSLDNPLFMGRDAYEISLFELIVPIFQLIAAVLLSMGSANLRVMSDVKSLLVK
                     FRKLSIGIMKRDALKDMNEKYRLSGVASEGQEQMVRLIVLLCTLTGYRGEETI"
     gene            complement(<673201..>675153)
                     /locus_tag="HG536_0E03760"
                     /db_xref="GeneID:59326661"
     mRNA            complement(<673201..>675153)
                     /locus_tag="HG536_0E03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284243.1"
                     /db_xref="GeneID:59326661"
     CDS             complement(673201..675153)
                     /locus_tag="HG536_0E03760"
                     /inference="similar to AA sequence:RefSeq:NP_012494.3"
                     /note="ancestral locus Anc_5.260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140139.1"
                     /db_xref="GeneID:59326661"
                     /translation="MPSFSGTGQQSSSSGFGKQNETKPSGGLFGNKSSNDGTAAVASS
                     AMSGFSFGANKGKESSPAPFGSQESKSNETAALSNGPAKFAGFGASGAGNQTEPRLSF
                     PSQATDSKPPAFSFGAGSKSAEQNAPATSVAEQKPIEKTTPSLNLGAGNKPSLSFGTT
                     AATESKGSDAAAFGSNAATPKPNMFSFGKTDDKNKVGGSLSGFSLSAKKDEDKGRAAF
                     NFGASVNKPAETNGASDSAAKPQLSFDGKDGSTGASIIGGSSGNKDASVRPSFSFGNK
                     TEDKGKDATAGSLFGGKTDDKTKEMPKVEGQTKQAFSFGSKSDDVAKPQTGFSFGGKT
                     ENKNDKPAVGFSFASKAGESQAQSQSGFSFKKSDAGEKSEKPSPAFSFGAKAAPEKAP
                     ATDASIKDSKQFSFGGTKENEKDKAPTAEGFTLLGKKSDEKKNDVKSSDGSSQILNPK
                     NVEPAPVSLDNKTLDDLITKWTEQLAGTASHFDTFSKKVNQWDQVLVKGGEQISQLCS
                     ETIAAQQTQNRIDQSLEYIERQQDELEIFLDSYEQKTDALLSDVLSSVGDSAANNNDQ
                     KRQQAYHTAETLDENLNSLFLNLSSLIAEINEVSNTFNKATTMNLTNGDENTHLVKLL
                     NSHLDALKSLDESSTTLEHKIKSISK"
     gene            complement(<675950..>677050)
                     /locus_tag="HG536_0E03770"
                     /db_xref="GeneID:59326662"
     mRNA            complement(<675950..>677050)
                     /locus_tag="HG536_0E03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284244.1"
                     /db_xref="GeneID:59326662"
     CDS             complement(675950..677050)
                     /locus_tag="HG536_0E03770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140140.1"
                     /db_xref="GeneID:59326662"
                     /translation="MDIATLLLEASKTNEVVDGGSPTSLYGGIVPNLAFNVAMLAIWG
                     VLLGWHTLMIRYKQYWFSSAFVVAAILEVIGYAGRVRGHFDPSLESPYVMQQVCLTIA
                     PVFMMRGVYYQLPKLIEIYGHRFSLLRSPAAYWYLFVAFDLVALPIQAAGGAVAARAL
                     INGTSPTQGVNTLIAGLSLQIASIVIFMALMGHLYYKVFIQTRLDHSGQSKLSLGLLK
                     ISQTEIDYLYRQKFSELRVSPDRWVFRYFPLAMVVAVATVFVRCCYRLAVVAADWHGN
                     LITHENYFIVLDGVMISLGTVALSVFHPGFAFQGRHVSIPVTDGRVDPETVTKPGFRP
                     EKEEAYIHSGQQGSPLYKLFMNRCRKIKNAFK"
     gene            complement(<678789..>682913)
                     /locus_tag="HG536_0E03780"
                     /db_xref="GeneID:59326663"
     mRNA            complement(<678789..>682913)
                     /locus_tag="HG536_0E03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284245.1"
                     /db_xref="GeneID:59326663"
     CDS             complement(678789..682913)
                     /locus_tag="HG536_0E03780"
                     /inference="similar to AA sequence:RefSeq:NP_012493.1"
                     /note="ancestral locus Anc_5.259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140141.1"
                     /db_xref="GeneID:59326663"
                     /translation="MKSMQDPQKLLKEHQVGSLDVDWLIGARNLDTNQPAVVEGSLSR
                     PLRSRSGSIESGDPLSDIPIAKIVKGDQVDNRKTHRNSSAVTELSAASGINAATGSSE
                     LRRTKSLSSATGSNYASGPRPRGASISESEFRQQSHNGERRMGFFKSLFSRKNKSKNE
                     SLPVTGNNNTKLSNRPFSRRSSTVEVVDSRLPFLKEDEDGDQGAPLARSKTASTVLDE
                     HSSHYHRHDSQSGCACRDDVTSAKMNAEGNDGRDPRLMEFLEYYKSKGYSVAAFNERS
                     SISRNNQNGFLSRSKTASFSIDDNLAEIKEEKPKAKKYDAKGRPIPPHPKRSKLPPAL
                     KTTREKPRSNSGSDSDSDSASSSTTTPSSSHKFGAFLKKVTSYGGTNVSSADTTREEL
                     SSERRESTAEKKTGFFDPGRAEVVPGLECMKALKHVSFATSTYFNDPPQQICSKHPRQ
                     GEVEVKPDGSVVIHRLTPEERRKVMENASSGVVVGGTGQLRLLVEQDDDVRQSNDVRK
                     QEQMAPRASSPSSSEPDREMQGRKDEPLATETVASSQVGELRRTSTNNEEEVKVSNIA
                     SRVKIDKPMVSRRATGTNSQTSLSSMISQESVVSEETLPPRDAKLPHDVVYTRCCHLR
                     EILPIPATMKQLKKGSTDPIPLLQLRNPRPSMVEIWSFSDFLSIAPVLCLSLDGVTLS
                     VDMFRVILSALVNKKGFEKLSLRNTSLDHEGWKILCYYVSKATSLTALDLTMVPIIKT
                     NVQKPSKSSLKNNIIRMECDLQSRKEMNWNLLAASIAKRGGLEEIIISGAQMPQDQFE
                     NFIEVACIATQRLGLAYNCLTKEQCDMLAKWILQSNVTGLDVGFNDLKGKLSAFSNAV
                     LDKIRNKGEKNVLKYISLNCTGLEVGSGNTSDNNEVLRLLSVLCYCENLKFLDLSNNP
                     KMFPNCLSTLVKCLPVFVNLVRLHLDYEGLESTAVVMLAEMFPLCTRLNYLSMLGTKF
                     DLASCKALAEAVRKSSSLITLDIDYACMPPSIKEKLSLYTMRNVESELNKVKTNNGKP
                     SNPKCLDVGDNLSNLQEELSILLTDSFKDGKSYDKLVEGYIEKVTAARKKIKKVVKDL
                     FDIRVKGQLSTEGKETLIRLCFIDASFEKGIKLLQERHLASGVRKDDKEFANKSAHIL
                     PDMCEADQFIKSRYLEPSDASLVPTSTVLYSSAFNQSGHSALLPFGRPDVEDFNPRAD
                     DTVELRDEDEGSSRKVSYQTQEEGKVFRKSDLMMKNVERFASEDGLPIDKDLLGRAAE
                     SLDSDQIKDLLLKTNVSTVVDVIDELHNQGYHLHDIFKKHDGAHDGAHEKLVALSPQP
                     SPADGTGATDRQSSGAHQDLIESPEPETHKDEKEAIDAAYDQVLDSIQKERKSE"
     gene            <684282..>685493
                     /locus_tag="HG536_0E03790"
                     /db_xref="GeneID:59326664"
     mRNA            <684282..>685493
                     /locus_tag="HG536_0E03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284246.1"
                     /db_xref="GeneID:59326664"
     CDS             684282..685493
                     /locus_tag="HG536_0E03790"
                     /inference="similar to AA sequence:RefSeq:NP_012491.3"
                     /note="ancestral locus Anc_5.258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140142.1"
                     /db_xref="GeneID:59326664"
                     /translation="MDLKQLTIDKYETREKLVLSGIWGGEIYKTANLAAGNGRGWLWK
                     TLVIDGDADVEEPVEVPSLEHNVEGSSQGRKPRVRKQKSIRRLTPIDVARHPLRIPAT
                     DGEAGTGEDDRTCLQEKLEIIDLDLSRLMLHDIFQQDQVHSEMRQILYNYLLRNEEDS
                     SYKQGYHELLGMIYLQLHTDEREDLGAGQRKMRLRNALCIFEKLMKHMTLFYNETRLI
                     QWEEKEFRPILSTCCPRLYDIFCSDDNHTNLLWLIRWTRLLFMRELPRDYTLIIWDHL
                     FTGLYPVHTLVACLIVVLLLNNYRLLVEEVEDHNDLVELMLHFQSRITSMVDCIELCK
                     MAGNLCELWYTQDVDSMKLICDNFLKIKFNVDREPDREERIDPNRRRIEEKLRRRVKQ
                     TLLPKRKTLNK"
     gene            complement(<685509..>686255)
                     /locus_tag="HG536_0E03800"
                     /db_xref="GeneID:59326665"
     mRNA            complement(<685509..>686255)
                     /locus_tag="HG536_0E03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284247.1"
                     /db_xref="GeneID:59326665"
     CDS             complement(685509..686255)
                     /locus_tag="HG536_0E03800"
                     /inference="similar to AA sequence:RefSeq:NP_012770.1"
                     /note="ancestral locus Anc_5.257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140143.1"
                     /db_xref="GeneID:59326665"
                     /translation="MPKLVLIRHGQSEWNEKNLFTGWVDVKLSAVGEKEAARAGELLK
                     EKNVKPDVLYTSKLTRAIQTANIALANADRAWIPVHRSWRLNERHYGALQGKDKAETL
                     EKYGEEKFTTWRRSFDIPPPEIEASSPYSQKNDERYKDVDPNVLPQTESLKLVIDRML
                     PFWEDVIAKDLLAGKVVLVTAHGNSLRGLVKHLENISDADIAKLNIPTGIPLVFELDE
                     NLKPTKPFYYLDPEAAAAGAAAVAAQGKKK"
     gene            complement(<686648..>687646)
                     /locus_tag="HG536_0E03810"
                     /db_xref="GeneID:59326666"
     mRNA            complement(<686648..>687646)
                     /locus_tag="HG536_0E03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284248.1"
                     /db_xref="GeneID:59326666"
     CDS             complement(686648..687646)
                     /locus_tag="HG536_0E03810"
                     /inference="similar to AA sequence:RefSeq:NP_012771.1"
                     /note="ancestral locus Anc_5.256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140144.1"
                     /db_xref="GeneID:59326666"
                     /translation="MSMLSKLTHRELIQLAQKRCITPLSPKFHKGQNGRVCIVGGCED
                     YTGAPYFSANATALIGCDMTHVICERDAAPVIKSYSPNLMVHPYLRTGQLGEMSKIKS
                     LVSRVHVLVIGPGLGRDDGMLGSVKEIIRTVLDDHKGQIPIVIDADGLYLISHDQETR
                     EMLARFPRGRVIITPNVVEFKRIKDAVGGDSGSLEAGAYVASKLQCIVVEKGGEDKIF
                     SPEPAPGAADGRSWLVNSVEGSNKRVGGQGDTLTGIIACMLAFSRARYDFKLCGDDAE
                     KCDPRMEWLDYAMLSCYVGSTVTRECAKLAYKAKKRAMQTMDMNDRVGEVYDKLFG"
     gene            <687967..>688929
                     /locus_tag="HG536_0E03820"
                     /db_xref="GeneID:59326667"
     mRNA            <687967..>688929
                     /locus_tag="HG536_0E03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284249.1"
                     /db_xref="GeneID:59326667"
     CDS             687967..688929
                     /locus_tag="HG536_0E03820"
                     /inference="similar to AA sequence:RefSeq:NP_012772.1"
                     /note="ancestral locus Anc_5.255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140145.1"
                     /db_xref="GeneID:59326667"
                     /translation="MVIVSSTALQDIPTRILARNQCQMFGAISRSNRRIVPLAIGGAA
                     IACSAYYAARMFTPVRNESSAVFVGDDKWIALPLSKVEDLSHDTKRFTFDLPGEDSTT
                     GLTLCSALLAKFVTAKGNNVIRPYTPVSDLSRKGSFQLVIKHYKDGKMTSHLFGLKPS
                     DTVLFKGPIKKWQWKENSFDSIVLLGAGTGINPLFQLVHHLSENPNEKTEIHLFYGNK
                     TPQDILLKKELDELQKKHPDRLKISYFVDKKDGEFEGETGFITKEYLEKHAPKPSEKT
                     HVFVCGPPPFMKAYSGEKVSPMDQGELVGILKDLGYSKDQVFKF"
     gene            complement(<688948..>690051)
                     /locus_tag="HG536_0E03830"
                     /db_xref="GeneID:59326668"
     mRNA            complement(<688948..>690051)
                     /locus_tag="HG536_0E03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284250.1"
                     /db_xref="GeneID:59326668"
     CDS             complement(688948..690051)
                     /locus_tag="HG536_0E03830"
                     /inference="similar to AA sequence:RefSeq:NP_012773.1"
                     /note="ancestral locus Anc_5.254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140146.1"
                     /db_xref="GeneID:59326668"
                     /translation="MRIAVQGCCHGDLNQVFSKVAQIHERNAIDLLLILGDFQSIRDK
                     NDFQSISIPKKYQKIGDFKEYYDNDDLKPPVLTLFIGGNHEAMRHLMLLPHGGYVSRD
                     IYYMGYSNVLWYRGVRIGSLSGIWKQWDFNRERMSWKSIEESHAWLSKVRELYHVRNS
                     DMLPLFMMDGEERLDIMLSHDWPDGVVYHGDIRGLLRRKPFFERDVQMRRLGNPKSWQ
                     LLRQLKPKWWLSAHLHVRYEAIINHNKRKKNDDELELDLSSEDDRQEATTRFLALDKC
                     LPRRNWLEIIEVEQDTSHPSYQDRDTLYWDPEFISNLQRIAAGDKVSKPVAKSRDEGT
                     DHSQYAIPQYTAGIQRREQEQTANFIKRFLSNI"
     gene            complement(<690162..>692078)
                     /locus_tag="HG536_0E03840"
                     /db_xref="GeneID:59326669"
     mRNA            complement(<690162..>692078)
                     /locus_tag="HG536_0E03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284251.1"
                     /db_xref="GeneID:59326669"
     CDS             complement(690162..692078)
                     /locus_tag="HG536_0E03840"
                     /inference="similar to AA sequence:RefSeq:NP_012490.1"
                     /note="ancestral locus Anc_5.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140147.1"
                     /db_xref="GeneID:59326669"
                     /translation="MLSVRSNVALRLGALKRHFSKSCVRLQTVGDVQGDANPMKGSKY
                     HVVDHEYDCVVVGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGN
                     MHKDDWQWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHFGVPFSRTESGRIYQR
                     AFGGQSKEYGKGGQAYRTCAVADRTGHALLHTLYGQALRHNTHFFIEYFAMDLLTHNG
                     EVVGVIAYNQEDGTIHRFRAHKTIMATGGYGRTYFSCTSAHTCTGDGNAMVSRAGFPL
                     QDLEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSR
                     AMTLEIKEGRGVGKDKDHIYLQLSHLPASVLKERLPGISETAAIFAGVDVTKQPIPVL
                     PTVHYNMGGIPTKWNGEALTIDENSGEEKVIPGLLACGEAACVSVHGANRLGANSLLD
                     LVVFGRAVAHTISDSLQPGLPHKPLPSDLGKESIANLEKLRTADGSRPTSEIRLHMQK
                     TMQADVSVFRTQETLDAGVRNITEVDNTFKDVHVSDRSMIWNSDLVETLELQNLLTNA
                     TQTAASAAARKESRGAHAREDYPERDDENWLKHTLSWQKNTADPVRLGYRGVVQTTLD
                     ENECKPVPPAVRAY"
     gene            <692440..>694368
                     /locus_tag="HG536_0E03850"
                     /db_xref="GeneID:59326670"
     mRNA            <692440..>694368
                     /locus_tag="HG536_0E03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284252.1"
                     /db_xref="GeneID:59326670"
     CDS             692440..694368
                     /locus_tag="HG536_0E03850"
                     /inference="similar to AA sequence:RefSeq:NP_012776.1"
                     /note="ancestral locus Anc_5.252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140148.1"
                     /db_xref="GeneID:59326670"
                     /translation="MTGCTSPDLSLHEVDERPEMVSHMSPSASNVSLGSLAGQGGLNI
                     SRRPSTTAALLKNPARDEDMAKSYGSVNRESQQTLEIVARHLVQSPNNLQLQSGDITR
                     DLYRWTQDHPVPLQSGDLVQPVPQRRRRSMSFSGVSIHSSTNQSFLQQGEQLPQTAMS
                     HEEITAPGGFRRSFLLQQHQQRYGDDAPPPNFFTRNFIEFLALYGHFAGEDLEEEEVE
                     EVERWEARDRDDETVLLDRRERESKRHKASTFKAVLLLLKSFIGTGVLFLPKAFDNGG
                     WAFSAVCLLVCAVASFMCFVSLIATKDMVGVNGYGDLGLRLFGPKMKFMILLSIALSQ
                     IGFSAAYVVFTATNLKVFCENVLGVYRDAVGLAGYILFQTLLFIPLALTRNIAKLSGT
                     TLVADVFILLGLIYVYYYPSYYIFKHGIASESMQTFNKSDWSLFVGTAIFTFEGIGLL
                     IPIQESMEKPALFNKCLLGVMGAVTLLFISSALLCYAAFGSKVEVVVLLNFPQDSAFT
                     KSSQLLYALAILLSTPLQLFPAIRILENWSFPTNASGKHNPRIKWLKNYFRAAIVILT
                     SLVAWIGANDLDKFVSLVGSVACVPLIYVYPPLLHFKAFKDRGASKLSLVADLSIAAI
                     GILIMIYNSYQSTLMWGS"
     gene            <694531..>695952
                     /locus_tag="HG536_0E03860"
                     /db_xref="GeneID:59326671"
     mRNA            <694531..>695952
                     /locus_tag="HG536_0E03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284253.1"
                     /db_xref="GeneID:59326671"
     CDS             694531..695952
                     /locus_tag="HG536_0E03860"
                     /inference="similar to AA sequence:RefSeq:NP_012777.1"
                     /note="ancestral locus Anc_5.251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140149.1"
                     /db_xref="GeneID:59326671"
                     /translation="MPPKEDWEKYKAPVEDEAEKSAADEKNVPLTEGDIQVLKTYGAA
                     PYAGKLKQTEKDLKDIENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVAR
                     CTKIIRSSDNENGNRNEDGLDSATLAGNGLEASESREAAEGDDDEGAKYVINLKQIAK
                     FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG
                     GCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDAT
                     FIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIDAIGGARFDDGAGGDNE
                     VQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA
                     NIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL
                     KAVEKVINGYKKFSSTSRYMQYN"
     gene            complement(<696113..>696745)
                     /locus_tag="HG536_0E03870"
                     /db_xref="GeneID:59326672"
     mRNA            complement(<696113..>696745)
                     /locus_tag="HG536_0E03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284254.1"
                     /db_xref="GeneID:59326672"
     CDS             complement(696113..696745)
                     /locus_tag="HG536_0E03870"
                     /inference="similar to AA sequence:RefSeq:NP_012778.1"
                     /note="ancestral locus Anc_5.250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140150.1"
                     /db_xref="GeneID:59326672"
                     /translation="MFILSKINDLVRIAPDQFHRDTVYSVTHQLNKKFANKIIPHVGL
                     CITIYDLLEVDEGQLKPGDGASYIYVTFRALVFKPFAGEVITGWVSKCTAEGIKVSLL
                     GLFDDIFIPKKMLFEGCYYSPDDNAWVWPMDEETKLYFDVNEKIRFRVEQEIFVDVKP
                     KSPKERELEEQAQQQEMEEGLPQTAVTKPPAYAILGSCQTDGMGVVSWWE"
     gene            <696979..>698343
                     /locus_tag="HG536_0E03880"
                     /db_xref="GeneID:59326673"
     mRNA            <696979..>698343
                     /locus_tag="HG536_0E03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284255.1"
                     /db_xref="GeneID:59326673"
     CDS             696979..698343
                     /locus_tag="HG536_0E03880"
                     /inference="similar to AA sequence:RefSeq:NP_012779.1"
                     /note="ancestral locus Anc_5.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140151.1"
                     /db_xref="GeneID:59326673"
                     /translation="MSKRFSKKNAQKYVVVHRPHDDPHYYDSNATDHVLVPVASPGQK
                     PGSKDTQGILERKSASQRLEKRNEHLGEAALYGITFDDSKYDYTQHLRPIGRDPENSF
                     FIPAKTSEPKKKSLDDLLVEPRYGDEQQAAKGSSSVFQRGIAKPEYLLHQQEVPEEIS
                     GFRPDLNPALREVLEALEDEAYVVNDDIVVKKSDLKTQEGASEQDNEEDDIFAELLES
                     GQAEDAEAFADQLDEWDVDNLGDYEEEQYHEELATFANVENLEDLRNLDYQADVRRFQ
                     KQQKQANDTDGELEELESLSPELEDQDVLGDLPSFAQKAGKKRKERRKKGAMSDVSGF
                     SMTSSAIARTETMTVLDDKYDQIISGYENYQEEQLEDEDNYQPFDMSKERPDFESMLD
                     DFLDNYELDSGGRKLVKKDEEIDRLKRAADEVSKGKLSQRRNRERNNKAVNKITNTLS
                     ALQL"
     gene            <698525..>699160
                     /locus_tag="HG536_0E03890"
                     /db_xref="GeneID:59326674"
     mRNA            <698525..>699160
                     /locus_tag="HG536_0E03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284256.1"
                     /db_xref="GeneID:59326674"
     CDS             698525..699160
                     /locus_tag="HG536_0E03890"
                     /inference="similar to AA sequence:RefSeq:NP_012780.1"
                     /note="ancestral locus Anc_5.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140152.1"
                     /db_xref="GeneID:59326674"
                     /translation="MSSELELLKQQVAELQELVKRQSLIISKTGQNVLELQVARQKAG
                     VEAFGKAPASKSGSQVEAADYATNEDLVQLVGELQGQLENIEERSIRRLVNSTKSDPK
                     DLISPLPNSDAEIPAEGFFPRSLEEFERISDTALYKLAKFYELLPPSLKEQEQFEDYL
                     EGKVEEFHISEIKDEEVEKELKKYSSDQLEDVFNDVARYLGLKLRRGTSTW"
     gene            complement(<699242..>701221)
                     /locus_tag="HG536_0E03900"
                     /db_xref="GeneID:59326675"
     mRNA            complement(<699242..>701221)
                     /locus_tag="HG536_0E03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284257.1"
                     /db_xref="GeneID:59326675"
     CDS             complement(699242..701221)
                     /locus_tag="HG536_0E03900"
                     /inference="similar to AA sequence:RefSeq:NP_012524.3"
                     /note="ancestral locus Anc_5.247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140153.1"
                     /db_xref="GeneID:59326675"
                     /translation="MGKVRGRKHLKKTQKDEFIAIEQQPDEHEAHGADNSEDSDPKTF
                     FGILDRDELEYFKQTEATLAMDAFESPEEKSHFVTRVFEEFQGKELKLVTSQICSKLV
                     ERVILNCNDDQLKAIFKACNGFFFNLACHKYASHVLETLFVRSAALVEKELLTPSFDE
                     AAMGDGNVHVTMENMFLFMLNELKSHLKAMIKQQYASHVLRILILVLSSKRLPNSTMN
                     NSALRSKKSKIARKMIDIKDNEDFDKAYQTPESFKKELREMMSTLYKQFSGDAKSRSE
                     ISPTEVTKFREYCVDKVASPVIQLIIQVEGIFDRDRSFWRLAFNTSEEKDSKEESFVE
                     YLLSDPVGSHFLQNVVMHARLKYVQRLYVLYMKDRIAKLAKRDSTAAFVLQALLETLK
                     NKEVSEILDAVVPELSMLLNSNMDFGTSIINASIKQDNYLREKVIEQLIAKYYPKESS
                     DKNILESCLLLNSSTLGNTRDDWPTAEERRRSLFLEKIIDYDDKFLSATIESMLSLPE
                     ERLLQMCYHGVFSHVVEHVLQPERVDTIKRKLLLNVLSKDVVNLACNAYGSHIMDKLW
                     VFTAKLTLYKERIASALVGESEKVKNSVYGRQVWKNWKMELYVRKRWDWKREIKEQEL
                     EIFPDAKPLQPKEQGRDLKRHREQDHNQAHVKRSH"
     gene            complement(<701421..>703130)
                     /locus_tag="HG536_0E03910"
                     /db_xref="GeneID:59326676"
     mRNA            complement(<701421..>703130)
                     /locus_tag="HG536_0E03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284258.1"
                     /db_xref="GeneID:59326676"
     CDS             complement(701421..703130)
                     /locus_tag="HG536_0E03910"
                     /inference="similar to AA sequence:RefSeq:NP_012526.1"
                     /note="ancestral locus Anc_5.246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140154.1"
                     /db_xref="GeneID:59326676"
                     /translation="MSLKLPQNPNSGLFKQGYNSYSNADGQINKSINAIREIHQMCLT
                     SMGPCGRNKVIVNHLGKVIVTNDAATMLRELDIVHPAVKVLVMATEQQKIDMGDNTNL
                     VMILAGELLMVCEKLIALGLSAVEIIQGFNMAKNFTLQELDKLVIGEITEKTDKDELI
                     KVIKPVISSKKYGSEDLLSKLVAEAVSHVLPRSESSSPYFNVDSIRVVKIMGGSLSNS
                     TVIKGMVFNREPEGHVKSLPEGVKHKVAVFTCPIDIANTETKGTVLLHNAQEMLDFSK
                     GEEEQIDGMMKEIADMGITCVIAGAGVGELALHYLNRYKILVLKVPSKFELRRICRVC
                     GATPLPRLGAPTPEEIGIVETVKTTEIGGDRVTVFKQELDEITRTATIVLRGATQNNL
                     DDIERAIDDGVAAIKGLMKPAGGKLLPGAGATEIELVSRITNYGERTPGLLQLAIKQF
                     ALAFEVVPRTLAETAGLDVNDVLPNLYAAHTIISGEEELQNDDGLYKGIDIQNETSQG
                     VKDIREEGIYDMLAPKKFAINVATEAATTILSIDQIIMAKRAGGPTPPPQGPRPGNWD
                     HDD"
     gene            703411..703483
                     /locus_tag="HG536_0Etrna4M"
                     /db_xref="GeneID:59326890"
     tRNA            703411..703483
                     /locus_tag="HG536_0Etrna4M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:59326890"
     gene            <703653..>706115
                     /locus_tag="HG536_0E03920"
                     /db_xref="GeneID:59326677"
     mRNA            <703653..>706115
                     /locus_tag="HG536_0E03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284259.1"
                     /db_xref="GeneID:59326677"
     CDS             703653..706115
                     /locus_tag="HG536_0E03920"
                     /inference="similar to AA sequence:RefSeq:NP_012505.1"
                     /note="ancestral locus Anc_5.245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140155.1"
                     /db_xref="GeneID:59326677"
                     /translation="MISNDLNYDPFEDLATILSARESLDEIDRLIHATRKYKTDLETE
                     ILKDREDESSSEQITNVEFDFEKIFREIEETRSFASSTQSTISGLTEGISHLDNAKRN
                     LIQCMTLFQNLKILTDSYVQCKSLLEGDNYKEAASSFKIMSSLAETTFRPYKSVDEIN
                     KLLNSISRLRMDTYESIKRSYGKALGGKVPEGHSLERELREGACDLLESGTSGKTQII
                     DWCVSKLLYEMREIFQVDDEAGSLENISRRFIYYKKVLNNYNTSFARFFPQEWEIPLR
                     MTRSFYESTRKDLQILLKNQLLHDKNSSIDLFMRALQDTLDFEKYIDVRFSRKLRETS
                     LSACFEPYISLWISHQDKLMEEKMLSYMSAGTVDFSNNSLVIPSSADLFRTYRSVLSQ
                     TFELIENKTDEKILLALATFFTKWLVTYSNKILKPLLLPDNVDIHNKEETIKYTVALI
                     NTADYCSTTIDQLEEKLTAVNQNSSRISDAFISVKNLYGELLTSGTNLLLNRILKLDL
                     DFAWKEFYNTDWAHVLVEDYSRYAVTLRNVLSFSSSDASLSTKPALEMILTQFNRDVY
                     CWNFLDKVIELIAHEFTGHIIRLLQRTPPLCNLGSPRKFDPQRVINIGEQLLLDLELL
                     KHTLLTLPDSVASVTNSSQSASFKRVRKHMDVDLDRILQFIKLLVIPVDSADDYSETY
                     KQLTNGNYNSSVWAFVLSLKGVPWDLALWKQHWSAFDLDSDEQTGNDEGKDILIFQWN
                     VQLIRQFEFNMGRVQDPAWSKFIKNDLKISTPSRTPSRTQFRNPVIQTDLRQQQPQSQ
                     PKSPVANVKNLVSNSRFFNRGF"
     gene            complement(<706158..>706760)
                     /locus_tag="HG536_0E03930"
                     /db_xref="GeneID:59326678"
     mRNA            complement(<706158..>706760)
                     /locus_tag="HG536_0E03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284260.1"
                     /db_xref="GeneID:59326678"
     CDS             complement(706158..706760)
                     /locus_tag="HG536_0E03930"
                     /inference="similar to AA sequence:RefSeq:NP_012504.3"
                     /note="ancestral locus Anc_5.244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140156.1"
                     /db_xref="GeneID:59326678"
                     /translation="MSRPISLRGSTKTITEFFEYSINSILYQRGVYPQDDFTTAKKYG
                     LTLLKTTDDELKAYIRVVLLQVHKWLIGRKCNKLVLCVVDKDEGEVVERWAFDIHHVG
                     KDEDAEDSRIGEQVDPDQTQNQIRALIRQITASVTFLPELANEGNYTFNVLAYTDANA
                     KVPLEWSDSDSKTISNGETVQFKSFRTDDHRVSAQVSYKH"
     gene            <706907..>707960
                     /locus_tag="HG536_0E03940"
                     /db_xref="GeneID:59326679"
     mRNA            join(<706907..706909,706980..>707960)
                     /locus_tag="HG536_0E03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284261.1"
                     /db_xref="GeneID:59326679"
     CDS             join(706907..706909,706980..707960)
                     /locus_tag="HG536_0E03940"
                     /inference="similar to AA sequence:RefSeq:NP_012503.2"
                     /note="ancestral locus Anc_5.243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140157.1"
                     /db_xref="GeneID:59326679"
                     /translation="MHGVKRKQWTQELLKQKRIQDQRKIASYRELVDEVLKLRDDGCF
                     TNESLKATTRLLQANPEFNAIWNYRREIVDRLAPSLDSGFWNDELMFTLVLLKQYPKV
                     YWIWNHRIWTLQHHSDRTTTVWENELAMVSKLLQLDARNFHGWHYRRLILNKLEKLTS
                     RNRDADELQYVTQNINKDISNYSAWHQRASLISSLFDNHEIADERKFILDEFAYITNA
                     IFTDAEDQSVWFYTKWFIKYVNVSKVLGHGEYIRQLQDLKSNIIAINQDDVEFSGKEN
                     NWCLKILIFIEGIEQELGLQIESHSEAYLKQLIIADPLRKNRYLSLIAKRT"
     gene            complement(<707970..>709043)
                     /locus_tag="HG536_0E03950"
                     /db_xref="GeneID:59326680"
     mRNA            complement(<707970..>709043)
                     /locus_tag="HG536_0E03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284262.1"
                     /db_xref="GeneID:59326680"
     CDS             complement(707970..709043)
                     /locus_tag="HG536_0E03950"
                     /inference="similar to AA sequence:RefSeq:NP_012528.1"
                     /note="ancestral locus Anc_5.242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140158.1"
                     /db_xref="GeneID:59326680"
                     /translation="MIGVNGSLLQALDIIPSDELSRWNSLRSRGSTAIMSSKFETQLL
                     VSRPYLTKKQLSKLQNSTIPDRRAYNQKKIAIFKFLSDICVQLKFPRRTLETAIYFYQ
                     RFYVFNRFETELCHTVATSCLLLSCKQVETIKKANEICSISLRLRSAAKVTPEIIDGF
                     KKRVLQIELRILEACAFDYRVNNMVHIDEYVVKIGKDLNLEVLTCHLAWIIAYDVLKL
                     EILLMVPQHIIAIAVLKTAHELVHGKTGWPKIRYNAFEADEKSVSQAYFDILNFYINS
                     FTVSDLPDNLPEGIPPVSIDTFIGLKKNAGQEFGLEEITEKAIEADAYLTTPRDYSIR
                     ERRYVLSAQLVADEANHSTTSKP"
     gene            complement(<709085..>711394)
                     /locus_tag="HG536_0E03960"
                     /db_xref="GeneID:59326681"
     mRNA            complement(<709085..>711394)
                     /locus_tag="HG536_0E03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284263.1"
                     /db_xref="GeneID:59326681"
     CDS             complement(709085..711394)
                     /locus_tag="HG536_0E03960"
                     /inference="similar to AA sequence:RefSeq:NP_012501.1"
                     /note="ancestral locus Anc_5.241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140159.1"
                     /db_xref="GeneID:59326681"
                     /translation="MGKVRNSKTSLRKEQRKKEAEYINDLERRIEEYDPKTSKAVFFK
                     DLPISDATLKGLKEASFVKLTEIQRDSIPVSLKNRDVLGAAKTGSGKTLAFLVPVLEK
                     LYRARWTEFDGLGALIISPTRELAMQIYEVLTKIGGHTSFSAGLVIGGKDVKFESERI
                     SRINILIGTPGRILQHMDQAVGLNTDNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPS
                     RQTLLFSATQSQSLDDLTRLSLTDYQTVGAPKSAHADNGENGLSTPETLQQSYITVEL
                     ADKLDILFSFIKTHLKSKMIVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQTART
                     ETLDKFSRAQQVCLIATDVVARGIDFPGVDWVIQVDCPEDVDTYIHRVGRSARYGKRG
                     KSLIMLTPREQEGFLKRLKTKNIEPNLLTIKQSKKKSIKPQLQSLLFKDPELKYLGQK
                     AFISYVRSIYIQKDKEVFKFEDLPTEEFAQSLGLPGAPKIKIKGMKAIERAKTLKNTS
                     RQLLSLSKTSEDGEPINEKTREVKTKYDKMFGRKNQTVLSEHYLNITKSNAQEDEDEN
                     FMTVKRQNHKLNEDELPELTVPTSKRSIKKALSKKASLSSKGNATKMVFDDEGTAHPV
                     YELEGEEEFHKKGSAESQKKEFLEKETKVMAAVDSDDKKLAKEKRQEKKRKRLEAMRR
                     EMEAELAEEYSDEAETVAQLGTGNLSDDMEDDYESDSDENGRQSKKHKSVNYKRHAAV
                     VEDHGDFIEVEEPHTLEDLESLTARLIES"
     gene            <711649..>712266
                     /locus_tag="HG536_0E03970"
                     /db_xref="GeneID:59326682"
     mRNA            <711649..>712266
                     /locus_tag="HG536_0E03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284264.1"
                     /db_xref="GeneID:59326682"
     CDS             711649..712266
                     /locus_tag="HG536_0E03970"
                     /inference="similar to AA sequence:RefSeq:NP_013116.1"
                     /note="ancestral locus Anc_5.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140160.1"
                     /db_xref="GeneID:59326682"
                     /translation="MEMWRKRQSGENRTQLKRSKQGLPKQILPKFEPSGLLELESNSK
                     EGVLLKHVEPSDARCPKDFWAKNRVPLKNRHIFQAVLYRKGEEVPMRTYDLELKSSYI
                     IGRGVGRSWDDSEEKEVVVADIVIPEETCSKQHCAIQFREVRGRLAAYVIDLESSNGT
                     NLNGVRLPAARYVELRSGDIINPSAVADDESDYDIVFVNANFQSM"
     gene            complement(<712370..>714415)
                     /locus_tag="HG536_0E03980"
                     /db_xref="GeneID:59326683"
     mRNA            complement(<712370..>714415)
                     /locus_tag="HG536_0E03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284265.1"
                     /db_xref="GeneID:59326683"
     CDS             complement(712370..714415)
                     /locus_tag="HG536_0E03980"
                     /inference="similar to AA sequence:RefSeq:NP_012500.3"
                     /note="ancestral locus Anc_5.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140161.1"
                     /db_xref="GeneID:59326683"
                     /translation="MLFNRSSSSRWLAPLAVILYALFVVVLPLQGSGKSSRVLARADD
                     VESYGTVIGIDLGTTYSCVALMRNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKN
                     QVASNPRNTVFDIKRLIGLKYDDKSVQRDIKHLPFEVVNNNGKPAVQVTVKGEKKVFT
                     PEEISGMILGKMKQIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIV
                     NEPTAAAIAYGLDKSKEEHQIIVYDLGGGTFDVSLLSIENGVFEVQATAGDTHLGGED
                     FDYKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDG
                     IDLSETLTRAKFEELNLDLFKKTLKPVEKVLEDAGLEKKDIDDIVLVGGSTRIPKVQQ
                     LLESYFDGKKASKGINPDEAVAFGAAVQAGVLSGEDGVEDIVLLDVNALTLGIETTGG
                     VMTSLIKRNTAIPTKKSQIFSTAVDNQPTVMIKVYEGERAMVRDNNLLGNFELTGIPP
                     APRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLSQDEIDRMVEEAEK
                     FASEDAAIKKKIEARNKLENYAHSIKNQVNGDLGEKLEEEDKETLLEAANDTLEWLED
                     NFESAVSEDFEEKFESLSKVAYPITSKLYGAADGGPAGAYEDEDEDEDGDYFEHDEL"
     gene            <714677..>715426
                     /locus_tag="HG536_0E03990"
                     /db_xref="GeneID:59326684"
     mRNA            <714677..>715426
                     /locus_tag="HG536_0E03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284266.1"
                     /db_xref="GeneID:59326684"
     CDS             714677..715426
                     /locus_tag="HG536_0E03990"
                     /inference="similar to AA sequence:RefSeq:NP_012499.1"
                     /note="ancestral locus Anc_5.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140162.1"
                     /db_xref="GeneID:59326684"
                     /translation="MLEVRLKHMRSAVRLAKFALDHGETPVACVFVHEPSGQVVAYGM
                     NYTNESLSGIAHAEFMGIEQLRERFGGGEELMCVMRDVVVYVTVEPCVMCASALKQLE
                     VGKVVFGCANERFGGNGTVIRVNGDRCTGGRGYVAVPGILRREAIMLLRYFYVRSNER
                     APKPRNKAERRLDRNAFPSLPWSRYIGRESFVEEFGEKMLCHFDDSTDIFGDLVDWDL
                     IDEPCDWILEHLKTQCQEFALHRRKKIKLEV"
     gene            complement(<715436..>716701)
                     /locus_tag="HG536_0E04000"
                     /db_xref="GeneID:59326685"
     mRNA            complement(<715436..>716701)
                     /locus_tag="HG536_0E04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284267.1"
                     /db_xref="GeneID:59326685"
     CDS             complement(715436..716701)
                     /locus_tag="HG536_0E04000"
                     /inference="similar to AA sequence:RefSeq:NP_012498.1"
                     /note="ancestral locus Anc_5.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140163.1"
                     /db_xref="GeneID:59326685"
                     /translation="MKAAEEVKEGSSKQENAGKNLKYRLEILVSDPQKRSGDQGTASS
                     YVSYQISTKTDNPIYHKNYGGDKNAIIVVHRRYSDLLLLHNILLNDHPTCIVPPLPDK
                     KVLQYIAGDRFSQSFTQKRCHSLQNFLRRVANHPTLSQSTVLMTFLVSKDWDAYRKSI
                     SGHLQTNKEEVTDAFMNAFKTVHKQSDEFIEIKEKSDKLDHNVAKIDKIFHKVVKKHD
                     LISEDYAKLGANLQDLQELCSGENDELAKKLRLFNEGITQLSFGIRDLSKFLDYEYIV
                     DLKDLEHYIDSMSQLIKLKDQKQIDYEELSEYLTKSVNEKNNLISGYGGSNFFTNKLE
                     ELAGINQEAARREKIDKLETKISSLTSELESAKKVADAFEQETLKEVALFEDLKTREL
                     KESLGSLADHHIEFYEKMLETWIKVDESL"
     gene            complement(<716904..>718340)
                     /locus_tag="HG536_0E04010"
                     /db_xref="GeneID:59326686"
     mRNA            complement(<716904..>718340)
                     /locus_tag="HG536_0E04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284268.1"
                     /db_xref="GeneID:59326686"
     CDS             complement(716904..718340)
                     /locus_tag="HG536_0E04010"
                     /inference="similar to AA sequence:RefSeq:NP_013115.1"
                     /note="ancestral locus Anc_5.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140164.1"
                     /db_xref="GeneID:59326686"
                     /translation="MKVGIIPYQAEELVRGNDSGPVRPRFPSVQKTHEIETKDDGVKV
                     FVKPEDIPLNRRNFVYRPCAPNPHFTELGYCCSEYPFRNAGMNVMDRSDGISLIKDGN
                     DLVSVNDSLGWRTSRCDACVKDGEAYWEVEVIRGGLLEPFPEDASLQKRKDVLNAIPH
                     LRIGISKREASLEAPVGFDSYGYGIRDHTLESIHEGIITQTLPLKSLKPGDRIGLLLR
                     LPTFEEQKQQADEYIQRRIAALSSHSSKPTSSNDYWASEDPGPNKKKTKKAFSNVDFQ
                     KALLEDIDNNNVIRDHIAIRYKNQLFFEATDYVKTTKPEYHSSDKREREEYYRLAHSH
                     LSVYLNGQPLGRAFEDLKPFLPPFSELQYKEKFFFDYWRHGSASNNDKGVLDSTQKKG
                     LLLRNKYVNNNKLGYYPTISCFNGGTARIITQRSELKFLDEILKAHPRPNDVRVLETL
                     YQEQIAEDIVWDIVDEVEEEINAKLLKV"
     gene            <718526..>721105
                     /locus_tag="HG536_0E04020"
                     /db_xref="GeneID:59326687"
     mRNA            <718526..>721105
                     /locus_tag="HG536_0E04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284269.1"
                     /db_xref="GeneID:59326687"
     CDS             718526..721105
                     /locus_tag="HG536_0E04020"
                     /inference="similar to AA sequence:RefSeq:NP_013114.1"
                     /note="ancestral locus Anc_5.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140165.1"
                     /db_xref="GeneID:59326687"
                     /translation="MAEGDKKSVNSRKRPSSAVTGITKSISACKRCRLKKIRCDQEFP
                     SCVKCAKAGEPCVSLDPATGRDVPRSYVIFLEDRLTAMMKKLKECGVDPTQVQGNMPA
                     TSSDNPINLDLYEETLRQEHEMPHDNVFAAYLINKATSMQRGVSASSDVVGERPKSDV
                     TIDAPSSEGLVHQLNELDEPDKSVAALGAMKSNASNSYLGDSSGIPFAKLVFTAVNFR
                     PDLVGDDSDEEIKQRNGRYAEYNASESSGNFDPVWLPSRNAAETLISRYFVESNSQLP
                     VLHREYFLKKYYEPIYGPWDPDLSIASDHTKINTSFKLPKRTSEDCPANNGKHIDEQA
                     GEHRPWYDVLNNSEKVADSKVEVLEEYCLPYFFLNMVFAIGESVTVLQSDIHDVVTFK
                     RRAMHFSKALYGSPDRMEVLAGTILIAIYSLMRPNVPGVWYTMGSVLRLTVDLGLHAE
                     KLNKNYDPFTRELRRRLFWCVYSLDRQICIYFGRPFGIPEENVTAQYPSVLDDALITT
                     SNDDISDYSKVKTSISTPKVIALAMFKIRRIQASIVQVLYAQHGEVPRRFADLEFWRS
                     YMHEIIDKWFEREVPRTHKKMNCKFTTEFFSLNYFVTKCMLYGLSPKNLALSDRDFEI
                     VYDATKGTIETYDILCTKQKINYTWVAVHNIFMAGMTYLYVVYYSDKGLREGRQAVKL
                     RTTAILKVLKELIGSCEAAKSCFIIYKVLSSAVIKLKFNGNQQRSGETQSREQNLPLI
                     DSNATKPEPAARFFSDRATRNLNIKEEPLNFDNSLDQFFNELEKVASASENESSVGQL
                     SNVNSPNIGDRQDRTDKQNDSSFTAKDGQRLIDMISQVTTESIWDELFGKSMNNEAFA
                     STD"
     gene            721292..721373
                     /locus_tag="HG536_0Etrna9S"
                     /db_xref="GeneID:59326899"
     tRNA            721292..721373
                     /locus_tag="HG536_0Etrna9S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:59326899"
     gene            complement(<721569..>722591)
                     /locus_tag="HG536_0E04030"
                     /db_xref="GeneID:59326688"
     mRNA            complement(<721569..>722591)
                     /locus_tag="HG536_0E04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284270.1"
                     /db_xref="GeneID:59326688"
     CDS             complement(721569..722591)
                     /locus_tag="HG536_0E04030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140166.1"
                     /db_xref="GeneID:59326688"
                     /translation="MSTEKITFLLNWQPAPYHIPIYLAQQKGYFKEQGLDLAILEPTN
                     PSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGLLYLNGSGITED
                     FQSLKGKRIGYVGEFGKIQVDELTKHYGMKPDEYTAIRCGMNVAKHIIEGKIDAGIGI
                     ECMQQVQLEEYLKKQGRPSTDAKMLRIDKLACLGCCCFCTILYICNDAFLAKNPEKVR
                     KFLKAIKKATDYVLAEPEKAWNEYVDFKPELKNDLSFKQFQRCYAYFSESLFNVHRDW
                     KKVTGYGKRLEVLPPDYVANYTNEYLSWPEPEEVSDPLEAQRLMAIHQEACRDCGGFK
                     RLVLPA"
     gene            <722912..>723361
                     /locus_tag="HG536_0E04040"
                     /db_xref="GeneID:59326689"
     mRNA            <722912..>723361
                     /locus_tag="HG536_0E04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284271.1"
                     /db_xref="GeneID:59326689"
     CDS             722912..723361
                     /locus_tag="HG536_0E04040"
                     /inference="similar to AA sequence:RefSeq:NP_013110.1"
                     /note="ancestral locus Anc_5.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140167.1"
                     /db_xref="GeneID:59326689"
                     /translation="MATEWQPEAPPMSRLFVHTAELAQWVHCEEQPAAPVRYRLLGQL
                     AEITTTGESIELHIRDLPEFGNAGQEGIRAVVGSRVYESRFVENAGVDKEIARAGCAL
                     SVCLGVVLQRDGTRILEVFDVQVLKRREIERLRYFICSSLGSELIRS"
     gene            <723429..>724574
                     /locus_tag="HG536_0E04050"
                     /db_xref="GeneID:59326690"
     mRNA            <723429..>724574
                     /locus_tag="HG536_0E04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284272.1"
                     /db_xref="GeneID:59326690"
     CDS             723429..724574
                     /locus_tag="HG536_0E04050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140168.1"
                     /db_xref="GeneID:59326690"
                     /translation="MLTLRRFQHTFQRFDVAIVRSLAKPNEQFHLSQPLQPGLAVKTG
                     NGPILHDDIIGKPYRSLLEAGASKYIVTKPTLEEYVVNRRREAQPIYALDAGMMVELS
                     GICVDYPQLRVSEQARALRPPATLKLLNADDPYDLALIRRLQERKGALQANLTATRPP
                     KQFLECGTGHGSLTLNILKEIHGGNAFYDGENDLTRGSILHSLDRSEKHIKVGVRNVK
                     HYMRGMYWPDVEFHLTDRGPSEWLQSEISSYYRCQLGQARENEPFLSGAFLDMPSPEL
                     HLSVLSDALTVDSPIVVFVPSIMQLWDCLSHIKTHGVRLTLTKVCELMAGSGGGMREW
                     DLRRVSVRETGQHGVVMRPKVGARIVGGGFIGVFRKLPNDSIVKKWD"
     gene            complement(<724682..>725266)
                     /locus_tag="HG536_0E04060"
                     /db_xref="GeneID:59326691"
     mRNA            complement(<724682..>725266)
                     /locus_tag="HG536_0E04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284273.1"
                     /db_xref="GeneID:59326691"
     CDS             complement(724682..725266)
                     /locus_tag="HG536_0E04060"
                     /inference="similar to AA sequence:RefSeq:NP_013109.1"
                     /note="ancestral locus Anc_5.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140169.1"
                     /db_xref="GeneID:59326691"
                     /translation="MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRR
                     NPRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVQTTLKAMDRIEEIRQK
                     RERAFYKNRMKGNEEREFLRDKALVEANPELLRMREVEMAEKLAKQQAEEEGEEEEEV
                     DEEMEVESEEEEEQERKHKVVLKNKKKNSKKVAF"
     gene            <725503..>726012
                     /locus_tag="HG536_0E04070"
                     /db_xref="GeneID:59326692"
     mRNA            <725503..>726012
                     /locus_tag="HG536_0E04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284274.1"
                     /db_xref="GeneID:59326692"
     CDS             725503..726012
                     /locus_tag="HG536_0E04070"
                     /inference="similar to AA sequence:RefSeq:NP_013108.1"
                     /note="ancestral locus Anc_5.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140170.1"
                     /db_xref="GeneID:59326692"
                     /translation="MSGNGVNDRNVLEVPQLPIPGENNSKLSKNETRVTYDTSNQQLV
                     GPGKNGMDLYFDQALDYMGKHPVATGFGAFLTLYVVAGAYKSISTRISGGSASKAFLK
                     GGFDSKMNAKEAFQILNLNEANLNKKKLKEVHRRIMLANHPDKGGSPYVATKINEAKD
                     FLEKKVLRK"
     gene            complement(<726055..>727020)
                     /locus_tag="HG536_0E04080"
                     /db_xref="GeneID:59326693"
     mRNA            complement(<726055..>727020)
                     /locus_tag="HG536_0E04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284275.1"
                     /db_xref="GeneID:59326693"
     CDS             complement(726055..727020)
                     /locus_tag="HG536_0E04080"
                     /inference="similar to AA sequence:RefSeq:NP_013107.1"
                     /note="ancestral locus Anc_5.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140171.1"
                     /db_xref="GeneID:59326693"
                     /translation="MSVQVSGRSAGQSKLTDNDLGRYILHYLMSSRGICEENVLLIAL
                     MRLCDEPVEEAGEMDIEGWQKRLSDVIKRINLKLNGLDYKVVQISHGMGKNIVASKSK
                     EAMQFCSRAITSPGATALSATNRFYVYIDVGAVEETKLATRFSQKEVDFIKHAIQKTC
                     ESGFNIRQGEVSATSAVVQEVDRVRRLVLERAGAAFEPWDRYTTFAVGSSLLTQHRAL
                     NALEIEDMIIRLCEYKWFCRNEKGEISLDLRCIAELEDDLLSTYEFPACQNCNRLAIY
                     GVMCLHTDDAPAMWHVDCYQYQIAHKDTHCTACGESLITNGVYVI"
     gene            <727260..>729278
                     /locus_tag="HG536_0E04090"
                     /db_xref="GeneID:59326694"
     mRNA            <727260..>729278
                     /locus_tag="HG536_0E04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284276.1"
                     /db_xref="GeneID:59326694"
     CDS             727260..729278
                     /locus_tag="HG536_0E04090"
                     /inference="similar to AA sequence:RefSeq:NP_013106.1"
                     /note="ancestral locus Anc_5.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140172.1"
                     /db_xref="GeneID:59326694"
                     /translation="MNNIDKMERKSPRDVGRATTLNSALPWKVWLRIEQWTDEINEPF
                     ALHFNEQDTIDDLKTKIFDKLNGLRWSRLNDNASIAIAYYVSRDFIDERTPPFPRPPS
                     SPVDATSSFSGRNRSFHYPKPLALGISEDFSRRCYSVTASPSRSASNSPNLVKIWQPP
                     LVRYRSASPYGRLGGTSVPHPQSTMNAAKRVPGVLNKSYEFPPEEKDNDSPDMKISFE
                     PDELIITVYSSLFGHIGSQRASEALFVVCNEREPALSVTAPPPALSAINASTYVPTNE
                     EIDRQLSDIQASGMKEGLFLETDLPHGSTNDNEEIEVPALLDSTTPTDEEGEIEREFK
                     LITNEEQLKKESRCLQDTEHATDSPKPAILLLPKNYTGGVDLNELDSKFSSDSSSPGS
                     TGGNDCETGRQSQQAISTSSYAPLDENEIGLIHPLLESERKKNTSSCPSSPQLPAKPT
                     TIVPSLRSNTSITSLHENQLPNGFTTPTNHEIFPKINVLIVEDNVINQAILRSFLKKH
                     KISYKVAKNGQEAVDRWKEGGIDLIFMDLQLPVFSGMDAAKKIRDLEKQNISKQNNSV
                     RTSNNKAPVIIVAFTASNSLVDKREALLSGCNDYLTKPVNLHWLSKKINEWGCMQALI
                     DFDGWKKGQSRMTDSVIKASPKFPKASEFNSGHSSSSRRSRNTSETRQ"
     gene            complement(<729432..>730835)
                     /locus_tag="HG536_0E04100"
                     /db_xref="GeneID:59326695"
     mRNA            complement(<729432..>730835)
                     /locus_tag="HG536_0E04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284277.1"
                     /db_xref="GeneID:59326695"
     CDS             complement(729432..730835)
                     /locus_tag="HG536_0E04100"
                     /inference="similar to AA sequence:RefSeq:NP_013105.1"
                     /note="ancestral locus Anc_5.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140173.1"
                     /db_xref="GeneID:59326695"
                     /translation="MGLDSDSDDEQVIVSSKESRRQKKRIDLDDLGEEGDGGENAGVV
                     NNGSKQSGDRRIRRSREQGKRKKLSNKNLQGANGGYAWEDEIKRSWDLVKVDEDGDMS
                     SLAASIIESRKKRSALKNITPYQRGIIRTLVLVLDCSEAMAEKDLRPNRHVMIVQYAI
                     DFVHEFFDQNPISQLGIVTMRNGLAQMISQISGNPQDHIDALKQIRKQEPKGNPSLQN
                     ALEMSRGLLLPVPAHCTKEVLIIFGSLSSTDPGDIHQTIASLVQESIRVKVIGLSAQV
                     AICKELCKATNYGDESFYKVPLDETHCKELFEEAVVPLPVNKINRGFTLVRMGFPTRI
                     FEDSPTFCACHSQLMYGGYFCPNCQSKVCSLPTVCPCCDLMLILSTHLARSYHHLMPL
                     KTFSEVPSTENFPTDNCFSCQIRFPTIKNNKTGELLTSSRYRCENCKQDFCIDCDVYI
                     HEILHNCPGCESQPVIM"
     gene            <731446..>733071
                     /locus_tag="HG536_0E04110"
                     /db_xref="GeneID:59326696"
     mRNA            <731446..>733071
                     /locus_tag="HG536_0E04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284278.1"
                     /db_xref="GeneID:59326696"
     CDS             731446..733071
                     /locus_tag="HG536_0E04110"
                     /inference="similar to AA sequence:RefSeq:NP_013104.1"
                     /note="ancestral locus Anc_5.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140174.1"
                     /db_xref="GeneID:59326696"
                     /translation="MSAAASAISYVESRGKEEDVTTNVKADDVSNSSDNYGSSTLDEA
                     DDEVDVALLFLKENHAKETVIEKDDQLRTAEEKSRANFYGASDLPPKVLRKLDIFVLP
                     FLCCTYLLMFLDKALLNYAAAMGIKKHLKGNEFSNLGTIFSAAYIFMEPIVTYLIQKF
                     PISKIMAIFIVCWGIVLACHSACKTYASLMVVRTLLGMFESASAVGCIAVSGMYYTKS
                     EQSARIGYWAAQAGTGYIIGGLISFGFLHYHGKSFTSWQIMFLVVGLVTVVFGIITFL
                     YLPDNVTNAWFLNQDEKVAVVKHIRDNQTGVENKKFKKQHVKELIFHDKLTWPMLAIT
                     AFSQISTGSIGTFSVTITQTFGFDSKQTALLQLPIGAITIIIIIVTTQMISRWNQITL
                     VTTSMYIPAIIGCIVMLALPLSNHVGNLLALYLLYSGSCVITNIYIWNSCNTSGYCKR
                     IVRNALTMIVYNVACIVAPQMFRAYSAPRYVPAKIALLVTQCVCVPLQLYVGYLSRRE
                     NLKRDKEQEGQVIENYQFLDLTDIENRSFRYVY"
     gene            <733701..>734534
                     /locus_tag="HG536_0E04120"
                     /db_xref="GeneID:59326697"
     mRNA            <733701..>734534
                     /locus_tag="HG536_0E04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284279.1"
                     /db_xref="GeneID:59326697"
     CDS             733701..734534
                     /locus_tag="HG536_0E04120"
                     /inference="similar to AA sequence:RefSeq:NP_013103.1"
                     /note="ancestral locus Anc_5.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140175.1"
                     /db_xref="GeneID:59326697"
                     /translation="MSNPDDLEDGLLYDYQSDTESNHIKEVSPETADKADEVLSDRKR
                     APEDNASEKKLLSKRQKKLGNSSLRDKKKELFEYEIERRKALAKSSPEVIVDYFAALV
                     REKNPNLSALELDDLYFKKSDFISTEKFEKDRSLTNFPDFVSQFTKAPRALILSMSNM
                     RVADIFRSLNGSKNCVKLFSKNKLKDDLAIVERVFEKKTNEKTQNIKYFISTPTRINK
                     IFESSELFFQGKDKLDVILDASYLDPKKNTLLSSDNTMILCQVLKLVLERKSSVKILL
                     Y"
     gene            complement(<734571..>736685)
                     /locus_tag="HG536_0E04130"
                     /db_xref="GeneID:59326698"
     mRNA            complement(<734571..>736685)
                     /locus_tag="HG536_0E04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284280.1"
                     /db_xref="GeneID:59326698"
     CDS             complement(734571..736685)
                     /locus_tag="HG536_0E04130"
                     /inference="similar to AA sequence:RefSeq:NP_012538.3"
                     /note="ancestral locus Anc_5.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140176.1"
                     /db_xref="GeneID:59326698"
                     /translation="MSDQRVFTRYKANELRAELQAFDVKKSKSSANKRKNALRKIVAN
                     LTMGNYSEMAILIPEILKFWKIEDDLEVKRICHEYVRSLGSARPKIALEALPLILGDL
                     NSRNEQVQIMALETLVAVPVSEFFEEATKNVLSFINRRSVPPNVTKTAIYASEQLEFT
                     GSARTDLLDLLLNLIERENTQPTLRIAALHALHTIHDRNMDLQPLRLHMDTSFKLLDL
                     LPQLNEWDKALALESLTISAVPENHEDAYEMIDIALTQLQHVNTFVALNAFKFVAYLL
                     NYVDQVDESLIKRFSNSIVSLLNKPPEIQFLVLRNIILLLLSRDTPLLQMDVSYFFIE
                     FNDPIYIKDTKLECLYLSANRDSLSRILEELEQYATDIDIQMSRKAIRAIGNLAVKLD
                     RDCAAECVSALLDLLEFGVDYVIQEIISVFRNILRKHTEDFTSIINKLVEYKDSVQEP
                     ESKNAMIWIITQYSRDIPNYLQVFDTFSSNIKEETLEVQYSILNSSVRFFVRDPNPAT
                     EKNCLQMFKVCTEETNNPDLRGRAFMYWNLLSMSQSPKNHLMSSDAIKKIVDGELPVI
                     ELNTKLDPLVLEELELNVGSIASIYLKPVSQIFRTDRTKHLLRSPVLNKDRKHIKILR
                     RSTSGLNFDGFDALPELVSRNDSDRRSNISARRTKMNDYDKPAEKVNHLKGKRKSSST
                     SPSKITRKPSMLVRKLSIRRPF"
     gene            <737705..>740437
                     /locus_tag="HG536_0E04140"
                     /db_xref="GeneID:59326699"
     mRNA            <737705..>740437
                     /locus_tag="HG536_0E04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284281.1"
                     /db_xref="GeneID:59326699"
     CDS             737705..740437
                     /locus_tag="HG536_0E04140"
                     /inference="similar to AA sequence:RefSeq:NP_012537.1"
                     /note="ancestral locus Anc_5.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140177.1"
                     /db_xref="GeneID:59326699"
                     /translation="MSSFRFYSLSLIISSLAFAAEIAQISFAGLSYTPLTSLHYPQQG
                     WKASFDFSIGQSVSTGDFFELSMPHVYRLKFDNDESTMTAQLSDGTQAFKCYVTQQAA
                     YLYEDTVFRCEATTDLSAAVSGSMSFSLSFSNGGSAYKYELQNAQTFHAGVNEVQLSD
                     KMSAPINFDAYDFNGDIYTIGRSTTYNKFESYYLGMKCADGYLLGGTQTINYDNLGKN
                     FALDCSSAQVYLSDNFNDWFLPVAYEKAYANITCSANSLQVSLNEAKPKESLWINALQ
                     SVAQGINTIQHDVHLIYSCSNTLQKTVQTKELHTIVEYTIYQGTAAATLSGTSNQQVP
                     TSTKSCSKCTAASSDASTQTTGTCSQYSDSLMTSSSKSGTSSESCSSPLRSSSVITDH
                     TTPCTVCHSSEMMSSSSGASTSSTISSPSSRPASLSTSTPSTSSTVTSATGTTSSNLS
                     SAPSTTSISSIKITSSSSFLTTSSTSPTSFFSSNTNVLSSSTKTSSAISRTSSTDISS
                     NSLITSSSTNISSSSTNISSSSTGIHSSSGERPSSMSNNTSAHSSSTETSTLNSSTAS
                     QSIGTFSSSASPPPVSSASYFTTVFSSSGTEATSSGSSSPSSSNSSPSSTRNSLTSLS
                     SLSSSSITSLSTGVVNTSFIYSWPSSPVSSIPFTSSSSILPSFFSLTSTISSQGTAPS
                     DSSAISISTSCWTSLDSSCTTETSMASDTKFYTVETISCSHCDASSISVSDSGLFPQS
                     RTTTSLIVSSIGGANISHFASCTNCPASTATQFMGTGTSSDLQLLTTTTTSETDTINP
                     SQNIPPELQSSRDTGSVSSDRGLVVSSPVWTGDVITTEIFQMGTTSTKNDTTILETSL
                     ITIVSSKSHTKPVSLQPTPLVSESSSSVYEGAAFCYGEERRNTAFLALLLLMLL"
     gene            <740612..>742156
                     /locus_tag="HG536_0E04150"
                     /db_xref="GeneID:59326700"
     mRNA            <740612..>742156
                     /locus_tag="HG536_0E04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284282.1"
                     /db_xref="GeneID:59326700"
     CDS             740612..742156
                     /locus_tag="HG536_0E04150"
                     /inference="similar to AA sequence:RefSeq:NP_012536.2"
                     /note="ancestral locus Anc_5.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140178.1"
                     /db_xref="GeneID:59326700"
                     /translation="MLSLIRFLGTRKRLVHTGSISSTRAVANFLQHECLNPIRNELPS
                     HSKIESPYELSKWLNEIMARSYLSDEEASAIHNRLIEELCQHEYGISQIHAKKLRELR
                     QPLSGKSILEIVKNNPGRVSTSWELLLKHYESLALLPDELLNSALENTVLSIETKDTE
                     NQDLPSMVQSIILLNNIRDKKLVGPSIVEKLVADILETDATCLLSTLLAEHDFPITVF
                     EQRMDVLSDYQIYLLAKNCPFDLLSKNEELLLLAVNVMGKKTKVHLNERETQKAKEVQ
                     ECFSRVKDDIPENWKVEKIATRPIESAAEFIRLFEQIKAERLDERNLKLAKKLLRIFG
                     VFRGNTKISLELYHSYLIRYPDDSRELMFETFLALAYQSYETGNKELLGYAEAFIPDN
                     AGQSMLANIYRVLILVKSRFDIEHSLQLYNENIESLSKENDSNTNIAPAGLVAEALIL
                     SYLSQNDLDFARVIFDGSVREKLVSGPTAIKRIKRYMALYGETVEEGKTQETMKREVQ
                     EMLRNI"
     gene            complement(<742410..>743225)
                     /locus_tag="HG536_0E04160"
                     /db_xref="GeneID:59326701"
     mRNA            complement(<742410..>743225)
                     /locus_tag="HG536_0E04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284283.1"
                     /db_xref="GeneID:59326701"
     CDS             complement(742410..743225)
                     /locus_tag="HG536_0E04160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140179.1"
                     /db_xref="GeneID:59326701"
                     /translation="MKVVLVDPSSADNRWRFKTCLQESSKGIRNGLKSFDLTNCPLQF
                     HNCHVRTSLGECRLSSEEVDDSSYKKLHRTQDDEQISQYVNLNKELIFKDCFSTEFLS
                     SKYSRRPKNCSSTNLRENLFVPSRGGLALDKSEKRTCRPSGAPKTALTVINFGCPRKV
                     VKSKVSDLKFANTADVADRRLASEIGAICEQLLANLNTQNMSRSSADLNLSNNQNIDP
                     VTTPSTEWRWKLQKSRAQSDNSCLTCTFRVKAQEPQVYKSRKVKMRSLSRSGP"
     gene            <743458..>745455
                     /locus_tag="HG536_0E04170"
                     /db_xref="GeneID:59326702"
     mRNA            <743458..>745455
                     /locus_tag="HG536_0E04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284284.1"
                     /db_xref="GeneID:59326702"
     CDS             743458..745455
                     /locus_tag="HG536_0E04170"
                     /inference="similar to AA sequence:RefSeq:NP_013102.1"
                     /note="ancestral locus Anc_5.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140180.1"
                     /db_xref="GeneID:59326702"
                     /translation="MAKSKRGLKAIQARTAKKRKQQDAQLLENGFQNASNFTDTEDHY
                     EDVAKTRTDSWEEEQDYELRPRKLQDYGEEVVEGLPIKVNGRIERKLRKKTSSTKDSD
                     REEVNEGDDEELSDERSESPTSDFEQDVKSDEELDTEESIIALKEEIADLVEKIIEEP
                     EENTAALSRLCRMAGSKNPNTCKFSMLALVPVFKNIIPGYRIRPLTDLEKKEKVSKEI
                     GRLRNFEQTLVLNYRRYLDLIKDLSKVPNNDDPLKVSLGALATQAANELAPNVSHFNF
                     RDDLITTLVRRVCKPNLHADPVSSLSIKTLEVLLNDDDEGNISLSVVRILAKTLKVRK
                     YNVDESVLNILLSLEVLQDYDPNTKTEERVTKPRAKKVHLSKKQRKARKELKAIEDEM
                     RKAEQSVSAEEREKNQGEILKVILSLYLNILRMDSSALVGSVLEGLVKFGSMANLELL
                     GDFLEVMKDIIRNTDIENPTSLTVRKILLCIVTSFSLVAAHTQMKLHTDLSTFVDALY
                     ALLPHVSLDPDLELSHKSLRLADPLHNDLIKPSVNVSTKAELLLKALDHVFFRSRSGT
                     KLKALAFTKRLYTCMENTPEHTTIALLKFLEKLMSRYPELSGLYSTEDRVGNGIFIME
                     ADNPTRSNAESAVLWENNILRKHYCPVVVKGIKSLASHSKN"
     gene            complement(<745561..>747354)
                     /locus_tag="HG536_0E04180"
                     /db_xref="GeneID:59326703"
     mRNA            complement(<745561..>747354)
                     /locus_tag="HG536_0E04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284285.1"
                     /db_xref="GeneID:59326703"
     CDS             complement(745561..747354)
                     /locus_tag="HG536_0E04180"
                     /inference="similar to AA sequence:RefSeq:NP_012535.3"
                     /note="ancestral locus Anc_5.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140181.1"
                     /db_xref="GeneID:59326703"
                     /translation="MSRNFIEAIQSDPISIFYKEPSFPLKSVKTYLDGVIKLSRQSGF
                     QSSDIDEITIDGMDANQVWWQAKMVLDSVEGNLLAKIQEYQEDATSTGQDSENSDSNS
                     DSDFSSAQENAEVDLEGIEDEAENASESENASYTGDLKVGGLSKTAYLAAKEDSEDES
                     SDMHEESMTYSGVDEPDQDEGADDEENGLNDDFFNLEEFNKQTTGIEDGTGIDTDDES
                     VDWFNEIPSDEEEEAVYYEDFFDKPGFQNQKANIDRTKNSKQSDEHLAEADYDDAVDS
                     VKLDLFAEEQEASELEDVNPGTSLSTYERQQIDIQKQIEQLEQEAVAEKKWALQGEIE
                     AQDRPADSLLTEDVEFDRTAKPVPVVTTEVTESIEQMIRRRIQEYNFDDLPKRVISDV
                     SSQSAKPQFELSDQKSARSLAQIYEEDYKNIPQDAEISEEIKKSHDEITSLFTNLCYK
                     LDALSSAHFIPKPAEKSLEVRVDTAAISMEDAQPLSMSSASALAPQEIYKVERSRNMN
                     EITLKNGITMSKDELTRDDKNRLRRAAKRKRSKTASQITKKKSKKDEVINTLAKNKNV
                     TVINSKGEKHDVRGRVINLNDSGEGANRIKL"
     gene            complement(<747760..>749559)
                     /locus_tag="HG536_0E04190"
                     /db_xref="GeneID:59326704"
     mRNA            complement(<747760..>749559)
                     /locus_tag="HG536_0E04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284286.1"
                     /db_xref="GeneID:59326704"
     CDS             complement(747760..749559)
                     /locus_tag="HG536_0E04190"
                     /inference="similar to AA sequence:RefSeq:NP_012534.1"
                     /note="ancestral locus Anc_5.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140182.1"
                     /db_xref="GeneID:59326704"
                     /translation="MPGDSERQPLQDGDSSQPQVHYISIPIKRTSEYGTEDLSAPAGG
                     FTTRRQSILDQPIGSFRGVNSLSRFATSLRRANSFRHIDVHPEIQRNYFEDANDEIYD
                     PDTMAPAHNGRKLSIALNRAGNISVRPSITNLDGRRPNAAYQDLDDYGAISDSNSVIR
                     ADGSVAESISGVSYSDLVPPDTESIMIKRIEGKDGAVVTVLAGQSTAPQTIFNSINVL
                     IGIGLFALPLGLKHAGWVLGSALLLLLACGTFCTAELLSRCLDTDPTIMSYADLGYAA
                     FGRRGRALISCLFTLDLLGSGVSLIILFGDSLNALFPSRSSNFFKVVGLFAVTPAIFI
                     PLNILSNISFLGIMSTIGTVFLIIFCGFYKAEAPGSLLQPMETHLWPESFMGFCLSIG
                     LLSACWGGHAVFPNLKTDMRHPEKFKDCLKTTYKITSVADIGTAVVGFLMYGNMVHDE
                     ITKNILLTAGYPNFVYGALSALMAVIPIAKTPLNARPIVSVLDTLMEIDNAERKFEGN
                     RLYFAKGQRVFNRIFVNVLFVGVAIVFPKFDKLIAFLGAGLCFAICLILPCLFYIKIC
                     KKTIKPWEQLLCHIVIGLSIVLAILGVGAAFLA"
     gene            <750255..>752798
                     /locus_tag="HG536_0E04200"
                     /db_xref="GeneID:59326705"
     mRNA            <750255..>752798
                     /locus_tag="HG536_0E04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284287.1"
                     /db_xref="GeneID:59326705"
     CDS             750255..752798
                     /locus_tag="HG536_0E04200"
                     /inference="similar to AA sequence:RefSeq:NP_013101.1"
                     /note="ancestral locus Anc_5.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140183.1"
                     /db_xref="GeneID:59326705"
                     /translation="MKGLPYAIAGLLSCVATVQCLGEPCKDCDFTSVVDILSASAMFS
                     TFLRVLQRNGDIPTLNELQNFTLLAPVNTAFAGLSDSESIAGFDISNYILRDRVLETS
                     AIDNGTSVIYEGVKFPLGLRRDESGPIRINGAAVVESDLKPNFQNATVHGISELLPDP
                     PNSRGLVHDINREGRSVNIFHSFVESFPGFEQMTDNNTLLIPSDVNFFKCFNHIEINY
                     ILDTFDELSSLDGPLAGSWSHDRQIFLQNLICHGIIGGQTANRQIVKNLNNQPVQVTS
                     HELGSSLSVNDSTPSNQANMIFDRGIAHSFSDLPFLPDAFQFTAEKYLHGMNSTDFVK
                     ELYFRKLQHMIREKSLHQNLTIFVPEFNSNEHQGFTKSSLLYHFVEYQLWLEEEFKDV
                     NRIHSSTKTFPSAFCSSNKRLGGNCQRLRITKTESSYIINDKYRVLHAKPYMVGRTLV
                     YTISEALQLPGEFLFSLNPFHHCSKSLSLLRQVNLLNLPLNNKGYTILLPCFDSWRNY
                     DLNFEYLRNNATAVEHIAKSMILQSLIYSDTKTQTIEVSNMLDEEVSLSIHPPRSNRV
                     DIELSNVVGKIKIERGLDALFNQGVIHPLKGFYLPKDINISLKDLIETSGANRFLELL
                     ENLEDFTSMINESIPFSVLVPMSTFLGPGGITGSSKNLQDFLKVHLAIGSSTHSLLKC
                     DGTISTLFGEPLICRQSSTGDYWLKLQNGDDHEVRILRRGCASSGNESCVFLIDRPIS
                     IRWLNRDKKSLRLPGIAIGAGVLVGSVSMLAVFLCILLVLFGKSAKRSPLPASADEEH
                     TNQEARPLLANNDSSRAISNLSHEQNGRFESTYSSNASVPAIDVAYSPR"
     gene            complement(<753190..>755538)
                     /locus_tag="HG536_0E04210"
                     /db_xref="GeneID:59326706"
     mRNA            complement(<753190..>755538)
                     /locus_tag="HG536_0E04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284288.1"
                     /db_xref="GeneID:59326706"
     CDS             complement(753190..755538)
                     /locus_tag="HG536_0E04210"
                     /inference="similar to AA sequence:RefSeq:NP_013100.1"
                     /note="ancestral locus Anc_5.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140184.1"
                     /db_xref="GeneID:59326706"
                     /translation="MASLEDLIPTVNKLQDVMYDAGIDTFDLPILAVVGSQSSGKSSI
                     LETLVGKDFLPRGTGIVTRRPLVLQLNNIATDSPIIKEHPSLQSATPAESEQSNGIGG
                     KHELEDREITLEDHLRKNTENYQAPNTEEWGEFLHLPGRRFYDFKEIRKEIEKETARI
                     AGKNKGISKVPINLKVYSPRVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILEYVAT
                     PSCIILAVSPANVDLVNSESLKLAREVDPLGKRTIGVITKLDLMDSGTNALDILSGKL
                     YPLKLGFVGVVNRSQQDIQLNKTVEEALDNEEEYFNRHPVYRTISNRCGTRYLAKLLN
                     RTLMSHIRDKLPDIKARLNTLIGQTEQELTSFGDTGPIKNENRAGLVLQLMNKFATNF
                     ISSIDGTSSNISTKELCGGARIYYIYNNIFGNSLRAISPTANLSILDIRTAIRNSTGP
                     RPSLFVPELAFDLLVKPQIKLLLEPSERCVELVYEELMKICHNCGSPELARYPKLQSM
                     LIEVVSELLRERLGPTRSYVESLIDIHRSYINTNHPNFLSATEAMSDIVASRKKTSIL
                     KAKKVQQETHAVEQLPKADKGTDRGPSLTASLRVESESSVESGSEDEDFEIKNSKDSF
                     LKYFFGKDQKGQEFNAHNGEVRRSSPLENDISGQTLADMKYLQISNDTEIGAIDNDRN
                     NEPALTEREELECELIQRLIVSYFSIVREMIQDQIPKAVMCLLVNFSKDTVQNRLVTK
                     LYKESLFEELLMEDQALAQDREKCMKLLDTYKKASNIVGSIL"
     gene            complement(<755790..>757079)
                     /locus_tag="HG536_0E04220"
                     /db_xref="GeneID:59326707"
     mRNA            complement(<755790..>757079)
                     /locus_tag="HG536_0E04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284289.1"
                     /db_xref="GeneID:59326707"
     CDS             complement(755790..757079)
                     /locus_tag="HG536_0E04220"
                     /inference="similar to AA sequence:RefSeq:NP_013099.1"
                     /note="ancestral locus Anc_5.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140185.1"
                     /db_xref="GeneID:59326707"
                     /translation="MFLNEALKSVLPEGQEFETLHLRSPPIECHPLVTKQSSSSNDWI
                     TVKAQHFFILFHNGKTIFGLQIYVYINLKAAGSSTQDGERMIFISKADTTGHADCKVN
                     YRGVTKVVIEYLLSLDPNSYLQKVIPKQRDYGKIEAILITKKTSSIRALRILSNRSVS
                     SDSPEEKSQSQFYNSYRCKPGLKTKVCLFTRPAPQYLFPESSKNPKKRVIDGERLLRW
                     WISILDDILHGTFQSGTEARLLIPGEDSTSIRRYLRDLKYGGWEVGDIFGTKDKDIAV
                     YHVPLFPDDPKARFLRQLVEENRARKTTLETFWIELQNRQEFKLSVAVSVIGIQGLTA
                     VESLQRPSPCDVVLSSRKDFNALKRYVTGEKYDTVAGAAEAYSNVRDYLSIRCNQKMT
                     IIVGQYATGCETRNLDFKSKKTGITANTLQPRKKAKK"
     gene            complement(<757273..>757984)
                     /locus_tag="HG536_0E04230"
                     /db_xref="GeneID:59326708"
     mRNA            complement(join(<757273..757855,757920..>757984))
                     /locus_tag="HG536_0E04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284290.1"
                     /db_xref="GeneID:59326708"
     CDS             complement(join(757273..757855,757920..757984))
                     /locus_tag="HG536_0E04230"
                     /inference="similar to AA sequence:RefSeq:NP_012533.1"
                     /note="ancestral locus Anc_5.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140186.1"
                     /db_xref="GeneID:59326708"
                     /translation="MNGIQVDVNRLKKGEVNLGTSIMAVTFKDGVILGADSRTTTGAY
                     IANRVTDKLTKVHEKIWCCRSGSAADTQAIADIVQYHLELYDSQYGEPSTKTAASVFK
                     ELCYENKDNLTAGIIVAGYDKKNKGEVFSIPLGGSMHKQSYAIAGSGSTFIYGFCDKN
                     FKENMTKEETINFIKHSLSQAIKWDGSSGGVIRMVVLTEEGTERLIFYPEDYETL"
     gene            complement(<758208..>761096)
                     /locus_tag="HG536_0E04240"
                     /db_xref="GeneID:59326709"
     mRNA            complement(<758208..>761096)
                     /locus_tag="HG536_0E04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284291.1"
                     /db_xref="GeneID:59326709"
     CDS             complement(758208..761096)
                     /locus_tag="HG536_0E04240"
                     /inference="similar to AA sequence:RefSeq:NP_013098.1"
                     /note="ancestral locus Anc_5.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140187.1"
                     /db_xref="GeneID:59326709"
                     /translation="MSFQSSTESLLFNSSRQNPDGNRLESSSTESLLNDNALSSSTQS
                     LINQSVQELLSRLHFPDTLIVDSESPDSTVSPILVSPNSISAFPPETERSNYQNVPAI
                     RMELSEEASPLLSLLYNRIQVFLLRNKLSLDFLRIYKRYVNCLLESGLNPLEDRYFHR
                     LQNELSESYEFTPRMQEILDAFLINPQNLIMKLALFEHRKMGNLICRYFEKWEWNCEI
                     RRSLNQLEGIWKEFLKRKYLLLWSKKRHIIVIDLPSQGEDFRHFNLVSSLFDRWLARI
                     ETTEARKGLADHYLMDHALQRVVKRMNHVADMGEQAGLRYDAVSKKAALKQWRLRARE
                     RHFTTRQVNFKRFFFSRAKLKLAFHEESEQRAAFTRRLLLMGSFFDDWRSRSYKEKER
                     LNSLAVLERKFIKTKALKFLIRYYREKEQELVARRQLDCISRKLFFEKIWKTRFRERL
                     HFYSFQKITEQRLLIKYSREWQTRFFSRIKASTFIGSQQLTRFFRTWQLETLLSRFIS
                     LSGKHIARALFLMWHDRLIAQKKVNHFQSDSLRQKYCRKWKEKFNVIKEADRKADVMY
                     AVSSVSHSFYQWSQRVRIIAEMSDRYNIFIALRAISRLKRGISHMNEVHRFWEVSCRS
                     PISKIVLLRFFRQWKEAAAARRSDKLELVLQVVEESVRLNDKRFYLQLWIQKTNFYQS
                     ECLTKAIQVYDRNLQLKCLLRINRKLEDIQVLSKIGDGLRTKSLSLYFFYRWRDQYDY
                     VQELLVKLETENNKKNLALLLNYLNYWSMKILKLNRNAETVQIFRKRWDRATVRGLML
                     LWKNKAEDSPRKTELTRVRQQLPSNSGLVTPIRRSATKNNTIPGSEGVKRYRIEAMKT
                     HYGRIRRAIPSPIKSSTTLNSLAKKKINSEVDAFTWNPRTIPPPRLSLERINKNLASK
                     IDRINFERIPEARLDPFIDEGQSDPKVDTSFLEEEQDIEFDESPIRRM"
     gene            <761316..>762731
                     /locus_tag="HG536_0E04250"
                     /db_xref="GeneID:59326710"
     mRNA            <761316..>762731
                     /locus_tag="HG536_0E04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284292.1"
                     /db_xref="GeneID:59326710"
     CDS             761316..762731
                     /locus_tag="HG536_0E04250"
                     /inference="similar to AA sequence:RefSeq:NP_012532.3"
                     /note="ancestral locus Anc_5.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140188.1"
                     /db_xref="GeneID:59326710"
                     /translation="MLNLFLWWLAGVACLFRAAECTLPSPAKVWNNVEYQKLIDVKHA
                     YINEAVELTIENISGEPVDEYYFALQENVYDKVSLFAVKLGDKNVFLNSSLHPGKSEL
                     EDGTMVGYGLVKFPSPIAPNERVSISVRISHNAFGIPHPSRISIAEEQSLLLRTPRLP
                     FSAYFTKKGNLKVIGSPRFGELDAVDDSSLNGKEIEGGLSFGSWKDVEPLETKYELKL
                     VYSHNLPIIEASRLKRDVWVSHWASTIQFEEYYEIINHSAELDKGFSRLELMKDQRGM
                     KLSHYCSVLEMNLPEQSTDHYYTDLVGKVSTSRVLGDHFYLKPRYPLFGGWKYNFTIG
                     WTNKLSNFLHKQRMAQDTYILSIPLLNGPTDTMYNEVELSVLLPEGAQVLAVDPPIPF
                     IDIGVTNQRSYLDLNTGHVKVTCNFKNLIDEIGNGQVLVKYRYDTNSLYKKPLSIALY
                     IFVALMSFFLLRSFNLSMDKN"
     gene            complement(<762819..>764726)
                     /locus_tag="HG536_0E04260"
                     /db_xref="GeneID:59326711"
     mRNA            complement(<762819..>764726)
                     /locus_tag="HG536_0E04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284293.1"
                     /db_xref="GeneID:59326711"
     CDS             complement(762819..764726)
                     /locus_tag="HG536_0E04260"
                     /inference="similar to AA sequence:RefSeq:NP_013097.1"
                     /note="ancestral locus Anc_5.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140189.1"
                     /db_xref="GeneID:59326711"
                     /translation="MNVSEFADAQKSHYTVFPQLKKLKTDTRTIPFVKLLDGKEPSDR
                     VEKRWELYHQLHSHFHAQVNDILENIGIDLRTEISELLFNRVDKNEKRKPAFNTLFLL
                     GSDSTTRIDVPKVTPEEFSTLVELTPKESPNVRMMLRRSMFKLFSAAEAELRDNVARI
                     KDEDEEHIELDAIYEADEVDADNESASGAENASGGGDVSYDLSLVQNFKLFYNKDLNL
                     VFNFKDVDSINFQVLDNFIILLKSALKHQHVQISLVFNINTNLSNFEKNLTQTTMRLL
                     RRSYHTLDVSSNKGYKYGNRIFQSFLDTVDGKLNLSSKFVDFILRKMANNSNHNLQLL
                     TKILDYALMSYFYQNPFSVFIDPVNVEYLNDDYLDMLIRCPTFMFFIEGLIKEGAPTE
                     EIRALITNKDATLTGFFLEFLVRENPINGFAKHVANFLEKKLQIYNYNLIAIYHKLLE
                     GKLETYLERWPAYQKYKEDLRFEPVDTIFQELFTLDNSNGLLSQAIFPRYRSNMEDDL
                     LSWERVLRVSSEKTGADPAARLDAAMSPIAGHLFKLYREAGLSINVYDFYTTFKETLP
                     RNEIRNFLQQLNDTRMEKFLKKNSEEEAFDKVSLALFMQALFDFDHIGIIKTQSNKNH
                     DIIEKCIWRGI"
     gene            complement(<764979..>765329)
                     /locus_tag="HG536_0E04270"
                     /db_xref="GeneID:59326712"
     mRNA            complement(<764979..>765329)
                     /locus_tag="HG536_0E04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284294.1"
                     /db_xref="GeneID:59326712"
     CDS             complement(764979..765329)
                     /locus_tag="HG536_0E04270"
                     /inference="similar to AA sequence:RefSeq:NP_012531.1"
                     /note="ancestral locus Anc_5.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140190.1"
                     /db_xref="GeneID:59326712"
                     /translation="MAGRKFRSRKEQLVYDASIAGKYQKRLKKNPFLYFGLPFCSLIV
                     LGSYWLSGFTAVKYEQQDRKVQEVQEEDLIKMRTNQRKFDLKEEYYRLQGLSEQDWEP
                     VRVPRPNGESENVW"
     gene            <765556..>768207
                     /locus_tag="HG536_0E04280"
                     /db_xref="GeneID:59326713"
     mRNA            <765556..>768207
                     /locus_tag="HG536_0E04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284295.1"
                     /db_xref="GeneID:59326713"
     CDS             765556..768207
                     /locus_tag="HG536_0E04280"
                     /inference="similar to AA sequence:RefSeq:NP_013096.1"
                     /note="ancestral locus Anc_5.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140191.1"
                     /db_xref="GeneID:59326713"
                     /translation="MACSVNISNTKLINLSAVIESCYGVQEDDTAAVVKLDLPGKGQN
                     QFQSLTSAIFSKFLNSTRTGSAHMQAGISLRTFLSSMLVSAVYFLLQVVLFTILRNKF
                     KCIYQTRTMNKSQRLFSASEKPKGSLKQWFSWIPTVIFSSTEKYQDRAGLDAYFFLRF
                     LKTQSLFFLTLSMLNMPILLPIHYHSSMTNLSSDPSPWLDRMNISSLVAQNSNKLVFH
                     MILGIFVVIWFHAFLIRELKFVHEVSLAVQQEASSILLIERIPECMVGDAQKVTSSIG
                     ILFPERILDVRFLPKTFGKLRKLHKRMLRAEEDVEELTMKILLNRFFLNACEENNEEY
                     RGLAYTQKFALQLNKLLFYLKTPERIIESTEMQKSGSAWLSGHAFKFNSSSYRAKLYL
                     SLDIATKRFEKASAEWMQGCAQLQKQGSSRYDLGNRALISQIYLNKVFVKFSSMNDAR
                     AAVGLLRNGSDDKWKRVHLISDLSDIVWSNVRASNPTLIRLRLASANLLSVLIIVGYI
                     IPVAFVGLISQIPYLASLTAFYSESEADRGSELVREMMAGLVPVITLIFLTECVPFIF
                     CWLSYLRCKKTSAEMQSDVQNWFFAFLFVHVFLVVTISSSLSIVLEKIVNNPVSIPTM
                     LANDLPKSSNFFCSFILVRGLAYSGGNLLQIKELFFEFYYRLTIYTPHRRMKRMESIP
                     NIQWCSVYPIFSVLGCISIVYSVISPLILPLSCISFSLVMFSFKYLYEYQYNRDGFSR
                     IEGRLYPSSLMQMYAGIYCMEFCMIGLFALGNCFKLCMCMILSLGFTIVAHVQVYRQC
                     LSKLYAFNFKQYCEKNPNIGSFSGLSSRCIDFPFANGEYRSQILIPKDTEGSTANERD
                     HLAREFHLEFKSSNFNLNRTGDIVYQL"
     gene            complement(<768234..>769553)
                     /locus_tag="HG536_0E04290"
                     /db_xref="GeneID:59326714"
     mRNA            complement(<768234..>769553)
                     /locus_tag="HG536_0E04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284296.1"
                     /db_xref="GeneID:59326714"
     CDS             complement(768234..769553)
                     /locus_tag="HG536_0E04290"
                     /inference="similar to AA sequence:RefSeq:NP_013095.1"
                     /note="ancestral locus Anc_5.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140192.1"
                     /db_xref="GeneID:59326714"
                     /translation="MSDLGLSDSVEHESSLFNSTMAENTSSNLMSLDDYINKALPLHL
                     DKMVADHLQNGSLLHDDHKESTAPLGAVEASDDNWAMQRTLRLLQQGQQHISVESSSS
                     FSSWSFLQGLIVGQITVVIVLIFFIKFFIFSESTSSKPNNPKNATGPSLSSRPFISSQ
                     FISSIMKRGGKEQINSAENVEAEQTRQIDAILEKTYYDVNTHPSESLDWFNVLIAQTI
                     QQFREEAWQKDNIVHSLNNFVEKKLHELPSYIDGAKITELDIGDDFPIFSNCRVQYVP
                     NSNRKKLEAKIDIDLNDRLAIGVETKLLLNYPKPATAALPINITVAIVRFQACLTVSL
                     TKAEEFVAPSSPTQENNGSGYFLVFSFAPEYRMDFETESLIGARSKLENIPKIGSLIE
                     YQIKKWFVERCVEPRFQFVRLPSMWPRSKRTWEGKPEAEGSKTSRES"
     gene            <769863..>771791
                     /locus_tag="HG536_0E04300"
                     /db_xref="GeneID:59326715"
     mRNA            <769863..>771791
                     /locus_tag="HG536_0E04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284297.1"
                     /db_xref="GeneID:59326715"
     CDS             769863..771791
                     /locus_tag="HG536_0E04300"
                     /inference="similar to AA sequence:RefSeq:NP_013094.1"
                     /note="ancestral locus Anc_5.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140193.1"
                     /db_xref="GeneID:59326715"
                     /translation="MPSLERARAILGDDKQLDEDKSRECFRCIFEPTLSFSEPEGYLS
                     LVGAFVLQCNPRFLCNSAIRNVQFWHLFKEILEKATSEELIIYLNTLLRPFLERPEKF
                     KDSYTSLCQAASSDDLILETLALNLSMEDLSSDTAAGILNCISALFACHTYLLTFSPA
                     DAAHIIPNFMLQSLETGLCDVLTVMLSVGDSRIEIINKLVRHRREMLTFLKSFTIHDY
                     ETPLKNKLLTALNKASGEQRIKLEETAGFQNMNNVSLLQALNITIFLNSKNLTFLKTF
                     AEQQLFGTRPFPLFYACLHVCDTTDEMIEKLEKKNTDIVHNIIFSLNEDKLMYALMDR
                     LLKSWVESQAESEEDLNSLLMLMPIIFERINKSIPDSSNLSPREYLRLALNVIQEVNY
                     KLARQLQLDALTETAYEKWSKHVGYFDDMLANQVHDYLHHQRLLYLQKGTWVYAENPL
                     DPKIKSPKVYFMVLSANQAKLLVREYTGISERTPFTEENEILTPSEAEQSDEKSKTRV
                     IPISSISFFTSERILSNDKSPTDSHLVNVIQKNVYTKVEFCNESDKSLLVVFFHTKEA
                     IYSWLDGLQLVCCIKHRGGLSNGTTDQIDTLIDIRKSVQMMNLTEDAISPNHSDSDDE
                     EYYDINTLKEITSDFYYE"
     gene            complement(<771832..>774120)
                     /locus_tag="HG536_0E04310"
                     /db_xref="GeneID:59326716"
     mRNA            complement(<771832..>774120)
                     /locus_tag="HG536_0E04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284298.1"
                     /db_xref="GeneID:59326716"
     CDS             complement(771832..774120)
                     /locus_tag="HG536_0E04310"
                     /inference="similar to AA sequence:RefSeq:NP_013093.1"
                     /note="ancestral locus Anc_5.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140194.1"
                     /db_xref="GeneID:59326716"
                     /translation="MSKIDFLSADFVPTISDSEDDIPNLDDPEDQIKPVTAGKAAGDV
                     KDNGRSQKSKKNKSQRKMPNGGDEDKEGDKEDLNPDFHFNVAVDDEVTKFDGWEFLGD
                     DKDGNSTKKDVDLDGIIRRKGGLINAAHIGGESEEEEEEEEEDDDDSEKSQSADEDDD
                     DELALDGFGMGRKLEEDGSSAEEQEESVDSDEEEAEQGADASSSHQDFDREEGEEEEE
                     EEDSPEEKAKFYAPESESAEATKQVHADFNSLSLSRPVLKGLSDLGYVKPSPIQSATI
                     PIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIASTRVIVLTPTRELAIQISD
                     VGRNLGKYVNGLTFGLAVGGLNLRQQEQSLKSRPDIVIATPGRFIDHIRNSASFNVDS
                     VEILVLDEADRMLEEGFHDELSEIMSLLPSQRQTLLFSATMNSRIKQLVSLSLKRPVR
                     VMIDPPKQAASKLLQEFVRIRKREHLKPSVLFHLIKKLDGTGQKRMVVFVARKEVAHR
                     LRIILGLLGIAVAELHGSLSQEQRLQSVNQFKSLEVPILVCTDLASRGLDIPKIEVVI
                     NYDMPKNYEIYLHRVGRTARAGREGRSVSLVGESSQDRSVVRSAIKSVEENKEGQSSV
                     VGRNIDWKQVEEINKLVSSMDSTIDEILEEEKGEKEILRAEMELRKGENLLKHKAEIE
                     SRPKRTWFQSEAEKKNAKMVGALAKNKKTINSKKRKRQEAIEDAPRAYKKTQKNRKDD
                     QERAFKKQNKKTGGKNNKKAKK"
     gene            <774392..>775000
                     /locus_tag="HG536_0E04320"
                     /db_xref="GeneID:59326717"
     mRNA            <774392..>775000
                     /locus_tag="HG536_0E04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284299.1"
                     /db_xref="GeneID:59326717"
     CDS             774392..775000
                     /locus_tag="HG536_0E04320"
                     /inference="similar to AA sequence:RefSeq:NP_012530.1"
                     /note="ancestral locus Anc_5.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140195.1"
                     /db_xref="GeneID:59326717"
                     /translation="MFLLSFRRYMRIPHELKPSQIFKQDSLSPNKIALQIILLQIFYY
                     VTASILFYCWAKLFGYDLQIKNWLFSWEYINYDTTLGLSLCILWLLDSLICVIFLTVI
                     VGRSKLAWDFAVTIHAINLIIVLITTGKVPSFSWFLLQLLSSLILVFLSTWTTRWKEL
                     RDTFFEGLVDPAVGSAQVDAGLRSSANDGSKAIELKDLEAQK"
     gene            complement(<775173..>781097)
                     /locus_tag="HG536_0E04330"
                     /db_xref="GeneID:59326718"
     mRNA            complement(<775173..>781097)
                     /locus_tag="HG536_0E04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284300.1"
                     /db_xref="GeneID:59326718"
     CDS             complement(775173..781097)
                     /locus_tag="HG536_0E04330"
                     /inference="similar to AA sequence:RefSeq:NP_012529.3"
                     /note="ancestral locus Anc_5.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140196.1"
                     /db_xref="GeneID:59326718"
                     /translation="MLLQGSLVDSFDQVESERKRDRQSEVAIRNNRTLFLSKRSKMTD
                     SNVNDQVADGAPFKSQYQLRSKEKSCHAPHSRTSSPNDRGVTNPQQQQHNNNHHSAGN
                     KSAESGRIRRGPILLRRTLSSLSMSAVNSGARESRDGSGPGEELSRSTSPGGQSGGSH
                     VRAKRHSLRSSIGGNQDEKVAQAQSPPSPPSRKRSFAGALFKKLAGSGLQNMESASHL
                     VPDDADSIASTQVSSDRRSSRDSGQSLHFVESVPSTLRRKVSNLVHGLGHETEGSAAG
                     GSGAGSSAANAGMAPIKKSVTASDEYKRKDADRPNLARHRTIHLLIPSTSSPSSRRSS
                     TASTGSSIASDTVKESAAENRNTLGNPVGKRFFQLDTNLENVSDITKLLEPLPAAPEE
                     PPTEQNPVRKSATGQFASRSHSTAELALSKTSSRTSTKENSPRVKATQWIAPESWDVD
                     ADLERARAKKYGHGEAASSHRRKKIQQQSASRNSSVEPSTAPGNISSNGPSAPSTLQR
                     NFAGSSLEGDGPSVDKDFSNEAYSTTDNDELESSISESSTSASDYISSHTEDYMAQEP
                     NRSSESETRSKSSLALSIIAINGARDEDAMSKDVSLADEKHDKVEYELERYYKDFSDL
                     DPKRHYAIRIFNTDDTFTTLSCTPNTTVREVIPALKRKFNITSQGSYQLSLKVGKLSK
                     ILRPLAKPIIIERKLLLLNGYRKTDPLHIMGIEDLSFVFKFLFHPVAPSHLTPEQEQR
                     LMRSDFIHVDLRGMDLTTPPIIFYQHTADIESLDVSNNADIFLPLEFIESTIKLTSLR
                     MVNIRASRFPANITEASKLVSLELQRNFIRKIPNSILKLSNLTILNLQCNELDRLPKG
                     FGHLKNLQLLDLSSNRFVHYPEILNQCTNLLQINLSYNKISSLPRSVNQLIKLAKMNL
                     SHNKLTEINDLSGMKNLRTLNLQHNRIGSIKTCASNLQNLFLTDNRISNFNDILPKLR
                     ALEIQENPMTSISYKDFYPMSMTSLSLNKAKLASVPGELFVKLSRLEKLDLSQNNLTQ
                     LPEEISLLNRLVYLSVARNKLESLPSGFPKLTSLKTLDLHSNNMRDLVDGIQDLELTS
                     LNISSNMLGNSILSTPFYQKITCESKLTKTLMFLLAADNQFDDQTWPFFNYFENLKLL
                     NLSYNNFQDIFNLKLENLLDLYFSGNKISTLSGDVVPKWKSLKTLMLNGNHLLSLPAE
                     LSQLSHLSVFDVGCNQLKYNISNYHYDWNWRNNKELKYLNLSGNKRFEIKSFVDREIN
                     ADLSDLTVLPNLKVLGLMDVTLNTSKVPDESFNFRMRTTGSMLNGMRYGVADTLGQRD
                     FVSSRDVTFERFNGKDDESLICLHDGKNQDATYGHNISKLVRDVYDKILIRQLEKYGD
                     SDEGVKKALRFSFLQLNKEINVMLGSVDSGANVANLTSADLLSGACSTAVYIKGNKVF
                     TANIGDCMAILSKNNGDYQKLTKLHVPCKRTEYERIRISGGYVNDDKLDGVVGVSRAV
                     GFFDLLPHIHASPDISLVTLNKADEMLIICTNKLWDYMDYEMACDIARENSADPMLAA
                     AAMKDHAIAYGCSDNLTILCLALDKSADQQNHFSLNKNSFIRRSTFEDTTLRRLQPEI
                     VPPTGNLAIVFTDIKNSTFLWELFPNAMRTAIKTHNDIMRRLLRIYGGYEVKTEGDAF
                     MVAFPTPISSLVWCLSVQLKLLDAQWPEEITSIQDGCLITDKNGNKIYQGLSVRMGVH
                     WGCPVPELDLVTQRMDYLGPMVNKAARVEGVADGGQITLSSDFCMELNKIIKLHERVV
                     KHKEPLKDVYGDKFVGVVFEKEIAMLDSIGFVLYEHGEQKLKGLETKELITICYPRSV
                     ASRHKFISEDEQTKLLNEKAMVRLRAVSRKLESIVSAVCGGLTEVGQRAGSERISVID
                     ENAQNLIKLGAGASDADVLAFFEHLLTRIESYIAILKLKQTVSHSLDCYKFYDNKSEP
                     MTVFELLDGILGKLQS"
     gene            <781412..>781813
                     /locus_tag="HG536_0E04340"
                     /db_xref="GeneID:59326719"
     mRNA            <781412..>781813
                     /locus_tag="HG536_0E04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284301.1"
                     /db_xref="GeneID:59326719"
     CDS             781412..781813
                     /locus_tag="HG536_0E04340"
                     /inference="similar to AA sequence:RefSeq:NP_013092.1"
                     /note="ancestral locus Anc_5.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140197.1"
                     /db_xref="GeneID:59326719"
                     /translation="MSNHLSSVRNDVKGTFFSRRASFPTRAGNSSYGMLSYLSAFQQL
                     ELGPAGLSGVQVQRSLNTPDSNASKWTQVMSETERNTQKQTDKPKPCCVCLPEKDERD
                     QCILFNGQDSDKCKVFVEAYKKCMKSYGFDI"
     gene            <781976..>782926
                     /locus_tag="HG536_0E04350"
                     /db_xref="GeneID:59326720"
     mRNA            <781976..>782926
                     /locus_tag="HG536_0E04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284302.1"
                     /db_xref="GeneID:59326720"
     CDS             781976..782926
                     /locus_tag="HG536_0E04350"
                     /inference="similar to AA sequence:RefSeq:NP_013117.1"
                     /note="ancestral locus Anc_5.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140198.1"
                     /db_xref="GeneID:59326720"
                     /translation="MSDSELPTTFEGEVDLGVIGGTGLYHLPCLEKIAVLPRMATPWG
                     YTSSPITISKFIGANGHLHVAFLARHGLDHQLPPSKVPFRANMAALKHLKCKAVLSFS
                     AVGSLQESIKPRDFVLPQQLIDRTKGIRESSYLNEEGLVGHVGFGDPFSESFAKYIYQ
                     FRDVLTNEGKPCTLHFDKDKTVVCMEGPQFSTRAESRMYRLLGGDVINMSVIPEAKLA
                     RECELPYQMVCMSTDYDAWREDEEPVTVEVVLGHLVNNGHNANALAASVIEAMSHDLP
                     EFMKTGDGLRGSVKMSISTKPEAMSQETLEKLKFLFPDYW"
     gene            complement(<782948..>784087)
                     /locus_tag="HG536_0E04360"
                     /db_xref="GeneID:59326721"
     mRNA            complement(<782948..>784087)
                     /locus_tag="HG536_0E04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284303.1"
                     /db_xref="GeneID:59326721"
     CDS             complement(782948..784087)
                     /locus_tag="HG536_0E04360"
                     /inference="similar to AA sequence:RefSeq:NP_013118.1"
                     /note="ancestral locus Anc_5.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140199.1"
                     /db_xref="GeneID:59326721"
                     /translation="MDNAPASTFATPSRPITREQFHSLRQKMVKESPRLYKNKILSDP
                     SENTERRIRSAPVTPRNYVRETRGTLLRNTNLADLNSRQLGELNDDLVSGKEKPVSGE
                     LGNKTAGFNAAEPGNYENPVLNKLASRTVNKEMETQIIVTNLIVLAIWDLFTKFLKIF
                     LDYSHFGKVIALLAQEKFSKLKLGIWIYRLNREFPWLVKRLSWSNFDTVFHLVVAYNV
                     LGSLWRLFSKVKVSDLNLNSSQRELLGLRSNDEFADSHASISSNKKPHVILDQNRQIP
                     RAIEDGTQQNPSVPATPFLFKSLETPLKAKQREQSRQQQRTQLDLQRQAQSASVSKVN
                     AFGSNFDKTESRPVPWTTSQISPAGYIPSSKYAYMMSSPSPRKRM"
     gene            <784639..>786114
                     /locus_tag="HG536_0E04370"
                     /db_xref="GeneID:59326722"
     mRNA            <784639..>786114
                     /locus_tag="HG536_0E04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284304.1"
                     /db_xref="GeneID:59326722"
     CDS             784639..786114
                     /locus_tag="HG536_0E04370"
                     /inference="similar to AA sequence:RefSeq:NP_013091.1"
                     /note="ancestral locus Anc_5.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140200.1"
                     /db_xref="GeneID:59326722"
                     /translation="MGFIASILCCSSDTSQHKSHWQSGQHAAGYSKGKSQTGVHNSQS
                     NIHSTLSKSSQKMAYSSQNLSGNNGQGTANGTNRRNHNKRTGNDDRIKVSEKASDLNV
                     GVEEEKEEANEKVKTSGSGGKKRYGNSSGDSNRRKERNERTPPLRKADYGDADDDEDK
                     EYDDDEEEDEIGEGESVEDKARGTANTKSVEEVTNEKDKHAIYVYNGETDTSTGGSSY
                     DQHLQQQSQTQTQLARGVGDIVVSDGGELTTTVHEGENCSSAEDTDIALQNSHTNDES
                     ADYDMAPPYEDEEEFVDLTELQLGQAHAQGYNTLLPPKTPEFKGKKCLVLDLDETLVH
                     SSFKYLRTADFVLPVDIDDQIHNVYVIKRPGVDEFLKRVGSLYEVVVFTASVSRYGDP
                     LLDILDKHKSVHHRLFRESCYNYEGNYIKNLSQIGRPLSEIIILDNSPASYIFHPQHA
                     IPISSWFSDTHDNELLDIIPLLEDLSERSVPDVGKVLDVTI"
     gene            complement(<786426..>787871)
                     /locus_tag="HG536_0E04380"
                     /db_xref="GeneID:59326723"
     mRNA            complement(<786426..>787871)
                     /locus_tag="HG536_0E04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284305.1"
                     /db_xref="GeneID:59326723"
     CDS             complement(786426..787871)
                     /locus_tag="HG536_0E04380"
                     /inference="similar to AA sequence:RefSeq:NP_013090.1"
                     /note="ancestral locus Anc_5.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140201.1"
                     /db_xref="GeneID:59326723"
                     /translation="MKIKTIKRSADTYVPVKSTQESQLPRNLDPELHPFERAREYTKA
                     LNATKLERMFAKPFIGQLGYGHRDGVYVIAKDYQDLNKIASGSADGVIKYWNMSTRGE
                     ICSFKAHYGLVSGLCVSPQRSPLNKDQHYMLSCSDDKTVKLWSMNGDDFAGVKDDQNI
                     NSTEGLLKTFYGDHAFQGIDQHRTRSTFVTGGARIQLWDTARSKPVSDFSWGADNTTT
                     VRFNQTETDILASSGSDNSVVLYDIRTNSPTQKIVQRLRTNAICWNPMEAFNFVIANE
                     DHNAYYYDMRNMSRALSVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFKTNHGHSR
                     EVYHTKRMQHVFQVKYSMDSKYIISGSDDANVRLWRARAWERSNVKTTREKNKLEYDE
                     KLKERFKYMPEIRRISRHRHVPKVVKKAQEIKQIELNSLKRREMNERRTRKNMPYVSE
                     RKKQIVGTVFDYEGKKKKKHSSKDEHSDEEE"
     gene            complement(<788052..>789704)
                     /locus_tag="HG536_0E04390"
                     /db_xref="GeneID:59326724"
     mRNA            complement(<788052..>789704)
                     /locus_tag="HG536_0E04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284306.1"
                     /db_xref="GeneID:59326724"
     CDS             complement(788052..789704)
                     /locus_tag="HG536_0E04390"
                     /inference="similar to AA sequence:RefSeq:NP_013089.1"
                     /note="ancestral locus Anc_5.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140202.1"
                     /db_xref="GeneID:59326724"
                     /translation="MLERIIDIAYEITSTIVIASFLVVVSLLALWHNFVTAHLTRHRD
                     FRDTRGSKTTIIPYHDGSLRRKKSRAPAGSNSPNSSSHPSRGIDVEEDEEHNIEFDHT
                     VHSDETRPFTGDSSHCGSDRDSALMSDARSYDNDPKRRLELEDNPFQDVLAAEDLKLV
                     PDLKYYYKQYNIEIEEFEVETDDGFIIDLWHLKRDNNDDGHMHPVLMLHGLLQSSGSF
                     ASSGRKSLAYFLHQSGFDVWLGNNRCGLHPKWNKKILGRNKRNRWDWDMDQMVQYDLR
                     ALVESVLAKSKNEKLTLVSHSQGTTQGFMGLVNGELLYQDGYNLSERIDNFVALAPAV
                     YPGPLLDEKAFVKFMAKGIDNPWIFGNKSFLPLMLFMRKITNGVILIPFMSYVMFNYL
                     FDWNDSLWDRPLRDRHFLFSPVYISVKLMQWWLSPSANKISFKKGAGTLFPDSKTWFP
                     VDNAHPVAKPEGLHMNRSRPNAADYPRFLMFIPKQDRLVDGERLINHFINHESTSIYK
                     IWYIEEYSHLDVLWSHDVIDRVGQPLIENLRLTKQVKDSDSN"
     gene            <789847..>790326
                     /locus_tag="HG536_0E04400"
                     /db_xref="GeneID:59326725"
     mRNA            <789847..>790326
                     /locus_tag="HG536_0E04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284307.1"
                     /db_xref="GeneID:59326725"
     CDS             789847..790326
                     /locus_tag="HG536_0E04400"
                     /inference="similar to AA sequence:RefSeq:NP_013121.1"
                     /note="ancestral locus Anc_5.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140203.1"
                     /db_xref="GeneID:59326725"
                     /translation="MFHRESIVSIPPALGLAGEVEISATHFSNEILLQIRYNGEMDTT
                     YEVAPEGLRPFDERQLAGFSDTLDENEAPADDQMANYKVVAKLGDSNDAKLPVVCTQI
                     ADLYQQVILPTGVDKIGVGEAERRNLLITMSSKLWSDDTRQFERLVFILNSVKQMYI"
     gene            complement(<790339..>791070)
                     /locus_tag="HG536_0E04410"
                     /db_xref="GeneID:59326726"
     mRNA            complement(<790339..>791070)
                     /locus_tag="HG536_0E04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284308.1"
                     /db_xref="GeneID:59326726"
     CDS             complement(790339..791070)
                     /locus_tag="HG536_0E04410"
                     /inference="similar to AA sequence:RefSeq:NP_013122.1"
                     /note="ancestral locus Anc_5.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140204.1"
                     /db_xref="GeneID:59326726"
                     /translation="MPINQPSGQIKLTNVSLVRLKKGKKRFEIACYQNKVQDYRKGVE
                     TDLDEVLQIHQVFVNVSKGLVASKEELKTCFGDAEPDAIIKEILTKGEIQLSERERQL
                     MLNKINNELLTIVSAKCINPRSKKRYPPTMVHKALVELKFSPVLNKPAKLQALEAIKL
                     LIATQIIPIARAKMKVKVSVGAADCEAIEQIRKLTANAQGASDGTVWSFLGLIDPVNY
                     RELVAICDKKGSVQVIDMAVIDDAA"
     gene            complement(<791196..>792836)
                     /locus_tag="HG536_0E04420"
                     /db_xref="GeneID:59326727"
     mRNA            complement(<791196..>792836)
                     /locus_tag="HG536_0E04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284309.1"
                     /db_xref="GeneID:59326727"
     CDS             complement(791196..792836)
                     /locus_tag="HG536_0E04420"
                     /inference="similar to AA sequence:RefSeq:NP_013123.1"
                     /note="ancestral locus Anc_5.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140205.1"
                     /db_xref="GeneID:59326727"
                     /translation="MDPSAPLPPLLLLPPLPPLVSYYTRRRTARRPLLPPAPRDPKNF
                     SEKKKKRSRPEIFCQTHWIYRGPRTAIWSWESVESGGRADMSESGAFARIRRRGAGMV
                     RRVPGSGIIGNNKCYNYLVGVWGSRRLRKRGRKVVRDTQPVLESSDSFSDTSTLVNSS
                     GSSRSSTFGASTATLLDDEWVGGCVESKELRAVEEEVCVDVREFVRAFNHTRAHELGR
                     ERHLHYYQLPFPWRENRYIIHGYRFYDSHAKSLLSVVNWYGWHNETWNIWTHLAGAGY
                     LVYLGARDFPRSEVWRSAEVPLPAKLVVYVFLAAGLKCMCASVFWHTFNGTCCLQLRS
                     RFACVDYTGITVLITASVLTTEFATSYESRWSLCCYLAASSVLGALGVVMNWSPKFDR
                     PEARPLRIKFFVLLAAMGALSFVQLVVRTSWRHAARLIAPVTTKSVVWYLIGVFFYGS
                     FIPERFRSDVVVDAAIPTELELSTNVEIVTKHRHVHFRERPTEGPYKKRCLRSLWWVD
                     YFGCSHSLWHLFVVLGVVGHYTAILEMFGKRWIAQDII"
     gene            <792827..>794620
                     /locus_tag="HG536_0E04430"
                     /db_xref="GeneID:59326728"
     mRNA            <792827..>794620
                     /locus_tag="HG536_0E04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284310.1"
                     /db_xref="GeneID:59326728"
     CDS             792827..794620
                     /locus_tag="HG536_0E04430"
                     /inference="similar to AA sequence:RefSeq:NP_013088.1"
                     /note="ancestral locus Anc_5.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140206.1"
                     /db_xref="GeneID:59326728"
                     /translation="MDPWAAVDVGGGSRAGSPGGGALDAELASIVSSLSALSNPHAAP
                     QLGGFRRSSFTETEGPRRTALSVGTAPGYGSGQRFKYVGAGGAGQYSASIGGPILSTQ
                     SPPAADGGGGFFEKFGKTLIEGTRELEQGAEPAETEEEPAEFPPRFRNIWNVAQAPVF
                     RPGEPQYAEPPFQGGFAVEPFPFVPDGEVYAAPKRGKGGRKPRANPYLEGRKKKAGKG
                     SSPPPQRQQGGNAGPARSPVLEEFRMNSGNRSYTLDDILGYVLEFCRDQHGSRFIQHE
                     LAAATASQREVVFNEIRDHAIELSDDVFGNYVIQKFFEYGSRTQRDVLVSQFAGKMRK
                     LSMQMYACRVIQKALEFIEPQQRIALADELSSCVLVMIKDQNGNHVIQKAIERIPMAK
                     LPYILDSLGGQIYHLSTHSYGCRVVQRLLEFGSERDQSRILAELKEFIPYLVQDQYGN
                     YVIQHILQQNGAQSYPEMRATKQMIVDTVSENVVELSKHKFASNVVEKAVIYGSPAQK
                     ALIMSKILPHSESHARELEDSAPIILMMRDQFANYVVQKLVGVSEGQDKRLIVTAIRA
                     YLDKLNKSDSMGNRHLASVEKLASLVESVKL"
     gene            complement(<794723..>795037)
                     /locus_tag="HG536_0E04440"
                     /db_xref="GeneID:59326729"
     mRNA            complement(<794723..>795037)
                     /locus_tag="HG536_0E04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284311.1"
                     /db_xref="GeneID:59326729"
     CDS             complement(794723..795037)
                     /locus_tag="HG536_0E04440"
                     /inference="similar to AA sequence:RefSeq:NP_013087.1"
                     /note="ancestral locus Anc_5.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140207.1"
                     /db_xref="GeneID:59326729"
                     /translation="MDTFASIKSDVNVAANKKRLLLLQDSTSLVVGIAAGILQLESLN
                     GFYMFIGSFLSIGALYIIWICQLKPHKYYQSPVQEVFFEPFFRELMGFVMAWTFSYAL
                     IG"
     gene            <795146..>796285
                     /locus_tag="HG536_0E04450"
                     /db_xref="GeneID:59326730"
     mRNA            <795146..>796285
                     /locus_tag="HG536_0E04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284312.1"
                     /db_xref="GeneID:59326730"
     CDS             795146..796285
                     /locus_tag="HG536_0E04450"
                     /inference="similar to AA sequence:RefSeq:NP_011703.3"
                     /note="ancestral locus Anc_5.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140208.1"
                     /db_xref="GeneID:59326730"
                     /translation="MPSQLEELVSFLHSSQPAVRQIALDNLVGFSTGPTAAIFKYDNC
                     KAIEDLKNLSQEKSKVLVQQSVTILANLCDDDQLRKLVASDEEYLEWLTWKICDLENT
                     SADIMCVLLSNLAKEDVITKVFCFTRENTDKSLPSLDRSVFKSDKLIDCLMDCFVKGY
                     DRKLNKYANFDFLSYFFADISRFKRGRQYFIEEQEYDGVVPLSKLLVFTEKYDCKIRR
                     EGVASTIKNSLFDSETHERILIDEQINLLPYILLPIASAKDSEIDEEDMFNLPDELQL
                     LPEDKTRDPVPAIICSHLESILLLCTTKVGREFLRSKSVYPLIRELHKNIEDEDVADL
                     CYRIVNVLMRGEPENDQLEELPSKAADEGDGEEEESDDEAVVEVA"
     gene            complement(<796389..>798413)
                     /locus_tag="HG536_0E04460"
                     /db_xref="GeneID:59326731"
     mRNA            complement(<796389..>798413)
                     /locus_tag="HG536_0E04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284313.1"
                     /db_xref="GeneID:59326731"
     CDS             complement(796389..798413)
                     /locus_tag="HG536_0E04460"
                     /inference="similar to AA sequence:RefSeq:NP_011702.1"
                     /note="ancestral locus Anc_5.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140209.1"
                     /db_xref="GeneID:59326731"
                     /translation="MALRRSGSSDAVSPFIKPDRNRRNFLRAMRSRGSTPRPMVKKED
                     PDAEAAREKLVLGGGVEGGGFGRSTKVKEETAEEYDEFPLRAVAKEELENMRTHLLKF
                     QSKKNINPSKDFHLPIRLHRKDTRNLQFQLTRAEIVQRQKEIAEFKSKQEQERSGGVK
                     KEGTGTPTPGIGTPADAKDSTPVPLASPSPATAGSPSVSSLPSTSSAATTGTSDVKIE
                     EKKGATPVATRLEDAGPAADPTKVGMVKYDGQEEVTDVVPGTTDPLADVAPDGGGRAK
                     RGNVRRKTRQLKVLDENAKKLRFEEFYPWVMEDYDGYNTWVGSYEAGNSDSYVLLSVE
                     DDGSFTMIPADKVYKFTARNKYATLTIDEAEKRMDRKSGEVPRWLMKHLDDIGTTTTR
                     YDRTRRRLKAVSDRRTAEEERSDNSEVELDYDEEFADDEEAPIIDGNEQENKESEQRI
                     KKEMMQANAMGLRDEPVSDEEDELFNEKKIDEEGERIKKALQKTELAALYSSDEDEAN
                     PYLSESDVENKKQADQVKKEASDENLSRKSSPRKHSKSAAAKVHREPQVRVKSIKDCI
                     IILKADKNILKSFPKGEWNPKVTKRKREEVDADLKDSTNKRVKVEEGSVPLITEQGII
                     DAIGDGVVNVKEFGKAIRKKYPGPENKQLMVAIVKKLCRAVDKQHMELKK"
     gene            <798968..>800191
                     /locus_tag="HG536_0E04470"
                     /db_xref="GeneID:59326732"
     mRNA            <798968..>800191
                     /locus_tag="HG536_0E04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284314.1"
                     /db_xref="GeneID:59326732"
     CDS             798968..800191
                     /locus_tag="HG536_0E04470"
                     /inference="similar to AA sequence:RefSeq:NP_011701.3"
                     /note="ancestral locus Anc_5.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140210.1"
                     /db_xref="GeneID:59326732"
                     /translation="MTAAPMDPQESFNLITKNLQEVLNPQIIRNVLEVEKRPLKLYWG
                     TAPTGRPHCGYFVPMTKLADFLKAGCHVTVLLADLHAFLDNMKAPLEVVNYRAKYYEF
                     AIKAILKSINVPIEKLKFVVGSSYQLSAEYTMDVFRLSNMVSQNDAKRAGADVVKQVA
                     NPLLSGLVYPLMQALDEQFLDCDAQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMV
                     PGLAQGGKMSASDPNSKIDLLEEPKQVKKKINSAYCSPGIIEDNGLLAFIQYVVRPIQ
                     ELKFGSEHFEFFINRPDKFGGPITYTSFEQLQADFKDQKLSPPDLKTGVSDAIIELLE
                     PIRKEFASNPEFQEAQEKGYPVAQPEKVKKAKKPKNKGTRYPGSQNQNGKSPTEDGDD
                     AVEKVAEKIKEAVLG"
     gene            complement(<800341..>805854)
                     /locus_tag="HG536_0E04480"
                     /db_xref="GeneID:59326733"
     mRNA            complement(<800341..>805854)
                     /locus_tag="HG536_0E04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284315.1"
                     /db_xref="GeneID:59326733"
     CDS             complement(800341..805854)
                     /locus_tag="HG536_0E04480"
                     /inference="similar to AA sequence:RefSeq:NP_013124.1"
                     /note="ancestral locus Anc_5.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140211.1"
                     /db_xref="GeneID:59326733"
                     /translation="MDLNGGIANIRDFLVHLPRLARYDYDEAVSYMVWKVLSLSVEQG
                     GERIDWGSIVNVMGSPKWRDGTYRSVLKDCSWKHKALETARKGHSHAGTMCNRQCYPP
                     ETVYYCFTCTMNPLYEICEYCFDKSRHEGHVYTAKMVVRPEGRVCHCGNTFVFPESHC
                     LSQCKEEQNNACPEASESQDSFEEHIVPTVSAVCNYLIDITVYFQEKEGLASPLDNAC
                     YGRSRFDPSAKPEIYLEDSRGNICDRIPEDETEWALQIDEEDCQMCYMDLAAKIGRIL
                     NKPLEYAVSITSVLENGGPSVTVVKSRDRTKIEKISSKFTSEGATNHIRETKDTFKKS
                     LVDDLVHWLYLFSIKEANSLQIKKALRLSFLEAWEPGLVSNKLALDCLNPFMSKINLL
                     GGFLISEEQRDTFPWFTPWEFSDINDLSVREILLKYNKRLASTNIPNAVSRYHTLHGS
                     RLQYILVGLADILTKLSKNRMLKVISSLFAIMDNTKQFLASQYLDVYLAVLYSTVASD
                     LTGFKVSLMGTLSQHIFQDPRNANLAIRRGFIQRTLRFAFTLMAFSPEDLSAYLPIPL
                     YYSCKLPSESIRNRRTIICLKDICMLMSTNTIPDELLKDEEILAVIIESFAAFNKILP
                     LKRETSEHVEFENFDFSSYYFFFSSILVLTDGYVHSISLLSDLESRRGFISKLLTIAM
                     DKELEILSKLRRSYSNSSLSDIKCRCKLKMDGLPLVKEKICNYVGHVINFQVGVDTQN
                     FFNPMSYLFRFVLQWSCCGKYTPLPDISRKYLDFRKLIQDKAKALYVSESALSTLVLI
                     GQISVGFWVRNGTPITHQARMYTTYSIREFTYMSDIFNVQFSMAMADPNEFIVTYLAR
                     WGLKHWSNGFPMGDYPDFETTVAMVNQCCLLLIRLFSQTKFLTVVSSVDGFEKTLRGE
                     IVHALCFKSCSYSQIMNSLPEHITKHAAFDLYLEKYTDFIAPAGVTDSGVYTLKTEYT
                     NEIDPYFIGLSSSKRYEVEKSIRMSMALREKIDYEDTFIPAPKTIDSLKFTPYCELFA
                     ISSVETFGTFLKNTLDHIKKYECDTLLPTVLHLIHLCIVNNLDAFSKIFWHEFGSLDT
                     EFCFYHSIGSILYSFLLQENCLQVHGKIREIFKYMVKNVPHVDADSYLREQVPSFDSD
                     ILWSSKAIRNNKDGELERKKNLARMKKEKMMRKLAKQQIQFIDNHNFSASDEEICKES
                     SADSTTSSQQHLENSNEDPCVFCKMPSEDDVFVYFSYQEQNICECRVDFTTERSWNNT
                     MTRSSEGCNFDWMKQIFNSKRTTQLTSQASVLRTCGHGSHISCLANHMKAIRATHNQT
                     TKNIPVAFGFGLLYCPLCNALCNSFLPHLAGLEWHYSEDYSRNKSPKSTGCMESSLLS
                     TGIKAAKVFQDLQWEPNGSTNNLADAVSYLLVNTIRNAELGLRPDDGLSMDRVSSQKL
                     RTLELLYALRNVIKDQSVNAHPSLGDLPGWYDCLSEKFDCDLLVSGSYLIDQYISGSK
                     EEGVEKRVGIYPPTIFHELIKRKVFRDILLISKGLVDESFRLDTLEKAVESKETDGNE
                     SRMEQSCIAMILREFSSFLEPEAERSAVSPPMVEYVHHLLIGSLTVFLRRLCIMYHIR
                     SGPRADRNCMSASCRPVDFYICYLNLQPMRVTLQRLIDEDFDTTLNSIKQSFVGHRSQ
                     TILRTPKCMSLSSAEPLHLAPLPSSLSAFFRSEDDNITHRALKHEIAVCLFCGTACRI
                     QKPIALHKYAIGVCTNHVRNVCPVISTYGAFLLIRSNAIYLAYGQRGSFYPAPYLHRH
                     GEPDEDLKYNSPVYLDETRYEHLKSGVILENMIPHIVHRLTENNSDLGGWETM"
     gene            <806675..>812539
                     /locus_tag="HG536_0E04490"
                     /db_xref="GeneID:59326734"
     mRNA            <806675..>812539
                     /locus_tag="HG536_0E04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284316.1"
                     /db_xref="GeneID:59326734"
     CDS             806675..812539
                     /locus_tag="HG536_0E04490"
                     /inference="similar to AA sequence:RefSeq:NP_011700.1"
                     /note="ancestral locus Anc_5.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140212.1"
                     /db_xref="GeneID:59326734"
                     /translation="MYQDPVVLEVRDHLRQFLSSIHGNRVFKDVRGPPERFEMDRILK
                     EHIFSYLFFLISRKGETLPLMFPEDDSITSIAAVPFPKTYEEAVAIDEQEPRLPFYRI
                     NDSKLSNVHQHSGRNCGRKFQVGEPIYRCHECGYDDTCVLCIYCFNAADHENHHVYTD
                     ICSDFNTGICDCGDKEAWHNELHCKAEEEARNGKSNRENDESGDVFLRQDMQEILEIV
                     LIEVFDHFIDVFNQNVEPLPTLQKDITLKLREMIQQGKLAERAQFLEALAYKNDTILR
                     EKEAMNLETARGDPSSQADLKNYTVIIYNDEYHNYSQATTALRQGVPDNKHTDVLTSR
                     IDGEGRALLKCSEELSSVIGGFFAVQTNGLSATLTSWSEYIHQETCKYCILWLSYCLK
                     IPIPAFQSVFRSAMGKVLCAEYDRASETVDVTPIIREYFSSKFNESDPYRFVDLSILG
                     QGNCIPLGHHKELDETDTHSISNTLNKVIAPTHRHYSNSRLQLIFYFDNRYWKKLRKD
                     LQSVIIPTLSSDVYYKPLFCKQVVEIFNHITRSVAFMDREPLLTVLRECVVQLFTCPK
                     DASMIFSMGSFKDILWSVIDIFTEFSKVDGGLLIWQKVQKTNPTKSYSISFKQGLYAV
                     ETLLSKVSDGNIILKPENFISIVTLCKLFNGAYKIKRKEGEHVLHEDQHFIPYLEYTT
                     SIYSIIQTIAKVLENSKEKINEGLLLNAVELLTTFLGHRSLTYKLTSDSREIIKFEVH
                     KQRVAFMNPVHTLYSFLIEKCNLESALRATSYCSDFLMISDFSLRSIVLCAQIFVGFW
                     VRNGMSVLHQSKYYKNNPELSSYARDIHLNQLVLLRENDDLPRVIYNMLDRWALLDWY
                     TGEVDFKHTAYEDKIIPMVQQFIAFVYQVLTERSFFKTYSSAKERRMYHIKSAIIYSL
                     FSKPLSYSKLLRSMPDYLTEDTTEFDTALQEVSTFVEPKGLADSGVFKLKEKLYAVVD
                     PLKLLNMENEFESSAAIIKTHLSQRKFGEFKDIIHPQIISPEYLDKKSHELGRFTGTD
                     LFAKLIYKLLQVCIDNEEGTFLYELLHLVHGIFKNDELVNGKNSIPQAYISKPICNQL
                     LIISNTKRNVFSEDAKKKANYLLECMMERRPEEITDSLKSSFGENCVTEFMAKKMNRD
                     VHSSESDKLRKKRLIKKRQEKLLAKFNSQQSKFMKENESELWGQNKTDDDVAMEGVEV
                     QQFEEFTCALCQDDTSTDLFVVPAYHDHTPILRPGNIFDVEEFASEWNGFFNDEDRLT
                     YNNDKTLGSLRDNSNKGSKKVLVSCNHSVHHSCFKRYVQKKRFSSNAFICPLCQTFSN
                     CVLPIRRTSKQDTGLSVDNLVNQGVSVEILSRLFESFSAADFKNVYSTFNLVTSHSHS
                     YDKAARQAPGFESKDTAFILGVHWANTISMFEISSRLDASPNLTLLNSKEQKYKTLKN
                     TLICIVLMCYGIGKPNPDYDPYVAKDGVVWNQNQIFQYIVKRCLFSQEPLRESIGQAL
                     AAYSKQLVVEFIKGIAGADIRKMFAKGEKCGRLYSVESSTMAETLRRTCALGVSDPDL
                     SRQAYELAYTCLLKNMLPTLRRCLIMVRVFHDLLSDSEEELVVNGINMVEKSALPLPE
                     YVDQVVCALTDFDTLEELLSRGIPNMKPNDDPYLNDIPYENCAVVKMINLAKYLNTYI
                     TNSKKIKLREEHSLHLQNVHNRLDFKICLTCGVKVHQRPDRHEMSKHLQKYCFKTFGA
                     FLIPNTSEVCLFLSQPPSTIYISAPYLNSHGEAGRNAMKRGDLTVLNLKRYEFLNSLW
                     INNEIPGYISRVMGDEFRVNILSNGYFLTFNRDPRPRRPPAAGNDEDADEDDDEDAEL
                     YSGHSSDDDERDIDMAEDRLADMEGAFFGAGTEGGNVRGLLQVFENFQNAVENGINAE
                     DAQFATPLLQFFPPQFGGVNLRRNIVQEPEEDDEVLDAMEEHPQDDSNEDIPPN"
     gene            <812781..>813064
                     /locus_tag="HG536_0E04500"
                     /db_xref="GeneID:59326735"
     mRNA            join(<812781..812783,812864..>813064)
                     /locus_tag="HG536_0E04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284317.1"
                     /db_xref="GeneID:59326735"
     CDS             join(812781..812783,812864..813064)
                     /locus_tag="HG536_0E04500"
                     /inference="similar to AA sequence:RefSeq:NP_011699.1"
                     /note="ancestral locus Anc_5.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140213.1"
                     /db_xref="GeneID:59326735"
                     /translation="MSFSSTLYKVLFKRNSAFVGTVFASAFLFQATFDSAVTSWYENH
                     NKGKLWADVKKQLQGADDDEDDE"
     gene            complement(<813218..>813526)
                     /locus_tag="HG536_0E04510"
                     /db_xref="GeneID:59326736"
     mRNA            complement(<813218..>813526)
                     /locus_tag="HG536_0E04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284318.1"
                     /db_xref="GeneID:59326736"
     CDS             complement(813218..813526)
                     /locus_tag="HG536_0E04510"
                     /inference="similar to AA sequence:RefSeq:NP_011697.3"
                     /note="ancestral locus Anc_5.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140214.1"
                     /db_xref="GeneID:59326736"
                     /translation="MGLSSIFGGATPSQQQTVDTKPVNPVTDKLKGQIVQELAVANAT
                     ELVNKVTDNCFEKCLMSPYSEANEQCVDQCLAKYMRSWNVVSRAYIARIQQASTSGEI
                     "
     gene            813674..813744
                     /locus_tag="HG536_0Etrna11G"
                     /db_xref="GeneID:59326885"
     tRNA            813674..813744
                     /locus_tag="HG536_0Etrna11G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59326885"
     gene            <813953..>814582
                     /locus_tag="HG536_0E04520"
                     /db_xref="GeneID:59326737"
     mRNA            join(<813953..813974,814032..>814582)
                     /locus_tag="HG536_0E04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284319.1"
                     /db_xref="GeneID:59326737"
     CDS             join(813953..813974,814032..814582)
                     /locus_tag="HG536_0E04520"
                     /inference="similar to AA sequence:RefSeq:NP_012510.3"
                     /note="ancestral locus Anc_5.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140215.1"
                     /db_xref="GeneID:59326737"
                     /translation="MIHAVLIFNKKGQPRLVKFYTPVDLPKQKLLLEQVYELVSQRNN
                     DLQSSFLTTPPSLLSDDRSPEDEEIQIIYKNYATLFFTFIVDDQESELAILDLIQTFV
                     ESLDRCFTEVSELDLIFNWQTLQSVLEEIIQGGMVIETNISNIVHSVDELNSASEQSD
                     GAVGRLANSGFGSALQAFANGGFAQWASRQ"
     gene            complement(<814630..>815076)
                     /locus_tag="HG536_0E04530"
                     /db_xref="GeneID:59326738"
     mRNA            complement(<814630..>815076)
                     /locus_tag="HG536_0E04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284320.1"
                     /db_xref="GeneID:59326738"
     CDS             complement(814630..815076)
                     /locus_tag="HG536_0E04530"
                     /inference="similar to AA sequence:RefSeq:NP_011690.3"
                     /note="ancestral locus Anc_5.186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140216.1"
                     /db_xref="GeneID:59326738"
                     /translation="MERPLWVRWLRVWAVGGAIIAGGALLFKYTTPTDEQLIQSLSPE
                     LRLQYERERNLRQAEQQELMKIVKETSQSDRPIWDTGAIESPWERKTSPQSKNRAQFE
                     KLKAEQVQRQELEKIREELAEIRQQTASETSRIVDERSQKSWWKIW"
     gene            complement(<815387..>816865)
                     /locus_tag="HG536_0E04540"
                     /db_xref="GeneID:59326739"
     mRNA            complement(<815387..>816865)
                     /locus_tag="HG536_0E04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284321.1"
                     /db_xref="GeneID:59326739"
     CDS             complement(815387..816865)
                     /locus_tag="HG536_0E04540"
                     /inference="similar to AA sequence:RefSeq:NP_011691.1"
                     /note="ancestral locus Anc_5.185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140217.1"
                     /db_xref="GeneID:59326739"
                     /translation="MVAQELLNADSSVTYDAIVIGAGVIGPTVATGLARKGKKVLIVE
                     KDWEMPDRIVGELMQPGGLRALRSLGMIQAINNIEACPVTGYTVFYNGEQVDIPYPYK
                     ADLSPVEKLEGLVKDGNDKVLEDSTIHIRDFEDDERERGAAFVHGKFLNNLRNMVAAE
                     ENVTRLQGTCVEVLKARNNEVVGAKVNIEGRGKVDFKAHLTFVCDGIFSRFRRELNPE
                     HVPSVDSSFIGLSLWNAKNPVPMHGHVILGPNHLPILVYQISPEETRMLCAYNSAKLP
                     TNIKAWLTKEVQPYVPKSLRPAFDAALTESKFRCMPNSYLPARQNDVTGLCVIGDALN
                     MRHPLTGGGMTVGLNDVVLLIKKIGDLDFSDRETVLDELLDYHFDRKNYDSVINVLSI
                     ALFALFAAENKNLKSLQKGCFRYFQKGGDCVDVPVKFLSGVNPKPLMLTRVFFAIALY
                     AVYLNIEERGFLGLPMALLEGIMILITATKVFAPFLYRELCA"
     gene            complement(<817461..>819011)
                     /locus_tag="HG536_0E04550"
                     /db_xref="GeneID:59326740"
     mRNA            complement(<817461..>819011)
                     /locus_tag="HG536_0E04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284322.1"
                     /db_xref="GeneID:59326740"
     CDS             complement(817461..819011)
                     /locus_tag="HG536_0E04550"
                     /inference="similar to AA sequence:RefSeq:NP_012509.1"
                     /note="ancestral locus Anc_5.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140218.1"
                     /db_xref="GeneID:59326740"
                     /translation="MSTFIRGPVCGVSNCPSRLWRIIDGRRTCQYGHVMEGDVEFNND
                     DDDLASAGVVTRRLNLTTGATGSFQSSFNASQSHNQQNLTGSKKIHGYQAKVLFIKSF
                     QLVLRAQAKWLIREMNFPPEFEQVVKLIWIHYLQWLDNSNAGHTDVEEHESERQEDRL
                     QLTALQLSMPAALSMLYMASVHMGLPVYTADFIRWIAAAELPYYKANSLLPESWKQQL
                     PSTYLRLLDGGKPPADGHILLKVSQICFRTAFTKNFNCKLRYEGLVLRLVLLGTLPPE
                     FYLYTVELIRLVDEADGFRLIEHPRMFFTKYYQWPELRVIAYFLLTVRWVLLCSEETY
                     PLPWILSLSDRSQTAGASADQDAILARISSSKDESNVTSWSHDETSTYLQWFKQSFLP
                     LQAEQANMSIDHRIAQRKLHKIFPIEPGLSRNDGSASHSSFIDQLQERYLYFLSDVES
                     RWNDQTMPDAHQRTASIAKLEQSLMAEIENQFALAREQITSAVRYIATRCSQLSAQRS
                     SRGAGDRD"
     gene            complement(<819258..>821474)
                     /locus_tag="HG536_0E04560"
                     /db_xref="GeneID:59326741"
     mRNA            complement(<819258..>821474)
                     /locus_tag="HG536_0E04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284323.1"
                     /db_xref="GeneID:59326741"
     CDS             complement(819258..821474)
                     /locus_tag="HG536_0E04560"
                     /inference="similar to AA sequence:RefSeq:NP_011694.3"
                     /note="ancestral locus Anc_5.182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140219.1"
                     /db_xref="GeneID:59326741"
                     /translation="MKGNFNSRRKDHGNSANGSSTGGSGNNNQFAGSSGFHESAETTR
                     NFNDRLDYLLAKSIGSEVVATVTSAVKYSGVLVACNLESNNGLDIVLKYPQIVDGGFA
                     DNIEELSEQLGDTLLINGADVGELELKGIDFAAGEKSEQAKKQEIEEQTKKPIESQEG
                     KANGGFKTDVDISRGKGEVRERELQKWTPDAADESLEIHNQTLEESSGTWDQFSVNEK
                     KFGVKSTFDEHLYTTKINKKDPDYEKRLKEAERIAKEIESQGSAGNIHIAEDRGHIVD
                     DSGLDEEDLYSGVDRRGNELLAALKTNAKPSPAKPSKYVAPTLRDQPHNVDPAIISSI
                     TAKSHANKQAPTATVSVKEVSVHRSATPSSKVTHVEMPTKPSTKTSQRTDVASKKHVS
                     KEAQIEELKKFSQKFKVPYDVPEDLKGILKNSSLKSDPSLPPKPSGNTGSKPSLPGTP
                     VGAKPDLRKNLSGAKLPSQSQTPTHSPSLGRASVSSKRRSTISFFGSKAPQPDEKKKQ
                     SFSRNFNMFIKAKQAYDEKAKNLQQQDSENKSMEPFFIEKPYFTAPTWISTVDQSYKS
                     LFPDERSAIQRAQINLQHRQMNSINAAATAAAANQQMGVVVGNMVRFPMGPGGSPNPM
                     MNGMAGNMGMYMPLQPQPMFYPSMPHMMSMMGGGEEGGGSPSPQALSPHMPPAYLNNA
                     PGSPAMGAYGYPGMPFQPMAGGGANLGGGNANYRHGYHHHGGQGSHGHRRNNHDNH"
     gene            complement(<821833..>822981)
                     /locus_tag="HG536_0E04570"
                     /db_xref="GeneID:59326742"
     mRNA            complement(<821833..>822981)
                     /locus_tag="HG536_0E04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284324.1"
                     /db_xref="GeneID:59326742"
     CDS             complement(821833..822981)
                     /locus_tag="HG536_0E04570"
                     /inference="similar to AA sequence:RefSeq:NP_011695.1"
                     /note="ancestral locus Anc_5.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140220.1"
                     /db_xref="GeneID:59326742"
                     /translation="MINTRRKVTKWSMATDSPSIDLEESANDGFTDAVNGGGDFPSSD
                     DDSSMSVHDSDALRLDILEQPKQKQLFYQGDEESELDGEVHQPQPLVHSPIQKHVRFN
                     SQRRKQPDSEEDTSPMHPWEFRRVIRKEFREKLPKNYEIKRWRRPSKAMVNSVIQLLE
                     TNVESSLRQVLKKYTPELQAIEHTENVDKIFRQKQSIMNDIISKIKSQLKKSKFPSRI
                     SDRELEIEYIVSKRKFIQNRYAEELMNAERLERELLREQTLLNELKASCEAVKMNNRT
                     SLTKGLMENNLHPSLNKAVENAYGLIADPSGSQVAGTLYKRDVTELNLKLKDPIKTSP
                     SQEEAANLLPGLNKSNQASAELYNNLSNFAEPELQAIFQRLFSGRHGC"
     gene            complement(<823108..>824961)
                     /locus_tag="HG536_0E04580"
                     /db_xref="GeneID:59326743"
     mRNA            complement(<823108..>824961)
                     /locus_tag="HG536_0E04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284325.1"
                     /db_xref="GeneID:59326743"
     CDS             complement(823108..824961)
                     /locus_tag="HG536_0E04580"
                     /note="ancestral locus Anc_5.180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140221.1"
                     /db_xref="GeneID:59326743"
                     /translation="MTDDDSHSIQSYEPEELYDKRELSRRSSDADGLHGGSIISRTQT
                     QISQLLSGNAEDRQEVLNIIDSHKQGVESVLSRYETHTHGLGPVEPMLDEERPEKFVA
                     APNTGTHAEDKWQYPVDVETGFRIVQFVEDDRDDPRCWNKRQKWNITILLGVVCFDVA
                     MMSAVITGDMTSPAKHFGVSMEVMCLCVSLMVWGFGIGPLFFAPLSEELGRNWVYHTT
                     LLVAVVFIVPCAVAKNIGTLLAFRFLGGIAFSAPMCLIGGSLSDMWRNEERGVAMSLF
                     SAAPFLGPVMGPIVGSLLSVKAGWRWVYYFMIIFSGCLYVVLVMFLPETHHQTILKRR
                     SKKLRKLTGDPSFRAISEIKVRSLKEITEDSLLRPVILLTELIVFLITLYMSIIYGLL
                     YMFFFAYPMVYSEGKKWGDIKTSLMFIPLGVGVLISTAISPLLNRDYLKRAQRYLDKG
                     ELPPAELRLIPMMIGSWFVPIGLFAYAWSSFPHVSWAGPAFSGMACGFGFLMLYNPAN
                     NYIVDSYQHYAASGLAAKTFVRSMWGGAVPLFTIQMYHRLGYEWATTLMAFISLACVA
                     IPYLFYYFGARIRERSRYAYSPEINTVKTTVNDEENDRSAQKEMQQASLSS"
     gene            825760..825869
                     /locus_tag="HG536_0Etrna4P"
                     /db_xref="GeneID:59326891"
     tRNA            join(825760..825796,825833..825869)
                     /locus_tag="HG536_0Etrna4P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:59326891"
     gene            complement(<826012..>827211)
                     /locus_tag="HG536_0E04590"
                     /db_xref="GeneID:59326744"
     mRNA            complement(<826012..>827211)
                     /locus_tag="HG536_0E04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284326.1"
                     /db_xref="GeneID:59326744"
     CDS             complement(826012..827211)
                     /locus_tag="HG536_0E04590"
                     /inference="similar to AA sequence:RefSeq:NP_011696.3"
                     /note="ancestral locus Anc_5.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140222.1"
                     /db_xref="GeneID:59326744"
                     /translation="MVKETPSKVAAHALSDLELKDTKNLGSTLESVAESKESEEDLQL
                     RLSKAAQEHRAFLKSHHVHRHKLKEMEKDEPLLVENKRRFVLFPIKYHEIWQAYKRAE
                     ASFWTAEEIDLSKDIHDWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSAEVQI
                     PEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKESDFLFNAIENIPQIKEKAEWAIRW
                     IQDSESIFAERLVAFAAIEGIFFSGSFAAIFWLKKKGLMPGLTFSNELICRDEGLHTD
                     FACLLFAHLKNKPDPAIIERIITEAVEIEKRYFIDALPVSLLGMNADLMNQYVEFVAD
                     RLLVAFGNPKYFKVTNPFDFMENISLAGKTNFFEKRVSDYQKAGVMAKNTKEDAEGDA
                     FAFDEDF"
     gene            complement(827796..827923)
                     /locus_tag="HG536_0Etrna12L"
                     /db_xref="GeneID:59326886"
     tRNA            complement(join(827796..827840,827885..827923))
                     /locus_tag="HG536_0Etrna12L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUG"
                     /db_xref="GeneID:59326886"
     gene            complement(<829078..>830184)
                     /locus_tag="HG536_0E04600"
                     /db_xref="GeneID:59326745"
     mRNA            complement(<829078..>830184)
                     /locus_tag="HG536_0E04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284327.1"
                     /db_xref="GeneID:59326745"
     CDS             complement(829078..830184)
                     /locus_tag="HG536_0E04600"
                     /inference="similar to AA sequence:RefSeq:NP_011689.1"
                     /note="ancestral locus Anc_5.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140223.1"
                     /db_xref="GeneID:59326745"
                     /translation="MGVVDKIRAIEEEMARTQKNKATEHHLGLLKGKLARYRQQLLAD
                     EAGTGRGGGTGFEVAKSGDARAVLIGYPSVGKSSLLGKITTTKSEIAHYAFTTLTSVP
                     GVLKYQGAEIQIVDLPGIIYGASQGAGRGRQVVSTARTADLIIMILDATKSEHQRASL
                     EKELEAVGIRLNKEKPNIYFKKKETGGIKITFTSPTRSNLTEDAIKLLLKDYKIHNAE
                     VLVRDDQCTIDDFIDVLNEQHCNYIRCLYVYNKIDAVSLEEVDRLAREPNTVVMSCEM
                     DLGLDDVVEEIWYQLNLSRVYTKKRGIKPDFSDPLVVRNNSTIGDLCHSIHRDFKEKF
                     KYALVWGSSAKHSPQKCGLNHKIDDEDVVSLFTK"
     gene            832301..832382
                     /locus_tag="HG536_0Etrna10S"
                     /db_xref="GeneID:59326884"
     tRNA            832301..832382
                     /locus_tag="HG536_0Etrna10S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:59326884"
     gene            <832655..>833389
                     /locus_tag="HG536_0E04610"
                     /db_xref="GeneID:59326746"
     mRNA            <832655..>833389
                     /locus_tag="HG536_0E04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284328.1"
                     /db_xref="GeneID:59326746"
     CDS             832655..833389
                     /locus_tag="HG536_0E04610"
                     /inference="similar to AA sequence:RefSeq:NP_011688.3"
                     /note="ancestral locus Anc_5.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140224.1"
                     /db_xref="GeneID:59326746"
                     /translation="MSFYNQGASNGGFYQPSSQFAFPQGSMSFQSQPSNAGSGNDGMT
                     VSPDPLPVGILNALSTKGFPHEPPLLEEIGINFDHIITKTKIAFNPVNSKGALSDEIL
                     SDSDLAGPLIFFLLFGLFLLLAGRVHFGYIYGVALFGTVSLHGLSKFMSNNESSSPTK
                     LQFFNTASILGYCFLPLCFLSLIGIFCSLDNKVGYFLGVIFVSWSTLSSSAFLNSLLQ
                     LHGARALIAYPLMIYYSVFALMAIFV"
     gene            complement(<833462..>834982)
                     /locus_tag="HG536_0E04620"
                     /db_xref="GeneID:59326747"
     mRNA            complement(<833462..>834982)
                     /locus_tag="HG536_0E04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284329.1"
                     /db_xref="GeneID:59326747"
     CDS             complement(833462..834982)
                     /locus_tag="HG536_0E04620"
                     /inference="similar to AA sequence:RefSeq:NP_010022.1"
                     /note="similar to Saccharomyces cerevisiae GIT1 (YCR098C)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140225.1"
                     /db_xref="GeneID:59326747"
                     /translation="MSAVKETIRYDAEKRQQRVNEPRKQQLIHIIALVASGFALISDG
                     YQNNAMSMLNKLFPELYGSKAYSSKVSTRVSNASLVGTIIGQVGMGIGCDYIGRKSSI
                     VFGTVLLVVGSLLCAASHGKTVDGMFWMLTVMRGVVGVGVGCEYPSASVSANEAANEY
                     TRKRRGGLMVMVTNLPLSLGGPFASIVFLIVYSICGENHLEAVWRTMFALGCFWPLSI
                     FYFRWKMATNELYKKGRFQSKIPLWLIVKFNWKSMLGTCGAWFMYDFVTFPNGIFSGT
                     IIASVIGDSKDLKKICEWNLLLGVIAIPGVFLGAYLCDRIGRKYTLIFGFCGYLVFGL
                     IIGCAYEQLSKIVPLFIVFYGIMNSLGNAGPGDMMGVTSSESFPTAVRGTLYGLSAAI
                     GKVGAVAGTQSFQSIRNKLGPRYTFIIAACCGIAGILFAWIFIPHSREEDLMELDIKF
                     YNYLVEHGWQGTMGFDAAKDDTTVFYEDENSNHTGLKADVNSEKKDENITTIESRI"
     gene            <835648..>837336
                     /locus_tag="HG536_0E04630"
                     /db_xref="GeneID:59326748"
     mRNA            <835648..>837336
                     /locus_tag="HG536_0E04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284330.1"
                     /db_xref="GeneID:59326748"
     CDS             835648..837336
                     /locus_tag="HG536_0E04630"
                     /inference="similar to AA sequence:RefSeq:NP_011687.1"
                     /note="ancestral locus Anc_5.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140226.1"
                     /db_xref="GeneID:59326748"
                     /translation="MRLWGPWHRRLHSQVSHITTPIFYPNARPHLGHLYSSLLCDVFH
                     RWQLFKKGSSLFTTGTDEHGLKIQAASERAGYASPREFVDNLCRDFVKLDRAGDIRFT
                     RFIRTTDADHVENVRKLWKLCDLNGFIYRGEHKGWYSVSDETFYPESKVQRSGTDADK
                     FINTETGNEVVYHTETNYFFKLSAFRERLVAYITENPRFIDPSAKRLQVLRELQEEGG
                     LPDISISRPSSRLKWGIDVPGDPSQKVYVWFDALCNYVSSVGGIDAILQDAIPEVALR
                     HEGGNLEVSSAEWWRNTTHVIGKDIIKFHTIYWPAFLMAAGLPLPKQIVVHSHWLSNG
                     VKMSKSLGNVVDPLLMIDHYGRDAMRWFLLENSQLEDDNNFQEDKLHSTRELLVSKWG
                     NLVNRCCGAKFNLQRAVATFASMDRETLLNLLDGDQMLKEAVQKLFTELDMISEKMDG
                     YISRFESRAALRNVWSVIDLSNTLIQDSKPWTKEGPQQDVIIYACMEASRILSILCQP
                     IIPSLAARLLDRIDVPLDRRSVAFTKVGTDDLYGRGSNERGRPVPLQRKPLREQ"
     gene            complement(<837393..>838556)
                     /locus_tag="HG536_0E04640"
                     /db_xref="GeneID:59326749"
     mRNA            complement(<837393..>838556)
                     /locus_tag="HG536_0E04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284331.1"
                     /db_xref="GeneID:59326749"
     CDS             complement(837393..838556)
                     /locus_tag="HG536_0E04640"
                     /inference="similar to AA sequence:RefSeq:NP_012539.1"
                     /note="ancestral locus Anc_5.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140227.1"
                     /db_xref="GeneID:59326749"
                     /translation="MKAKVLDIQGKEPCWAIGTVYCELKYKPNILEEVINDVYRAPDL
                     TKSYTDPEGSDEIMLEDESGRVLLVGENIRATPFITGAVIGVLGMEADAGTFQVLDIC
                     YPIPIPQKPLSLSPGRSAVAGNKKIAVVSGLNISTTSPRRLLKLQLLQEYLTGNLCSP
                     ELISNIGKLLVCGDSLSFKFDTSSSGELVNCLSTLGNFLSNVTQSIPVALMPGAKDPS
                     NRSLPQKPLHKALFSQTLGAHLEEVNRDVLKLVTNPYYFHIEGLEILATAGQSINDIC
                     KYLIPNQGSSQEEDTIEHRLDLMECTMKWQNIAPTVPDTLWAYPFPSSDPFLLDEWPH
                     VYIVGNQPGYGFRDLDVHGRKIKLISIPVFSSTGDVVLLDLTTLETEVINIGA"
     gene            complement(<839087..>842473)
                     /locus_tag="HG536_0E04650"
                     /db_xref="GeneID:59326750"
     mRNA            complement(<839087..>842473)
                     /locus_tag="HG536_0E04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284332.1"
                     /db_xref="GeneID:59326750"
     CDS             complement(839087..842473)
                     /locus_tag="HG536_0E04650"
                     /inference="similar to AA sequence:RefSeq:NP_011686.1"
                     /note="ancestral locus Anc_5.174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140228.1"
                     /db_xref="GeneID:59326750"
                     /translation="MGLIRHRRRPATRKPRLMLKVNVVQVQNVDLFKDFKCNPTCVIT
                     TNSLYSKRTSKLKSSKTKWNETLKMKLPSSPQSEWVRIVIYDALPTAPAVAIDGADGA
                     SNSNDSTTSLGAQGYSTGDPSRSNSQISSASSRGSENSYLYVGETKLSLLDLFKRRDT
                     VTSYRFSIDPTWFRIYDKRLQRQLKDRSELPYAVGEVQLGFKLSTSSKHLSTIQAYNQ
                     WRNSLLGALEHKRSLKRTHPSRFSSLYHEKIDHSTSEENFHDNYDFLASKDNDDDVES
                     RVDYSDNEVYDQDEFTSENNLFSDIISLDSDEASLVDDEDVVEKDLASIVPVLDEYEV
                     VDPDLISSVSHLSLIEDEHDDIDDDEDDDDDIEEVYENDAIPATHITDLNQDIYRESS
                     ADLEDEDEPDDYEDDETDDFTVKHTGRRLPRLRRTRRSNRIPSHFITPSGNYKLSKKQ
                     HASGVVFLEFRNIKDLPSLKNKVSRRTYEMDPFIIAIFGRRVFKTSWKKQSLNPVYNE
                     CAAFEVFPDETHFGFHFNVLDKDSFSANDKIAHCDLSWSHMIAKQTPENDWANYDLPL
                     SLTVEPQDSKSPTLSLKMKFVPYSILKKSFWSNALKMHTSRTEFDIVDLTLYLDKLGY
                     FTADEICEFFNHFGKKPWAGETLSNVQITEFLQNWKKSSGFKNVWKCPNCSHSCKPTR
                     NMMNTKLVLENDLITHLAICSFESDRKLLKPSYVSSDFASKRWFSKVLIKLTYGKYAL
                     GSNNANILVQDRDSGIILEEKISAHVKLGMRIIYNGKGKESRKFRALLKTLSIRQGKK
                     FDDPASVRQIAPFIKFHSLDMTEYEETSYTTFNDFFYRRLKPGARKVEGDGKIFVSPA
                     DSRCTVFSNIHQAKDIWIKGTRFSLTRLTKNYKPDIFNDRSCSIMIFRLAPQDYHRFH
                     CPCDATIGKPVFVDGQYYTVNPMAVRSSLDVFGENVRMVIPLESPEFGTLLLVPIGAM
                     MVGSIVLDRKEGEFVRRGEEMGYFKFGGSTVAIVIPSKSIVLDADLSKNSADGIETLV
                     KVGMSVGHSPVVAEHKREKIKITNPAQVEKIKRTISISQENATSLNNAPWEYQALRNI
                     LQSEYGKSAVESSAQNGTSPGELLPHPSSPTSSSTSTTTV"
     gene            <842755..>843030
                     /locus_tag="HG536_0E04660"
                     /db_xref="GeneID:59326751"
     mRNA            <842755..>843030
                     /locus_tag="HG536_0E04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284333.1"
                     /db_xref="GeneID:59326751"
     CDS             842755..843030
                     /locus_tag="HG536_0E04660"
                     /inference="similar to AA sequence:RefSeq:NP_878106.1"
                     /note="ancestral locus Anc_5.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140229.1"
                     /db_xref="GeneID:59326751"
                     /translation="MGKRFSESAAKKAQGQARKREQAAAQQRAEHARQEAEEAAKWEE
                     GARRPSQKKLSEEQKRQEKLKAKKEREELLAAEESDIAKEGRSKRRM"
     gene            complement(<843127..>844122)
                     /locus_tag="HG536_0E04670"
                     /db_xref="GeneID:59326752"
     mRNA            complement(<843127..>844122)
                     /locus_tag="HG536_0E04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284334.1"
                     /db_xref="GeneID:59326752"
     CDS             complement(843127..844122)
                     /locus_tag="HG536_0E04670"
                     /inference="similar to AA sequence:RefSeq:NP_012511.1"
                     /note="ancestral locus Anc_5.172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140230.1"
                     /db_xref="GeneID:59326752"
                     /translation="MNRCKQASELVLKKLKLPTAYNNGTGPVLPNASGVSLSSPRARQ
                     LALKKKLEDCNNTFITDVRPRERWDQNQERQNLATAAAKVKGCNRIVQRFQNVHKIYS
                     RESHVYQCDFFRLMYFPPDHFLSMFRKSKPAVNVRTVGQVFLNGSGSSGDGSAGKALF
                     QRNSQKNGFLRTQSTANSLGRLFESNPSNIPRNYAFLRRNLRVSLRKCFIKEWCALSG
                     DLAVQEALSSGGAGTRYTDPDGRSRVGVAKDGYYMYQVLIFPDRETKKEFESCVKESV
                     QVVSRLDWDEFLKPQSSKAGGKTWVQLANDRVRVHSLNKSLESNEIPFAVKRLWY"
     gene            <844921..>847314
                     /locus_tag="HG536_0E04680"
                     /db_xref="GeneID:59326753"
     mRNA            <844921..>847314
                     /locus_tag="HG536_0E04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284335.1"
                     /db_xref="GeneID:59326753"
     CDS             844921..847314
                     /locus_tag="HG536_0E04680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140231.1"
                     /db_xref="GeneID:59326753"
                     /translation="MTGNINTVIADIASPIGSISETATDAAGRNFLKNYMEHVAPSEW
                     LSLNAATIMLSILAPLMLTLACNETARSIVLFCWACFIKPFHAKSSHSADNQQKNLEL
                     FYKTQAKIYDKTREVLLQGRFEALQLAYSHLPKNKKGLIWIDIGGGTGLNIEKMSQIC
                     SLKDTFQAIYLVDLSPSLCEVARERADRLKWTNVHIMCADACDFEIPQHECADLITFS
                     YSLSMMPPYYAVIDHAYELLNENYGIVCSVDFGVQSSAHVTGRVNNIGGLMNYHIPWF
                     YRTFWRIWFECDKVFLDPSRREYLEYRFGTLKSINMRNKTLGNIPYYIWLGVNKDEDH
                     MLSHRFKVLAARSPYLAPVEQGTPLKGSQCPTSKELEVAASNTKKGLPFPSLFYQREI
                     WRAYYDELSPHYDQFKNQYIYAFTWEDPREDAKILNLTADDTVLAITSACDNILAYAA
                     LPNPPKRIHGVDLNPFQGHLAELKLAASRCLTYEEIWSLFGEGRIANFKKLLLCKLAP
                     HLSSNAFQYWMSEGARAFDISGHGFYDTGSTRWALRLARYIFKTMGLSGKVTELCKAR
                     TIREQQLIWNKYIRPALFNPIVGKLLVGNPIFLWKALGVPTNQAEMMGSSTLQYIIDT
                     MDPLISRSLISTDNYFYYLTLNGRYSKDNCPVYLKEKVHEIFASESNSPLDRIRLHTD
                     TLNNVLSRLAQKSLTVAVIMDHMDWFDPNGNDANHEITALYNALQFGGRVLLRSAATH
                     PWYIKSFEDMGFVCEPAAIRRSGESIDRVNMYASTWICTKTIELDARRRMSSLDLTH"
     gene            <847429..>848649
                     /locus_tag="HG536_0E04690"
                     /db_xref="GeneID:59326754"
     mRNA            <847429..>848649
                     /locus_tag="HG536_0E04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284336.1"
                     /db_xref="GeneID:59326754"
     CDS             847429..848649
                     /locus_tag="HG536_0E04690"
                     /inference="similar to AA sequence:RefSeq:NP_011685.3"
                     /note="ancestral locus Anc_5.171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140232.1"
                     /db_xref="GeneID:59326754"
                     /translation="MGVEVYFANGVRNLRPYYHGRASFAKGRWFKRTLLEVLLNEFNA
                     ESKEEYVEGIRGGKYRIIREGRALDPEEVLISPIRNSDVIETNSHKHEPPVKQWCDAE
                     VDIPGEKVAGIDIVYEDESLLVLDKPNGIPIHPTGMFYQNTLTEILKSRGKEARPCYR
                     LDKVTSGLLIMGKTKAIANEIQAKIRSRDMNKIYLARVSGKFPGYNRLTNEACGQLPR
                     PFENQELNTVVESATYTIELKKSFPAGLSVPKQAITSFCPLRYFANLDQTLVACKPLT
                     GRTHQIRIHLARLGFPIVNDPFYNLANTKYPLRSKFILDIEDWENSSLTIEDLRKHFN
                     RFDQECDEVQAKQRSTQAHLICKECGSIEAETPPLKELELWLHAWKYSDSQKTIAFET
                     KAPSWTEEDCGIVL"
     gene            complement(<848730..>851750)
                     /locus_tag="HG536_0E04700"
                     /db_xref="GeneID:59326755"
     mRNA            complement(<848730..>851750)
                     /locus_tag="HG536_0E04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284337.1"
                     /db_xref="GeneID:59326755"
     CDS             complement(848730..851750)
                     /locus_tag="HG536_0E04700"
                     /inference="similar to AA sequence:RefSeq:NP_012514.2"
                     /note="ancestral locus Anc_5.170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140233.1"
                     /db_xref="GeneID:59326755"
                     /translation="MSEPETPFQVIAHYPFKSEHEDDLNFDKDQLITVTSVEDDEWYF
                     GEYVDAGGNVLEGIFPKSFVAVKSSKDSSTGRKAVGLTETKTKDDTHDEEEFVDAESM
                     ESPTVGKRKSIFDQDEVAPMPRASEFFDSEAMPVKKTVVANPPQFYVPPPIAQEAEKP
                     QVAVRKPEVPEPVNRTTAEGDLGDSGSAATGLPKVSLKERIALLQEQQRLQAEREREL
                     ELKRSEEVHAEEDDKYQDEERVKEANDEPRGKEKATVINSDPAGLEHQHIPEGFLVPA
                     DNKDSAPLDEQPGREEQPVQHNDEEQENEASGEEEDSEETRRAALRERMAKLAGAGRF
                     GGPASFNPFGMPAGGSTGSTATKMHAKPEPQIESMIPQAVPVMPFADPNAVPFLIKKS
                     RRKSESSDESPDESPKDTTVVPKVSTTGGQTLATLDPSALNTPGFDADEEEAGEEGAY
                     FGEDLTAPTHDGEAIEQGEGIVGDLPPSGSTEGYQSSDDSRCASTDNIGQASSAFEPL
                     IVPTPNISKLKDEEKAVLNSMAPAIDLPLDNIPPSVPIGEELAPEVPESAEIPLDPSE
                     LVPPAPPVPGVDMSKIKPSTKPPISAVPPLPSDLEIKTPHPPHLRRNSFEGKGEQGFA
                     ANKDVPAVSSLSQPQPDKGKRAPPPPPPPPPAPAPARSVGSELGSTLSGPPPPPPAVP
                     SIPAVERAAIQSHPHPSRAPPVPIPLAPPAVAKSERPNYLRHEPMPPEGQPPVANPPP
                     APITSLQRRTTTGDGLEAAHESSVEFDPTDLWWLHKTAPSKLFSPKSNYLMEVDDHLI
                     KKRLSQSIMVRDFYFLFEDYSQLHLSLTFDIDNPQATVQSTQRFVALKNNPELLSTSS
                     EKYGSYIIQRASELIQSQNPDFVNSILSQLSNEIVMPIESRTYGVVLLSYKAGQTLNL
                     EALRSIRAGDILVIRKGKFETHRKLGPKEVVKVGMEAVPHTAVVTEYDHSKNKLRVIE
                     QKDGKITQTGYRLEHMKAGKLKIFRVIGRDYVGW"
     gene            <851985..>853067
                     /locus_tag="HG536_0E04710"
                     /db_xref="GeneID:59326756"
     mRNA            <851985..>853067
                     /locus_tag="HG536_0E04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284338.1"
                     /db_xref="GeneID:59326756"
     CDS             851985..853067
                     /locus_tag="HG536_0E04710"
                     /inference="similar to AA sequence:RefSeq:NP_011684.1"
                     /note="ancestral locus Anc_5.169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140234.1"
                     /db_xref="GeneID:59326756"
                     /translation="MGALARVVSFCVAKDVNGRPALARLLLTRLISLYGVSTVLFLIK
                     LRKLTSSSRWTAELWKYLRNSSGLAMALTLVPVIRALAGVENIVLPWSAAVGGALATV
                     TGLPSWLSSYVAVESISDAVLSTRTVKKVLSNMGTSSLVIGRQALLCLLIPFFYSRAD
                     KQSSAAARFLFKKRSLGRDFVLFYCIWNFLSVYNSLKSFLRDSRREKVYRSQQYSSGQ
                     VDEWPMISSNLKPLMDKLVEIHEITLQDTYSSFEKIMNSPMIKNFMPCFKWALWRQLC
                     VRTMTHTPPTRHNHAAGASLMKSITLMLGFFVLDGSDNKMNVRPGVLRYLIRCTLSTY
                     LGITSLKTQQLIAFLGSHLALQNIAQ"
     gene            complement(<853139..>853657)
                     /locus_tag="HG536_0E04720"
                     /db_xref="GeneID:59326757"
     mRNA            complement(<853139..>853657)
                     /locus_tag="HG536_0E04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284339.1"
                     /db_xref="GeneID:59326757"
     CDS             complement(853139..853657)
                     /locus_tag="HG536_0E04720"
                     /inference="similar to AA sequence:RefSeq:NP_011683.3"
                     /note="ancestral locus Anc_5.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140235.1"
                     /db_xref="GeneID:59326757"
                     /translation="MSDFEVENIPASATGVSEPDLLGVGEEDTMQREPHEESTENELN
                     DFSAPSTESSNGDAIRNWREKREADIASRDKADQEAKKKLQEAAVKHIDDFYENYNRK
                     KAQQQEEVKREAEEFLRKKQEFFSQENTTTWDRALQLINEDDADILGNRDRSKFKEIL
                     QRLKGNPHAPGA"
     gene            complement(<853809..>855260)
                     /locus_tag="HG536_0E04730"
                     /db_xref="GeneID:59326758"
     mRNA            complement(<853809..>855260)
                     /locus_tag="HG536_0E04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284340.1"
                     /db_xref="GeneID:59326758"
     CDS             complement(853809..855260)
                     /locus_tag="HG536_0E04730"
                     /inference="similar to AA sequence:RefSeq:NP_011682.1"
                     /note="ancestral locus Anc_5.167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140236.1"
                     /db_xref="GeneID:59326758"
                     /translation="MMDCYIPLDNSIDNEDLASLERSHKLRDFIIFDEDLKIVLYSKN
                     KLKTFTVWINDAKVYESSMADTFNCRGSIWQLKDSKSSRSFFRSSVVMNNGYSNEIKL
                     LVEYQETADSAQHATTPNGRPKQEYEDFLPSFEPVSWEEQLIGETQQLALKDEELQSN
                     ESLKSFELIYPIYSLLNMRLRNSLLKPAHSILSSLDFQTSKASIQLSEKFLPNSGDKA
                     PFLLEFEDVRFELVEKDNHIALNPVCTLQVPFECAPYDGWSLGYELPLVAGNVSNSRP
                     HRVRITIRYALVLAELKQRLPVTTTWETEVTLKKPMISNAISQASSAISTPKLYGTMP
                     RTPMLGSTTSLVNNKLNNVKFKFLSNKIVTTKGQNFTLKLQISNTSNSSLDMVVYYNS
                     KPPIPGQSSSPLALQKQFQIYKRYRKISEGVILLSNDCKIPTVEPNETYLADLSFVGV
                     MSGYYPTLAGLKMVDLKTNEVIDIGQGASVLVK"
     gene            complement(<855969..>856622)
                     /locus_tag="HG536_0E04740"
                     /db_xref="GeneID:59326759"
     mRNA            complement(<855969..>856622)
                     /locus_tag="HG536_0E04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284341.1"
                     /db_xref="GeneID:59326759"
     CDS             complement(855969..856622)
                     /locus_tag="HG536_0E04740"
                     /inference="similar to AA sequence:RefSeq:NP_011681.1"
                     /note="ancestral locus Anc_5.166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140237.1"
                     /db_xref="GeneID:59326759"
                     /translation="MMLSVGGCRPGSAPGAVVICQQVRNISRRRIAYPFYPFKRLGKQ
                     DPKKHDSNLKSAMRQFLGPKNYKGQYVMNKYFEVPKNHVPNYIKPDLERGQSLQNPIT
                     GENVVLKYDGTYGEAPENRRLQQISEKRVLQPFPNNSHCRTNSIISDDLKMRIYNDIE
                     VEGHTTQQVSQNYGLKVPRVEAILKLAEIEQKWAKRVCIRSYETELKLGVSYDETTK"
     gene            <857000..>859030
                     /locus_tag="HG536_0E04750"
                     /db_xref="GeneID:59326760"
     mRNA            <857000..>859030
                     /locus_tag="HG536_0E04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284342.1"
                     /db_xref="GeneID:59326760"
     CDS             857000..859030
                     /locus_tag="HG536_0E04750"
                     /inference="similar to AA sequence:RefSeq:NP_012515.4"
                     /note="ancestral locus Anc_5.165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140238.1"
                     /db_xref="GeneID:59326760"
                     /translation="MTELDGKDRIYNKSMKAAYADLLMEKMASGTGSAVYDNNEGGCE
                     EGELAMIQDDEENDGEDDDGYYGRFKRSILRERGEELEKTSMSELEEEDDGWLDDNST
                     LDEDYTDEADRSFYADNGEEDSEDYEEESDYQYDGRYADEAPSAGLISRKWSLVALAL
                     VIMLIVGPAMNGLLFSGQSSLKPSSGSPAIQKQINHLYSEMTTREQRAKSEFDKTIKV
                     IISQFEKKIKELLPANVMKLQNQLESLTNRVNNLSFSLSQREYGSGPVFSIENVTEWQ
                     RRLVQDLETSLPQQIPVVMNNNTSMLVLPELNNYLAQVISSLVQERDTIREEQSLKYD
                     LNCYVKEILANEFQYVDKAFFISELNRRMQLNKHEILQEMNDKLDQYKLESAKNRSPS
                     ETIPQQYSNILLKKLVNKIYNTNQHQWEDDLDYATFAQGTKLLNHLTSSTWSLGNGVN
                     PVELLRDSRIGSSTYWQCSGSRSCSWAVRFKEPAYLTRVSYVHGRFNNNLHMMNSAPK
                     VISVYVKLAKSSPNVDVKRLTELARSFKQGQPFNKDGQHVRIGQYHYSLTDNQVRQVL
                     PLPSWFIQLKPLVRSVVFEINENHGNSRFTSLRKFIINAVTQEDLRIMESNSFPFRSD
                     DPPDYALSSIDTTKLKAAKLEQSHEVPQLDDDAAGLSKDRIPSFGQDEPDST"
     gene            <859671..>861257
                     /locus_tag="HG536_0E04760"
                     /db_xref="GeneID:59326761"
     mRNA            <859671..>861257
                     /locus_tag="HG536_0E04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284343.1"
                     /db_xref="GeneID:59326761"
     CDS             859671..861257
                     /locus_tag="HG536_0E04760"
                     /inference="similar to AA sequence:RefSeq:NP_012518.2"
                     /note="ancestral locus Anc_5.164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140239.1"
                     /db_xref="GeneID:59326761"
                     /translation="MRLLTSLRSSVNISRQGPAKVGNSKSIAGEDVALASPSSAPRTF
                     RSLPQDLLDGIKPLLVLLQAHSRKTYYEWALDTLTQDIWQITSKDRPTHFYPVRKLLL
                     VGTEVIVEAEELGACKVSLVEQNDRVQRLGIEVSGQVLSLNGGEVVFTCTNPSSLKDM
                     EKLCLLSVFEYYSILKSVTGTIISGLGIILSDMHVVLSSAFNYKDWCEIYLQDQGWLK
                     VWCHIDKVGKRGSGSQQSGRCQIKFYKDRKQASSSNLVCFIPDCEYTQDMFFYKDCKQ
                     ASPDYSQMDLQEFLENLNMIKIVGNVCFPQEGFQKNRSRSSSTMSFLNGNETSSKRSS
                     VAASPKSTSSRLKALSPTKGQHRRKTSELSLDSNHSQYKDLENCITDPKGLLIRPLSH
                     NGVHHLEAMIRMIIPMMDCTRLYGRPSLFKSNRSHPESLMFGLPKLPTVDYFAREELS
                     SLHMPGFEAGKFPSTDSNAVAMHYYSRSLHEKMTQDPHRDRKLSFRQLASITDHGKEQ
                     LPVLEKQEGSFLGSLTSLMV"
     gene            <861422..>863041
                     /locus_tag="HG536_0E04770"
                     /db_xref="GeneID:59326762"
     mRNA            <861422..>863041
                     /locus_tag="HG536_0E04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284344.1"
                     /db_xref="GeneID:59326762"
     CDS             861422..863041
                     /locus_tag="HG536_0E04770"
                     /inference="similar to AA sequence:RefSeq:NP_012520.1"
                     /note="ancestral locus Anc_5.163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140240.1"
                     /db_xref="GeneID:59326762"
                     /translation="MQNPTQAPVVFMNTSQERTTGRQAQISNITAAKAVADVIRTCLG
                     PKAMLKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVII
                     LAGEILAQCAPYLIEKNIHPVIIIQALKKALSDALEVIKQVSRPVDVENDSAMKKLIE
                     ASIGTKYVSHWSDKMCDLALAAVKTVRVELGDVTAGEAVFEIDTKRYVRVEKIPGGDV
                     LDSRVLKGVLLNKDVVHPKMSRSIQNPRVVLLDCPLEYKKGESQTNIEITNEEDWNRI
                     LQIEEEQVKYMCEQILAVKPNVVITEKGVSDLAQHFLLKGGCSVLRRVKKSDNNRIAR
                     VTGATIVNRVEDLKESDVGVQCGSFRIELIGDEYFTFLDECQNPKACTIMLRGGSKDI
                     LNEIERNLQDAMAVARNVMLAPSLSPGGGATEMAISVKLAERAKQLEGIQQWPYQAVA
                     DAMECIPRTLIQNSGGNPIRVLSELRAKHAQGAYTTGIDGDTGKVVDMVDYGIWEPEV
                     IKQQSIKTAIESACLLLRVDDIVSGVRKQEE"
     gene            complement(<863214..>866240)
                     /locus_tag="HG536_0E04780"
                     /db_xref="GeneID:59326763"
     mRNA            complement(<863214..>866240)
                     /locus_tag="HG536_0E04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284345.1"
                     /db_xref="GeneID:59326763"
     CDS             complement(863214..866240)
                     /locus_tag="HG536_0E04780"
                     /inference="similar to AA sequence:RefSeq:NP_011704.3"
                     /note="ancestral locus Anc_5.162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140241.1"
                     /db_xref="GeneID:59326763"
                     /translation="MMSNGSSNRGRTTNFNEIEEEKENILPLRDGRSAQGLSQVLNED
                     LSQLNCTRLTFERRLLEELEDLDDPLELFMEYINWINHAYPQGGSSKKSGMLDLLERC
                     LMYFRDMETYKNDPRLLKVWLWYIEVFSADSDQDSKEIFIYMLRKRIGNKLALFYEAF
                     AASLFEAGKFKEAHIILKMGVDENARPQNRLLKRLEECEMKLRIMNIEPSNSGPADRQ
                     FLESSSNLVLGRGRSSLLTTMQGGSSGNAVLDRDVRLAKYDVFRDEENANDVNAPLRN
                     DGWDLLDSRANRTKENQATSTRITSGSNLGKIDQEGDYQQRQASSEKLPIFKDSLGRS
                     EPVYKLVQVAGKKPEKIDCNFNLIYPTSNEEFCIEEILAISRNVYHKIDNDAVLAQDE
                     APMIKKRKKSAPLTEKKALLPSSQPPVSHIRDGSQNEPSNHSNQSEDNEKLQVVPSTS
                     ILPLRSGQEDDRTDHEKIKKQLQSPRSPTITYFSKSAMEEVYSMFNQHYQEPKAIADR
                     DETTGRFVLDNITQDYTRQNLEDLTEVKRTDADGNTKTGNLYVEAAEKNIVASPHKEA
                     IEAETASDIYGAGRHDFMTPIQERNEKPSETPSEGQNGDSGKDLSEVDGSSPFLTQPQ
                     LTTSGNKKSEAHIIEDPLNSKLRAQLLANVKPPLDDYETFYRYNQPLKMSALLKRIHR
                     VSKSENKNPIVDFKKTGDLYCIRAELGEGGYATVYLAESSTGGLKALKVEKPASVWEF
                     YILKQVEKKLKGNGVLRSIINASSLHCFQDESYLVLNYANQGTILDLVNLQKEKSKGP
                     IDELLCMFMTIELMKVVEALHSVGIVHGDLKPDNCMIRFETGSLGPYQADGSEGWDRK
                     GIYLIDFGRSFNMSLFEPGTKFKANWKTDQQDCVEMTKGIPWSYEADYFGLAGIIHSL
                     LFGELIDTIQGPDGRVRLRNSFKRYWKQDIWSSIFDALINSNSFDCFPITSMLVESRL
                     QIEAYLTSHNTDNLRCIIRDLESELTQARRGTRFSR"
     gene            complement(<866512..>868680)
                     /locus_tag="HG536_0E04790"
                     /db_xref="GeneID:59326764"
     mRNA            complement(<866512..>868680)
                     /locus_tag="HG536_0E04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284346.1"
                     /db_xref="GeneID:59326764"
     CDS             complement(866512..868680)
                     /locus_tag="HG536_0E04790"
                     /inference="similar to AA sequence:RefSeq:NP_012522.2"
                     /note="ancestral locus Anc_5.161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140242.1"
                     /db_xref="GeneID:59326764"
                     /translation="MKFGEQLSKSLIRQYSYYYICYDDLKNDLEENLEKNNGNWSQDL
                     ETEFLESLEVELDKVYTFCKVKHSEVVRRVQEAQEQVQHTVRALNSNTPPTALDFDIL
                     EEELSDIIADVHDIAKFSRLNYTGFQKIMKKHDKKTKFVLRPVFQIRLDAKPFFKDNY
                     DELVQKISKLYDIVRTRGQPVKGDSSAGGKQQNFVRQTTKYWVHPDNITELKLIILKH
                     LPVLVFNANKEFEKEDSAITSIYYDNENLDLYYGRLRKDEGAEAHRLRWYGGMGSDTI
                     FVERKTHREDWTGEKSVKARFALKERNVNDFTKGKFTVEQAFAKMRREGKKPIKEIEN
                     LEALAIEIQYTMLKKKLRPVVRSFYNRTAFQLPGDARVRISLDTELTMVREDNFDGCD
                     RTKGNWRRMDIGVDWPFKQLDEKDVCRFPYAVLEVKLQTQLGQEPPEWIRELVGSHLV
                     EPVPKFSKFIHGVATLLNDKVDSIPFWLPQMGVDIKKPPIKTNINITRPDRDDDDDDE
                     DDEDEEDAALVNAMTATGNTLDIEERAGNYGSIEGPGQTRADQGADEGASSNAAYYRR
                     KINTARNPLTRVCYKVAGLFDHYMNGDQIVKVPKGTVFDTQVKAPPGKTICVPVRVEP
                     KVYFATERTFLSWLSIALILGGVATTLVTYGSTTTMIASIGFFITALATIIHAVLIYA
                     TRVVNIRLKKAVDYEDKLGPPMICTFLMLSILFSFFCNLV"
     gene            complement(<868899..>869369)
                     /locus_tag="HG536_0E04800"
                     /db_xref="GeneID:59326765"
     mRNA            complement(<868899..>869369)
                     /locus_tag="HG536_0E04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284347.1"
                     /db_xref="GeneID:59326765"
     CDS             complement(868899..869369)
                     /locus_tag="HG536_0E04800"
                     /inference="similar to AA sequence:RefSeq:NP_012523.2"
                     /note="ancestral locus Anc_5.160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140243.1"
                     /db_xref="GeneID:59326765"
                     /translation="MKILEARDAFFSDYETLQFLSKLERQHHWDEDSTTHDRRDKKKI
                     KTHKPYNNPELQAITRDTIAYLTTDKGVPQEDDESSGNNDKKKSAISSLNDQRFSELV
                     AQLNNFDLFKAEKLQIVNQLPTTMVHLYAVVEECDTRFTQEQIEQILGITAQYL"
     gene            869529..869601
                     /locus_tag="HG536_0Etrna9K"
                     /db_xref="GeneID:59326898"
     tRNA            869529..869601
                     /locus_tag="HG536_0Etrna9K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59326898"
     gene            complement(<869720..>871186)
                     /locus_tag="HG536_0E04810"
                     /db_xref="GeneID:59326766"
     mRNA            complement(<869720..>871186)
                     /locus_tag="HG536_0E04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284348.1"
                     /db_xref="GeneID:59326766"
     CDS             complement(869720..871186)
                     /locus_tag="HG536_0E04810"
                     /inference="similar to AA sequence:RefSeq:NP_011705.1"
                     /note="ancestral locus Anc_5.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140244.1"
                     /db_xref="GeneID:59326766"
                     /translation="MVKAGLVSAIAIASFWSRVVNGQSSTVAGDCNPLKSTNCSPDKA
                     LATSFAEDFSSESDWFEKDNDSGEINYGSDGLQMTLAKRYDNPGLKSKFYLMYGKVEA
                     VLKAGPGTGIVSSFFLQSDDLDEIDLEWVGSDDTQFQSNYFSKGNVATYDRGAFHGVS
                     QPQAEFHNYTIDWAMDKTVWYLDGQPVRTLENTTSEGYPQSPMFLKMGIWAGGDPSNE
                     PGTIEWAGGLVDYSKAPFSMYIKKIVVTDYSSGSEYSYGDQSGSWESIKAKDGSVYGR
                     YDVAQQEFAALSNGEAISNSTTTSSTSSTISSSILSSSAASSSTLSSSAVSSSTLSSS
                     AVSSFTLSSSAVSSSALSSSSSGFSESSASSAISSTAKASSETSSSTTSSAASSTTSA
                     SPETSSAASSSVSSSSGPSEASASSHSSEVNTSPTAVSTLQPSTEKPSLTTSTSRAQE
                     STKSSSAVSVLVSNEGILVSYSCGLTGLLTGLALALVC"
     gene            complement(871577..871677)
                     /locus_tag="HG536_0Etrna1W"
                     /db_xref="GeneID:59326888"
     tRNA            complement(join(871577..871613,871641..871677))
                     /locus_tag="HG536_0Etrna1W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:59326888"
     gene            complement(872954..873049)
                     /locus_tag="HG536_0Etrna10K"
                     /db_xref="GeneID:59326883"
     tRNA            complement(join(872954..872990,873012..873049))
                     /locus_tag="HG536_0Etrna10K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:59326883"
     gene            <873595..>877710
                     /locus_tag="HG536_0E04820"
                     /db_xref="GeneID:59326767"
     mRNA            <873595..>877710
                     /locus_tag="HG536_0E04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284349.1"
                     /db_xref="GeneID:59326767"
     CDS             873595..877710
                     /locus_tag="HG536_0E04820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140245.1"
                     /db_xref="GeneID:59326767"
                     /translation="MPGICYASKGDPKGITLLSTILKSLKTSSNEETSAKSSLKALDS
                     SSVEESHLLQLHKRLGDKSLDYDQRAQTAVEVRQVLKKFEKNCIPALWYSAHDLIRPE
                     VPLGARKCAFELLAECINDCQDPAVREMFFRIAMTILARPSEDESEFLGPHIALILSC
                     LRSLLNGMLPLKKDDAAFLRDLIEDIIDVSRRKASCPDANVVQELLLLTPILKDPIRH
                     DSLVKLLDLLSSALKPPSSSDIGLSSSAVDFILYLTQEYGQLLRSDVLRRFTVILSRI
                     ADEPGTERNMEKLEYALHKIVQAPCNSVFLEELFAVDNTDCCELMNLYPLIFVDNLCR
                     CSKNTEDPPSEKQINYMLDALHQLKKDKEILKVMTRLLRCCERTGFASSILRQGHIWP
                     MVKSILTRGREDEIVRKFVESVLDIATRTNLSLFSTSLDDLIQSVCALQISDFDSRII
                     KLVKVRRADVGMFKTLDDVAKRTLSPNSSTISRLELYKLLIGLVKDAAFRPLTNTANQ
                     FAIALRTYNGSTNHEMEGEELLLFENFLYEYLQVLHVKDFRFLITEHIIPDVQAILAQ
                     AKRRKSIVNTLGSFGKSRRANEQNLQRADFLVRSCVKTFIWSATDSTGFKCILLFNVL
                     CSIYSTAEKFSHSPASLAVARAMIRIRRSTEGHFYFTIPIDAVGISAAFRRLKEQNTY
                     QGDPHKWTFPESVEYMDESLLGKPNENVGFTSHDKEQGTNINIGTWLSLAIGSIKAPT
                     DWEIHSYLLAHLCSQLSEIPLLFGHFNLIEDFKIVICDHLTRATPLQIDLSEGVSHSD
                     LHSAYVRNLSSVLAYHPFQQKKFADELVSALVVGLKSWEKTFIPILHILSVSCFEVPL
                     SVQKCLTHLLPQIQMRITNPYAMPSVLEFLLALGNSPGVISNLTIDEVKRVFGIAFRL
                     IENSVDLRIRSKLESLKNDSPELSLSQPHNQEYDIEVSPSTENFSIKESMVLFLQYQS
                     FEVITSWFCSLNADRIKELLPFIVANLRKLEKVECLKYDALAQIDFVLRFPFMRHTYW
                     GMAKEEGQGAKRWVGESTMISIGVSAGGALVKVWKPTCTFSFEYRPRVDLCGATYDVF
                     GFNEDAEMASYEELCPDTVLSQLSYSLETGEASQQHLIQVPDDTSFDRSIHMLDHLPN
                     KEFLKIGIIYIDKDQDSEVQVLSNTKGSHQYHWFLNQMGRFIKLSEKPKLFYAGGLED
                     VTDGEFALLWNGEITHMAFHTTTLMPNSTDLSSKKRHVGNNFVNIFYNESGLPHFNFN
                     IIKSQFTFISIVITPLTAAAKDEIAEHYKIKLYRRTGTPGLLSCAHFKILTKNNLARY
                     VRHVAQIANALAEKTHQRHPPDACSAWGKRYKHLQMIRERAVKLNSAENEV"
     gene            <877902..>878810
                     /locus_tag="HG536_0E04830"
                     /db_xref="GeneID:59326768"
     mRNA            <877902..>878810
                     /locus_tag="HG536_0E04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284350.1"
                     /db_xref="GeneID:59326768"
     CDS             877902..878810
                     /locus_tag="HG536_0E04830"
                     /inference="similar to AA sequence:RefSeq:NP_012540.3"
                     /note="ancestral locus Anc_5.157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140246.1"
                     /db_xref="GeneID:59326768"
                     /translation="MSTSHCRFYENKYPEVDDIVMVNVQQIAEMGAYVKLLEYDNIEG
                     MILLSELSRRRIRSIQKLIRVGKNDVVVVLRVDKEKGYIDLSKRRVSSEDIIRCEEKY
                     QKSKTVHAILRYCAEKFQVPLEDLYRTIAWPLSRKYSHAYEAFKLSIIDESVWEGIEP
                     PSKEVFEELKVYISKRLTPQAVKIRADVEVSCFSYEGIDAIKEALKAAEALSTEQMQI
                     KVKLVAAPLYVITTQSLEKQQGIELLEKAIEQISQVISKYNGVCNITMSPKAVTATED
                     AELQALLESKELDNRSDSDEDEEDSD"
     gene            <879087..>880091
                     /locus_tag="HG536_0E04840"
                     /db_xref="GeneID:59326769"
     mRNA            <879087..>880091
                     /locus_tag="HG536_0E04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284351.1"
                     /db_xref="GeneID:59326769"
     CDS             879087..880091
                     /locus_tag="HG536_0E04840"
                     /inference="similar to AA sequence:RefSeq:NP_012541.1"
                     /note="ancestral locus Anc_5.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140247.1"
                     /db_xref="GeneID:59326769"
                     /translation="MSTRPATHAGSWYSNRGSELSSQLKGYLNDTERRDGAVSNARLI
                     ISPHAGYRYCGATMAHAYASLDISPAIKRVFILGPSHHVYFRNQIFLTRFHSLETPLG
                     SLQVDVEVVEKLHKLHEGHLFVPMDNDTDMGEHSLEMQFPMLVQTLQWRGVPVNGVKV
                     VPMMVSHNSAEVDSAVGMALKEYLADPSNLFIISSDFCHWGRRFAYTGYVGSQDELED
                     ALQEETEIEMLTARSKLSHHQVDVWQSIELLDRMAMKVLSESADDAKYNAWKQYLDIT
                     GNTICGARPIAVVLSALQTVRVPAGKTRFEWPSYSQSSHVKSLDESSVSYAAGYAVIE
                     "
     gene            complement(<880277..>881275)
                     /locus_tag="HG536_0E04850"
                     /db_xref="GeneID:59326770"
     mRNA            complement(<880277..>881275)
                     /locus_tag="HG536_0E04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284352.1"
                     /db_xref="GeneID:59326770"
     CDS             complement(880277..881275)
                     /locus_tag="HG536_0E04850"
                     /inference="similar to AA sequence:RefSeq:NP_011708.3"
                     /note="ancestral locus Anc_5.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140248.1"
                     /db_xref="GeneID:59326770"
                     /translation="MVRIAINGFGRIGRLVLRVALSRKNVEVVAVNDPFISTEYAAYM
                     FKYDSTHGRFGGEVTHDDSHIIIDGHKIAVFQERDPAALPWGKLNIDIAVDSTGVFKE
                     LDTCQKHIDAGAKKVVITAPSSTAPMFVMGVNADKYTPDLKIVSNASCTTNCLAPLAK
                     VINDAFGIKEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKV
                     LPELQGKLTGMAFRVPTVDVSVVDLTVNLNKETTYDEIKKVIKAASEGPLNGILGYTE
                     EAVVSSDFLGDSHSSIFDAAAGIQLTPTFVKLVSWYDNEYGYSTRVVDLVEHVASA"
     gene            <881909..>883435
                     /locus_tag="HG536_0E04860"
                     /db_xref="GeneID:59326771"
     mRNA            <881909..>883435
                     /locus_tag="HG536_0E04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284353.1"
                     /db_xref="GeneID:59326771"
     CDS             881909..883435
                     /locus_tag="HG536_0E04860"
                     /inference="similar to AA sequence:RefSeq:NP_012543.3"
                     /note="ancestral locus Anc_5.154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140249.1"
                     /db_xref="GeneID:59326771"
                     /translation="MPVPHGGVLQDLVARDASKRDELLREAQSGKLVGWDLTERQVCD
                     LELILNGGFSPLDGFLTQADYESVVDEMRLTSGTLWTMPITLDVDAGFAQRLSAGQRV
                     VLTQDREIPLAILTVKDVYKPDKQAEAKKVFRGDPEHPAISYLYHEAGEYYVGGSVEA
                     IQLPQHYDYPGLRKTPHQLRLEFESRQWDRVVAFQTRNPMHRAHRELTVRAAREANAK
                     VLIHPVVGLTKPGDIDHHTRVRVYQEIIKRYPNGLAFMSLLPLAMRMAGDREAVWHAI
                     IRKNYGATHFIVGRDHAGPGKNSKGVDFYGPYDAQELVEAYKNELGVEVVPFRMVTYL
                     PDEDRYAPIDEIDTAKTRTLNISGTELRKRLRTGGEIPEWFSYPEVVRILRESNPARP
                     RQGFAIVVEDSLQVSRRQLGTALLSTFLQFGGGRHYKIFDHNDSDSTLLSLVPDFIQS
                     GAGLIVPKQWSSAVKAPNVYLLGSSENSDIKLGSSEESVLHIVQKTVLFLEDNGFISF
                     "
     gene            complement(<883537..>884754)
                     /locus_tag="HG536_0E04870"
                     /db_xref="GeneID:59326772"
     mRNA            complement(<883537..>884754)
                     /locus_tag="HG536_0E04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284354.1"
                     /db_xref="GeneID:59326772"
     CDS             complement(883537..884754)
                     /locus_tag="HG536_0E04870"
                     /inference="similar to AA sequence:RefSeq:NP_011709.1"
                     /note="ancestral locus Anc_5.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140250.1"
                     /db_xref="GeneID:59326772"
                     /translation="MLRSAFRGSLKVVSLKQLSARHMSRTARLLDAQVFAMPAMSPTM
                     ERGGIVEWKFKVGEPFSAGDVILEVETDKAQIDVEAQDDGKLAKIVVDKGAKDVPVGA
                     TIAYIAEIDDDFSTLEFPKSNEKPLESPAEKKKEQKQAKSKPLSAGEKSDIQGNQQNA
                     NPDQTLLPSVVMLLAENGISKEDAFSKIKATGKDGRILKGDVLAYLGRISADSAVRIA
                     DYVKSGERLDLSNIELKTEVPKSASVPEADKGKETNTTAAAQPEPIIFSEQLILEFPG
                     KSQPGELQQSVRAFLKEAYHYTHEAPLADARSEHFDPIFEDLITPAPTAPRFRYTYQL
                     TSLADNPDSKGHRDIFDLLSESTDASAATKPASPAKQEYALSLSVQVSDKFYDAEERS
                     KRFVEYVKQLQLV"
     gene            complement(<884959..>886698)
                     /locus_tag="HG536_0E04880"
                     /db_xref="GeneID:59326773"
     mRNA            complement(<884959..>886698)
                     /locus_tag="HG536_0E04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284355.1"
                     /db_xref="GeneID:59326773"
     CDS             complement(884959..886698)
                     /locus_tag="HG536_0E04880"
                     /inference="similar to AA sequence:RefSeq:NP_011710.3"
                     /note="ancestral locus Anc_5.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140251.1"
                     /db_xref="GeneID:59326773"
                     /translation="MTASEESYYLGFDLSTQQLKCLAINGSLKIVHAETVDFDRDFPQ
                     YKTKKGVYISGDVVECPVGMWVEAIDLIFEKFTRSSFDLSKVKAISGSCQQHGSVYWS
                     SAAEGLLSSLDSAKGSLFDQLVPGAFSRETAPNWQDHSTGKQCKEFEEAVGGPQSLAK
                     LTGSRAHFRFTGSQILKIAEEEPEVYQKTEAISLVSSFVASVLSGSLTALEEADACGM
                     NLYDVAQRQFDDKLLGLIDQNKTNIEKKLLAPCTKCDEPVRLSSISSYFVAKYGFDAT
                     CSIFPFTGDNLATICSLPLKENDVLVSLGTSTTILLVTDQYHPSADYHLFIHPTIPKS
                     YMGMICYCNGSLAREEIRNQLNGEGETGDWTRFNEAVSDDNLANEDEIGVYFPLGEIV
                     PSVDATYKRAKFDVKSGEIKTFVDSYANLRHDAKNIVESQALSCRVRISPLLSSTVSS
                     LNNKNKGVKVKFDYDTFPLNEYLTKRPRKAFFVGGASKNNAIVKKFAQVLGATEGNYR
                     LETPNSCALGGCYKALWSDLFYSKQTQLRYDQFLDHKFPWHDLEYVCDSDDKAWQAYN
                     NKIVPLSRLEASL"
     gene            complement(<886883..>887149)
                     /locus_tag="HG536_0E04890"
                     /db_xref="GeneID:59326774"
     mRNA            complement(<886883..>887149)
                     /locus_tag="HG536_0E04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284356.1"
                     /db_xref="GeneID:59326774"
     CDS             complement(886883..887149)
                     /locus_tag="HG536_0E04890"
                     /inference="similar to AA sequence:RefSeq:NP_012544.1"
                     /note="ancestral locus Anc_5.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140252.1"
                     /db_xref="GeneID:59326774"
                     /translation="MSEILEEVKRKLVFPIDFPSQQRTERVQNIVLATGSVLSCLVGF
                     YMQSLTHLMVIYGLAVVLALIAVLPAYPSYTSRKLEWAKSSIVA"
     gene            complement(<887354..>888157)
                     /locus_tag="HG536_0E04900"
                     /db_xref="GeneID:59326775"
     mRNA            complement(<887354..>888157)
                     /locus_tag="HG536_0E04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284357.1"
                     /db_xref="GeneID:59326775"
     CDS             complement(887354..888157)
                     /locus_tag="HG536_0E04900"
                     /inference="similar to AA sequence:RefSeq:NP_012545.1"
                     /note="ancestral locus Anc_5.150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140253.1"
                     /db_xref="GeneID:59326775"
                     /translation="MEGDKSATEPDREDVKAFAMPLHMVEKDMSFEERKNLLLLNQII
                     VFILNTSHYMTDLIYALYYLSNCEGTGEVKDGEGQDKLGQQDSNIVDQLSQIRKQLYT
                     LAAQFRSNFRQMLDESNMASLDSAPKFRKLIDRNLICVLGVINELLISEMKSISEPLS
                     MQLHNCLMGFANIYQFLRKVPIHHQYKITKPQLDVLLKALGQELIPSWKYQLDLLNFK
                     LFNLLASHPSIVAQYRDATGDTVSDVRDGPGFKRFVTWLKDEIVGKAAF"
     gene            <888514..>889422
                     /locus_tag="HG536_0E04910"
                     /db_xref="GeneID:59326776"
     mRNA            <888514..>889422
                     /locus_tag="HG536_0E04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284358.1"
                     /db_xref="GeneID:59326776"
     CDS             888514..889422
                     /locus_tag="HG536_0E04910"
                     /note="ancestral locus Anc_5.149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140254.1"
                     /db_xref="GeneID:59326776"
                     /translation="MSATASGKFIDDETYSRIMGFVAGMFSGVAKNTVGHPFDTVKVR
                     LQTSQGTGMFNGPLDCVYKTLKHQGPRGLYLGFTPPLVGWIAMDAALLGSLHNYRMLL
                     HKYMYPEYEKLPLSGCVISGVMSGWTVSFIAAPVELAKAKLQVQYGPQTTKYKGPIDV
                     IRKVWAEAGIRGLYKGLVSTLIFRSNFVFWWGSYELITQWFKKHTNMRDPAINFWAGG
                     LSASFGFWTTAYPSDVIKQVVLCNDKCDGSFRSWRETATQIYRERGIKGFFRGFVPSF
                     LRSFPANAAALAAFEFVLRTSGAKPS"
     gene            complement(<889464..>889775)
                     /locus_tag="HG536_0E04920"
                     /db_xref="GeneID:59326777"
     mRNA            complement(<889464..>889775)
                     /locus_tag="HG536_0E04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284359.1"
                     /db_xref="GeneID:59326777"
     CDS             complement(889464..889775)
                     /locus_tag="HG536_0E04920"
                     /inference="similar to AA sequence:RefSeq:NP_012546.3"
                     /note="ancestral locus Anc_5.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140255.1"
                     /db_xref="GeneID:59326777"
                     /translation="MSGGHELTYDEIVDHIVSDKPIPNVVEVPNITLDESLRSASEMA
                     PRPKPWEKSAGDDLQIDMGRSDLSLGSAISDLDLDVMSKYQTMETELDNAMTNPENSQ
                     T"
     gene            <889879..>891141
                     /locus_tag="HG536_0E04930"
                     /db_xref="GeneID:59326778"
     mRNA            <889879..>891141
                     /locus_tag="HG536_0E04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284360.1"
                     /db_xref="GeneID:59326778"
     CDS             889879..891141
                     /locus_tag="HG536_0E04930"
                     /inference="similar to AA sequence:RefSeq:NP_012547.2"
                     /note="ancestral locus Anc_5.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140256.1"
                     /db_xref="GeneID:59326778"
                     /translation="MNIRPRRSLERTVKPTRMLSNGKLLIIASLLVRVGFFLYGLYQD
                     ANYKVKYTDIDYLVFHDAAGYVYEAWKEGRVGSPYQRDTYRYTPLLSWLLVPDHYFEW
                     FHLGKLVFVAFDLLTGIIILDLVKRCLSRRESTLPLWLSSLWLLNPMVITISTRGNAE
                     SVVSFLIMLTLLLLQKSKDTWSAVVYGLSIHFKIYPIIYCLPIAIFLYHRNKRLSEVI
                     AYGFWALVALVVSSAAMYKLYGSEFLQHAYWYHLYRTDHRHNFSLWNLLLYYDSARSA
                     SSWLSKFAFLPQMATTMALSVLQWRQPSLANLLNVLFLQTFAFVTYNKVCTSQYFVWY
                     LIFLPFYIANTNLSWQKGVCMAAVWVITQAFWLLQGYLLEFEGRNVFFPGLLSASALF
                     FIGNVWILGQFIDDINTRVPVSHTKKHN"
     gene            <891318..>892058
                     /locus_tag="HG536_0E04940"
                     /db_xref="GeneID:59326779"
     mRNA            <891318..>892058
                     /locus_tag="HG536_0E04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284361.1"
                     /db_xref="GeneID:59326779"
     CDS             891318..892058
                     /locus_tag="HG536_0E04940"
                     /inference="similar to AA sequence:RefSeq:NP_011711.3"
                     /note="ancestral locus Anc_5.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140257.1"
                     /db_xref="GeneID:59326779"
                     /translation="MSRLEIYSPEGLRLDGRRWNELRRFECSTNTHSHAADGSSYLEQ
                     GNNKVITLVKGPQEPTSRSQVDTTGAVLKISVNITKFSKAGRSRTGHKNERRVLEMQT
                     ALVRTFNKSVMLHAYPRTLINIEIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISG
                     VSVGLYDTTPLLDTNSLEENAMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGI
                     AGTHRIRDLMDKEVRKGRRNRVANALSG"
     gene            complement(<892102..>894402)
                     /locus_tag="HG536_0E04950"
                     /db_xref="GeneID:59326780"
     mRNA            complement(<892102..>894402)
                     /locus_tag="HG536_0E04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284362.1"
                     /db_xref="GeneID:59326780"
     CDS             complement(892102..894402)
                     /locus_tag="HG536_0E04950"
                     /inference="similar to AA sequence:RefSeq:NP_011712.1"
                     /note="ancestral locus Anc_5.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140258.1"
                     /db_xref="GeneID:59326780"
                     /translation="MTEQVERKKSYRWVSAGQASYDGADWNSTDDSSGEEATNKSSVK
                     RGDTVSKLPALPKLNYNQEEDSEDERAEDGSLNDNERKEQFSISQTIKPQSLVVEDQD
                     GSPITWESPGLGASLSRDSSKSSVQVRRTPVNEDLENLMVQIVKEMTPKVGQSEEFGE
                     EEHSGEPKSYSAVSLERASLNSSRSEDELQVSKDGYFSKFIQRKDEDDYMSDDGASSH
                     SPVEETCPTPSVAETNNKQGEDGLAHSFDEEAVTAQGGKDEEVSAVIEDSRSLQPSSD
                     EDAYLSSEEGDEDALSYTDSINYQAARSQSAGKQDVDSEGVIIPREDEDSDGLDEEIR
                     VSKSGYFNKMVQSDSDASANEQDSLDDDDERTIPETINSSDTSQIGKAANEAIPAASR
                     QDENEPDENEPVENESVENESVETKPAEDEESRASQLIASNHQQGGLKGTDEVTTNGQ
                     NIEDGDEPERDGSENEVGETPEKELSSTRQSINMGKWKPDMSAFRNDFVQETTNNPPP
                     GFVYDETGNLVDLTPSSMKPRVVSTYSEVESSWNAFPSEGNDDLETVRDTKTLYDNNT
                     IHNVPGIIGNNQNLPPLPSITSGVNSTESSDEPRSLGTGTSTTLTLDGENRRGPLQTH
                     FKEVFTVPAPDTKDIAKVTGEKTVPSWNINKIVSSKTSHADKIEQLRAYSKQLKDYDT
                     GIQTWLGYTLKSSSKTDRDFIFDEYKVSTHVRDAYAHADELSKKHTVSNTVANVNQNV
                     SHLTKKVFAHSKKSRGLFSSIGKKRV"
     gene            <894807..>895406
                     /locus_tag="HG536_0E04960"
                     /db_xref="GeneID:59326781"
     mRNA            <894807..>895406
                     /locus_tag="HG536_0E04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284363.1"
                     /db_xref="GeneID:59326781"
     CDS             894807..895406
                     /locus_tag="HG536_0E04960"
                     /inference="similar to AA sequence:RefSeq:NP_012548.1"
                     /note="ancestral locus Anc_5.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140259.1"
                     /db_xref="GeneID:59326781"
                     /translation="MSTVTLRKVVYCDVCSFPPDYCEFSGKLKRCKVWLRENHPDIYV
                     QQYGEDEDEVNAVSSKLAESSIGEEREEKLEKDLKRLETKQENREQRELAKKLSSKVV
                     IKREARTKRKFILAISGLEVFDVDMKKLAKTFASKFATGCSVSKNAEKKEEIVIQGDV
                     LEEVEKYIHSLLEEKGLKDVKVETIDAKKKKKAPETPAN"
     gene            complement(<895462..>896964)
                     /locus_tag="HG536_0E04970"
                     /db_xref="GeneID:59326782"
     mRNA            complement(<895462..>896964)
                     /locus_tag="HG536_0E04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284364.1"
                     /db_xref="GeneID:59326782"
     CDS             complement(895462..896964)
                     /locus_tag="HG536_0E04970"
                     /inference="similar to AA sequence:RefSeq:NP_011713.1"
                     /note="ancestral locus Anc_5.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140260.1"
                     /db_xref="GeneID:59326782"
                     /translation="MVDEDEMALNQVYTEGASECMNRVVNKDLHVEGSSEASTAESAA
                     GYDGEAAPVETKQQEEAKQQEGSAALQRMGTRFFSPKMKSHRKKIIWTFVLTNALLAV
                     FVLSLLSIYWGATYNRQHYMFKVNVLTVIQDESELVGTTMSAAIATLVAGVPCTWHVF
                     NASEFSEKYKVSSEEIDDKVVDLIFGEKYWMALNVKRNATNALYDSLTGGPTAFNSTE
                     YFEAIYESGRDPTSLQSAILPNMKTLEGIYRTYFLDQYLPSLLGNLTETPPPDRIIAA
                     SNMNFEYVDYRPFYNALLLAPLQVGLIYCLLLTFFQLSLFAPLHVEMSKLLKPRHIIL
                     YRIGISWLTYFFLSLFFCTVSAIFQVDFTKAFGRAGFVVYWMSTWLLMMALGGANENV
                     ISLVLTLGPQYLGFWLMTWIILNIAPSFYPLVLNNQFYRYGYAMPIHNGVDIYKVIFL
                     NLSKQHMGRNYGILVAWVALNTALLPFVLRYVGKTMRKRAAAAAAAQQTN"
     gene            <897496..>899778
                     /locus_tag="HG536_0E04980"
                     /db_xref="GeneID:59326783"
     mRNA            <897496..>899778
                     /locus_tag="HG536_0E04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284365.1"
                     /db_xref="GeneID:59326783"
     CDS             897496..899778
                     /locus_tag="HG536_0E04980"
                     /inference="similar to AA sequence:RefSeq:NP_011714.3"
                     /note="ancestral locus Anc_5.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140261.1"
                     /db_xref="GeneID:59326783"
                     /translation="MVVLGDAIERSLAARLLGAGEFNSGDAVLDRALRLQFRVQYHLF
                     GAGMTAVVGQVLLDECEKVGGCLAASAREAQTSRLIDKVLHNTRGVLCFHLGEMEDAV
                     TQLEAARAIGIGYGEFGRYLELENLYYRGLCQDSPALYGSELAEVVEAIPDESQGLAL
                     HYLYAILEKLAKEANKTEMLKQLPQTSSVGLMARHFSREIREKELLSLAQAVLQKAKF
                     PQAKETNDVELERFHAFMSYYFRTQKSVSAEWGDFIVASMQRTFQSVKVAKSAMLYFA
                     KTNGKATHSRRESVLNFINFARYAEKHYVISGGTYQDVMSLIDCYSFVLRMARDESWN
                     IESVFNVEETTNKLLKLLHFFYHEYNFPLMENAESLNWLENSSKLFLPRTVSRTLSEA
                     WEVLYQVRAESLKHMVSNDLACYLSNAMCAAPKGSNLADLQFEYSYVLASQRKIEPAI
                     KVLKSVLLEANPELYKAWHLLALCESIHENKEVSFKIVCSVLEAMKESLAENKLRILD
                     RWQFIQLKLTQLSLIDELFGTLDASEMLPEVFELYSVLFPADTEEFDRIGDKCKQSKE
                     YLLQAIWIFAANLYMRLGDKVEDAKKAISEAEQVTDKFKNLNCDLARGYLKLINGEPR
                     AALSNFETVLFYDPLNVNALIGFAQIIFPEELNESEAALREYWHLEESNKGAHSAGGT
                     TQQVFVSDLDKSAACARLKFLLEYAITKSIEAYHSPEVWWYLSSIYEKYEDQSYKASL
                     LNCIRYKESDPIRAFQSCNF"
     gene            <900165..>902366
                     /locus_tag="HG536_0E04990"
                     /db_xref="GeneID:59326784"
     mRNA            <900165..>902366
                     /locus_tag="HG536_0E04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284366.1"
                     /db_xref="GeneID:59326784"
     CDS             900165..902366
                     /locus_tag="HG536_0E04990"
                     /inference="similar to AA sequence:RefSeq:NP_011715.1"
                     /note="ancestral locus Anc_5.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140262.1"
                     /db_xref="GeneID:59326784"
                     /translation="MSASPKPKGSSLQDVSEKGTASPTGESSDIRTTIRHCLSVLVPL
                     ALTSLSFYVRLHNIEKNQYVVWDEAHFGKFGSYYIKHEFYHDVHPPLGKMLIALTEWL
                     AGFDGNFGFDSNTAYPDNVNYKRIRQYNAIFGALCTPVAYYSAKNMGFGALTVFLITL
                     MVTLEHSFIVLSKFILLDSMLLFFTMLAFYCMVKLYNFRDKPFTRPWSWWMLLTGVSI
                     GCVCSVKWVGLFITLVIGLYTVMELFSFHSNASISKKMLFKHWIIRVINLILIPFLIY
                     LFCFRVHFAILYKSGTGDASTNTLFQINLQNNKIENSPRDVVYGSEVTIRSHGLSPNL
                     LHSHVQTYPEGSNQKQVTGYGFADGNNVWQIRFSRGSGLQSDFNDTLDDMLRPVKDGD
                     EIRLVHKSTGTNLHSHEVPSHVSRGNFEVSGYGSETVGDDKDDWIIEFVEQLDSSNPD
                     FPKEDHTNLHPVSTFFRLRHKVLGCYLTSTGLSYPAWGFKQAEIVCKESWSRRDKSTW
                     WNVEEHWNEHLESSPDYVPPKSKFWTDFVLINFAMASSNNALIPDEDKYDNLATKAWE
                     WPTLHTGLRMCSWSRDVYRYYLIGSPFNTWLSTASLFAFIFLMVKLAFQWRRQAIEIS
                     EQQFWDLMIKGGFPFVSWIAHYLPFVTMGRVTYVHHYVPALYFAILVFGFTIDYVSQG
                     LRTPVRYAIYTLLFAGCTYTYIYFSPLCQGMHGPGVVYSKLQLLPTWDIVI"
     gene            complement(<902485..>904845)
                     /locus_tag="HG536_0E05000"
                     /db_xref="GeneID:59326785"
     mRNA            complement(<902485..>904845)
                     /locus_tag="HG536_0E05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284367.1"
                     /db_xref="GeneID:59326785"
     CDS             complement(902485..904845)
                     /locus_tag="HG536_0E05000"
                     /inference="similar to AA sequence:RefSeq:NP_011716.3"
                     /note="ancestral locus Anc_5.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140263.1"
                     /db_xref="GeneID:59326785"
                     /translation="MVVVNSEAIFIGANRQNQVSDYHSGEKVVAFGAGKTIALWKPTD
                     DISEGIYKVLKGHEADVTCVKFVPTINYMISTSEDHRVKVWDFSTLQCIQTIEHFDHT
                     IVTLAVVEGLMVIGTANGLISMWLYDNQRNQFTLGHEFAVRKGFLPLALSMKHIEDDK
                     FLLAVGGTSVNVFIYSFLAADTQIKDCQLRAELEGHEDWVKSLAFRQQSESPYDFLLA
                     SGSQDRYIRLWRIRAKEALDLEKDDEHRPTLLSNKKYKFEVSTDFRIVINFEALIMGH
                     DDWISSLQWHEKRLQLLAATADTSLIIWEPEESSGVWICASRLGEISSKGASTATGSS
                     GGFWSCLWFKDADRDYILTNGKTGSWRIWSSSDCVEWAPMLGVTGATKEVTDIAWAPS
                     GEFLLASSLDQTTRLYAPWLYESSGRHRPVATWHEFSRPQIHGYDMICVEPISDTRFV
                     SGGDEKILRSFDLSRGVSDILRKFVGCSFGTSQALPESAALPALGLSNKAVNQNDEAE
                     QEEDDPNERETNETKNISYSLISALATPPLEDQLQRHLLWPEIEKLYGHGYEITCVDV
                     SSDGALIASACRSNSPQHAVVRIFDSKTWQEIKPQLPYHELTITRLKFSRDSQLLLST
                     SRDRKWALWQRDVATNKFSLKYSNAKAHTRIIWDCDWAPIEYGQTFFTGSRDKSVKAW
                     RFDESEHDFVSESSVKFTEPVTALSVYHELFNGKILLAIGAGNGTIHIYTYLDSRFEL
                     LTTFEEDIAPADRVTRLRWSTLQRDGKKFLGVGSEDSSTRIFSIKL"
     gene            complement(<905141..>906898)
                     /locus_tag="HG536_0E05010"
                     /db_xref="GeneID:59326786"
     mRNA            complement(<905141..>906898)
                     /locus_tag="HG536_0E05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284368.1"
                     /db_xref="GeneID:59326786"
     CDS             complement(905141..906898)
                     /locus_tag="HG536_0E05010"
                     /inference="similar to AA sequence:RefSeq:NP_012550.1"
                     /note="ancestral locus Anc_5.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140264.1"
                     /db_xref="GeneID:59326786"
                     /translation="MGLLARVAGNRQFSTTRNVAKKLNRYSNIITEPMDQGASQAMLY
                     ATGFKKDDFSKAQVGVGSCWWSGNPCNMHLLDLNNRCSLSVEKAGLKAMQFNSIGVSD
                     GISMGTKGMRYSLQSREIIADSFETIMMAQHYDANIAIPSCDKNMPGVMMAMGRHNRP
                     SIMVYGGTILPGHPTCGSSKIPENIDLVSAFQSYGQYISKQFTEQEREDVVEHACPGP
                     GSCGGMYTANTMASVAEVLGITLPNSSAFPAVSDQKLAECDNIGESIKKTMELGILPR
                     DVFTKEAFENAITYVIATGGSTNAVLHLVAIAHSAGVKITPDDFQRISDKTPLIGDFK
                     PSGKYVMADLIRVGGTQSVIKYLFDNGFLNGNTITITGDTLAERAAKAAPLPEGQDII
                     KPVSQPIKSSGHLQILYGSLAPGGAVGKITGKEGTFFKGKARVFEEENAFIHALEKGE
                     IKKGEKTVVIIRYEGPRGGPGMPEMLKPSSALMGYGLGKDVALLTDGRFSGGSHGFLI
                     GHIVPEAAEGGPIGLVKDGDEIVIDADNNKIDLLVSDQELSDRRAQWTAPPPRYTRGT
                     LSKYTKLVANASQGCVTDA"
     gene            complement(<907176..>908348)
                     /locus_tag="HG536_0E05020"
                     /db_xref="GeneID:59326787"
     mRNA            complement(<907176..>908348)
                     /locus_tag="HG536_0E05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284369.1"
                     /db_xref="GeneID:59326787"
     CDS             complement(907176..908348)
                     /locus_tag="HG536_0E05020"
                     /inference="similar to AA sequence:RefSeq:NP_011718.1"
                     /note="ancestral locus Anc_5.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140265.1"
                     /db_xref="GeneID:59326787"
                     /translation="MGKSKKHSSIKSRLSNSSLSNLFNLNKKRKRDDESATDDSAKQQ
                     GGDGEMKAAKRLRRSEPNAEQKRFEELERKYEAELPAELRKYRPKGYRFNLPPEDRPI
                     RVYADGVFDLFHLGHMKQLEQCKKALPNVVLICGVPNDEITHKLKGLTVLTDEQRCET
                     LRHCKWVDEVVPNAPWCVTAEFLAEHNIDYVAHDDLPYVGADSDDIYKPIKEMGRFLA
                     TQRTSGISTSDIITRIIRNYDKYLMRNFARGATRQELNVSWLKKNELDFKKHVDDFRS
                     YFKKNQHNLNNVSKDLYFEVREILLRKTLGKKLYSKLVGQGLGQDLKKRLQHDRRLIR
                     EKSPVSEFASKFTGEPSEQDPHCQTSQNEEDDEGASIDSQTASSSDDNRSQNVQNE"
     gene            <909532..>909975
                     /locus_tag="HG536_0E05030"
                     /db_xref="GeneID:59326788"
     mRNA            <909532..>909975
                     /locus_tag="HG536_0E05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284370.1"
                     /db_xref="GeneID:59326788"
     CDS             909532..909975
                     /locus_tag="HG536_0E05030"
                     /inference="similar to AA sequence:RefSeq:NP_011719.1"
                     /note="ancestral locus Anc_5.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140266.1"
                     /db_xref="GeneID:59326788"
                     /translation="MSSRTINNIRYVDATELFQWLKQGLTSLGYPFRVIDVRGSDYVG
                     GHIKGSWNYPYKRLSQDENVMNELRTRLAEATVNDEVMNVVFHCAQSQQRGPSAAMKF
                     LRHLSDQELDKFKIWILRDGFNHWQDIYGADATVTEGYEPDLWSW"
     gene            complement(<910026..>910652)
                     /locus_tag="HG536_0E05040"
                     /db_xref="GeneID:59326789"
     mRNA            complement(<910026..>910652)
                     /locus_tag="HG536_0E05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284371.1"
                     /db_xref="GeneID:59326789"
     CDS             complement(910026..910652)
                     /locus_tag="HG536_0E05040"
                     /inference="similar to AA sequence:RefSeq:NP_012551.2"
                     /note="ancestral locus Anc_5.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140267.1"
                     /db_xref="GeneID:59326789"
                     /translation="MSITCGPCNLSLINLACRRVINAWHCWHLANIDPKQDSLSVATA
                     MSEAANGLPAPWTVRYSKSKKREYFFNPETKASQWEEPEGTDHGLLKQYLAEHPVRVR
                     CLHILCKHSDSRRPASHRSEHITISKAEAIEELQEIQRRLESGESFESLAKERSDCSS
                     YKRGGDLGFFGKGEMQGSFEKAAFALKVGETSGVVETESGVHLIKRVQ"
     gene            <911074..>913920
                     /locus_tag="HG536_0E05050"
                     /db_xref="GeneID:59326790"
     mRNA            <911074..>913920
                     /locus_tag="HG536_0E05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284372.1"
                     /db_xref="GeneID:59326790"
     CDS             911074..913920
                     /locus_tag="HG536_0E05050"
                     /inference="similar to AA sequence:RefSeq:NP_011720.3"
                     /note="ancestral locus Anc_5.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140268.1"
                     /db_xref="GeneID:59326790"
                     /translation="MSAQLIDGKACAQAIRTEIADEITGLKCRDPSFKPRLSIIQVGS
                     RKDSSTYVRMKCKAAKEAGIEADLISLAEDITEQQLLDKIASLNEEPSVHGVLVQLPL
                     PAHIDEDRVTSAVAASKDVDGFGPINIGELNKKNGHPFFLPCTPKGIIELLKRYDVTI
                     AGSKSVVIGRSDIVGSPVAELLKSLDSTVTIAHSKTKELPSYLTDADIVVVAIGVPEF
                     VKGEWFKNNKKGVVVIDVGTNFVEDASKKSGYRNVGDVEFAEALKYARLITPVPGGVG
                     PMTVAMLMQNTLTAAKRDLESGGKLCKFEPLPLLLQKPVPSDFEISRAQKPKEISKVA
                     LEAGILPSELEPYGSTKAKVNLKIIDRLKDRENGKYVLVTGITPTPLGEGKSTTTVGL
                     AQALGAHLKKTVFANVRQPSMGPTFGIKGGAAGGGYSQVIPMDEFNLHVTGDIHAISM
                     ANNLLAAAIDARMFHESTQKDVALYKRLVPAKNGVRKFTKTMLKRLQKLGIDKSNPDD
                     LTPEEVTKFARLDIDPETISWRRVVDCNDRFLRGITIGEAPTERGFTRHTGFDISVAS
                     ECMAILALCNSLSDMRERLGRIVVAASKSGEPVTCEDIGCAGAMTALLKDAIKPNVMQ
                     TLEGTPVFVHAGPFANISIGANSVLADKMALKLAGVDPALPQQEKNERAGYVITEAGF
                     DFTMGGERFINIKCRSSGLKPDVVVIVATVRALKVHGGGPEVKAGAPLPVAYLTEDVE
                     LLRKGCANLTKHISNAKRYNLPVVVAINKMSSDTDLEHQIIREESLKAGAYDAIVSNH
                     WEEGGAGAVDLANGIIKATQEESNKDFKFLYDTEGLTVEEKITKIAQDMYGAKDVEFL
                     PEAQKKIKLYTKQGFDKLPICIAKTQYSLSHDANLKGVPTGFTFPIRDVRASIGAGYL
                     YALAAEIQTIPGLPTHCGFMNVEVNEDGEIEGMF"
     gene            complement(<913988..>914986)
                     /locus_tag="HG536_0E05060"
                     /db_xref="GeneID:59326791"
     mRNA            complement(<913988..>914986)
                     /locus_tag="HG536_0E05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284373.1"
                     /db_xref="GeneID:59326791"
     CDS             complement(913988..914986)
                     /locus_tag="HG536_0E05060"
                     /inference="similar to AA sequence:RefSeq:NP_012553.3"
                     /note="ancestral locus Anc_5.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140269.1"
                     /db_xref="GeneID:59326791"
                     /translation="MSSKYTSLEKILELSRVSASKFVTKALPAAPVGSRGTFGGTLVA
                     QSLLASLHTVPQDFVPSSLHCYFISGGDPSKMIAYDVQDLRHGRNFIHKQVRAYQSKR
                     LVFSTNILYSREKKEHDSLHHLKTVELKDKPEAFEDGGELFKAKVAGNGNAERYARLS
                     VGLKEIDRLQKHIEAFKYGPIEYRFPHDMFYSRKHADMLEQFVRIRNEVTFGEERPDS
                     DYSLTITPRNDARYNYVAFAYLSDSYLLLTVPYFHRLPMYSHKFSVSLDHCIHFHQLP
                     KVNDWIYLQINNPRSFWDKHFLQGEYFSASSGEIVASVSQEGLVVYDSEETIRAKF"
     gene            <915424..>916305
                     /locus_tag="HG536_0E05070"
                     /db_xref="GeneID:59326792"
     mRNA            <915424..>916305
                     /locus_tag="HG536_0E05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284374.1"
                     /db_xref="GeneID:59326792"
     CDS             915424..916305
                     /locus_tag="HG536_0E05070"
                     /inference="similar to AA sequence:RefSeq:NP_011721.3"
                     /note="ancestral locus Anc_5.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140270.1"
                     /db_xref="GeneID:59326792"
                     /translation="MCDDKSVLGCTFEFLDEYIPLWFDKRRLCNDNSALFILISGPQG
                     SGKSYTADFVYKYLLEKYGDSRRIAKMSIDDFYFTHEDQKEFNNRFRENELLQGRGAP
                     GTHDIPLLSRCVDAIIANRESKLTLPLYDKSRFNGEGDRCEKGNEVQLPLDLVILEGW
                     FLGFRPLLDRREIDKQPLLQKQKDMIQVNANLFFYADLLWKNPEIKSLGIVFEADNIQ
                     NVYQWRLEQEHALRESTGEGMSDEEVKRFVDRYFPSYELYYEDFVNSESLGSVATLTL
                     GIDLQRNVYSVKTKSIE"
     gene            complement(<916344..>917250)
                     /locus_tag="HG536_0E05080"
                     /db_xref="GeneID:59326793"
     mRNA            complement(join(<916344..916885,916962..>917250))
                     /locus_tag="HG536_0E05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284375.1"
                     /db_xref="GeneID:59326793"
     CDS             complement(join(916344..916885,916962..917250))
                     /locus_tag="HG536_0E05080"
                     /inference="similar to AA sequence:RefSeq:NP_012555.1"
                     /note="ancestral locus Anc_5.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140271.1"
                     /db_xref="GeneID:59326793"
                     /translation="MTSHSEDLSTDVSSSLSSPFRNSFNRKRTTTASSQVERLDEADK
                     QILEWAGKLEMESVDLREKSSQLIQVLQGNSDDLSELVKKLNGVLAKQGNLDEFRSSI
                     SGLGSRLGEQLNTLEKLAKESQKNCKGASGYDKALKKVEADIMGALDAKHQSTTRSIE
                     QAQELLFNIGRQLEDTHQVMTSMSKDINRLNQRQSSLEKEIKECKAALTTGADNSPIL
                     PVIDDGSTLLNDGPITRSMSKRRTRGIAAKKVIKPRDTALTRTIIPWEEVEMYYASEV
                     "
     gene            <917372..>917689
                     /locus_tag="HG536_0E05090"
                     /db_xref="GeneID:59326794"
     mRNA            <917372..>917689
                     /locus_tag="HG536_0E05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284376.1"
                     /db_xref="GeneID:59326794"
     CDS             917372..917689
                     /locus_tag="HG536_0E05090"
                     /inference="similar to AA sequence:RefSeq:NP_012556.2"
                     /note="ancestral locus Anc_5.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140272.1"
                     /db_xref="GeneID:59326794"
                     /translation="MSPLLKDYLNQRIVIVTTDGDCYIATLEGYDKSVNLLISDVRRR
                     SDGELVSIALTLRGSEVVLCGLLTNDQPEKLGPLPMLKDTKNKIADEYLIWEEALKTS
                     SSR"
     gene            complement(<917723..>918454)
                     /locus_tag="HG536_0E05100"
                     /db_xref="GeneID:59326795"
     mRNA            complement(<917723..>918454)
                     /locus_tag="HG536_0E05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284377.1"
                     /db_xref="GeneID:59326795"
     CDS             complement(917723..918454)
                     /locus_tag="HG536_0E05100"
                     /inference="similar to AA sequence:RefSeq:NP_012558.3"
                     /note="ancestral locus Anc_5.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140273.1"
                     /db_xref="GeneID:59326795"
                     /translation="MSLDSLVYSTDPRHPANLICTLCRQFFHNNWCTGTGGGISIKHP
                     ETDNYFIAPSGVQKELMDPEDLFVMDSRTQEYLRVPNNLKPSACTPLFVACYQHRNAG
                     AVIHTHSQNAVICSLLFDDEFRIANIEQIKAIPSGKVDSQTGKAIPLSFYDTLAIPII
                     ENMAHEDQLIDSLLETFEKYPHTCAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAV
                     KMHQLGIPPDCAIGEEKKFITKRFE"
     gene            complement(<918595..>919131)
                     /locus_tag="HG536_0E05110"
                     /db_xref="GeneID:59326796"
     mRNA            complement(<918595..>919131)
                     /locus_tag="HG536_0E05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284378.1"
                     /db_xref="GeneID:59326796"
     CDS             complement(918595..919131)
                     /locus_tag="HG536_0E05110"
                     /inference="similar to AA sequence:RefSeq:NP_012559.1"
                     /note="ancestral locus Anc_5.128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140274.1"
                     /db_xref="GeneID:59326796"
                     /translation="MLNTIPINLDRWLEENGHLLQPPVNNFCLHRNGFTVMIVGGPNE
                     RTDYHVNPTPEWFFQKKGSMTLRVVDESLEGDAKFIDITINEGDSYLLPANVPHSPVR
                     YADTIGIVVEQDRPEGANDKMRWYCSNCRMIVHQLEFYMVDLGTQVKEGVLAFENDPE
                     SRKCKNCGTMNHSRPQKP"
     gene            <919694..>919999
                     /locus_tag="HG536_0E05120"
                     /db_xref="GeneID:59326797"
     mRNA            <919694..>919999
                     /locus_tag="HG536_0E05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284379.1"
                     /db_xref="GeneID:59326797"
     CDS             919694..919999
                     /locus_tag="HG536_0E05120"
                     /inference="similar to AA sequence:RefSeq:NP_011722.3"
                     /note="ancestral locus Anc_5.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140275.1"
                     /db_xref="GeneID:59326797"
                     /translation="MTKLSEVEELLRKYPLYNSHGQEFPRNVLRRVPVPHIKLQPLQP
                     SAEMFAPWYRECDELVKCCEVHDKAGELFDQWYSQRYMSNKPPGMVGNVILSPSRRD"
     gene            complement(<920032..>920808)
                     /locus_tag="HG536_0E05130"
                     /db_xref="GeneID:59326798"
     mRNA            complement(<920032..>920808)
                     /locus_tag="HG536_0E05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284380.1"
                     /db_xref="GeneID:59326798"
     CDS             complement(920032..920808)
                     /locus_tag="HG536_0E05130"
                     /inference="similar to AA sequence:RefSeq:NP_011723.1"
                     /note="ancestral locus Anc_5.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140276.1"
                     /db_xref="GeneID:59326798"
                     /translation="MASKQLRILVPVKRVIDYQIKPRVNKTGTAVETTGVKFSINPFD
                     DIAVEEAVRIKEKNKSLVESIHAVSIGPAKAQDILRNCLAKGADTSTLIDSKDVVLEP
                     LAVAKVLKQVVEKQNSNLVIMGKQAIDDDCNNTGQMLAGLLNWPQATNAAKVEFTDNG
                     KVNVTREVDGGEEVVSASLPLVITTDLRLNVPRYVGLQNLMKAKKKPMEKLALKDFSN
                     VDLEPRLKVLSVEEPQPRAPGVKVNSVDELVDKLKEAKVI"
     gene            <921403..>922314
                     /locus_tag="HG536_0E05140"
                     /db_xref="GeneID:59326799"
     mRNA            <921403..>922314
                     /locus_tag="HG536_0E05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284381.1"
                     /db_xref="GeneID:59326799"
     CDS             921403..922314
                     /locus_tag="HG536_0E05140"
                     /inference="similar to AA sequence:RefSeq:NP_011724.1"
                     /note="ancestral locus Anc_5.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140277.1"
                     /db_xref="GeneID:59326799"
                     /translation="MTAFVVTCIGHDDALPLPKIDAIIEQIKSALSDAFTLSDQTKKL
                     AENAIDLHISSSSETSWLQLKEQLKSVICAHSDVDIIVQVDNEFRHKKLVVFDMDSTL
                     IYQEVIELIAAYAGVEDKVRDITERAMNNELDFKQSLRERVKLLKGIKIDHLYDEIKQ
                     KLLITNGVPELCEQLHANGCKLAVLSGGFVPFANYIKEKLHLDFARANVLETDDEGVL
                     TGVTTGPVVDGELKAETLLQLCEEYGIPKEASCMVGDGGNDLPAMAAAGFGVAWNAKP
                     KVQELAPARLNTSSMVNLLHVFGYSSK"
     gene            complement(<922378..>922689)
                     /locus_tag="HG536_0E05150"
                     /db_xref="GeneID:59326800"
     mRNA            complement(<922378..>922689)
                     /locus_tag="HG536_0E05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284382.1"
                     /db_xref="GeneID:59326800"
     CDS             complement(922378..922689)
                     /locus_tag="HG536_0E05150"
                     /inference="similar to AA sequence:RefSeq:NP_011725.3"
                     /note="ancestral locus Anc_5.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140278.1"
                     /db_xref="GeneID:59326800"
                     /translation="MVTAITSASEFEKVIAVDKLVVVDFFAVWCGPCKMISPMVEKFA
                     TEYTQADFYKVDVDELPEVAKKNEVSSMPTFILFKGGKPVAKVVGANPAAVKQAIASN
                     V"
     gene            <923153..>925561
                     /locus_tag="HG536_0E05160"
                     /db_xref="GeneID:59326801"
     mRNA            <923153..>925561
                     /locus_tag="HG536_0E05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284383.1"
                     /db_xref="GeneID:59326801"
     CDS             923153..925561
                     /locus_tag="HG536_0E05160"
                     /inference="similar to AA sequence:RefSeq:NP_013146.1"
                     /note="ancestral locus Anc_5.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140279.1"
                     /db_xref="GeneID:59326801"
                     /translation="MSVGIDQEDEDFTKLSLDERLAHKLWKARLHAYQELLATFQGSQ
                     RDRNSIVYWSDPEQFARYVTDSNVAAQEQAVLALEALLRGGGLPAQNVDLSQVISLWV
                     SALVEKALTSSRAATRTKALDCILLLCAYDESITRSVRAVLPFFQNKLPKLVAASVNC
                     VAELVKSYQFINTEVNVLLADILEPLVKLAGHADRNVRGQTMSLVVEIYNATGRSKVL
                     LQEMLLDRLKPIQQNDLQKLFDKASNEPAENQPRLSFRWQEAQRVDKDGDTLMDMKPV
                     SPQEMESNGLSRVKNIGEKIEIDPFDLLPEQTILDKLPVDFHEKINSTKWKDRVESLQ
                     EFWNPTVSSVKKLKSRGQDYTEILNILGHIVQKDANVQAVTIAAQCIKTICEKLRTPG
                     FTKHYASLVFVPLLERTKEKKPSAIDSIRQTLKVICHFYNPLNPTGHNEDMLQEILEF
                     MKHKTPQVRMEATNLFTFVINEINDGEVRVLKKYLEDEIIPTVLKIVNDTQPTIRNSG
                     FECFATLIRLLGKRELSIPLETLDGLKRKKIQEFLNGLPAVTERKENVLTNETSRPSS
                     SPHLSTIPTKRGPSSPLQKVAKASSPSAARSRVLLTSRSLATSQQAISPGPPSAVTKE
                     VERSRREKQEWIRERHQLINQINNLTGFQTELSNENDSLREQLKMAQTSLHEKNLQIR
                     SKELQLSKLQDRVAQLEAELKQQQQHPQGRISSSDASAVSTNLGVRSLSSSSFDPKTT
                     KSKHCRTPSESSDDLPRRVDSLQLNNEMLNEESWKRAAEVTSQLKARIERMRAKSKGV
                     NSNV"
     gene            complement(<925593..>926396)
                     /locus_tag="HG536_0E05170"
                     /db_xref="GeneID:59326802"
     mRNA            complement(<925593..>926396)
                     /locus_tag="HG536_0E05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284384.1"
                     /db_xref="GeneID:59326802"
     CDS             complement(925593..926396)
                     /locus_tag="HG536_0E05170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140280.1"
                     /db_xref="GeneID:59326802"
                     /translation="MFVEDSEGVVEWLESTLPEVSEADPELLKELLLDFLEECSLKGR
                     EAFVEAVCVLVEGIIDDSRPFAEQLYEKVCSQRVPADVGNWVAVYDLPGHLCRQKLII
                     REFEQFGEMCACRVCGSVSQDRRNALIKFVDRASVEACLRSSVPFFNDRFVQVDAVGR
                     ADAEEPQPVGSALGQLSTQLNVKSKQLAGYRERLREIQRRVEATNPRDSCNLKRCYSL
                     YQEFMQEIEKKQLTPELLYRLRDKLQTLKEDPKMYVKPKNVSASKRLKT"
     gene            <927139..>928830
                     /locus_tag="HG536_0E05180"
                     /db_xref="GeneID:59326803"
     mRNA            <927139..>928830
                     /locus_tag="HG536_0E05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284385.1"
                     /db_xref="GeneID:59326803"
     CDS             927139..928830
                     /locus_tag="HG536_0E05180"
                     /inference="similar to AA sequence:RefSeq:NP_013145.1"
                     /note="ancestral locus Anc_5.122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140281.1"
                     /db_xref="GeneID:59326803"
                     /translation="MSEITLGRYLFERLRQVDTNTIFGLPGDFNLSLLDKIYETPGMR
                     WAGNANELNAAYAADGYARVKGMAAIITTFGVGELSALNGIAGSYAEHVGVLHIVGVP
                     SISSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMLTDINSAPSEIDRCIRTTYVTQ
                     RPVYLGLPANLVDLKVPASLLDTPIDLSLKPNDAEAENEVVETVLDLIKDAKNPVILA
                     DACCSRHDVKEETKKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAV
                     ESADLILSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKVRNATFPGVQMKFALQKLL
                     GKVAEAAKGYKPVPVPPRTPANPVVPESTPLRQQWIWNQVGKFLQEGDVVITETGTSA
                     FGINQSHFPNKTYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLT
                     VQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWKNLDLLPTFGAKDYE
                     VHRVATTGEWNKLTEDAEFNKNSRIRMIEVMLPVMDAPSSLVAQAQLTASINAKQ"
     gene            complement(<928916..>930154)
                     /locus_tag="HG536_0E05190"
                     /db_xref="GeneID:59326804"
     mRNA            complement(<928916..>930154)
                     /locus_tag="HG536_0E05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284386.1"
                     /db_xref="GeneID:59326804"
     CDS             complement(928916..930154)
                     /locus_tag="HG536_0E05190"
                     /inference="similar to AA sequence:RefSeq:NP_011726.1"
                     /note="ancestral locus Anc_5.121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140282.1"
                     /db_xref="GeneID:59326804"
                     /translation="MPRDPLIGIVGKPSSGKSTMLNSLTDAAAAMGAFPFTTIDPNKA
                     TGYVQVDCACSRVGKQSLCKPNYGWCSGGKRHIPIMLLDVAGLVPGAHAGRGLGNKFL
                     DDLRHADALIHVVDVSGCTDAEGKNTRGYDPLNDIEWLQDEIRLWIEGNLKKRWGSIV
                     RKHTATKSSIVDTLQAQFGGYGSQAVMIQRALDRLTGLPPLQDWDDSWITKVVSSFMM
                     EKFPTVLALNKIDHPDADKNVSKIMLKYPNTKAVLTSAITELFLRKLNKQGFVRYEEG
                     TEFVDTHEDDPDHLKPLDDKIIERIENIRDLVLYRFGSTGVVQVLQAATGILDLIPVY
                     TVKNIQTFTGGNGVNVFRDCFLVKRGTPVGKVTKYIMGTEVTIAAIETVGGIRVSEDS
                     TVEPGQNDILSFKIAPKSKE"
     gene            <930384..>931871
                     /locus_tag="HG536_0E05200"
                     /db_xref="GeneID:59326805"
     mRNA            <930384..>931871
                     /locus_tag="HG536_0E05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284387.1"
                     /db_xref="GeneID:59326805"
     CDS             930384..931871
                     /locus_tag="HG536_0E05200"
                     /inference="similar to AA sequence:RefSeq:NP_011727.3"
                     /note="ancestral locus Anc_5.120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140283.1"
                     /db_xref="GeneID:59326805"
                     /translation="MAEESSQIEPKTQEEMLFKPVGETVKEIQEEVDHDGETAQVKLT
                     GASDAMGHPVQEIESLCMNCHQNGVTRLLLTSIPYFRDVVIMSFECPHCGFKNSEIQP
                     ASEIQEKGCKYLLKVENAEDFNRQVIKSETATCKFIELDIEIPAKRGQLTTVEGLLSE
                     MIEDLESDQEARKTVDEALYDKIEQFIGKVRDCIACKAGTLPINFVLDDPAGNSWIEY
                     KPGEPQHKWSHSEYLRTDDQNVEVGIITRDQLEQRRREKLQELSNRERNPSESVKAGV
                     ANPEFLSDATDIENFNNEVQTFRGSCPSCMHECETHMKPVNIPHFKEVIIMSTRCDSC
                     GYKSNEVKTGGAIPEKGRRITLLCDDPADLSRDILKSESCSLTIPELSVEIQQGTLGG
                     RFTTLEGLLRQVYDELHSRVFSQTSDSMDEQTRERWLSFFSKMKDALDGKIGFTVIME
                     DPLAGSYIQNVYAPDPDPNMKIEDYERTRQQNEDYGLTDIMVDQQ"
     gene            <932010..>933416
                     /locus_tag="HG536_0E05210"
                     /db_xref="GeneID:59326806"
     mRNA            <932010..>933416
                     /locus_tag="HG536_0E05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284388.1"
                     /db_xref="GeneID:59326806"
     CDS             932010..933416
                     /locus_tag="HG536_0E05210"
                     /inference="similar to AA sequence:RefSeq:NP_011728.3"
                     /note="ancestral locus Anc_5.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140284.1"
                     /db_xref="GeneID:59326806"
                     /translation="MVPKTDSKRKLSSYEKFHYDRSRLNLHSCFYLGIELNELPEKRL
                     ICHALKETIANHPQLHQTIAIDPEDNQPYIKNIDRVLKFDDVADYVPFAYTEDSINQL
                     FRDRKFPYCVEEPLWKLLILENDKKCLLLLDHTLFDGMSALAFWKSFMKSLPDEAEES
                     DDDLWAPSQESSSQECHPYERWPTTWGSVCKALLVGALFKLCPSAVLAVGRDQLRFKN
                     YQFPDGLFVDNGSIGRSRYHIRNDNCQQTLQIEPGRLRDLLSACKRHGVSLTSFLAAL
                     LAISMDKCLEQDCYTGSYLKIDVPMNTRKACAEVLNIPENSMTMGNYVAPTELRYNLR
                     TTDDVWQTAKRLCKVLKSQTTTDVISTINNVRLLDVADTAKFIEEKLKAGGPSGTFEI
                     TNLGAQDFCRGSNDRFLVENAVFNEPQSISDVFTCSIISTPLGGLSCCLSYPRAIKRS
                     IEPCIDNLKEFLDQRRFI"
     gene            complement(<933616..>935778)
                     /locus_tag="HG536_0E05220"
                     /db_xref="GeneID:59326807"
     mRNA            complement(<933616..>935778)
                     /locus_tag="HG536_0E05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284389.1"
                     /db_xref="GeneID:59326807"
     CDS             complement(933616..935778)
                     /locus_tag="HG536_0E05220"
                     /inference="similar to AA sequence:RefSeq:NP_013148.1"
                     /note="ancestral locus Anc_5.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140285.1"
                     /db_xref="GeneID:59326807"
                     /translation="MLKRDISEELEGPQPERRQVLDGLLNWLGDHLPSFDHRVNRKVQ
                     CSRVVRAARFCFIFTVVLLCLVLPMWNVMSRTRRVFRMVQYTKRRIFRSHSWVHRSLL
                     YHNQSFHQFVLWSLIVATFTWYGVDRDLVQVTRRMGRIAAALMPPLLFLTLRPSPLPE
                     TLFLALIPIHKWISRVVVVESLLHSLLYSWFMARKHAFWIKIKKPANMYGVVAMALFL
                     LIGFSSVRTVRRRRFRVFYSVHYISTWLSVILIHFHARPGVPYYTLLNCTILAAQILY
                     RVLHTRTATISVISISDSLALVEFPREALSSKQVLPSGHVRISTWEKNWLKRLLGQVV
                     PLQHPYTIASLPTDETVKLIVRNGKFPLISNRLYYITGAFEPRFTFMKNPRTRTTSLI
                     PWPRPNPFHMASRSLLHSPLNYDIAARRVLMCVGGSAISFALPLLRILNFNGVNVKLI
                     WVVRDLKDLKVLYHFKNNFDGLEIYISGTSGSEQDIQIDYIDCYDDSDTSPHAPSSGV
                     RDPGAAPPMPPTEQASLLENATGSGYWSTGNKRYGPYSVKHSLSGVSCIGSDNANDEI
                     DFTKTFAARNARSQSINNWDTTVSLPMSANNIFRKPSIIEGPASRNSNFGDESYPGEQ
                     QRPTDSDTKLKIPSSVKVVFGRPTLGGTEYKWCLQRECDAETARDICCRLNGEDSDLV
                     DSLAEVAVIAAGPPSLIESARRFATDAGLLFHAESFAV"
     gene            <936452..>937210
                     /locus_tag="HG536_0E05230"
                     /db_xref="GeneID:59326808"
     mRNA            <936452..>937210
                     /locus_tag="HG536_0E05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284390.1"
                     /db_xref="GeneID:59326808"
     CDS             936452..937210
                     /locus_tag="HG536_0E05230"
                     /inference="similar to AA sequence:RefSeq:NP_011730.1"
                     /note="ancestral locus Anc_5.116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140286.1"
                     /db_xref="GeneID:59326808"
                     /translation="MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFKTRPDG
                     VNVVNIGKTWEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKYAAHTGATPIAGRF
                     TPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEYVDVAI
                     PCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYRNPEEIEQQVAEEA
                     AGAAADEEEAKEEVIEEQTEATEWAEESTEAVAW"
     gene            complement(<937543..>938859)
                     /locus_tag="HG536_0E05240"
                     /db_xref="GeneID:59326809"
     mRNA            complement(join(<937543..938172,938424..938517,
                     938849..>938859))
                     /locus_tag="HG536_0E05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284391.1"
                     /db_xref="GeneID:59326809"
     CDS             complement(join(937543..938172,938424..938517,
                     938849..938859))
                     /locus_tag="HG536_0E05240"
                     /inference="similar to AA sequence:RefSeq:NP_011439.1"
                     /note="ancestral locus Anc_6.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140287.1"
                     /db_xref="GeneID:59326809"
                     /translation="MAAEKILAPESLLKKNKAQQKSIEQTAAERAARKAANKEKRAVI
                     LERNTAYQKEYEAAQRAVIQAKRDAKASGSFYVEAQPKLVFVVRIKGINKIPPKPRKV
                     LQLLRLTQINSGTFVKVTKATAELLKLIEPYVAYGYPSYSTVRQLVYKRGFGKVNKQR
                     IALSDNAVIEENLGKYGILSIDDLIHEIVTVGPHFKQANNFLWPFKLSNPSGGWGVPR
                     KFKHFIQGGAFGNREEFINKLVKSMN"
     gene            <939622..>940383
                     /locus_tag="HG536_0E05250"
                     /db_xref="GeneID:59326810"
     mRNA            <939622..>940383
                     /locus_tag="HG536_0E05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284392.1"
                     /db_xref="GeneID:59326810"
     CDS             939622..940383
                     /locus_tag="HG536_0E05250"
                     /inference="similar to AA sequence:RefSeq:NP_015125.1"
                     /note="ancestral locus Anc_6.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140288.1"
                     /db_xref="GeneID:59326810"
                     /translation="MSASAAVIGPDRGPLVSNGGDNVRDYNHATDQEYQRLRSLADEA
                     HKRRQQLSNESQAAYKQGDGGRAHQLSEKAKIQQRLAEQYNMDAAEYVFVQNNADSDS
                     DEIDLHGLFVKEAVWILKRRIASGIKAHESHVRVIVGKGVHSQNGLAKIKPAVEELCR
                     DANLRNYLDKKNQGVLIIELESARVPDSWADSAFSTEKPAQTHQANAYHPAQQPQYQQ
                     PQHQQPQHQQQNSSGSGDLLAKVFKFLFVCIQKNL"
     gene            complement(<940397..>941398)
                     /locus_tag="HG536_0E05260"
                     /db_xref="GeneID:59326811"
     mRNA            complement(<940397..>941398)
                     /locus_tag="HG536_0E05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284393.1"
                     /db_xref="GeneID:59326811"
     CDS             complement(940397..941398)
                     /locus_tag="HG536_0E05260"
                     /inference="similar to AA sequence:RefSeq:NP_011440.1"
                     /note="ancestral locus Anc_6.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140289.1"
                     /db_xref="GeneID:59326811"
                     /translation="MDFDKSSSSIILDVAWGNTDKKNQGFIYAKNLPELIREIELVLN
                     RGEPTKGSRLLSNTGQNVIDTFAREKEFFKIYKDEFKEIFQGLVGKTFKDAVEGTFPS
                     GKIPPSILQEELGPSDNSKTPRRKEFRLKSLENRLAALSEELQFKDDIIAEKDRELIK
                     LTRNLSEYKDKYDFLQRQFSFYKDRGERPGHLNVHDDDSKTDQMTSTRHEFIISEMKR
                     KLEEQLLTINTLREQMQQSRGGYTWYNVPSRSGKHDYLPFSLLAALAVILLSLVCYLV
                     NSYRAADQSSDYTESFWWENSGLLSKFGWYWQDWKENAVQQTSDQAYDRIFGLTDYT"
     gene            <942021..>943760
                     /locus_tag="HG536_0E05270"
                     /db_xref="GeneID:59326812"
     mRNA            <942021..>943760
                     /locus_tag="HG536_0E05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284394.1"
                     /db_xref="GeneID:59326812"
     CDS             942021..943760
                     /locus_tag="HG536_0E05270"
                     /inference="similar to AA sequence:RefSeq:NP_011442.3"
                     /note="ancestral locus Anc_6.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140290.1"
                     /db_xref="GeneID:59326812"
                     /translation="MEKIPSLNDDDIEKILHPNSLFTDELRPLEKDSSASGIEDIINP
                     SLEPQPAAASSNESIANIPHEPGQHLIHRMYPVGMYAHQDDQLNKQLMPTKMFRNARQ
                     TSQSPQQTAQSTPGTRHTKTRPAFVNKVWSMLNDESNVNLIQWSPDGKSFIVVNREEF
                     VHEVLPKYFKHSNLASFVRQLNMYGWHKVQDVKSGSIQNSSDDKLQFENEYFIRGRED
                     LLEKIVRQKSSAASGSKMNPNGNNGGSANGADLHLMGDLNLGDHASASALLGELEQIK
                     YNQMAISKDLLRINKDNELLWKENMMARERHRTQQQALEKILRFLASLVPHMDQKMIT
                     EGILNSDDAPQDLHLHQETGDNSNSSNTKHAANPTSFDMFDQDFMRNLHKSRFLLKNR
                     TNSSVSSTVQPSLSHGDAKISEIPFDEEEDEQEAKHRSSAQRNSISGEDTVSFLNHLQ
                     SNIDEQDARIQHLEDMVQVISPQEANARHSFDLQDYCFNSESPMDTRRPISTGLSPLL
                     APEDLTSLQTHSPSHLIQELSHTEVPAAPTAPIQAPKRYHDALDARQRRSEPLVEEIP
                     NESSSSSRKRLKR"
     gene            <944019..>945167
                     /locus_tag="HG536_0E05280"
                     /db_xref="GeneID:59326813"
     mRNA            <944019..>945167
                     /locus_tag="HG536_0E05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284395.1"
                     /db_xref="GeneID:59326813"
     CDS             944019..945167
                     /locus_tag="HG536_0E05280"
                     /inference="similar to AA sequence:RefSeq:NP_015123.1"
                     /note="ancestral locus Anc_6.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140291.1"
                     /db_xref="GeneID:59326813"
                     /translation="MGIPIALYEDSECEEIEQFGWCSEACKRRLGELCYSRESTVLEE
                     DYEERPVDDDMVYAWRFDLQTRAENRVVNLAELESTRSKDASSWIFYRPDGSETAVYR
                     HRGREDDPLTVVHGVQELLQGSTIQSVDVRGGTLLLGLDSGQIKVVTCNNDGRIVQCE
                     SLVLRSGRILDVFAGLLPEFVIAFAADEGLLCTELRSGRTSKLLDVPPARLQRVSLDF
                     PRLSAFGATRIWSCDDVLSCPLVPVDAPLWPGEQLLNVDPCARHMLLLETDQRYLSLD
                     TAPAGCACTVLHKSEYGGPARAHTSTGGQQLFVSEQHLYATSLTMYGRCSRNRDCKWI
                     SLGYSDIRAKYNICRVLRLTLMTASTPATSVLALLTDDGSIHSFSIER"
     gene            <945491..>946852
                     /locus_tag="HG536_0E05290"
                     /db_xref="GeneID:59326814"
     mRNA            <945491..>946852
                     /locus_tag="HG536_0E05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284396.1"
                     /db_xref="GeneID:59326814"
     CDS             945491..946852
                     /locus_tag="HG536_0E05290"
                     /inference="similar to AA sequence:RefSeq:NP_011444.1"
                     /note="ancestral locus Anc_6.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140292.1"
                     /db_xref="GeneID:59326814"
                     /translation="MMNWVSNDSSTPDESPQLMAPIGMTEGSGSELTTEALRSDQNKF
                     IHLDPIPDFKDRSEIKPWLQKIFYPQGIEIVIERSDSIKVVFKCKAAKRGKNTRASEP
                     VAEQFSVPSEPVESKTKDRKKKKRSVSRFNICPFRIRATYSLKRKKWSIVVLNNCHSH
                     PLKFNPDSEEYRKFKEKLRQNNDWEAIKKFDELEYRTRSNLPIESSPIRCDCGLTEEI
                     ASFNIVLPSTNHSSVSSTLVKKPKKKSGLRKQRKEAFLMMPTQQHHLANTTHVQSPSV
                     SGFLDDPSANPLFTTPITATDAFTDLNEIDFTNMFDKMHHNSTHSRAQQRHSGAEDAL
                     NVFSPLAISSFQYCSPSGDLVQSPAHPQAPPASTTHGGMDNAVDFSMKPFLDLPGHDS
                     FTPPLCEINGSNACQDHRCCYSELNAESSPARDMLSGELDVLKAINGELSEHLTTELF
                     NLQ"
     gene            complement(<946993..>947361)
                     /locus_tag="HG536_0E05300"
                     /db_xref="GeneID:59326815"
     mRNA            complement(<946993..>947361)
                     /locus_tag="HG536_0E05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284397.1"
                     /db_xref="GeneID:59326815"
     CDS             complement(946993..947361)
                     /locus_tag="HG536_0E05300"
                     /inference="similar to AA sequence:RefSeq:NP_011445.1"
                     /note="ancestral locus Anc_6.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140293.1"
                     /db_xref="GeneID:59326815"
                     /translation="MTTFRFCRDCNNMLYPREDKENQRLLFECRTCSYVEEAGTPLVY
                     RHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRSDTSMVLFFV
                     CLACSHIFTSDQKNKRTQFS"
     gene            <947590..>948138
                     /locus_tag="HG536_0E05310"
                     /db_xref="GeneID:59326816"
     mRNA            <947590..>948138
                     /locus_tag="HG536_0E05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284398.1"
                     /db_xref="GeneID:59326816"
     CDS             947590..948138
                     /locus_tag="HG536_0E05310"
                     /inference="similar to AA sequence:RefSeq:NP_011447.1"
                     /note="ancestral locus Anc_6.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140294.1"
                     /db_xref="GeneID:59326816"
                     /translation="MSLRLASTRSVVRTSRLLRVNGAVWRLNSTASAAAETAQAKAAI
                     DPKIKKIVDEISKLTLLETSSLISELKSQLNIPDIAFPAAGAVAAAPGGAAAAAEESG
                     AQEEEKPEEKTIFAIKLESFDAKAKPKIIKEVKNLLGLSLVEAKKFVEAAPKVLKDNV
                     AKEDADKIKTTLEGLGAKVALE"
     gene            complement(<948250..>949350)
                     /locus_tag="HG536_0E05320"
                     /db_xref="GeneID:59326817"
     mRNA            complement(<948250..>949350)
                     /locus_tag="HG536_0E05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284399.1"
                     /db_xref="GeneID:59326817"
     CDS             complement(948250..949350)
                     /locus_tag="HG536_0E05320"
                     /inference="similar to AA sequence:RefSeq:NP_015121.1"
                     /note="ancestral locus Anc_6.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140295.1"
                     /db_xref="GeneID:59326817"
                     /translation="MDLGYHHQLQPQQQHQQQYQQQYGNAAGYGGHGTREKSLLPQRS
                     VVSKGKYSLQDFQIMRTLGTGSFGRVHLVRSVHNGRYYAMKVLKKQQVIKMKQIEHTN
                     DERRMLKLVEHPFVIRMWGTFQDARNLFMVVDYIEGGELFSLLRKSHRFPNPVAKFYA
                     AEVTLALEYMHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVVTVTWTLCGTPDYI
                     APEVITTKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVNYPPFFHP
                     DAVDLLSKLITADLTRRLGNLQSGSDDIKSHPWFSEVVWEKLLAKDIETPYEPPITPG
                     VGDTSLFDQYPEEHLDYGIKGEDPYAQYFTDF"
     gene            complement(<949576..>951063)
                     /locus_tag="HG536_0E05330"
                     /db_xref="GeneID:59326818"
     mRNA            complement(<949576..>951063)
                     /locus_tag="HG536_0E05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284400.1"
                     /db_xref="GeneID:59326818"
     CDS             complement(949576..951063)
                     /locus_tag="HG536_0E05330"
                     /inference="similar to AA sequence:RefSeq:NP_015120.1"
                     /note="ancestral locus Anc_6.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140296.1"
                     /db_xref="GeneID:59326818"
                     /translation="MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRS
                     RHPQLDYESRVYKYLSGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFTF
                     KTVIMLALQMICRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFN
                     THRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKA
                     TTKKQKYDRILEKKLCTSVETLCGGLPQEFAEFMLYCRNLKFDERPDYLYLARLFKDL
                     SIKLEYHNDHLFDWTMLRYTKAMVEKQCDLLMVENQGNKDKAIASASTSATATNDNNN
                     AGSAASGTNNKDDSFNRVKLLAMKKFATHFHYCKNEDKHHPTPDEIKQQSIQNTNAAA
                     SLPEELLNAIDKGMENLKQQHQQQQQQQQQQQQQQQHSDPILQQHQKEQQYAGNLAQD
                     AIQQPSMRTTHYPPQVQQPQQDPSRPDQLKHQHQPLKPAGEDIWL"
     gene            <951362..>952507
                     /locus_tag="HG536_0E05340"
                     /db_xref="GeneID:59326819"
     mRNA            <951362..>952507
                     /locus_tag="HG536_0E05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284401.1"
                     /db_xref="GeneID:59326819"
     CDS             951362..952507
                     /locus_tag="HG536_0E05340"
                     /inference="similar to AA sequence:RefSeq:NP_011448.3"
                     /note="ancestral locus Anc_6.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140297.1"
                     /db_xref="GeneID:59326819"
                     /translation="MEAVVRTGATFFGYESLNRVSFLRNDVEFVRKSLQHKSTVFVPF
                     VQGEALVRGQEEPELCLLTLQDGWFPMARVVDKLLPVLNSQAARVVESGANLTFLGLK
                     SSDGDDVFQYRSSYSGVPYYAVDFRTSGGTLIQAAELEPLLQCARVDRKLIFEMSNET
                     ASLYSHAKMYLDWLAKYHFCPGCGSVMFPVDAGTKMQCGNADRSVACNVRDAAVNNVC
                     FPRTDPVVIVAIATKDFSRICLAHSKRWVHDTLYSTVAGFMEPAETVEQACSREIWEE
                     TGIRCRDITLVSTQPWPYPANLMIGCVGLVEPNGVDEKINLSHDNELMDAQWFDVEEV
                     IEAMDRYDGSGVVKFKKSDITFPGSTAIAFHLIKFVCDRYKRSLGSL"
     gene            <952666..>953613
                     /locus_tag="HG536_0E05350"
                     /db_xref="GeneID:59326820"
     mRNA            <952666..>953613
                     /locus_tag="HG536_0E05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284402.1"
                     /db_xref="GeneID:59326820"
     CDS             952666..953613
                     /locus_tag="HG536_0E05350"
                     /inference="similar to AA sequence:RefSeq:NP_015118.1"
                     /note="ancestral locus Anc_6.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140298.1"
                     /db_xref="GeneID:59326820"
                     /translation="MIEIVGHRAFKGQYVENSWTAFERAYEGKADVIETDLQMTSDGV
                     VVINHDADTGRIWDRELVIAENSYDEISKLRCKEDRSSQMPTLEQLLRWAVEHPRVQL
                     MLDIKFTNNKLILLKTFATMLRVRNDVAYWQSRIIWGLWLLDWFEYGIETGVLKDFKV
                     VVITLSLDVACQFIDYSLQLNNPHYRLYGISVHYVASWTDTFRLKMAPVLRKYDVKVF
                     LWTVNKVTDFKCMAGLPIHGVVTDDPVVARRLCLELSPMKEFRLPDLATVNGFRFHLY
                     LLVYQIVCSLLFAKWAHYSVGGWSFAYLVFLLLKKIHFL"
     gene            <954002..>955672
                     /locus_tag="HG536_0E05360"
                     /db_xref="GeneID:59326821"
     mRNA            <954002..>955672
                     /locus_tag="HG536_0E05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284403.1"
                     /db_xref="GeneID:59326821"
     CDS             954002..955672
                     /locus_tag="HG536_0E05360"
                     /inference="similar to AA sequence:RefSeq:NP_011449.1"
                     /note="ancestral locus Anc_6.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140299.1"
                     /db_xref="GeneID:59326821"
                     /translation="MSSARSEIEGIKKQIQEKYSNVNGAGSQGSDGENGWKDLLQSVK
                     NNVYQYKGINQASREKYFSANARILEDPLESSFQYRVCNNCGVPLALNSIMDHLENHC
                     KGTAAESPREMKKELTDDDVGSISSNKRKNMESSVSSFDGKTYPVEAASPTPRPDQKR
                     LKESSETPVKRQRKVKQRNPTEKHLIDFDKQCGVELPEGGYCARSLTCKSHSMGAKRS
                     VVGRTQPFDMLLAEYHKQHQTKIGAAAEKRAKQQEIQKQQKQIQKEQKKQLQQQKQSQ
                     RGRKGNSTSAGNNSKTSSGGLSHLSDATGLNMNVTPEEETTQVLNGVSRSLPLPLEST
                     VLSSVRSRNKYFRMREMFASAFSVRPGFTSPGYGAIHSRVGCLDLDRTTDYKFRIRTP
                     QPMNQLPPQGMTPQQMKKLQQQRLLRAQLQQGNQLQQANYQQNQQPVPQQSNNVPKPV
                     NGIVRPPQEQTALEQKGLTPQEIQFQQQKLRQQQLQQQRFEAAAFHLANATKLMQGPN
                     GNPGSTEIHNNNSNSPPPAGTPSANQQIVSPMGGRVNVGIGNYGGRVN"
     gene            complement(<955762..>957279)
                     /locus_tag="HG536_0E05370"
                     /db_xref="GeneID:59326822"
     mRNA            complement(<955762..>957279)
                     /locus_tag="HG536_0E05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284404.1"
                     /db_xref="GeneID:59326822"
     CDS             complement(955762..957279)
                     /locus_tag="HG536_0E05370"
                     /inference="similar to AA sequence:RefSeq:NP_011450.1"
                     /note="ancestral locus Anc_6.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140300.1"
                     /db_xref="GeneID:59326822"
                     /translation="MKVKAADEKLRIAFIHPDLGIGGAERLVVDAAVGLQQEGHDVVI
                     YTSHCDMNHCFEEVRQGMLKVEVFGDHLPTNFLGKFFIVFANLRQLYLVLQLCLQRKI
                     KMHDLFIVDQLSTCLPFLHLLSNAKQLFYCHFPDQLLAQRRGILKQLYRIPFDLFEQF
                     TIGTADSVVVNSNFTKTIYERTFQFLRDSPRVIYPCVDLSKREIDHVDELFYNSLLGS
                     SSFFLSINRYERKKAIALALEAYALSKKEANFSSKLAICGGYDDRVAENVEYLNELQR
                     HASSLKLTHITIFYADIHKVKNFNLFQGRDFEVVFLTSISSSLKELLLSKTDLLLYTP
                     SFEHFGIVPLEAMKYGKPVLAVNTGGPVETVETLVPGQNENTSTGWLRNADPKEWAGA
                     ISEFLSVQDKNSVNFKKNGPERVKKYFSREAMTASFEENISLFIKDEQVTYSWESMLA
                     VLGNVFVHVFINSLFQRKHRLSPYAVMAAISILYCRSFRFGLYWVAVFAALFFDI"
     gene            <957386..>958630
                     /locus_tag="HG536_0E05380"
                     /db_xref="GeneID:59326823"
     mRNA            <957386..>958630
                     /locus_tag="HG536_0E05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284405.1"
                     /db_xref="GeneID:59326823"
     CDS             957386..958630
                     /locus_tag="HG536_0E05380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140301.1"
                     /db_xref="GeneID:59326823"
                     /translation="MNRLALLRYRYCPRRFQSTKDDGGYLAARLQELKEQNDPNPDDP
                     LVKLTQGKSLVDEDAELQKIYQKLDQKAFEERYRREIQYAKIPNHVNQQSKDTAVSEP
                     WTGEEGVEFTSLRMILDSTGKPDGSSSSVAANVGFINAALPAKEPRAVRASKSFRRKL
                     EDAQDRVLKFQRDQKQEIDETEQSEFRTLYAEKFTPIGSFEKLRSLADQRIEESMKQG
                     GFDGLEHIKGKPSSFVQLNQHIDRTEHHLNNMLVRQNIAPPWIESQGRVNGDISAFRR
                     EAASMFENELLAYLDKTGILRHNATWESAKSEITSRFGSTGELLQARFSLWKTSQRSY
                     FESRIKTLNSGLRTYNLQAPLSTQKLYLLPEKEFDRAYNSIDLEKLVIETLQERMKQT
                     ADSNADRSDGGFSLFRKSLKFW"
     gene            complement(<958708..>961002)
                     /locus_tag="HG536_0E05390"
                     /db_xref="GeneID:59326824"
     mRNA            complement(<958708..>961002)
                     /locus_tag="HG536_0E05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284406.1"
                     /db_xref="GeneID:59326824"
     CDS             complement(958708..961002)
                     /locus_tag="HG536_0E05390"
                     /inference="similar to AA sequence:RefSeq:NP_015117.1"
                     /note="ancestral locus Anc_6.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140302.1"
                     /db_xref="GeneID:59326824"
                     /translation="MHFNRAGALVALLCVAIYWFLGGRSSIALAGTVFCGIAYKEAID
                     SGKNSSSEANSSEAAAPKKKKGCCGGKGGKNCCSSKGGEKKSGCCCSSKKIESKDKQD
                     FMMIPGSEASKEVNFPDEIDFTNAFKPSGKNNGASAKPRKIISKPKLISKPKNEDGLV
                     KSAMTISKDALLSSQIYIFYSSLQGAAQRAASTVHETLSKIEGLDLEPILLNLDELDD
                     IDEYFVSVPSENALYFLVLPSYDTDCPLDYFLQTLEENFNDFRIDKFPLRKLVGYGIL
                     GIGDSESWPEKFCYQAKMADHWIARLGGRRVFPVGEVCMKRGGISDVQNWANLLSETL
                     KDDEPILYEYDETIDENLQDGDDQLGDLEDIGKESNGDESQIKQMVAENSPTYRKLTK
                     QGYVIVGSHSGVKICRWTKSDLRGTGSCYKHSLFNIVSSRCMELTPSLACSSKCVFCW
                     RHGTNPVSKNWRWEVDPPEYILENALKGHYSKIKQMRGVPGVVMERFAKAFQVRHCAL
                     SLVGEPIMYPYINRFVELLHEKGISSFLVCNAQHPDALESIGKVTQLYVSIDASTKQE
                     LKRVDRPLYKDFWERMLSCLDILRTKQSHQRTVFRLTLVKGFNMADISSYADLVQRGL
                     PSFIEVKGATFAGSSDGNGNPLTMQNIPFYEECTNFVKQFAAELQRRNLGYDIAAEHA
                     HSNCILIASTKFKINDEWYTHIDFDKFFELLRSGENFNPMDYIAKTPEWALFGNGGFA
                     PGDTRVYRKGKKKSKNVPKAEPTT"
     gene            complement(<961178..>962983)
                     /locus_tag="HG536_0E05400"
                     /db_xref="GeneID:59326825"
     mRNA            complement(<961178..>962983)
                     /locus_tag="HG536_0E05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284407.1"
                     /db_xref="GeneID:59326825"
     CDS             complement(961178..962983)
                     /locus_tag="HG536_0E05400"
                     /inference="similar to AA sequence:RefSeq:NP_015116.1"
                     /note="ancestral locus Anc_6.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140303.1"
                     /db_xref="GeneID:59326825"
                     /translation="MQFEKIQRLLDWGGRFGVEIPSGVRFEFDEIEGIRCICTERIES
                     PMLSIPSDLIIRKELLSLALPNITYKDADSNTYLKFLLAKLMYDCRDEQINELRGKFK
                     PYLDCLPAVVESPLIWNPREQALLEGTNLGSSLRDKLHAIWREWYTAIQNCDIFDKTA
                     IQKDLELYENYHGTSMEIIYESILKETVHRTPAVWYSFSAFLWSHLIFLSRAFPEYVL
                     NSKCQKHHVMLLPIVDLLNHDYKCKVEWLGSAFKFSYKYLGSAEKGTQLYNNYGRKGN
                     EELLSGYGFVLMDNPCSSVALRIKLTFDSISEILTSEPSIRLLTLEDYTTFAFDRRPG
                     GNENPEGKNAEHIYREGVTYLICKNNEGSLQNMLSLFAYLNKVDQEDWKELASQFRGL
                     QSLRLALDQKLRQIDVKCVETEPNLQYPIDHQRKQNAVTYKKEQISILKWALSLLKSK
                     EKQWLSENKTALLTAKKVMKYDPRFLDEELPAMLGRSVDDYLASLSSHQFLALWISMK
                     LFNRSFVAKYSWVEENYKNFISGKPNLAQICSDPEADSFHSALLEKSGARFSISVEDI
                     RSVFQFLAGRTFTRLASRDQETILVRRLDKWSTLD"
     gene            <963688..>964809
                     /locus_tag="HG536_0E05410"
                     /db_xref="GeneID:59326826"
     mRNA            <963688..>964809
                     /locus_tag="HG536_0E05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284408.1"
                     /db_xref="GeneID:59326826"
     CDS             963688..964809
                     /locus_tag="HG536_0E05410"
                     /inference="similar to AA sequence:RefSeq:NP_015115.1"
                     /note="ancestral locus Anc_6.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140304.1"
                     /db_xref="GeneID:59326826"
                     /translation="MEAQKSRRDSLLQRSILLSMRLDNGRSAHAMGSRSRKTAVGSSN
                     VVKSWRMSYSPQKTSLKQSSPSKLLRNGSVATRNRGEEQSLIPSPARLQSDGSKSKQS
                     PTVGLKVLSLADFEIGKKLGKGKFGRVYCVRHKETGFICAMKAMEKKELVQNNAQKQC
                     RREVEIQSALNHPHVTKLYGFFHDEKRVYLLMEYMVNGELYKLLKAKGPFNDIRASHY
                     VYQMADALDFLHQRNIIHRDIKPENILIGFNNIIKLTDFGSSVVSPRGTKRKTLCGTI
                     DYLSPELINSREYDDKVDIWALGVLAYELVVNCPPFEEESKDLTYKRIVNGDLRFPNT
                     ISSDAQDLIRKLLRHNAKDRISLREVKKHPWILKHKSFW"
     gene            complement(<964901..>966538)
                     /locus_tag="HG536_0E05420"
                     /db_xref="GeneID:59326827"
     mRNA            complement(<964901..>966538)
                     /locus_tag="HG536_0E05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284409.1"
                     /db_xref="GeneID:59326827"
     CDS             complement(964901..966538)
                     /locus_tag="HG536_0E05420"
                     /inference="similar to AA sequence:RefSeq:NP_011451.1"
                     /note="ancestral locus Anc_6.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140305.1"
                     /db_xref="GeneID:59326827"
                     /translation="MKLLKLPLNPLGLYGGLLVRNYAKRALKTERSRGSLKLASSVGP
                     KKKIRSRNSSKDKSESKGPKSFRYGNFGGLKDSVSSNGEGNERLLSKITDFDQLKILP
                     SVRTAVRQIIEAESLYQGNEIIPSPIQVMSIKRMASRLMDPKLQVHAIAAETGSGKTL
                     AYLVPLLDYLKRQEVEFPELWESLKDKAVIRSVILVPTHELVTQVHDTVSKTEGVLGL
                     HTYKWGAGSPYTEFLDKVKERIDILVTTPAKLLSLFNIRMISRADKLLSHVKFMALDE
                     ADTLMDQSWIEETHQAIRKMPNANHVVFCSATIPTEFNKTLDRLFPTLVSITTPRLHK
                     LPSMLEFKMIDASLNPYKGSKIKALAQTLYAIVNDGTELDYEKRCIVFVNEKKDVPGV
                     VEKLSKTYGHDCVGLTGSDTAEDRATKIKTFLDPPRLLRSATTRNSKDRNVRRVKVPD
                     SNVTIVYDNAARTEETKSPLKVLVTTDLMARGLNFKGVRNVILYDVPKTSIDLVHRAG
                     RTGRMRQSGRVFMIVEKSTKSWARAIPKVVKKNIAIS"
     gene            <966787..>968721
                     /locus_tag="HG536_0E05430"
                     /db_xref="GeneID:59326828"
     mRNA            <966787..>968721
                     /locus_tag="HG536_0E05430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284410.1"
                     /db_xref="GeneID:59326828"
     CDS             966787..968721
                     /locus_tag="HG536_0E05430"
                     /inference="similar to AA sequence:RefSeq:NP_015114.2"
                     /note="ancestral locus Anc_6.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140306.1"
                     /db_xref="GeneID:59326828"
                     /translation="MANESLTQLLSQLNVQSTKDEFAKVEQTCMNVLNNGSSSVDLGA
                     VLKAYLVASIKQDKYDQGFRILSEKKEIAERYGDQIALEKLYIYYKLNETRKFEELYS
                     ELVPQSIDAIADKSEIETLSIRGFLHVRAQFCYKNGLYDETQKIYHYLASHNSRGTDN
                     DLELQCNERVPLAANASLALDTDISTVSEESYDLLYNNSMILSARGEYEQAIELLKRA
                     GEMAVKDGYESDINAIELQLSFVYQMVGNTKQSKELLDKLISKLDKNSPIALLANMNK
                     KAFINFSKYKTNLNLVLRELNPEALNGINKQHFTQEQWSAINRNLLFLHLFNSDSIQS
                     KSSLLSRTLHNYRKIVNNMNFESYESQAKKLYHQALKMIESGPNGSVIGFLLLTIQLQ
                     VIEKQWDNAIRLGERFLNRLWERRPTPEIQSSSDRENIQAICYILLELYKITGRNNSK
                     TILLNHLMKDFSLLNLSAQASSEISFWKHIAFEHLEQTDLKNAKSLFEKVSKCCSDRL
                     INKILSDEDLDAEEGAQITQGVDVEAVIAAGVKPLEPTKASNNVANLFMVKKVRADRV
                     RDRKKRERLARFIKHHGIKGTLDPERWLPKKDRTSYRPKKRQLAKQTQGGAVSKKAEQ
                     ALDISKKTAKSSKKAKNRKK"
     gene            complement(<968796..>969341)
                     /locus_tag="HG536_0E05440"
                     /db_xref="GeneID:59326829"
     mRNA            complement(<968796..>969341)
                     /locus_tag="HG536_0E05440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284411.1"
                     /db_xref="GeneID:59326829"
     CDS             complement(968796..969341)
                     /locus_tag="HG536_0E05440"
                     /inference="similar to AA sequence:RefSeq:NP_015113.1"
                     /note="ancestral locus Anc_6.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140307.1"
                     /db_xref="GeneID:59326829"
                     /translation="MRQLTEEETKVVFEKLAGYIGRNISYLVDNKEQPHVFRLQKDRV
                     YYVPENVAKLATCVARPNLMSLGICLGKFTKTGKFRLHVTSLTVLAQNAKYKVWIKPN
                     GEMPFLYGNHVLKAHVGKMSDDIPEHAGVIVFSMNDIPLGFGVSAKSTSEARNLQPTG
                     IVAFRQADIGEYLRDEDTLFT"
     gene            <970402..>971898
                     /locus_tag="HG536_0E05450"
                     /db_xref="GeneID:59326830"
     mRNA            join(<970402..970421,970485..>971898)
                     /locus_tag="HG536_0E05450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284412.1"
                     /db_xref="GeneID:59326830"
     CDS             join(970402..970421,970485..971898)
                     /locus_tag="HG536_0E05450"
                     /inference="similar to AA sequence:RefSeq:NP_011452.4"
                     /note="ancestral locus Anc_6.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140308.1"
                     /db_xref="GeneID:59326830"
                     /translation="MSRRERIKHDRKPLVDESGSPVAKEPRLPKRKVAVMIGYCGTGY
                     HGMQYNPPNPTIEAELFRAFVEAGAISKANSNDLKKNGFMRAARTDKGVHAGGNLISL
                     KLIIEDPEIKEKINEKLPDGIRIWDIERVNKAFDCRKMCGSRWYEYLLPTYSLIGPKP
                     GTILHKSIEDSKMELPGILDDDIESKKFWEELNNEAHEQFTEKELEEIKSYVPPAREV
                     FDGSDELYLKVKKYKQLENSHRRKYRISEEKLKKFAAVMEQYLGAHNFHNFTLGKDFK
                     DSSAIRFMKEIKVSQPFVIGDAKTEWVSIKIHGQSFMLHQIRKMISMATLITRCGCPT
                     NRISEAYGPQKLNIPKAPALGLLLESPVFEGYNTRLEKFGYKPIDFSKYQAEMDAFKM
                     KHIYDKIYKEEVDENVFNAFFNYIDNFDRVTGAQGSQSDEKTGNAVQKSVFEFLTARG
                     ISNSTEENHQSLTKSAEELSDDKPAES"
     gene            <972123..>973448
                     /locus_tag="HG536_0E05460"
                     /db_xref="GeneID:59326831"
     mRNA            <972123..>973448
                     /locus_tag="HG536_0E05460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284413.1"
                     /db_xref="GeneID:59326831"
     CDS             972123..973448
                     /locus_tag="HG536_0E05460"
                     /inference="similar to AA sequence:RefSeq:NP_011386.2"
                     /note="ancestral locus Anc_6.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140309.1"
                     /db_xref="GeneID:59326831"
                     /translation="MLKLQYRQLFTTTVAKAAAPARGKAQGFAKKASGNRAGAKRITN
                     DTLYKNWADTVSFSKLNQYALPTEIPTFNPKELASSLNRVSSYSNKHYRSLYHLGSFH
                     KNQFNELFPKPVSLIRKDSIGKLINLLQTGDHKTFVLTGEPGVGKSTLLAQLHAFGCD
                     SNNIIIHISYPELFLNGRSDFFYDDKLKEYVQPMYMKKLLRKILKSNDENILRSLKLI
                     SDYKFPNADPKDSAIKKHISLIKGKNTLFDLLSIKTLGRNRGELFKAVISELAGQKSH
                     PVLFTVDNFSRILTGPVTSYKDANNKNISIFEFQLGKTILGIVSGEICFPNKNSACVL
                     AISGVDRTNRTLPVALGKIPEDVYIKRYHYDPQLAEILKKGKVQEFEVPKLTKEEVRE
                     LMDFYFKSEILLESDSENNSLDKLTDEKYFLSGNGNPRDLLKSIVLMHT"
     gene            complement(<973515..>974867)
                     /locus_tag="HG536_0E05470"
                     /db_xref="GeneID:59326832"
     mRNA            complement(<973515..>974867)
                     /locus_tag="HG536_0E05470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284414.1"
                     /db_xref="GeneID:59326832"
     CDS             complement(973515..974867)
                     /locus_tag="HG536_0E05470"
                     /inference="similar to AA sequence:RefSeq:NP_011385.3"
                     /note="ancestral locus Anc_6.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140310.1"
                     /db_xref="GeneID:59326832"
                     /translation="MDSRTSPEIPGIIQPANVTQDLRMMICKLLNSPKPAKTFPGSQP
                     VSFQHSDIDEKLFSQDYYVCEKTDGLRALMLILINPVTREQGCFMIDRENNYYLVNGF
                     RFPRLPRKDKKELLETLQDGTLIDGELVIQTNPMTKVKELRYLMFDCLAINGRCITPS
                     PTSSRLAHLGKEFFKPYYDLRSLFGDKCVTFPFKLSMKHMNFGYDLLKVVNSLDKLPH
                     QSDGLIFTPVKAPYTIGGKDSNLLKWKPEDENSVDFKLILRIPMVEDESLPKKDPERW
                     YYNYDAKPIFDLYVWQGGADVNSKLKNFDRPFSKKELEILQRTYKKFAELDVSDEKWQ
                     ELKSLEEPLNGRTVECYKDQETGAWKMLRFRDDKLNGNHTSVVQKVLESISDSVKVED
                     LAEVVPEIKKRWEERNVGDGRNNHTKPLQQHPSQNKAVADQPASKTEPSYVDDDDWSE
                     "
     gene            <975013..>977577
                     /locus_tag="HG536_0E05480"
                     /db_xref="GeneID:59326833"
     mRNA            <975013..>977577
                     /locus_tag="HG536_0E05480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284415.1"
                     /db_xref="GeneID:59326833"
     CDS             975013..977577
                     /locus_tag="HG536_0E05480"
                     /inference="similar to AA sequence:RefSeq:NP_011384.1"
                     /note="ancestral locus Anc_6.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140311.1"
                     /db_xref="GeneID:59326833"
                     /translation="MANPYDAALPKKRAASRTVNYSESDADAELSLRLEALEKRNGLG
                     DTKVKKAKREDSGYRYQAFLDDKMTSWNFVPNLPPSFRKTSRFSNFIELEGSTVNVQR
                     QCLFSTEGEILKVDDTIYMVSEPPGEPYYIGRVVEFLCRPEFRHLVKELMKYTAEIPS
                     KYFELKMNWYYRPRDIHNHTKNVSSRLVYASLHHDICPITSYRGKCTVIHKNEAPGTL
                     HSQLELITKDNVFYYDQLYDRHTLKYYDVYPTDTLLNRVDSKSPFLYYLFKRFYHVYV
                     EEGYPFHKVLKRYFLIDDNNLETDNSWDNRCTTCKEWCNNSQFLKCDECDCAVHLSCM
                     NPPLTRKPNKGVIWLCYLCLSRQEGSSEALHEVEREEKTMRSLILEEKRRLNHLANSR
                     VQEKLPIKRESAWYQYVGQHMICSMEDLLDTDLLLPYPFKTSRIGPKYQWSGCNDQEN
                     WHEMPYQNQQSDNRGTSTSAELNWKLDESKISAEELEAYVSHCKQEFAPRLEMIPESC
                     NFLDMILKILMLCDYDESSALNICETDLTRINLKEPTFTPEEIHQFEEGVAKYGSELN
                     HVSDCVPTQSLSMVVRYYYQWKKTPSGREIWGNFKGRSKNKLSKMPKDIRESTHRKSL
                     RERKLTKLAKESSACNFQRQSRFIDESCFDIENMPILKNYFRCLFCLIDFSPMWYKVT
                     DGFDEDDIEAQQNLAQRPPGRAINGRPKNNLEKVDALCIRCARLWRRYGVRWEPPLEV
                     LKRLNNNNNSSFLNSLAAILDETNMNILKTEPQQAGDKLVEWELVQDAELLARQRLAL
                     THEPGSFSKYKRHSASNRSRLYKMVKRPYDSESYRTENMIKELENMLAEHAGNPYR"
     gene            complement(<977750..>978448)
                     /locus_tag="HG536_0E05490"
                     /db_xref="GeneID:59326834"
     mRNA            complement(<977750..>978448)
                     /locus_tag="HG536_0E05490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284416.1"
                     /db_xref="GeneID:59326834"
     CDS             complement(977750..978448)
                     /locus_tag="HG536_0E05490"
                     /inference="similar to AA sequence:RefSeq:NP_015111.1"
                     /note="ancestral locus Anc_6.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140312.1"
                     /db_xref="GeneID:59326834"
                     /translation="MRFTPSVLLDAPEYYVDHLNGKHDVDKCTILRNLQLETDTESMP
                     SSLKRLSKPTHILDLTNNELVAIPDLRDRSDIHTVLLSRNQITATNGRLLPGRIRNLV
                     VANNNISTLEQLNGLKNAPGSLETLVLRGNQVCHLQGYREHVLRAVPNLTVLDFERVT
                     QEERVRSRETQEIDIASEAVATGVKRDKSLEIADLVVSKMSEERKNELKAQLASATSL
                     AEIARIEKLLAGGV"
     gene            <978763..>980382
                     /locus_tag="HG536_0E05500"
                     /db_xref="GeneID:59326835"
     mRNA            <978763..>980382
                     /locus_tag="HG536_0E05500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284417.1"
                     /db_xref="GeneID:59326835"
     CDS             978763..980382
                     /locus_tag="HG536_0E05500"
                     /inference="similar to AA sequence:RefSeq:NP_015110.1"
                     /note="ancestral locus Anc_6.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140313.1"
                     /db_xref="GeneID:59326835"
                     /translation="MVFNKENVDYSLYLVTDSSMLPDGTTLYSQVKAGLENGVTLVQL
                     REKDIETKDFIREAVEVQKLCQSFNVPLIINDRIDVALAIGADGVHVGQDDMPIPMVR
                     KLVGPDMIIGWSVGFRHEVETLAEWGPDMVDYIGVGTIFPTLTKKNPKKAPMGPQGAI
                     EVLNALEDNKAHWCRTVAIGGLHPVNIERVLYQCVSSNGQRALDGISVVSDIMAAPDA
                     AAATKNLRHLLDNPSYKFVNLGLKSETVSSETYREVVGQVTRNRPLVQHMTNKVHQNF
                     GANVTLAVGSSPIMSEVKEEVHELARIPHAALLLNTGSVAPLDVLREAITAYNKEKRP
                     IVFDPVGYSATEARRLLNDTLLSHGQFTCIKGNTSEILSLAKLTTEKMKGVDAFTGQL
                     DKVMVAQATRVVAYTYKTVAVCTGEYDFVADGTFGGRYYLSCGLGISAKDIPCVAIHN
                     GSIPIMGDITASGCSLGSTIACCVGGVAPESNLFDAVVTAVVLYKTAGKLASTRCQGN
                     GSFNVQLLDALYQLFHENCPATWSTSLERLS"
     gene            complement(<980477..>981481)
                     /locus_tag="HG536_0E05510"
                     /db_xref="GeneID:59326836"
     mRNA            complement(<980477..>981481)
                     /locus_tag="HG536_0E05510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284418.1"
                     /db_xref="GeneID:59326836"
     CDS             complement(980477..981481)
                     /locus_tag="HG536_0E05510"
                     /inference="similar to AA sequence:RefSeq:NP_015109.1"
                     /note="ancestral locus Anc_6.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140314.1"
                     /db_xref="GeneID:59326836"
                     /translation="MMSSRLVKSQLSRSFEICHLQNRARLFWSASPLYKADKATELES
                     PEAVAKQSHMRSEPLDFSNNASVKAPKTKIVAESKYESRNYELPKWKEALGELFIKTF
                     RLDMDKVRAGPVAGFYYYTLCKEQALQYEGEKLSDTAKFFYEDLKLPRTFSQWFQITL
                     LHEWILFVRMRAMPFKYGRNYQQKLVDRTFADIEMRLFEEMNVNSGRIADQYLKDFNT
                     QMRGAVFAYDEGFYTDDATLAAAVWRNLFSGRKNIDMVHLEAVVRYIRSQLYVLSRLS
                     DRDFAMGNFKFVPPNESVTVLTPEQEAELKRKVAEKYEAMDKDSNTLPSNRSKLSYTN
                     "
     gene            complement(<981689..>985066)
                     /locus_tag="HG536_0E05520"
                     /db_xref="GeneID:59326837"
     mRNA            complement(<981689..>985066)
                     /locus_tag="HG536_0E05520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284419.1"
                     /db_xref="GeneID:59326837"
     CDS             complement(981689..985066)
                     /locus_tag="HG536_0E05520"
                     /inference="similar to AA sequence:RefSeq:NP_011382.1"
                     /note="ancestral locus Anc_6.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140315.1"
                     /db_xref="GeneID:59326837"
                     /translation="MVLYKRKPVTLPDPEVLPADLNIEVWHIDETGEWFASYEKYLER
                     LDFYSRHHFTCEITGTSCLTFFEALDSEETQFRLVEEKFPLKLREPVARFLHFNGIKR
                     LDALVETTYVRFKNDFFPGEVVYLRKGNKEVSAPSSNHSTPQPDESFFKGHKETATEA
                     PQPQYQRPYIIKEKAQFNATTDSVTGEIIVPAYSKYMLTEGSHGNKSLIADQSQIYRD
                     RSTFTKHLIKCFCKITLRRASSKMGAPWAVKDEYLPMYGLTMDWPPEMLKYKEDEIPN
                     EKGRKQRSIEDTDENEHESGTADRENTDDLDIEELGSVSSKRRKVGEDIRENHAMADA
                     SATGSITSILEDLCLPYQGPPKLFPSVFQYNQYLELIQLENNIPFRPFQSMGKLLQVF
                     QFLSSFGPTLLLSHFTLDQFLTTLKCTDPQELKGEAVHVELDADGEKSEKKKQQSDWE
                     RSWPIRATIRNMSTPIIHYTIVKDEPASEGVIDDVNNNGSGLLIEIFCALLRMFVDES
                     GDWSFSLPEDWLQEDIQKTNQMPSENESQELSSSTDDQANSLELALEKCLDYRNVNWA
                     ERLSKRQFNNGHWLVILLGILTECVHIPLYKELIDDFNQKVIPENISSTQLPKQLWRN
                     FCSNLSFKEKVDVIWILVDVLTNYSPDIKTAVDSSLELCGLIRSERFRVGKDLKSEAL
                     VLNQLRVNLQTAEDANQEEVILEQLRNTVAQQESRLADLQNDKMFLDQKVMEHDIQRL
                     RPLGLDRYCNRYYWLDLSGVPSGDPSASINGEDTRNIRYHSGRLWIQGPTREAVKFHL
                     RISDDELDKWLNLAKEAGKERATEEVFHISMKDDGSYIYSEKGSETQLVDKDGLANTL
                     IDLMPIQKKVIDETPKCLLLSDTEWYSVDRVEDLRRLGDWLDTWGRREHDLLRQLGTL
                     EKEVQEAYKVREEQISFYQYDEVESKLFREFEESKLSESELKYLSERNESAQENNELD
                     EESALKDEEELETIADEIMKLDDCSQTRQIADKVKELEERRDLLLERRQLTENEPGPG
                     SRVQARTERKRLNNVLDLKLARQARILTDLLNHRHFNAIENVVQWKNDLAIRYYGTSL
                     RKNAAGSTKEPIADSVDEKLKQIISQTSRTTTAAVAN"
     gene            <985862..>989308
                     /locus_tag="HG536_0E05530"
                     /db_xref="GeneID:59326838"
     mRNA            <985862..>989308
                     /locus_tag="HG536_0E05530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284420.1"
                     /db_xref="GeneID:59326838"
     CDS             985862..989308
                     /locus_tag="HG536_0E05530"
                     /inference="similar to AA sequence:RefSeq:NP_015107.1"
                     /note="ancestral locus Anc_6.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140316.1"
                     /db_xref="GeneID:59326838"
                     /translation="MEQSNKEHRKRKEKNTAKKKLHTQGHNAKAFAVAAPGKMARTMM
                     RSSDVNERKLHVPMVDRTPEDDPPPVIVAVVGPPGTGKTILIRSLVRRMTKTTLNEIN
                     GPITVVSGKRRRLTFIECPSNDLNAMIDVAKIADLVLLLIDGNFGFEMETMEFLNIAQ
                     HHGMPRVLGVATHLDLFKSQSTLRASKKRLKHRFWTEVYQGAKLFYLSGVLNGRYPDR
                     EILNLSRFISVMKFRPLKWRNEHPYMLVDRMTDLTHPEILETQGTKVDRKVALYGYLH
                     GTPLPSAAGTKVHLAGVGDFGVAQVERLPDPCPTPYFQQKLDEYEREKMKQEGGAAAA
                     TTTRRRKRLDDKDKLIYAPMSDVGGVLMDKDAVYIDVGKKNEDLSFVPGQEKGEGERL
                     VTGLQTAEKSYAEIFDGVGLQLFSNSATIQGDESDEESEQEDVDENQDQGRTSLRQPR
                     NPQRATGREDDHTVNDTANVDGEEDDENAMSEGDSDFEAGDGEALGWESSVAEKLNGD
                     VNRRKKWDIGKLIYMDNISPNDCLKRWRGEEDDDASDMDAEDAEKEDVDEFFQKKDTK
                     NTAQDYEGDLEKFVPYFDTIEKLVQKWSSIDAIKDRFIGTPDFGGAQGEPNPDNSDEE
                     LYGDFEDLEENGGSAENVDGDTGEAPDIDDGSDTESSDSFTNFDEEEKKELTVGEERE
                     LNASKKEKLRLQFEMEEGDNFNEDDPENEYDTWYELQKAKIAKQLDINNAEFENMTPE
                     QRQAIEGYKAGSYVRLVFENVPMEFVENFDSKIPIIIGGLLPTELKFGIINARLRRHR
                     WHKKILKTNDPLVLSLGWRRFQTLPVYTTSDSRTRTRMLKYTPEHTYCNANFYGPLCS
                     PNTPFCGVQIVANSDTGAGFRIAATGVVEEIDASVEIVKKLKLVGFPYKIFKNTAFIK
                     DMFSSAMEVARFEGAQIKTVSGIRGEIKRALSKPEGHFRATFEDKILMSDIVILRSWY
                     PVQVKRFYNPVTSLLLKDKTEWKGMRLTGQIRADQGLETPSNPDSAYKKVERVDRHFN
                     GLKVPKSIQKDLPFKSQIHQMKPQKKKTYMAKRAVVLGGEEKKARTFIQNVLTISKDK
                     EQRRKAKKQDQRKERLKKLAKAEEERTQKDKEKKKQFFAANGKKRANGDDESRASSKR
                     RK"
     gene            complement(<989413..>989862)
                     /locus_tag="HG536_0E05540"
                     /db_xref="GeneID:59326839"
     mRNA            complement(<989413..>989862)
                     /locus_tag="HG536_0E05540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284421.1"
                     /db_xref="GeneID:59326839"
     CDS             complement(989413..989862)
                     /locus_tag="HG536_0E05540"
                     /inference="similar to AA sequence:RefSeq:NP_015106.1"
                     /note="ancestral locus Anc_6.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140317.1"
                     /db_xref="GeneID:59326839"
                     /translation="MLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHVQARRLWK
                     DYFPEVNGIVFLVDAADPERFNEARVELDALFNIAELKNVPFVVLGNKIDSANAVSEA
                     ELRSALGLMSTTGNSRIEGQRPVEVFMCSVVMRDGYAEAFQWLSQYI"
     gene            complement(<990331..>991722)
                     /locus_tag="HG536_0E05550"
                     /db_xref="GeneID:59326840"
     mRNA            complement(<990331..>991722)
                     /locus_tag="HG536_0E05550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284422.1"
                     /db_xref="GeneID:59326840"
     CDS             complement(990331..991722)
                     /locus_tag="HG536_0E05550"
                     /inference="similar to AA sequence:RefSeq:NP_011381.1"
                     /note="ancestral locus Anc_6.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140318.1"
                     /db_xref="GeneID:59326840"
                     /translation="MEVGLKKRLYADGLAREVPGAGDAADQMVLGDLADDDTFEIPLK
                     TRYSRNSNFPELDEDFSCIRDSTNGNVEKKVRFDAGDEPAVRRSNETSESRSDSARGK
                     KNVEDLLQYANQLNDYLAQNLDKINTFRSALLSDEQLYMPLSNAATQATTLSASMSNF
                     ELSDNEGEDHDLLSPATTAPEISGTDYGVLSKSSDSLLNTVPRNVSSADSSDSGSKHS
                     TDHTLENSPQVDNTDVLNSPELDQHLQDLALRQLFKSREPALEKDSGIFSPQEHSLIL
                     TDENTAVHEIPDLTEEEGITILLDTIDHILKLSESKAQDAPEQDTGSSEYTIFTMKST
                     PTVTCSQLIARMQSKCMFGSIVYLAATFLIQTCFLTRDEQGQLVLRRPLTQRQTHRLV
                     IATVRVATKLLEDFVHSHQYFCKVCGVSKKLLTRLEVALIICLKNDGLMITSEKLAAT
                     RPINAELKSNEPN"
     gene            complement(<991901..>992554)
                     /locus_tag="HG536_0E05560"
                     /db_xref="GeneID:59326841"
     mRNA            complement(<991901..>992554)
                     /locus_tag="HG536_0E05560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284423.1"
                     /db_xref="GeneID:59326841"
     CDS             complement(991901..992554)
                     /locus_tag="HG536_0E05560"
                     /inference="similar to AA sequence:RefSeq:NP_011380.3"
                     /note="ancestral locus Anc_6.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140319.1"
                     /db_xref="GeneID:59326841"
                     /translation="MSKLSSSQIRENVKELLKYSNETKKRNFLETVELQVGLKNYDPQ
                     RDKRFSGALKLPVCPRPNLSICIFGDAFDVDRAKSCGVDAMSVEDLKKLNKNKKLIKK
                     LAKKYSAFVASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLK
                     KVLCLAVAVGNVEMEEDVLVNQILMSVNFLVSLLKKNWQNVGSLVIKSTMGPAYRLY"
     gene            <993014..>993934
                     /locus_tag="HG536_0E05570"
                     /db_xref="GeneID:59326842"
     mRNA            <993014..>993934
                     /locus_tag="HG536_0E05570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284424.1"
                     /db_xref="GeneID:59326842"
     CDS             993014..993934
                     /locus_tag="HG536_0E05570"
                     /inference="similar to AA sequence:RefSeq:NP_011379.1"
                     /note="ancestral locus Anc_6.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140320.1"
                     /db_xref="GeneID:59326842"
                     /translation="MSMPWQVLGGRVVARKLFVRFNSGSRSRWLSRQQNDYYTREAKV
                     QNLRSRAAFKLMEIDDKFKIFCRNTPQRVLDLGFAPGAWSQVASRRIGDGGMVLGVDI
                     LPCNPPPGVSSIQANILSRKTQELIRLYLSKHFRLNKHDDIHEDHGYLQHMTEELSRE
                     SDCETYREVFSPDVVPDKVGKYPIDVIISDMYEPWPQDSGFWTNITNAAYYRMANTSG
                     LAIRDHYQSIDLCDAALVTAIDLLRPRGHFVCKLYTGKEDKLFEKRLKKVFRRVNRFK
                     PVACRDESKEVYFVAREKRDGVDKLLVFTD"
     gene            complement(<994023..>996769)
                     /locus_tag="HG536_0E05580"
                     /db_xref="GeneID:59326843"
     mRNA            complement(join(<994023..996647,996752..>996769))
                     /locus_tag="HG536_0E05580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284425.1"
                     /db_xref="GeneID:59326843"
     CDS             complement(join(994023..996647,996752..996769))
                     /locus_tag="HG536_0E05580"
                     /inference="similar to AA sequence:RefSeq:NP_011378.1"
                     /note="ancestral locus Anc_6.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140321.1"
                     /db_xref="GeneID:59326843"
                     /translation="MKLDVKKSFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYET
                     QTEVRSITVTETPVRAGRFVARKNWIVVGSDDFRIRVYNYNTGEKVVDFEAHPDYIRS
                     IAVHPTKPYILSGSDDLTVKLWNWERNWALEQSFEGHEHFVMCVAFNPKDPNTFASGC
                     LDSTVKVWSLGQSQPNFTLTTGQEKGVNFVDYYPLPDKPYLITSSDDLTVKIWDYQTK
                     SCVATLTGHMSNVSFAIFHPTLPVIISGSEDGTLKIWNSSTYKLEKTLNLGLERSWCI
                     ATHPAGKKNYVASGFDNGFTVLAIGNDVPILSLDPVGKLVWSGGKNAAASDIFTAIIR
                     GNEEVEENEPLSLPTKELGSVDVFPQLLTHSPNGRFVTVVGDGEYVIYTALAWRNKSF
                     GKCHDFVWGPDSNSYAIVNENGQVKYFKNFKEVTSWSIPLTYGVDKLFSGALLGAKSD
                     GFVYFFDWESGSLVRRIDLNAREVVWSDNGELVMIINTEEERGDEASAYTLAFDRSLY
                     EEAVSQGNVDDEDGAEDAFEVLHELDEPIASGKWVGDVFIFTTTTNRLNYFVGGKTYN
                     LTHFSKEMYLLGYLARDNKVYLADRDTHIYGYVISLEVLEFQTLTLRGELQEAMESIL
                     PNIEDKETQLKISRFLEGQEYYEEALEVSPDKDQQFDLALKVGRLSLAHDILTDEDSD
                     LKWRALGDASLEKFDFKSAIEAYTKAHDLESLLLLYSSFNNRDGLLTLGEEAEKQGKY
                     NLAFKALWLAGDVNGAKDLLIKNERFSEAAILGLTYGLKTDDVNNTVKKWKDSLIAEG
                     KEKTADRILTVETSSVTEAPLIDLNSTSKNQDDIEESKQSGGEKDPLEERENTAEPAE
                     PVEPAEVSEPSKEESTEESHEATA"
     gene            <997041..>998354
                     /locus_tag="HG536_0E05590"
                     /db_xref="GeneID:59326844"
     mRNA            <997041..>998354
                     /locus_tag="HG536_0E05590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284426.1"
                     /db_xref="GeneID:59326844"
     CDS             997041..998354
                     /locus_tag="HG536_0E05590"
                     /inference="similar to AA sequence:RefSeq:NP_011377.1"
                     /note="ancestral locus Anc_6.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140322.1"
                     /db_xref="GeneID:59326844"
                     /translation="MYFSILKGIYVAISLFGSLASSASVANRNISKAFTLQDKICSMK
                     FDPKDGSYWRFFEQVTGFILPPYLDNYDKTPYTGFKFLRTYSFQPTSLNSETNLLMAF
                     CSDGKVQWDLSVPVKQDIDWKKPLCVHIATETVETPQKKHFWAKILDIGKPPGIRKKS
                     KKETAIADLDNFHCFKLARRKKYFNRNISLFFPGSWVGGIYFCDLTDESKRDLIRSMD
                     DNLLLKEAGDFDFCTKTNAIPLMPLESDNYSKSWREYKSSKLLSFLGRIQEFRVTKYV
                     PFLNTPNYPMQGLNVKTDKAPYPAMTTFTGKVLREQVMDIFHRSNSVTKAQDPWFTDI
                     EVQENYCFSTQEERRLNKLLDQTRKTLDSISMSALNSARNFLSSSDCEQATDRTDRGA
                     RKLFNRLETKFWDHLPLYDKDLALMGSDDENLRQLDKKWKTLRLG"
     gene            complement(<998605..>1000992)
                     /locus_tag="HG536_0E05600"
                     /db_xref="GeneID:59326845"
     mRNA            complement(<998605..>1000992)
                     /locus_tag="HG536_0E05600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284427.1"
                     /db_xref="GeneID:59326845"
     CDS             complement(998605..1000992)
                     /locus_tag="HG536_0E05600"
                     /inference="similar to AA sequence:RefSeq:NP_011376.3"
                     /note="ancestral locus Anc_6.241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140323.1"
                     /db_xref="GeneID:59326845"
                     /translation="MQLLSLIFLIGPWLLTLVAAKRSLIATSLVTCMENSQLSASSFN
                     ITFNPDDRSLHYNLNMVTQIDGFVFAEIEVYAYGFKIITENLDLCSLNWKQFCPIHPG
                     NVEIDSIQYVSSSYTKRIPGIAYQVPDIDAYATVKIFNNQSEYLACVQAFFSNGKTVS
                     QVGVKWATAVIAGIGLLMSALLSIFGNSTAASHISANTMSLFLYFQSVVVVAMEHVHR
                     VPPIAAAWSENLAWSMGLIRVGFMQKIFRWYVQATGGNPSLYLTSTTISVLTQRSLDY
                     MRSFELFKRASDVLYGNSNVLIFRGIKRLAYQVHIENTSVVPTGFTFFVLCGWVLAGF
                     IIVCKNAMDLCIRLGWMKPTRFPEFRQNWRTVLKGALLRYIYIGFTQLMILSFWEFTE
                     RDSPAVIVIACLFIILCVGLMGWAAFRTTYFARKSIELHNNPAALLYGDSYVLSKYGF
                     FYTMFNAKHYWWNIVILSYIFLKSLFIGLAQASGKTQALAIFIFDLCYFVAVIYFQPY
                     LDRPTNILNICISTVTLVNSFLFMFFSDLFNQSYSVSAVMGWVFFIMNAAFSLILLLM
                     ILAFIAMIIFSKNPDVRFKPAKDDRTSFQRHDLKDGTVISKSVANELLALGNVAKDHK
                     ENWESELRYNNAMDYDNMAQKSDVEDEKLGPVSSNNESSSTAKPTFSEKIMRKLSFKK
                     PINKQNGEGIEAASAEITRLTPESDSISSISPAKRYPGVGHARQKSESRNGLMNSYEE
                     EEDFQISQPNILEKQHDGDSSTELHGIPNRDFSLDSMGNQHPATETTDILNSKFQ"
     gene            complement(<1001443..>1004460)
                     /locus_tag="HG536_0E05610"
                     /db_xref="GeneID:59326846"
     mRNA            complement(<1001443..>1004460)
                     /locus_tag="HG536_0E05610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284428.1"
                     /db_xref="GeneID:59326846"
     CDS             complement(1001443..1004460)
                     /locus_tag="HG536_0E05610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140324.1"
                     /db_xref="GeneID:59326846"
                     /translation="MLFNRSTGTTIFTDFPCLTLQGTPSVVPLPGLIYKIALERAVGD
                     RILGYYKSSDRYQPHFLLTETTDYDKESANISPDSIKSLEKFGQRFSHDDATNPLYLC
                     LIPAQSENISVGCVCKIVGVLTEERMVTVSFKALARSTIKTPLLNSGNSIWTSDILVC
                     DDTALASNMRDEQKQQAVTDFFGLFQQLDDAIVSFKRKYKKSCRRGSSQHLLLLSPLS
                     NTLFFQLDKSQFTKAWATISALINELKSQSNEQSPSSTMSQMSSLMDLTVAVLPTTPK
                     QKVEFLKNQLMLDRVQLFRRMVEQFRQIFETLYSSTEYVQRYFSEASNLEKSRLIANQ
                     LKSLRFFIEDVKAQNRLLPVSNQVKKHQTQRSVLRSSSRSREEDNENDNNEDAGENDE
                     DDEDEIEKLESFIKNLKKYGVHEDGIRTLRKDFKRFRRTNPQSAEYQVLRSYFDVICD
                     IPFGRYSQCQNLDLEKARRKLDEDHYGLPLVKKRLVEYLCVRDLNTNAKSDGGLETQG
                     KAPILLLVGPPGVGKTSIAKSIAEMLKLKFQRVSLGGVHNEAEIRGHRRTYVGSMCGL
                     IINALRKSGSMNPLILLDEIDKVLSTTGSGSGYGNKINGDPGAALLEVLDPEQNCTFM
                     DHYIGFPVDLSQVLFFCTANDLEGISRPLLDRMEVIEIPGYTPEEKVHIGTKFLLPKQ
                     IRLNGLSAHNKTFSLTSEAWDSLIQEYTRESGVRSLERRLASIVRGKILEYVEEGGNE
                     SPNETVSRRELFKYLGFPLHPLATELLSDIRMANKEGVVNGLSYNSDGTGSVLVFEVI
                     RTGTVEHSKGPVIKATGNLGSVLQESIDIGRSLVKSMLHRRLIIGANLDAVKSFLASE
                     YHLHVPMGAVSKDGPSAGTAITLALISLALGKAVDPLLCMTGEITLRGKILPVGGVKE
                     KLLGAQTYGMKRVLIPIANRPDVVQAVTNDILAFVDDDGLHLELEMIKTKLGLSVTYV
                     NDMFDVIQYVWPDLLLNAHFPATGNGNPCISKM"
     gene            <1006469..>1011184
                     /locus_tag="HG536_0E05620"
                     /db_xref="GeneID:59326847"
     mRNA            <1006469..>1011184
                     /locus_tag="HG536_0E05620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284429.1"
                     /db_xref="GeneID:59326847"
     CDS             1006469..1011184
                     /locus_tag="HG536_0E05620"
                     /inference="similar to AA sequence:RefSeq:NP_013413.1"
                     /note="ancestral locus Anc_4.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140325.1"
                     /db_xref="GeneID:59326847"
                     /translation="MISGAESKCGDSAYSETTYPLCNVSPIAIVTAIYDYSGRKKNHL
                     SFQQGDTIYVLEKHESGWWDGLVIEANGKVNRGWFPQNYCRAAHAVSYNHLASKMKRR
                     ASQMKPSYSTQTSRRGSLQHQPAFAQLSPQQRKSSVSASSPPRNSFSAQLHNQGHMAA
                     PQHRRSNSHSHSPTESSFGSISASPMGAGSQTLSNLGGNPTNLGDLSHQQRKSLSEAK
                     SLSSSGPPSSSGSRMGSRSMSATRTAKSKHLQQHGLHQQINEHTGEKLTILSSEEIEM
                     IFNSMHTEVPPVWSPVPTANSEKVLYYNKHFDIYCSQMPLVSSAFLETSSSLTLNDQQ
                     VDLSPRDLQNASKHKDKTFKLMSYSNRSTNTPSKRSSLSSASCNYPSPSTHTERRNSS
                     TSTTHSNFYRAVSESSSVQQPHSRGVPQKHHSAPVVGVSSTSASKRKHPPPSLQPCQH
                     KHTKTQAILAKPDLFYHHTMDIKLWPELRDSTLYYAKRAHEMLIKNNQLEFEALFQLS
                     STYCTYTQIACRLSYPHIKESCRVKEVKRLLKRIIASLVKIGINSSIYFTSSHRSLHI
                     WNTTPRASEVSETSIENNDDSDFGAITRSGTVGAATLTSEDIAKSQNLEHSGSMAQNE
                     RSFSSDYGFVRNKSATTTRTSVPSEKHNIDGFAPDSMMTSLYENLDNEFTQFIKTIQL
                     LYHVLQTSVTAGDYIPQLFPRFFRGSFNGGSWNNPFSQFDPVNDGINDTEDSSNNGSS
                     IGGLPPKIAEAIAAASGCHAASYIDLHSQVVSPHDAFHSNQKAILCQGFNRPSHHRTF
                     SRSRASRKIQYPLSENTVNMMKKRYFSICEKISSFELNEESYQDPELTKSKKRQLEVT
                     SQTYEEVSSCILLEVLENLDLGIFVNLRTLIASNKHLDAESEEFLRHALSSISTLLTE
                     FFDTKQAFHDTVIKLIMCAQQLTLYDPYVFCSMRPNTPVGYNEPGMSPSQSHFNKIDK
                     AVSELYKLLVAQDVEFNNMQYLRTFDEFSDVCLKYTEIASLSCTITEQLVEERENLLN
                     YAARTMRNDLTTKLLKGESEKWFGDYDVFEPEDNEPFHSSDDEYHSDYNTKSENLDKD
                     TPWFLGSEFEKTLIYDQRGRVKGGTKKALIEHLTSHEIIDAWFNVTMLLTFRSMFTTR
                     EFLYSLVHRYNLYPPEGLSYDEYNLWVEKKLNPIKCRVVSILKSFFSQYWTPAYFEPG
                     ISATLNFAHIAVSENIPGAQELFQDIKDNLASHGKGAPSQTDIGTFGDPVASDDSSDS
                     HRPVLSARSSSSSFLKLRRYKLLDIDPKTYAAQLTIMEHALYLRITVFECLDRAWGMK
                     YCDMGGSSNIANFIASANNLTNYVSHAIVLQTEVKIRALLIQYFVSVAEHCRELNNFS
                     SMTAIVSALCSSPIYRLKKTWPLVSRECTNVLKELNKLMDSAKNFIHYRELLRSVKDV
                     ACVPFFGVYLSDLTFTFGGNPDYLHNSNEIINFSKRGRIVDIVEEIMSFKKIHYKLKR
                     YDDIQTIIEGSLENVPHIEKQYELSLLIEPRSDAQNRPTANDPLKGFKSSAAPDDRNS
                     RLLKFGKKQSSRLFAKPND"
     gene            <1011500..>1014133
                     /locus_tag="HG536_0E05630"
                     /db_xref="GeneID:59326848"
     mRNA            <1011500..>1014133
                     /locus_tag="HG536_0E05630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284430.1"
                     /db_xref="GeneID:59326848"
     CDS             1011500..1014133
                     /locus_tag="HG536_0E05630"
                     /inference="similar to AA sequence:RefSeq:NP_013412.1"
                     /note="ancestral locus Anc_4.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140326.1"
                     /db_xref="GeneID:59326848"
                     /translation="MFKQLSQIGKNLSDEFAKGLSEDLNAGQEAVVDDKSGLPQEIQL
                     KLRKFEKYEEKYPRLLAAYKNDKLRLEKIGAAEKVLAENTPVSNIDDAESLEAFFKDM
                     NEKQKMLNDEIKRLLTSSKAEPGQAESLESAEVSGDGKKETSPETLNDGLAQEISELR
                     DKLAETEGELKESQEKYEEFRQQKEHEVSELQGKIIDAQEKLETSERSFEQETLKLKK
                     SLSETEDLVKTRDVSLEELRKQLEAEEQEVQKLNNLLTERSAVASADSSRSAGKNKRK
                     AKRKKNSSAGFTVANGGEDEHKRLSDEVEKLKGAETRAEELESQCTSLQSQITSLKQI
                     EVDLKVELDKLNDGNEKLREELKKKETELEDVRDMLRDVGNELVDAKDQLKSTANSEN
                     EKIQSLITEKETLNNQFEAKKQELISTISKLNEQISAASAKLASQQNQTKTVEKKYSK
                     LNESYSKLKTDNATLLDQVNEANKTQKTLRISLLQKEKTISYLEQQVKEYNETSSASK
                     KANEDLKKENEHLSKRLDTLKAENESLRCEMKNSSSLFENHIRENGKLSERLSIIQEK
                     YETLQSLKSNSNEQADSIKRQCEELNSKLREANKRIMSLEEEVSDYTNIIQEKTRETN
                     AMRRLLNENNHHESTKEGEYQEKLAAVIDEKSRLESELSVQASRRVRESQNWKQANNE
                     LKLEIQSLKLREKELTAEVLSLTALTDKMQRKNSTFADDSDDMERVTANLKEALSKAD
                     GKIRDLQEANENLMQTNDDINKKLDRLSKNYRTLMSQVTVLKEEKNESSTRSSRSSSV
                     ASVSGTQTPQPDMRRSHSFVKETPAIESQNEVNEKIAYIKNVLLGFLEHRDQRNQLLP
                     VVSMLLHLDSKDEKRLLMSIK"
     gene            complement(<1014191..>1015156)
                     /locus_tag="HG536_0E05640"
                     /db_xref="GeneID:59326849"
     mRNA            complement(<1014191..>1015156)
                     /locus_tag="HG536_0E05640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284431.1"
                     /db_xref="GeneID:59326849"
     CDS             complement(1014191..1015156)
                     /locus_tag="HG536_0E05640"
                     /inference="similar to AA sequence:RefSeq:NP_013411.1"
                     /note="ancestral locus Anc_4.47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140327.1"
                     /db_xref="GeneID:59326849"
                     /translation="MRLGFLLLVAVQALGSLGLPLVYSNASNISNVSSASNVSRVEQS
                     VIVGTSNGFFWPQPETPFPSWLTDFTGLTEWPGIDPPYIALDFIDVDRLPKYEPYSLD
                     QCERVPRDACSFDCHSCLEPDDIYTCPKLSQTFDDGPSGETEALLGKLTHKTTFFTVG
                     VNVVRHPNVYRRMVEEGHLIGTHTWSHPYLPTLSNEQIIAQLEWSIWAMNATGHHYPK
                     YFRPPYGAIDNRVRAIARLFGLQAVLWDRDTFDWQLSVPSLRTTEDIVRDVQEWKTRN
                     GGLILEHDASANTVEAATRVSELLGNDQLTVAECVGGIDYIKKYY"
     gene            <1015567..>1015923
                     /locus_tag="HG536_0E05650"
                     /db_xref="GeneID:59326850"
     mRNA            <1015567..>1015923
                     /locus_tag="HG536_0E05650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284432.1"
                     /db_xref="GeneID:59326850"
     CDS             1015567..1015923
                     /locus_tag="HG536_0E05650"
                     /inference="similar to AA sequence:RefSeq:NP_878131.1"
                     /note="ancestral locus Anc_4.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140328.1"
                     /db_xref="GeneID:59326850"
                     /translation="MPLAVQTILISCLQSSVLSIKDIQQKNYHKMTFRTTTAHALKAA
                     CRTFTPRSGLQTTTFPTVSSSSRYHTVQCFVNEHSKGLLDSYSQGGSGGRTTRPTVVI
                     SSDSDEIETVSGHVRV"
     gene            complement(<1015985..>1016473)
                     /locus_tag="HG536_0E05660"
                     /db_xref="GeneID:59326851"
     mRNA            complement(<1015985..>1016473)
                     /locus_tag="HG536_0E05660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284433.1"
                     /db_xref="GeneID:59326851"
     CDS             complement(1015985..1016473)
                     /locus_tag="HG536_0E05660"
                     /inference="similar to AA sequence:RefSeq:NP_013409.1"
                     /note="ancestral locus Anc_4.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140329.1"
                     /db_xref="GeneID:59326851"
                     /translation="MSAAGLRLQRDLEALDIPSMAQIEVVAAPLPLAKDLPLLRLTIA
                     PDEGYYSGGKFNFDIAFSAGYPIEPPRVRCLNRIFHPNIDYQGKICLNILREDWSPAL
                     ELQSVVIGIIFLFLEVSEKDPLNKDAAAMLSRDRVEFAHAVRRSMAGDTVHGQRYDNV
                     LR"
     gene            <1016819..>1022545
                     /locus_tag="HG536_0E05670"
                     /db_xref="GeneID:59326852"
     mRNA            <1016819..>1022545
                     /locus_tag="HG536_0E05670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284434.1"
                     /db_xref="GeneID:59326852"
     CDS             1016819..1022545
                     /locus_tag="HG536_0E05670"
                     /inference="similar to AA sequence:RefSeq:NP_013408.1"
                     /note="ancestral locus Anc_4.50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140330.1"
                     /db_xref="GeneID:59326852"
                     /translation="MRFGHREGVKERLRAKALGKLAQLCSKQEPAGIPEDDENKGDSL
                     ELLTHSLPVYYSTNTSKLYTIPITLNEWEVLVALCECTPGSSMQAERLIKGVIGPYFL
                     ASPRQRMSETLEARFKLKELRQPNELLTLELIRFLIVSCSKYPRLTKMCSVIIDQYLR
                     EVSSLFNKRCSAVFSLVGFLNAFIMDNSALQLTQTVWKKLAGLFGDGSFVLLPETRLL
                     ADFSGEVTVRYHEANKEISNSLFLNLMAQLQVSLASKIVALPKDATSLSEYLLQVHSK
                     NYMVQQEGSADRVDMAASEELYSTLTRNRPILTEMSHFAFKHSINIEDLDLSTDVRAA
                     YSFNTRAFFLDFLCLILFFDNAVSDLGQKFLQLVSDSIDKFLLSEIVSPKLVRSILCA
                     GALLNFFTEETSLTLLRLFPALVSSPQISNAEVARITKIFTFGLMPLNEDAVVSTVYS
                     INNLLTLGDDGIPVQAVRERQLTNSTVTSTALGDHELRGRAGTSDTIQAIHNISNRMA
                     LSSTENNGRVDEVTSATYHHQLFRNCITTMITIASHYGDQAITALTITVLTQKVSVIS
                     KELDAVIIDLLAELVSNISITELALLLKFYKPAYSQAKKQENKILQESICEARIKISE
                     IVLSKRSDSDLYRFTLANLLDSITACGEVEQSDLHRTDKEIARCAEDIGAYLRPLAAI
                     LPKPGSKPFPFDGDEALIRSFRNIWFNMIIHGFRCDSQLVEKHYSCLLTIAYNSPPLA
                     SDFPSSNKEVSLDMNAVLRRHSSNAIHKQQKQAIAGYLSTNPVQARTLSMPKIMFLAA
                     TALLETLRCEAGDCSKILRYYCDPSVVSSSIDKFIEALNLQLISKYTSIVQSKNSSLF
                     GSLAIAHQLNDLLLHLAHRNRELQNAAFQSCDIFIKTIPSSLCHHHSLYTLLDLMTTL
                     FDSVVDCETNKFQPHYEFVLKHSGTKVLIPDSALWRKTTLSRLHASSKDWVRIILDRA
                     NEDTKILLQSYISDLTHFDRSSTVEYGVSFAMEMAGSISLADEELSKLTYVGRERPST
                     IAAFISQHSWRSKNLVDTAIISSPQDIAQQIGLHVQNIRRALAAKEPVSFKDITTFLD
                     LSAASLLLGKFGAASLVYDLVHIPFSVFTSSAIKMASNIWLTVIKERPDIAHMLLVEV
                     GYCWMKSIDDRRGLYSRDHDLAREENQMMEYAPYNKTAINRDALAASQSLQPHRHVIK
                     FFKSHFEGTSFQSDHLLDVFTRWTLHGLNQLKEASMHPFARMARHDLLNFALSLLQVH
                     SKQKTDYVPVLAKAITNSGLSWFRRPIAWPFGSNQLKIKADLSGTVQFYSELNKLSAL
                     LIRQCGSTFKLLQFFLLSEIWHIETWLAPLQKIVKNGGAEPNAELLKTAFIIDPQLAL
                     NLFQRYPTTKLDVSLTSLVLEDPLMCVGVPEILDLYLLSNKTGSKATDMHFVVYWCPV
                     NPLKSINFFLPPWNDNTFILQYAVFSLESHDVNVTFFYVPQIVQCLRYDRTGYVTRLI
                     LDTANTSVLFAHQIIWNMLANSYKDDEGLEEDPIKPTLDGVRKAMISAFASDKFEFYE
                     REFGFFNEVTGISGKLKPFIKKSKAEKKHKIDEEMSAIQLEPDVYLPSNPDGVVVDID
                     RKSGKPLQSHAKAPFMATFKIKKTIRDSETGRKKEIQQWQAAIFKVGDDCRQDVLALQ
                     LISMFRTIWSNIGLDIYVFPNRVTATAPGCGVIDVLPNSISRDMLGREAVNGLYEYFV
                     TKFGREDTIEFQNARNNFVKSLAGYSVISYLLQFKDRHNGNIMYDDQGHCLHIDFGFI
                     FDIVPGGVKFEAVPFKLTKEMVKVMGGSQDTQAYRDFEELCVKAYLAARPHMAAIIEC
                     VKPMLDSSMPCFKGLKTIKNLQNRFQPLKTDHEAALFMKSLIRKSYESLFTKGYDEFQ
                     RLTNGIPY"
     gene            <1022795..>1025128
                     /locus_tag="HG536_0E05680"
                     /db_xref="GeneID:59326853"
     mRNA            <1022795..>1025128
                     /locus_tag="HG536_0E05680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284435.1"
                     /db_xref="GeneID:59326853"
     CDS             1022795..1025128
                     /locus_tag="HG536_0E05680"
                     /inference="similar to AA sequence:RefSeq:NP_013407.1"
                     /note="ancestral locus Anc_4.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140331.1"
                     /db_xref="GeneID:59326853"
                     /translation="MLSARAALKRPVSRGLATVANLTRDSKVNQNLLEDHSFINYKQN
                     LEYVDIVRKRLNRPLTYAEKILYGHLDNPHEQKIERGVSYLKLRPDRVACQDATAQMA
                     ILQFMSAGLPEVAKPVTVHCDHLIQAQIGGEKDLARAIDMNKEVYDFLASATAKYNMG
                     FWKPGSGIIHQIVLENYAYPGALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMSDLPW
                     ELKAPKILGVKLTGKMNGWTSPKDIILKLAGITTVKGGTGKIVEYFGDGVDTFSATGM
                     GTICNMGAEIGATTSVFPFNKSMIEYLDATKRSKVAEFASLYKNDLLSADADAEYDEI
                     VEIDLNTLEPYVNGPFTPDLATPISKLKDVAVQNKWPLEVKVGLIGSCTNSSYEDMSR
                     AASIVKDAAAHGLKAKSIFTVTPGSEQIRATIARDGQLDTFKEFGGVVLANACGPCIG
                     QWDRRDIKKGEKNTIVSSFNRNFTSRNDGNPETHSFVASPELTTAFAIAGDLRFNPLT
                     DKLKDKDGNEFLLKPPTGVGLPVKGYDPGENTYQAPAKDRQTVQVQVAPTSDRLQLLK
                     PFKPWDGKDALDMPILIKSLGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENK
                     KANCVKNIYTGEYKGVPDTARDYRDQGIKWVVIGDENFGEGSSREHAALEPRFLGGFA
                     IITKSFARIHETNLKKQGLLPLNFKNPADYDKINPDDKIDILGLKELAPGKPVTMRVH
                     PKDGKPWDTELTHTFNEEQIEWFKAGSALNKIKADKA"
     gene            complement(1025332..1025405)
                     /locus_tag="HG536_0Etrna7I"
                     /db_xref="GeneID:59326894"
     tRNA            complement(1025332..1025405)
                     /locus_tag="HG536_0Etrna7I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:59326894"
     gene            complement(<1026910..>1027680)
                     /locus_tag="HG536_0E05690"
                     /db_xref="GeneID:59326854"
     mRNA            complement(<1026910..>1027680)
                     /locus_tag="HG536_0E05690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284436.1"
                     /db_xref="GeneID:59326854"
     CDS             complement(1026910..1027680)
                     /locus_tag="HG536_0E05690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140332.1"
                     /db_xref="GeneID:59326854"
                     /translation="MTKVVLVTGASRGIGRAIVDDLLKRENDAAVYGVARSEELLKKI
                     KEKYGNRFYYVAGDITDDSVLEKLVNDAVERHGHIDSVIANAGVLEPVQDVSKLEVAS
                     WKKLFDVNFFSVVSLTSKVIPYLSKVHGNLIFVSSGASVKPYYAWGAYGSSKAALNHF
                     AMTIAAETSQVRSIAIAPGVVDTQMQVDITEVLGPNAMTPEALQRFIELRKNRELLPP
                     SVPAAVYGKLALEGIPAELSGQYLRYNDKRLHPPGNDS"
     gene            <1028150..>1032772
                     /locus_tag="HG536_0E05700"
                     /db_xref="GeneID:59326855"
     mRNA            <1028150..>1032772
                     /locus_tag="HG536_0E05700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284437.1"
                     /db_xref="GeneID:59326855"
     CDS             1028150..1032772
                     /locus_tag="HG536_0E05700"
                     /inference="similar to AA sequence:RefSeq:NP_013086.1"
                     /note="ancestral locus Anc_4.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140333.1"
                     /db_xref="GeneID:59326855"
                     /translation="MVLSGSGCPCGFAAYPDHSTNALNPCFLSLVVLVEGVFFMVFGS
                     IQLIQLVKESKVPESFKRRSLSQRQVVQLSNVSLFAVLIVCQLTAALNEQEAVPVLVW
                     SLWIHLCYVVLISLPTQYLQYFKSPCALGNQLFYYMIQATVLGFQVAQRAAHYPNEDY
                     NLIKGKYGAILEVGMLICSATIFVFDVYLFQPSDELETYYKKEGHHLQVNFLARATFT
                     WMNELIVDTYHRKKLKDPYDLPEPPVNIDIRDVCRKLQAAREAQKWKGSNSLFSALMK
                     TFGKSILIATLLETCKDLLSVVQPQLLRLFILSFDGNAASDYPPLNGFFVALGLFLVS
                     VISACLQNQFYITIFEVGLGMRGALIALLYKKSLRLSLASREKSSTGDILNMASVDVL
                     KIQRFFEDCQIIVGAPIQIVVVLLSLYWLLGPATIGGVVTMAIMIPINSFLSKRVKKL
                     YKTQMKYKDARIRTTTEIINSMKSIKLYAWEKPMLDRLDHVRNGLEMENFKKIGVVSN
                     LIFFAWNCVPLMVACSTFGMFSFANKRPLSPEIVFPALSLFNILNDAIYSLPNIINSV
                     IETRVSMNRLKEFLLSDELDDSFMEVEETPCDKTLPVVEIKNATFLWKSQAVLLNGDF
                     DDEESRVESSQVALKDVQDFHANKGELTCIVGRVGSGKSTMLRAILGQLPCISGSVEG
                     VSPKVYIRASSIAYCPQEPWIMNASIKDNILFGHRYDETYYNATIEACQLLPDLDILP
                     ERDATLVGERGISLSGGQKARLSLARAVYSRADLCLLDDILSAVDAEVSKNIVEKVLD
                     RENGLLKNKTVVLTTNAISVLDRSQMIYALEGGHIVEKASYKDVIASSKASTLKMMIE
                     EFGRNIEYSSGIAGENHSVEEIILKSDANADALANDVTSLTSLIAPDTVNDLSLSSRR
                     ASMATLDAPRLFATDGSAPMTVEKKEEGRVKTSVYMFYMKACGVLGVALFLSFMVSSR
                     IFDLLENFWLKYWAEENERRGSNEDVWRFVGIYAVIGVFSAAFNNLRTIVLLLYCTIR
                     AATKLHDEMARSVLRSPMSFFETTPAGRILNRFSSDIQAVDSNLQWMFAFFFRSILNY
                     LVTVVLISYNMPWFLAVNAVLLVVYLYYQTYYITLSRELKRLTSISVSPIMSLMGESL
                     GGHAVINAFKHFDRFDFLNFSNVQFNINCNFNLRSTNRWLSVRLQTIGAFIVLTTALL
                     SLGTLGSKQKLSPGMVGLLMSYALEVTSSLMWIVRMSVQIETNVVSVERIYEYCNLTP
                     EAPEVIESCRPVESWPAQGKISFKSYSTKYKTQKDPALRNINIDIKPQEKIGVVGRTG
                     AGKSTLSLALFRLLEATSGSIEIDDIDISTIGLADLRSHLGIIPQDAQAFEGSIRYNL
                     DPFQRYSTETLWKAIKLSHLEPHVIAMCHKENKNGHQATREEMLETKITENGGNLSVG
                     QRQLLCLSRALLNDSKVLVLDEATAAVDMETDKIIQETIRSEFKDKTILTIAHRIDTV
                     LDSDRIIVLDAGEVKEFDKPENLLSNKQSLFYALCEKGGHLGKKSP"
     gene            complement(<1032845..>1034179)
                     /locus_tag="HG536_0E05710"
                     /db_xref="GeneID:59326856"
     mRNA            complement(<1032845..>1034179)
                     /locus_tag="HG536_0E05710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284438.1"
                     /db_xref="GeneID:59326856"
     CDS             complement(1032845..1034179)
                     /locus_tag="HG536_0E05710"
                     /inference="similar to AA sequence:RefSeq:NP_013406.1"
                     /note="ancestral locus Anc_4.53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140334.1"
                     /db_xref="GeneID:59326856"
                     /translation="MPSHFDTIQLHAGQESADDNANRPRAVPIYATTSYVFNDSKHGA
                     QLFGLETPGYIYSRIMNPTVDVLEKRIAALEGGAAGLAVASGQAAQTLAIGGLAHTGD
                     NIVSTSYLYGGTYNQFKVAFKRLGIECRFVEGDRPEDFEKLFDERTKAVFLETIGNPK
                     YNVPDFDRIVEVAHKHGIPVVVDNTFGAGGFFAQPIKHGADIITHSATKWIGGHGTTI
                     GGLIVDSGKFPWKDYPEKFPQFSTPSDGYHGLVFNDAFGPLAFIGHVRTELLRDLGPA
                     LNPFAAFQLLQGVETLSLRAERHGENALKLANWLENSPYVSWVSYPGLASHSHHENAK
                     KYLTNGFGGVLSFGAKDLPNGAEAESEDPFKAAGARVVDSLKLASNLANVGDSKTLVI
                     APYFTTHLQLTEEEKLSSGVTKDLIRVSVGTEFIDDIINDFQQAFETVYGKK"
     gene            complement(1034522..1034620)
                     /locus_tag="HG536_0Etrna13L"
                     /db_xref="GeneID:59326887"
     tRNA            complement(join(1034522..1034566,1034582..1034620))
                     /locus_tag="HG536_0Etrna13L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /db_xref="GeneID:59326887"
     gene            complement(<1034773..>1035807)
                     /locus_tag="HG536_0E05720"
                     /db_xref="GeneID:59326857"
     mRNA            complement(<1034773..>1035807)
                     /locus_tag="HG536_0E05720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284439.1"
                     /db_xref="GeneID:59326857"
     CDS             complement(1034773..1035807)
                     /locus_tag="HG536_0E05720"
                     /inference="similar to AA sequence:RefSeq:NP_011679.3"
                     /note="ancestral locus Anc_4.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140335.1"
                     /db_xref="GeneID:59326857"
                     /translation="MSNEEMATVSKLDNEESKAMILLLGLRRGGKSSICKVLFHNMQP
                     LDTLYLESTSNPTMEHFSTLIDLAVMELPGQLNYFEPSYDSEKLFRSVGGLVYVIDSQ
                     DEYMNAITNLAMIIEYAYKVNPNINIEVLIHKVDGLSEDFKLDAQRDIMQRTGEELLE
                     LGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSYLENMLDNLIQHSKIEKAFLFD
                     INSKIYVSTDSSPVDIQLYEVCAEFVDVTIDLFDLYKDSHRSDKRASGGETTPYRPRE
                     LKNVAQLGNDVIIYLKQMIRGLALVAVIRPNGADAESCLTVADYNVDILKRGLEEIWA
                     NARIPAKDAV"
     gene            <1036565..>1037263
                     /locus_tag="HG536_0E05730"
                     /db_xref="GeneID:59326858"
     mRNA            <1036565..>1037263
                     /locus_tag="HG536_0E05730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284440.1"
                     /db_xref="GeneID:59326858"
     CDS             1036565..1037263
                     /locus_tag="HG536_0E05730"
                     /inference="similar to AA sequence:RefSeq:NP_011465.3"
                     /note="ancestral locus Anc_4.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140336.1"
                     /db_xref="GeneID:59326858"
                     /translation="MARQNPFDQKKASILAEIRSSQPDLSPKGDIDVLCYPIMDLINS
                     HSDMVTTSSCSGRLSIFLEGTKQHNGVQKSGGKGEGGRWLYVTHNCDEVTGWLDKIDP
                     ESYCYVQDDLLSAAKDSDSSKRLLLYKYEPFILHVKCRDFAMASKLYNTAMGCGFRES
                     GIGSNNLVAIRINIKLDIPIGFWDENANKIALCVPADYISLIDGLTCSKFQENARKMQ
                     VLYDRIKANIIDSV"
     gene            complement(<1037461..>1040487)
                     /locus_tag="HG536_0E05740"
                     /db_xref="GeneID:59326859"
     mRNA            complement(<1037461..>1040487)
                     /locus_tag="HG536_0E05740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284441.1"
                     /db_xref="GeneID:59326859"
     CDS             complement(1037461..1040487)
                     /locus_tag="HG536_0E05740"
                     /inference="similar to AA sequence:RefSeq:NP_011466.1"
                     /note="ancestral locus Anc_4.56"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140337.1"
                     /db_xref="GeneID:59326859"
                     /translation="MSDRVEPQGVGSSSQAEHVDQEPSGFSEGSQGQLKQSAGEEQYQ
                     QQQPYHYHTGGDYSQRGSRGGRQGQQRGGRYGANKYNYNGANVSQNQYNRYNSNGRNY
                     NGYKAHRGGMNAAAAAAMNLQWQGYYNPQMYYMAPQMAAVNNAPMEGSPSTSPVSSTS
                     STPTPTSRKIEITTKTGEHLDLNALHQAHQPAHRSQNTATNGNEAEKAAVNTAAPTEA
                     ASSASKDSADKEKTESGAKAPATPENAISEAEKTKREFLEQIKLRKAALEKKKHEQIE
                     ASKPKPAEPVLTPVQEEQKAAPEQPAKEIAKDEAGAQKTAGSEEASKKTATTFAEALK
                     LKKEAAKQSAEVEAAKPEPVGEPDVKKEEPSTEQLTETEAVDKEQVVNEEPAKTEAVK
                     DEAATSEGITTEGAAAEDTTMVEGEKAEDEVSEEKAEDEAIEEKAEDEAIEETAEDEA
                     TEEKTDESEDKLTVTQLLDRLNAAKPIEDIYAFTYPAGIEAPDARYKKSHIKYTYGPT
                     FLLQFKDRVKAVADDEWIQKAASKIVIPPGMGKGGRPRDPSLFGGAGRMNSGRDFGKS
                     SSFRNVDGRSNSRTSSKRKSKRVVDDRRSNRSYTSRRDRERERERGEEERRESEKPKE
                     EVAPLVPSANRWVPKSKQKKTEKKMAPDGVTELLDKEEAERRMKSLLNKLTLEMFDPI
                     SADILKVANQSKWEEKGETLNIVIEEVFHKACDEPHWSSMYAQLCGKLVKDLDPEIKD
                     ENNEGKTGPKLVLHYLVARCHTEFDKGWTDKLPTKEDGTPLEPEMMSDEYYKAAAAKR
                     RGLGLVRFIGFLYRLNLLTGKMMFECFRRLMKDLSNAPTDETLESVVELLNTVGEQFE
                     GDSFSTGQLALEGSALLDSLFAILQNIIENAPISSRMKFKLIDIRELRENKHWNSTKK
                     EDGPKTIQQIHEEEERRQSKNNSRNSSRRMNASLGSRNSFKREAPVISKDNFISTRSS
                     SQRHIQKPAQKEEPRQPQKTATNMFSALMDDNDDDD"
     gene            complement(<1040780..>1042000)
                     /locus_tag="HG536_0E05750"
                     /db_xref="GeneID:59326860"
     mRNA            complement(<1040780..>1042000)
                     /locus_tag="HG536_0E05750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284442.1"
                     /db_xref="GeneID:59326860"
     CDS             complement(1040780..1042000)
                     /locus_tag="HG536_0E05750"
                     /inference="similar to AA sequence:RefSeq:NP_011467.1"
                     /note="ancestral locus Anc_4.57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140338.1"
                     /db_xref="GeneID:59326860"
                     /translation="MTAATKSSSVLLNTHDSGIRPYFEQKIQETELKIRTKTEDLRRL
                     EAQRNALNDKVRFIKDELRLLQEPGSYVGEVVKVVSDKKVLVKVQPEGKYIVDISKDI
                     NVKDLKPSQRVCLKSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMLGGLNKQIKEI
                     KEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAEL
                     VQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRTMLEL
                     LNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTQILRIHSR
                     KMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDLELAVGKVMN
                     RNQETAISAAKLFK"
     gene            <1042161..>1042772
                     /locus_tag="HG536_0E05760"
                     /db_xref="GeneID:59326861"
     mRNA            <1042161..>1042772
                     /locus_tag="HG536_0E05760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284443.1"
                     /db_xref="GeneID:59326861"
     CDS             1042161..1042772
                     /locus_tag="HG536_0E05760"
                     /inference="similar to AA sequence:RefSeq:NP_011468.1"
                     /note="ancestral locus Anc_4.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140339.1"
                     /db_xref="GeneID:59326861"
                     /translation="MILAMAVKTVFVTCGATVPFPQLIHVVLGKALLERLSDAGFRRV
                     IVQYGKGYEAEFRKRLNALECVPAKCSLADSTLGITATGLCCGFYAPGALEVIGLEYS
                     TRVQDIVGLAGLVISHAGTGSILDSLRSGKPLIVCVNDKLMDNHQQQIADKFKQKGYV
                     WACKPCESEVSECLSRSQSETLIRFPQAYSARFENDLKRLAFS"
     gene            <1043312..>1046419
                     /locus_tag="HG536_0E05770"
                     /db_xref="GeneID:59326862"
     mRNA            <1043312..>1046419
                     /locus_tag="HG536_0E05770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284444.1"
                     /db_xref="GeneID:59326862"
     CDS             1043312..1046419
                     /locus_tag="HG536_0E05770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140340.1"
                     /db_xref="GeneID:59326862"
                     /translation="MQFLIYFLIFLSSVRCAVIPDISSNDDVVWESDKASDLSSQTIM
                     VGEPYVMNTKSVDIKSVNTESLSRVSALIAPSPSSAVVVMIETSADKTDSSVVLTSAK
                     STFTTMFANEQVETSGKITTLLTLSASTTTSILFSTSGAIQSSLLNGTTLTSIPTNSR
                     NPLVTQKPSQSAQSTVINPVTLSANKTLPATSETAVYSSMLPFSNVTSERTFYSTVYS
                     LAGSSLSNPSAASQNFNSSATASTTGKSSLVATSGSLPSGTTQITKPLLSTSQIIASS
                     ESSQTGTSEPTVTSPIITTSSASPSSSSSPSTAEIAQIVNLFDAISTETPPNVFPRAP
                     NPMSLADGVSNDGPVQTNKFYTNLIVGSQNSAAFVYPYSLRRHGSGQDIGIAVQHTTT
                     SQYSFGNYDSNGNSQFLINPLNIGELVLSSANFDSAAAVKVDNMKTSSATVKLVQGAS
                     SEDYLELPLVQGMGFATGVYHGSLIAKLGSEVGFKTLLQEKSQFLADGILKYRVELLN
                     GFSWLCYIVVPDNMSKDDFKLQAQNAYSVTANLAVDGLIMQVAIAPDDSNLEVFYDEA
                     AGMYAYELQLSGSSDGNVANYEFQYATEGESLSGNTMIFALPHHANALISSMENSYTG
                     IQVQSTTKGTMKGYLATRLLFSQKLNRQISWLPWSPLLGSADLKYSSEQLKLLAEVAN
                     KELQVSIASSISQLNTYYIGKVIDKYAYILLTVSQIIGDEVTTRSTLANLKTAFDTLL
                     KNKQLYPLIYDTKFSGLVSSGDWASTSTQYDFGNTYYNDHHFHYGYIIHAAAVVGYVD
                     KQLGGNWAEENKDWVNTLVRDVANPSEDDTYFAQSRMFDWYHGHSWAAGLFENGNGKN
                     QESSSEDYNFAYGMKLWGSVIEDSSMELRGDLMISIMAESMGEYYLYLDSNQVEPREI
                     IGNKVCGILFDNIIDYTTYFGTNVEYKHGIHMLPITPVSGQIRQVPFVQEEWQEKLAP
                     IISSINSGWTGILKLNQALFDPADSYEFFSDPSFNSDLLLDGGMSRTWSLAFSGGLAN
                     SMGLL"
     gene            <1048211..>1049956
                     /locus_tag="HG536_0E05780"
                     /db_xref="GeneID:59326863"
     mRNA            <1048211..>1049956
                     /locus_tag="HG536_0E05780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284445.1"
                     /db_xref="GeneID:59326863"
     CDS             1048211..1049956
                     /locus_tag="HG536_0E05780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140341.1"
                     /db_xref="GeneID:59326863"
                     /translation="MGDTSRALVKELFVDPWRRLKYGILPVRRIVDEELPSYENSIEN
                     DLTKVAEKIVECDVAEREEVELEIEYRDEAQRPWWKFFDEGEYRRNKAVASRNPWYSW
                     FNGSTSQEERKLILKLDILLAFYSCMAYWVKYLDTVNLNNAYVSGMKEELGMKGNDLV
                     QTQNMFSIGNIVFQLPFLFFLNKVPLNYLLPALDLAWSLLTVGEAYVKTLGGIKTLRF
                     FIGAFEAPTYLAYQYLFGCFYKHDEMIRRSAFYYFGQYIGTLSSGGIQSAVYTSLGGR
                     NGLAGWRWNFIIDAIISAIVGVIGFYALPGDPDNCYSIFLTDDEIRLARKRMRENKTD
                     KNDFQKKVFSLDVWKRLIFDWKVWVLSVWNIFCWCNSNAGTGCYILWLKSLKRYSIPK
                     VNQLSMISPGLGLVYLAVTAIIADKFHSRLSAILITQVFNITGNVILAVWHVPEGAKW
                     FAFMLQYMGWAMAPVLYGWMNDICRRDTDTRAVILVIMNIAGSVFSVWTSVVFYPTTM
                     APRYLRGYSFTAASALALSIWTFLVLWFFKKEERKHAKDNGIVLYNSATGISSLQDES
                     ELSIKGLQETEESKS"
     gene            <1050340..>1051200
                     /locus_tag="HG536_0E05790"
                     /db_xref="GeneID:59326864"
     mRNA            <1050340..>1051200
                     /locus_tag="HG536_0E05790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284446.1"
                     /db_xref="GeneID:59326864"
     CDS             1050340..1051200
                     /locus_tag="HG536_0E05790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140342.1"
                     /db_xref="GeneID:59326864"
                     /translation="MSLYLNKSFNANNYQSFRPTYPPSLYECIMQYHRLTRGTVVDIG
                     CGTGIATFPLLKYFEKVIGCDPSAKMIQNAEEQRQVLEDVQKHRIEFKIIPAEKISSV
                     IPDKSADMIVCAEAIQWVDHTIFFETVSKILKPGGTLAYWMYADPIFLDYPEANKLFR
                     TFVYEDPKYYASYWPPEMQYVRNLGKTIVIPKDKFQDITGEVYNPLDCDKKTAFSIAQ
                     NDFTIQKLKNWLRTWSIYLKWQEANRDANVDITDLLVGKLQEKCGWDDNTKIRIEWQT
                     CYYLARNRTT"
     gene            <1052166..>1053260
                     /locus_tag="HG536_0E05800"
                     /db_xref="GeneID:59326865"
     mRNA            <1052166..>1053260
                     /locus_tag="HG536_0E05800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284447.1"
                     /db_xref="GeneID:59326865"
     CDS             1052166..1053260
                     /locus_tag="HG536_0E05800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140343.1"
                     /db_xref="GeneID:59326865"
                     /translation="MDIATQLLEVSKRTNEVVDSLYGGIVPNLAFNAAMLAIWIVLLG
                     WHSLMIWFKQYWFSSAFVCAAILEVLGYAGRVQGHFDPSLETPFLMQQVCLTIAPVFT
                     AGGVYYQLAKMIEIYGHRFSLLPSPMAYSYTFIGFDIVALLVQAAGGGVAASASDSAG
                     NRLGANIFLAGLGLQVAAMVIFMMLMGHLYYKLFIQTRLEHSGQSKLSLSLLKIRHTE
                     IDYLYRQKFSDLRVHPVRWVFHYFPLAMVVAVVTVFVRCCYRLAELAAGWNGYLMRNE
                     NYFIILDALMIALGTVALSIFHPGLAFQGRHLSIPITRGRVDPETVEKPLLEPEKEEV
                     YIYSAEQASGLHRAFMEPKNIFKWYSHRQR"
     gene            complement(<1056579..>1058144)
                     /locus_tag="HG536_0E05810"
                     /db_xref="GeneID:59326866"
     mRNA            complement(<1056579..>1058144)
                     /locus_tag="HG536_0E05810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284448.1"
                     /db_xref="GeneID:59326866"
     CDS             complement(1056579..1058144)
                     /locus_tag="HG536_0E05810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140344.1"
                     /db_xref="GeneID:59326866"
                     /translation="MGILHVLFKADDDVRGSKARAILIGMFVAFGGVLFGYDTGTISG
                     IMAMDYVKKTFTSTGSFTASETSLITSILSAGTFVGAISAPLASDTLGRRLGLFISCI
                     VFCIGVALQTASSSQPLLIVGRVIAGVGVGVLSSIVPLYQSEAAPKWIRGAVVSCYQW
                     AITIGLLLAACVNEGTHKRNDSGSYRIPIAIQFLWAIILMVGMVFLPDTPRFHVMKGN
                     FQKARTALCKLRGLKPEDKFIEEELEEIVANYEYEKTLGSTKITDCFKTANHQLKRIS
                     TGIVIQALQQLTGINFIFYYGTQFFKSSGINNPFVIQLITNIVNVVSTIPGIALVELA
                     GRRRLLLWGAVGMCVSEFIVAIVGTALPNSQAANKTLIAFSCTFIASFAATWGPLAWV
                     VVGEIFPLRVRAKSVAICAGSNWLFNFVIAFITPYLVDADRANLKSKVFFIWGGCTFL
                     CILFVYLFVYETKGLTLEEIDELYETVSDARKSRGFVPTNKFLHTSPIPIEKETSNDN
                     NTEKATVDFVEKV"
     gene            complement(<1060453..>1061574)
                     /locus_tag="HG536_0E05820"
                     /db_xref="GeneID:59326867"
     mRNA            complement(<1060453..>1061574)
                     /locus_tag="HG536_0E05820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284449.1"
                     /db_xref="GeneID:59326867"
     CDS             complement(1060453..1061574)
                     /locus_tag="HG536_0E05820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140345.1"
                     /db_xref="GeneID:59326867"
                     /translation="MRQLRMSFDSIPVIDLGEAFTADSKSKFLEKLRYALIDVGFLLL
                     VNYEEYGPSQNDFADIKQQAIEFFELPEQVKKDCEMINSPHFLGYSRLGNEITAGRAD
                     YREQIDLATELPEPQEGEPVYKQIEGPNLWPDEKYAPSFRLVVVRYIEQMTKLATTFR
                     RLVCEAIGLHPNSLDSYFKSNQQCKMKLIAYPEDRTGTSNQEESYFNQGVGPHRDSDF
                     LTYIYQATEHRGSLQVQNFEGKWIPIGNVPGSLVVNVGQTLEALTNGVCKATIHRVAS
                     PQSGLGTRLSIPFFQTIDLDSHKSAAAGIPADVMQLKERRDERIIDWGADVGFQFTPD
                     MSKNPVGYSVFRNRIKSHQDVAARWYPEILKQVHTEYSA"
     gene            complement(<1061945..>1063042)
                     /locus_tag="HG536_0E05830"
                     /db_xref="GeneID:59326868"
     mRNA            complement(<1061945..>1063042)
                     /locus_tag="HG536_0E05830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284450.1"
                     /db_xref="GeneID:59326868"
     CDS             complement(1061945..1063042)
                     /locus_tag="HG536_0E05830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140346.1"
                     /db_xref="GeneID:59326868"
                     /translation="MDKKSPSCRFLGHLFRCDSHVSFSLAFASATILGNYTRVALNEL
                     SSYEPSYIAPGSVLWSNLVACMIMGMLQDLKKGGWFEPDELAKTFVVLTTGYCGALSS
                     YSTMMLEMFLHSTSLMPSDTAQGMKLPNRAYGIMEFLSVLLVQLLVSMGSYIFGRSFA
                     KNILLSLGPDMDLPEEKNELVPEPSVTGVENLWTYKLVKTFHLMLSIAALPLTALIIV
                     LGCVYDNNSRSLWTLPELLAIPAGFLRYYLALWFNQSLEFFPVGTFLANQLAVITLAV
                     FTMCLRGRSSEHSYAPIANTLTQCHILTALSTGFSGTLSTVSTFINEGYHLPLVKALI
                     YYGTSISLSYCILVIMLGSLAWTRGLTLPTC"
     gene            complement(<1063679..>1065817)
                     /locus_tag="HG536_0E05840"
                     /db_xref="GeneID:59326869"
     mRNA            complement(<1063679..>1065817)
                     /locus_tag="HG536_0E05840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284451.1"
                     /db_xref="GeneID:59326869"
     CDS             complement(1063679..1065817)
                     /locus_tag="HG536_0E05840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140347.1"
                     /db_xref="GeneID:59326869"
                     /translation="MSGSAGSPLPQGAGYAVVIGLGFVFAAGMILTTFILRRYQKEII
                     TSEEFSTAGRSVKTGLIAAAVVSSWTWAATLLQSSTQAYKNGISGPFFYAAGACCQII
                     LFAFIAIKAKQKAPDAHTYLEIIKTRYGGAAHAVFVFFAVATNVLVTAMLLTGGAATI
                     SDLTGMNSVACIFLLPVGVMIYTLCGGIKATFLTDYVHTIALVVIILTFAFTTYATSD
                     KLGSPGAVWELVTQAGKDHPVEGNAKGSYLTMNSRSGGIFFVINIVGNFGSVWLDNGY
                     WNKAIASSPAAALPGYVLGGLAWFGIPWLTATTLGLACLALESSPSFPTYPNRLSAEE
                     VAAGLALPNAAVALMGKSGAVATLIMVFMAITSAMSAELISISSIFTYDIYKGYINPN
                     ASGKKLIFSSHATVVVFTLVMSGFATGLHYAGISMGYLYDLMGIIISAAVVPTGATLL
                     SKRQNRIAAIVSPILGTSTSIMAWLVCTKVQYGSITVDNTYQDDPMLVGNVVALLSPA
                     IYSPILTVIFGPQNFDWDVLKQIKKVDEFEELEDVLPTTYKEVTENNSDEGSDKLKQV
                     RSQVSEVLDGLVDDKCIAQHKAEEEHLRKASKIAGYLSLFLSIAMLVVWPMPMYGSQY
                     IFSKEFFTGWVVVAIIWMFFTAFTVIVYPLYEGRHVIFTSLRGIYWDLTGQSHKLREW
                     QTDHPEELHVVQSQMSNRVREYSNIDDNLE"
     gene            complement(<1067707..>1069119)
                     /locus_tag="HG536_0E05850"
                     /db_xref="GeneID:59326870"
     mRNA            complement(<1067707..>1069119)
                     /locus_tag="HG536_0E05850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284452.1"
                     /db_xref="GeneID:59326870"
     CDS             complement(1067707..1069119)
                     /locus_tag="HG536_0E05850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140348.1"
                     /db_xref="GeneID:59326870"
                     /translation="MTVEAAPQESYLFQANIGKAGPQVVGGKGVRVDVKFDGKVQKGM
                     IDAVAGAAVGALGWGDEEVYQIINDAARNSTYSYPALLSNESAEELAKFYIENSPEGV
                     FAAALWCTSGSESNENALRIIRQYWVERGLPEKMKIISRENSYHGFTLAAQSISSNPR
                     IDAFSPLLIDQKNICIKMPCAYTYRFKEAKETEEEYAQRLLDILENKILEHTPERVGA
                     VIVETLPGSALGTSPPPKGYLKGIRALCNKYDIIFQLDEVMCGTGRCNPNGRLNCWEN
                     FLDPCDAPDIQTVGKTLGSGYVTIAGVLVGPKIRNAFLEGSGSIIGGHTYSCHAFNCA
                     VALGIQKKIKKEKLPENMFKMGNLMGQKLKDKLLSADNIAGDVRGIGGFWTVEFVQDR
                     VTKKMFDSSLNVAGRFKQIAYKNGITLICMPSVKDNVGDLAIMAPSFIITEEDVDEIV
                     EKMVESTNELSKQLRKEGVW"
     gene            <1069663..>1070682
                     /locus_tag="HG536_0E05860"
                     /db_xref="GeneID:59326871"
     mRNA            <1069663..>1070682
                     /locus_tag="HG536_0E05860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284453.1"
                     /db_xref="GeneID:59326871"
     CDS             1069663..1070682
                     /locus_tag="HG536_0E05860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140349.1"
                     /db_xref="GeneID:59326871"
                     /translation="MTGHKVLLIGAGGVGTIVAYGIHLAGKSELSIVVRRDFAKVSDF
                     GYNIDSIDYGIVEGWKPENIYPSIEAAASSDTVYQYVIITTKNLPDIAKVEELAEPVI
                     TPGVTVVVLIQNGFDLCRPFFDKYPKNVVISGITYVGSHNSGGSVHQTQPDRSFFGSG
                     RNPYIPEDLQESKVKEFLSIYSNGKNKPVYITNEREYRYKKLIYNAAMNTSCALSGVD
                     TGRLELAGTLDAVAIPAMREILAIAKADGIELPTDSINNAIHGDDGDWFEPSMLVDVR
                     KGNPIELEVILGNVLRVAEELNVKTPYLSILYGLLKAVQFRLREKQGHFSLPTKRPIS
                     DRFYK"
     gene            <1071522..>1073192
                     /locus_tag="HG536_0E05870"
                     /db_xref="GeneID:59326872"
     mRNA            <1071522..>1073192
                     /locus_tag="HG536_0E05870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284454.1"
                     /db_xref="GeneID:59326872"
     CDS             1071522..1073192
                     /locus_tag="HG536_0E05870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140350.1"
                     /db_xref="GeneID:59326872"
                     /translation="MLSRAFLRGSRLRNVASYHKLWRRTLASANPVSASVESSFGVIN
                     PKKAYFRKASFAAGATFAALLSYLFLDPSEGDITVSELRKHNSINDCWIALNGQVYDI
                     TSFLHMHPGGVARLLEVAGSDATEKFYQIHSDAVFDKMKDNFVYVGNLRGNVVNELTE
                     EEVKIMEMKKRLPPLSAIFSVSDFENIAKHVLPKSTFMYYATGASDEFTIRENHYAYS
                     RVFFRPRVLHESVREVDTSTTFLGTKVSLPFYITAFAGSKLAHPLGELNLQSASYDAN
                     VMQMVPKMVSYGIDKFFEHVPADQNQWMQYHFDNQQEVDDVVEFVRKVEKQPSVKGFF
                     FNVDLADIGNREKDTRQRSAEADTEELDMLVSNTYNHYPLLTWNTIDKILDATDLPVG
                     LKGIQRGEDVVIAAEKGVKAVVLSNHGGRQLDFSRPPLEVLAEARAMLKEKNLEDKIE
                     LYVDGGIRRGSDIIKALCLGAKGVGLGRPFLYAMAGYGEDGVSKLISILDGEIQNNMR
                     LLGVGRIEDLNESFIDAKSLALRNPRTNDALYDEAYEQLFFPAFKKSV"
     gene            <1074292..>1075995
                     /locus_tag="HG536_0E05880"
                     /db_xref="GeneID:59326873"
     mRNA            <1074292..>1075995
                     /locus_tag="HG536_0E05880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284455.1"
                     /db_xref="GeneID:59326873"
     CDS             1074292..1075995
                     /locus_tag="HG536_0E05880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140351.1"
                     /db_xref="GeneID:59326873"
                     /translation="MTSMLQATENVSLSPYLSSQVKENMKTSIQDVIDTEEGSFSDVG
                     KEPSHQIVRGLKSRHIQLIALGSAIGTGLFIGSGGALSTCGPAPVLIAYIIMSTFIWT
                     LMNQLTEMVTLVPLPGEASLNSLVRTYLNRPLSFMCGWNLFYAMAMIAPAEITACALL
                     VQYWTDANTAIFISIFVVATAVLTMLPVKFFGESEFWVCSIKILTITGLIIVGIVIFF
                     GGGPAQDHVLGFHYWKHPGAFKEHLVPGSTGKFLAVWTAIIKSGFSFVLVPEVVTSCS
                     AESTNPRRNMPRACSRFIYRLALFYVVGSLVIGVVVSSDDSSLLDAVSTGDSTAAASP
                     FVIGIKEAGIKVLPHIINACIMTSAYSCGTGVLYGSSRTLHAMAMRGEAPKIFKKVNR
                     FGVPYYSTGCACLFTLLAYLNCSKSSSVVFTWLSNIATISGFVSWVLVSTVYLKFRKV
                     IDELDLNDRVPFRVRFQKVGAYCSIVFFTLLALTNGYAVFIRGNWDTSTFFTCYITIG
                     FVFLLFIGSTVYYKEVSFRNAQEIGEDLIPKIDICDEEERNEVVPVPKNLLEKIWYTV
                     I"
     gene            complement(<1079672..>1080598)
                     /locus_tag="HG536_0E05900"
                     /db_xref="GeneID:59326874"
     mRNA            complement(<1079672..>1080598)
                     /locus_tag="HG536_0E05900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284456.1"
                     /db_xref="GeneID:59326874"
     CDS             complement(1079672..1080598)
                     /locus_tag="HG536_0E05900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140352.1"
                     /db_xref="GeneID:59326874"
                     /translation="MVQTAPALQLNTGALLPAIGLGTWKSGEEDTYNAVKSAIAAGYR
                     HIDTAAIYGNESAVGRAIRDSGVPREDLWITTKLFSTQHRNPKEGLEGSLERLGLDYV
                     DLYLMHWPVALKADKLATGHWFSIPLLPDGRRDIDVEDWDFVKTWRLMQELPKSGKCR
                     NIGVSNFSINNLKKLSDSEDKLVVPAVNQIEIHPQLPQTELIDFCKARGIVIEAYSPL
                     GSSDSAMLTHPVLVDLAKKYDAQPANVLINWGLSRGYCVLPKSINAERIKSNFRQITV
                     SDEDIELVTHLIDEVGAKRYVQPDWRPWPIFE"
     gene            <1081332..>1081721
                     /locus_tag="HG536_0E05910"
                     /db_xref="GeneID:59326875"
     mRNA            <1081332..>1081721
                     /locus_tag="HG536_0E05910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284457.1"
                     /db_xref="GeneID:59326875"
     CDS             1081332..1081721
                     /locus_tag="HG536_0E05910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140353.1"
                     /db_xref="GeneID:59326875"
                     /translation="MAKQLQWEEVGAAAHALLSPGYVTAKNSQTLYTSGCVGTDPKTG
                     EIPDCIEAQTRNALENLKAILKAGGSSLDSVLKVLLFVADGSYAASVNKVYKEYFPSK
                     PARSCVVVAFPDPTLKVELECVAAVEE"
     gene            <1087157..>1089160
                     /locus_tag="HG536_0E05930"
                     /db_xref="GeneID:59326876"
     mRNA            <1087157..>1089160
                     /locus_tag="HG536_0E05930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284458.1"
                     /db_xref="GeneID:59326876"
     CDS             1087157..1089160
                     /locus_tag="HG536_0E05930"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140354.1"
                     /db_xref="GeneID:59326876"
                     /translation="MVQVLDAGYGYGFVVGLGAAFAFIMIFVTRVLTRYMGEVQDSEH
                     FSTASRSIKSGLISSAVVSSWCWPGTLLSSCVYTYRYGVAGGYWYGISGISHSMLFTL
                     IALQMKRKATGAHTIVEIVRARFGKAAHCVYLFYSCGTNAIIASMLLLGCSQAFAHIS
                     DIHIVACAFLFPTSVAAYTMLGGLKSTFLSDWIHTVIIYLVIICSLLVCYGSSNLIGS
                     TGKMWDLLQEVSKTHPSGGHEGSYLTFSNKGLVMLAWSQIMSGWATVFADPSYGQKAI
                     AAKPLSTISGYVIGSLCWFIIPWSFGLGTALAALALTNNPVSLTYPKTIPTEEVNMGM
                     PLLYGLYAIMGKSGAAAGILVLFMSCTSSLSAELVSFSSVMTYDVYRAYIKPDANGKQ
                     LVRVSHFFVAVFALFVAGLTVMFNYIGITISWILTFIGIVLGAAPVGITLTLFWPRMS
                     RHCFYWALPLGSFTGLGCWLGACKHFYGEINKNNLSLVNSTIIANFSTFGATLLYCIV
                     ISYLKPDYSSLENLQDKFTVGDDATAKEKKLMQLDEETKAKLDAVFKWTSIGVFGLWA
                     SFTFLLPFPMYGQKYIMSKAFFKGWIVVSIIWLFIAFFYITFYPIYESRDAILEFYRK
                     VTGKEKSQVELFYGEELRQDSPDEFLKSTEIEETKEKGDRSSE"
     gene            <1090266..>1090841
                     /locus_tag="HG536_0E05940"
                     /db_xref="GeneID:59326877"
     mRNA            <1090266..>1090841
                     /locus_tag="HG536_0E05940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284459.1"
                     /db_xref="GeneID:59326877"
     CDS             1090266..1090841
                     /locus_tag="HG536_0E05940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140355.1"
                     /db_xref="GeneID:59326877"
                     /translation="MRIASQRNYRRSMALKLGSQASLTELFDAAIKRFGRIDIAINNV
                     GKMLKKPFTEVTEVEFDEMDVVNNKVAFFFISESMKKVADGGRIIMLASSLLAAYTPF
                     YTPYQGTKAASKEMMEKNITVNCVAPGPMDTPFLYAQETPEAVEFFKSSALQHRLTDI
                     KDIVPIINFLATDGGWITGQVIFANGGLAAN"
     gene            complement(<1092404..>1093048)
                     /locus_tag="HG536_0E05950"
                     /db_xref="GeneID:59326878"
     mRNA            complement(<1092404..>1093048)
                     /locus_tag="HG536_0E05950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284460.1"
                     /db_xref="GeneID:59326878"
     CDS             complement(1092404..1093048)
                     /locus_tag="HG536_0E05950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140356.1"
                     /db_xref="GeneID:59326878"
                     /translation="MEVVPCHLYGGFGCMLGVYVTGGKDIRTAATGVCLFTNPKPYVT
                     WRNAFFDEFIGAAMLVGCLMALLDDTNAPPANGMTAFVVGLLVAAIGMAFGYQTSFTI
                     NPARDLGPRIFAAMVGYGAKTLHLFPWWWARGAWGAPIAGGIAGALVYNLFIFTGSES
                     PVNCPDKGYVEQRVGKLLHNSVEATTDEGPTPLSSGQHNISSDTLVKNGKTAPK"
     gene            <1093530..>1093841
                     /locus_tag="HG536_0E05960"
                     /db_xref="GeneID:59326879"
     mRNA            <1093530..>1093841
                     /locus_tag="HG536_0E05960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284461.1"
                     /db_xref="GeneID:59326879"
     CDS             1093530..1093841
                     /locus_tag="HG536_0E05960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140357.1"
                     /db_xref="GeneID:59326879"
                     /translation="MSELFAPAPEPPTELGRLNLLSKTAGIKVSPLVLGGASIGKAWS
                     EKESSFKLLDAYYEAGGNFIDTANNYQNEESEACIGEWMESRKVRDQLVIATKLRLQI
                     L"
     gene            complement(<1094501..>1095442)
                     /locus_tag="HG536_0E05970"
                     /db_xref="GeneID:59326880"
     mRNA            complement(<1094501..>1095442)
                     /locus_tag="HG536_0E05970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284462.1"
                     /db_xref="GeneID:59326880"
     CDS             complement(1094501..1095442)
                     /locus_tag="HG536_0E05970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140358.1"
                     /db_xref="GeneID:59326880"
                     /translation="MSSSPKIVYGAYPFGLLPHEEASKIVEALKKNGIKELDTARIYP
                     GSEKAIGELNLPEQFVIDTKAKGFTDGSLTKKGIEESITESLGLLGAESVNIFYFHCP
                     DRDTDIKETIDAINELHQQGKFKKFGLSNFPAKDVEQVYNYAKSKGYVLPTVYQGNYN
                     AVARRSESELFPLLRKLNMAFYAYSPIAGGFLARSTDGIKNGEGRFDPNTPVSQIYAK
                     LYNRPVLLTALDRWGELAQEVGTSKARLAYRWVVHNSILSDKFRDAVIIGGRNADQVA
                     DTLDAISEGPLPANIVTDIDKLWEKIKHEAPLDNYSF"
     gene            <1097024..>1097350
                     /locus_tag="HG536_0E05980"
                     /db_xref="GeneID:59326881"
     mRNA            <1097024..>1097350
                     /locus_tag="HG536_0E05980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284463.1"
                     /db_xref="GeneID:59326881"
     CDS             1097024..1097350
                     /locus_tag="HG536_0E05980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140359.1"
                     /db_xref="GeneID:59326881"
                     /translation="MMMDDKQYEAYLEEIKPCYKDPFRFLDKFNKEKDEIYFDLLLMY
                     NWYLNLLRSQRPIKALESERGLRLSDVFSQTSIEIHSGYFRIWTELKEQEIGVPEFFN
                     DSLKSG"
CONTIG      join(CP059250.1:1..1098848)
//
DBGET integrated database retrieval system