GenomeNet

Database: RefSeq
Entry: NC_050732
LinkDB: NC_050732
Original site: NC_050732 
LOCUS       NC_050732             942542 bp    DNA     linear   CON 10-NOV-2020
DEFINITION  Torulaspora globosa chromosome 6, complete sequence.
ACCESSION   NC_050732
VERSION     NC_050732.1
DBLINK      BioProject: PRJNA670758
            BioSample: SAMN14605265
            Assembly: GCF_014133895.1
KEYWORDS    RefSeq.
SOURCE      Torulaspora globosa
  ORGANISM  Torulaspora globosa
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Torulaspora.
REFERENCE   1  (bases 1 to 942542)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     The yeast mating-type switching endonuclease HO is a domesticated
            member of an unorthodox homing genetic element family
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 942542)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 942542)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2020) Conway Institute, University College Dublin
            (UCD), Wolfe Lab, Belfield, Dublin Dulin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP059251.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: HGAP v. 3
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100.0x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..942542
                     /organism="Torulaspora globosa"
                     /mol_type="genomic DNA"
                     /strain="CBS764"
                     /isolation_source="soil, St Thomas, West Indies (strain
                     received from Westerdijk Fungal Biodiversity Institute)"
                     /type_material="type material of Debaryomyces globosus"
                     /db_xref="taxon:48254"
                     /chromosome="6"
                     /country="USA: Saint Thomas, West Indies"
     gene            complement(<2569..>4857)
                     /locus_tag="HG536_0F00100"
                     /db_xref="GeneID:59326901"
     mRNA            complement(<2569..>4857)
                     /locus_tag="HG536_0F00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284464.1"
                     /db_xref="GeneID:59326901"
     CDS             complement(2569..4857)
                     /locus_tag="HG536_0F00100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140360.1"
                     /db_xref="GeneID:59326901"
                     /translation="MTSRSPKGPRTLYDKVFEDHIVHEEEGGSTLIYIDRHLVHEVTS
                     PQPFEGLKNAGRKVRRTDCTLATVDHNIPTMSRKNFKSTATFIKEADSRLQVQTLEQN
                     VKDFDVTFFGMTESRQGIVHVIGPEQGFILPGTTVVCGDSHTSTHGAFGTLAFGIGTS
                     EVEHVLATQTIIQNKSKNMRVLVEGDLSPGITSKDLMLHIIGVIGTAGGTGHVIEFAG
                     KAIEQLSMEARMSMCNMSIEAGARAGMIKPDQITYEYLKGKPLAPKGAEWDKAVAYWN
                     TLHTDEGAKFDHEVIINASDIIPTITWGTSPQDALPITASVPDPARVSDPIKKSGMER
                     ALKYMGLTPGTALKDISIDKVFIGSCTNSRIEDLRNAAVVVKGYKLADNVKLGMVVPG
                     SGLVKAQAEKEGLDKIFEAAGFEWREAGCSMCLGMNPDILDPEERCASTSNRNFEGRQ
                     GANSRTHLMSPAMAAAAGIAGHFVDIREHVYKNNDSAKLSISQEDDKALQEHEKEPLQ
                     PAEEQINDIPVSQETKIESAPAGMKPFLTLEGIAALLDKANIDTDTIIPKQFLKTIKK
                     TGLKAGLFFEWRFNKGQEHNLKQTDFVLNVEPYTNAEILVVTGDNFGCGSSREHAPWA
                     LKDFGIKCIIAPSFGDIFYNNSFKNGLLPIRLDQNVILNKLVPLAKAGERIIVDLPNQ
                     KIVDTRGNELVGHFDVESFRKHCLVNGLDDIGLTLQKEEFISKYEDIRKEKFSFLEGG
                     SKLISPVRGAKKSPFGVTAQEW"
     gene            <8553..>9494
                     /locus_tag="HG536_0F00110"
                     /db_xref="GeneID:59326902"
     mRNA            <8553..>9494
                     /locus_tag="HG536_0F00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284465.1"
                     /db_xref="GeneID:59326902"
     CDS             8553..9494
                     /locus_tag="HG536_0F00110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140361.1"
                     /db_xref="GeneID:59326902"
                     /translation="MSNSPKIVYGGYPFGTLPHEESSKIVEALNKNGIKEVDTARIYP
                     GSEKAIGELHLPEQFVIDTKARGFSDGSLTKKGIQESIAESLGLLGVESVEIFYLHCP
                     DRDTEIEETIDAINELHQQGKFKKFGLSNFPAKDVEQVYNYAKSKGYVLPTVYQGNYN
                     AVARRSESELFPLLRKLNIAFYAYSPIAGGFLARSVDDIKNGEGRFDPNTPVGQIYLK
                     LYSRPALLTALDEWDKLAQKVGTSKARLAYRWVVHNSVLSGKFGDAVIIGGRNADQVT
                     DTAEAISEGPLPANIVSEIDKLWEKIKDEAPLDNYSF"
     gene            complement(<9887..>11029)
                     /locus_tag="HG536_0F00120"
                     /db_xref="GeneID:59326903"
     mRNA            complement(<9887..>11029)
                     /locus_tag="HG536_0F00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284466.1"
                     /db_xref="GeneID:59326903"
     CDS             complement(9887..11029)
                     /locus_tag="HG536_0F00120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140362.1"
                     /db_xref="GeneID:59326903"
                     /translation="MSELFAPAPEPPTELGRLNLLSKTAGIKVSPLVFGAMSIGEAWS
                     EAVGSMDKESSFKLLDAYYEAGGNFIDTANNYQNEESEAWLGEWMESRKVRDQLVIAT
                     KFTADYKSYEVGKGRSANFYGNNRRSLHVSVRDSLKKLKTDWIDILYVHWWDHMTSIE
                     ELMDSLHVLVQQGKVLYLGASDTPAWVVSAANYYAVSHGKTPFSVYQGRWNVMLRDFE
                     REILPMAKHFGMALVPWDVLGGGRFQSKESIEERKKRGEKLRSFGQPPEQTELEVKIS
                     SALEKVAKEHGTQSVTAIALAYIRSKGTNVFPLVGGRKVEHLKDNIAALSIKLTPEQV
                     SYLESVVPFDIGFPTSLIGQNPAISGELAFLSASCYKLNLDSLQFK"
     gene            <14168..>15127
                     /locus_tag="HG536_0F00130"
                     /db_xref="GeneID:59326904"
     mRNA            <14168..>15127
                     /locus_tag="HG536_0F00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284467.1"
                     /db_xref="GeneID:59326904"
     CDS             14168..15127
                     /locus_tag="HG536_0F00130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140363.1"
                     /db_xref="GeneID:59326904"
                     /translation="MSSKMECKPGKIAVVGVGNLGSATAYTLLLKGLAAEIILIDISE
                     KKAEGECMDLCHAVPFSCETQIRVGKCEDCAGCAIVIVAGGENEKPGQSRMDLVSENA
                     KIMQDVIPKIARSSPEAILLIATNPVDVMTSLAQKLSGFPAQRVIGSGTLLDSARFKC
                     NLGKYFKISSKDVNAFVVGEHGDSQVPVWSLASIAGMRLSDYCEQSGTNYDKAALHKI
                     YEQTRDASSKIIECKGSTAYSTAAGLAQIVSAILKDEGVLLPVSTVGDYYGVKNISMS
                     VPVKVGCNGAQHVVKLPLQDEEMKAVQKSAEIIKSVCKQAGCE"
     gene            <15553..>17235
                     /locus_tag="HG536_0F00140"
                     /db_xref="GeneID:59326905"
     mRNA            <15553..>17235
                     /locus_tag="HG536_0F00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284468.1"
                     /db_xref="GeneID:59326905"
     CDS             15553..17235
                     /locus_tag="HG536_0F00140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140364.1"
                     /db_xref="GeneID:59326905"
                     /translation="MTTTVGSYLATRFSQVGIENHFVVAGDYNLSLLDKLQEHPELEE
                     VNCCNELNCSFAAEGYARSKGVAAVVVTFNVGAFSAFNGIGSSYAENLPVILVVGSPN
                     TNESIDHNLIHHTIGTHNLDYEFEMAKKITCAAVQIKHAQDAPRLIDYAIRKCLTRKK
                     PCYIEIPTNMATQACPAPGPLEGLLYQLPSEPNTLSKAVDAAAKLIESRSKPTMLAGS
                     RLKSAGAEESFLTLAETLGCAVAVMPAAKSLFPEDHPQYVGVYWGNVSTKKADAILQW
                     SDLTICAGCVFTDYSTAGWTSPQPAAHRLEADSDEVKFSGHYYGHIKLADFLDALTKK
                     VKKNDKSLIEYRRLRPPPPLVEAADPSAPLTRQEMTRQIQGLFNSNTTFFAETGDSWF
                     NGIQMDLPRGAKFEAEMQWGHIGWSIPACFGYSVGAPDRQIVTMVGDGSFQVTVQEVA
                     QMVRLKKPILIFLINNYGYTIEVEIHDGPYNDIKNWNYAALIEAFNADDGHGKGYQVK
                     TGAELAEAIEKSKTNNKGPTLIEIQIHRDDCTTELVTWGQYVALANDRPPIS"
     gene            complement(<17600..>18631)
                     /locus_tag="HG536_0F00150"
                     /db_xref="GeneID:59326906"
     mRNA            complement(<17600..>18631)
                     /locus_tag="HG536_0F00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284469.1"
                     /db_xref="GeneID:59326906"
     CDS             complement(17600..18631)
                     /locus_tag="HG536_0F00150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140365.1"
                     /db_xref="GeneID:59326906"
                     /translation="MTVLVSGATGFIAQHIINELLVQGYKVVGTVRSQEKADKLWKQF
                     GNNPNLTLELVADVAAPNAFDSVFEKYGTDIKVVLHAASPVVFITEDYEKGVLTPAVN
                     GTKSIFEAIKKYGAESVERVVVTSSHGAVMDLAKEDDGSVVYTEESWNPATWESCQVD
                     GINAYCGSKKLAEAAAWDFLRENRQVVKIQLSTVNPVYVFGPQLFDEDVKDTLNLSCE
                     IINALVRNKPEAKQMEGLHGNYIHVRDVAKAHLIAFQKKEAIGQRLYLSNGSFVYQDL
                     LDILNEDFPQLKGKIPVGNPGSGQDLYKTFPSINNTKTKHILGFSLKSLRECVHDTAA
                     QILKKDGTL"
     gene            <20767..>22710
                     /locus_tag="HG536_0F00160"
                     /db_xref="GeneID:59326907"
     mRNA            <20767..>22710
                     /locus_tag="HG536_0F00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284470.1"
                     /db_xref="GeneID:59326907"
     CDS             20767..22710
                     /locus_tag="HG536_0F00160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140366.1"
                     /db_xref="GeneID:59326907"
                     /translation="MALLALLFWAYALVFVKASPVNNGDESLARILNTFQIMDDKDVI
                     NAISQALKEASASNDTCGACVGRLAIGKSLSLVRPDLVPATFEKWCNDNKYASKATCA
                     TNYHRNTLDASTTGSNFADMLQLMDPYGYDGQLYCHYKDNAACPKPKTPNVTMSHLWP
                     EKQAKHMLAPSSNGSETFNVLHVSDFHIELDYTVGAEVNCSTSMCCTPHSINTKSNVS
                     MNTSLGWNSFYEGSHYDDSNFSFVRGTKLSNPFHNVSIPAPSFGHYECDAPELLINSS
                     LNNVIEFAKNKSLDFKFAIFTGDLVDHDEYTYTDYEMTVKSEQYIMRDMKSRLGDLPV
                     FPVLGNHDTFPYGELAQEGYGFSNKFQWNADMLAEIYQDYGWLDGKQAQYARHHYTGF
                     SVTTKEDLKIISLNSNAFYKKNHYCYWNATDPDSFGQWKFLIDELVESEKHDQRVWII
                     THIPPISDSLPLPSKIFGEIVERFSPSTIAGIFFGHTHLDQFNLLYAKDSKSIDNVIN
                     MAWIGQAVTPWVENNPSWRYYEVDSKTFSIMNSYNYYSKLNETFANDGKEPEWLFEYS
                     ARDVYNVSWPSTAPLNATYWHLVAEKIKSDVSYRQLYENLAKRWSPYVPDCSKGKNCQ
                     TDYCFLSTFIVDDYDKCVAPLNK"
     gene            complement(<23603..>25216)
                     /locus_tag="HG536_0F00170"
                     /db_xref="GeneID:59326908"
     mRNA            complement(<23603..>25216)
                     /locus_tag="HG536_0F00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284471.1"
                     /db_xref="GeneID:59326908"
     CDS             complement(23603..25216)
                     /locus_tag="HG536_0F00170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140367.1"
                     /db_xref="GeneID:59326908"
                     /translation="MTTSSLNPPVPVTILSGFLGSGKTTLLERILTGDNGLKIAVIIN
                     DMSQLNIDASLIRDHKVSNKEEKLIQLQNGCICCTLRGDLLEELVSLHETGAFDYIVI
                     ESTGIAEPMQVAETFSSEFSQTLIDTPGAVTEDEEKLLKKVIKLGGLEKITKIDCCVT
                     VVDAVNFLSNIETTDFLATRWGDSGQGESDRTVTDLMVDQIEFSDVIIINKVSSIKKK
                     KLNKIEKMIRNLNPVAQILRADYCNVPLNKIINTNMFDFERASTSAGWLQSINEMTQR
                     EGFGDKNRSVLTPKPETEEYGVNNFVYNARKPFHPERLYEMLKEKFFIIEQTPLASIE
                     TVDEYEADSDAEMENEQESEKEDDEQEDGQEDGQELSEKEILKNKANSPFGPLLRSKG
                     FFWLATRHIMRGEWSSAGPMLTLKGGIPWFDVSGFEDIPPETEKLIRSEFQGPYGDRR
                     NELVFIGLSIDKKKLSDALDSCLLTDEEYEKFVEITSKEKNLLKVEEKLAEVFDDGFE
                     DWIILDDDDDDDDDDDDEKKEEEEAEEKS"
     gene            <27608..>28198
                     /locus_tag="HG536_0F00180"
                     /db_xref="GeneID:59326909"
     mRNA            <27608..>28198
                     /locus_tag="HG536_0F00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284472.1"
                     /db_xref="GeneID:59326909"
     CDS             27608..28198
                     /locus_tag="HG536_0F00180"
                     /inference="similar to AA sequence:RefSeq:NP_012317.1"
                     /note="similar to Saccharomyces cerevisiae YJL218W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140368.1"
                     /db_xref="GeneID:59326909"
                     /translation="MDELKKVVPGELYNPALPEIAALRIKAQAKCLELNQTHPGLTTE
                     RELLLRGLVGSCGENFTFDSPFFCDYGVNIHLGENFYANYNLVILDCAEVRFGDNVKL
                     GPNVGIYTAGHPIGPIKRKEGLEFALPVKIGHNVWIGGGVSVLPGVTIGDNAVIGAGS
                     TVTRDVPPNVIAGGVPCRVIRKITEEDEKTLLFTKR"
     gene            <28914..>29849
                     /locus_tag="HG536_0F00190"
                     /db_xref="GeneID:59326910"
     mRNA            <28914..>29849
                     /locus_tag="HG536_0F00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284473.1"
                     /db_xref="GeneID:59326910"
     CDS             28914..29849
                     /locus_tag="HG536_0F00190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140369.1"
                     /db_xref="GeneID:59326910"
                     /translation="MLSVDVFQKGCQGNNRHLSMTFQSFITAPAEQSEVPQQPPAGQY
                     GKSKPFLELFSQKGKLVVVTGAAGAIGGAICEGFASAGADLCLLDYKYDPKLANQLVS
                     EYGIVAKAYQVDITDANAVKQCVAAIRTDFKGRDIDTFIANAGIAWTAGSILNESATP
                     EAWRKVMEVNVQGTYHCSKYIAEVFKTQGHGCLILTASMSSYISNVPNYQTCYNASKA
                     AVRHMAKGFAVEFAHLTEPAGKIRCNSVSPGYTDTILSSFVPVEQRAQWWGLTPMGRE
                     ALPQELVGAYLYLASDAASFTNGCDIVIDGGYTCV"
     gene            complement(<30015..>31727)
                     /locus_tag="HG536_0F00200"
                     /db_xref="GeneID:59326911"
     mRNA            complement(<30015..>31727)
                     /locus_tag="HG536_0F00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284474.1"
                     /db_xref="GeneID:59326911"
     CDS             complement(30015..31727)
                     /locus_tag="HG536_0F00200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140370.1"
                     /db_xref="GeneID:59326911"
                     /translation="MDKYTDRHHPEYIPGTFNVFSSLDSEEELQPTGSRLKTDKNGVV
                     LIPQPSDSPNDPLNWARWRKYLHFGLVAFITAFTAATSNDAGATQDSLNEYYGISYDS
                     MNTGAGVLFLGIGWATLFLAPLSSLYGRKITYLICTTLGLLGALWFALARRTSDTIWS
                     QLFVGISESCAEAQVQLSLSDIYFQHQMGSVLTVYILCTSIGTFLGPLIAGYIASLIN
                     FRWVGWVAVIISGGLLIALLFGCEETYFDRNRYMTPLTCTGVTSPFEDEIVENGSSVD
                     SAKADEAEAAEKAVGESKTEQLEASEDQLIDGMSEKLKPYHKRVALITKGANLKGWGF
                     KQYPKFLFFNLRMMLFPPVWLSGLFWGIQDVFLTFYLTTEESYFYDAPWNYSDYGVAI
                     MNVPTLIGAVIGCIYAGILSDRFVLWMARRNNGILEAEYRLYFSFATALIGPAGLLMF
                     GIGTQRVLPWQVIYVGLGFIGFSWGCSGDIAMAYLMDCYPEMVLEGMVCTAIINNSIS
                     CIFTFVCSKWLDASGTERTYIALAVINFGITLLALPSFYYGKRIRLWTKKWYNQSVDM
                     RDLL"
     gene            <32318..>33046
                     /locus_tag="HG536_0F00210"
                     /db_xref="GeneID:59326912"
     mRNA            <32318..>33046
                     /locus_tag="HG536_0F00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284475.1"
                     /db_xref="GeneID:59326912"
     CDS             32318..33046
                     /locus_tag="HG536_0F00210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140371.1"
                     /db_xref="GeneID:59326912"
                     /translation="MSESGKQGDVLGLAKPVGWKGPLLAARIVRIAQFVFTVIALGLT
                     AKAKDYYTGESTADYGVAVSVMSLVYLIVIFFTSWFLGLYFMAGPVLICETLFLIFWL
                     TAFVALAAEFGTGSCSALYWGKSACQAAQASIAMAAVCMVLYGLSLVLLVLYTVLPVV
                     RTQGSDRLWGRALVMNASFDRGTGLLIYSAPARVADPEIGIAADRQITASSGEAPVEE
                     EKVMESADPLEPEPALVGPGTATQ"
     gene            <34012..>35388
                     /locus_tag="HG536_0F00220"
                     /db_xref="GeneID:59326913"
     mRNA            <34012..>35388
                     /locus_tag="HG536_0F00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284476.1"
                     /db_xref="GeneID:59326913"
     CDS             34012..35388
                     /locus_tag="HG536_0F00220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140372.1"
                     /db_xref="GeneID:59326913"
                     /translation="MTKKKSLEEFVEECRKVHDDKYNYSITNYTRWDCKIEYICPIHG
                     VQSQRANAHRHGRGCKLCGRERTRKTFALTTEKFIETCKKKHNNRYSYPNTVYVDYDS
                     AVKIECARHGEFLQIAGCHLTGRGCQKCAVFNKSSGPALKPADYDEFVGLSIKVHGDV
                     YDYSQVNYKKHYVTVDIVCTDHGPFRCTPTIHLKGKGCATCQNFDAFVQRAKSIHGDK
                     FQYDKSTYIRSKTKMRILCREHGEFWQTPGDHARVTRKGGFYCPSCFLENKRLTIDEV
                     KERSRNIHGLAYRFDKLVLGKSLQEEAIFYCIKCAKYFSQKPINHLRGHGCSWCCESK
                     HEKKIKNWLQTTDYQFESQKRFPDLRYEQSLRCDFYLEQFNLIIEFDGIQHFEPVEAW
                     GGFEKFLRVQARDRVKDDYCTEKRINLLRMKDGQDVIQGVQDLIELIKANETGHVLHM
                     IYGRLATF"
     gene            complement(<35528..>36508)
                     /locus_tag="HG536_0F00230"
                     /db_xref="GeneID:59326914"
     mRNA            complement(<35528..>36508)
                     /locus_tag="HG536_0F00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284477.1"
                     /db_xref="GeneID:59326914"
     CDS             complement(35528..36508)
                     /locus_tag="HG536_0F00230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140373.1"
                     /db_xref="GeneID:59326914"
                     /translation="MSATATNTQTEAAQLQLNAGSIRHALSDVVKTDDWSDFKFTPIR
                     ESTVSRAMTSRYFKDLDKHAVSDVIIIGAGSSGLSAAYVIAKNRPDLIVTIIEANNCP
                     AGGSWLAGSLMSAMIVRKPGHLFLEELEIPFEDEGDYVVVKHAALFASTVTSKVLQFP
                     NVKFFNATAVEDLVTRPAGPNGELTVAGVVTNWTLVTQAHDLQSCMDPNVIELAGYKN
                     DGTRDVSKKHGVILSTTGHDGPFGAFSAKRIVSIDKNSQLKGMKGLDMNNAEADVVKN
                     SGKYKGVDSMYFAGMEVAELAGCNRMGPTFGAMLVSGIKAAEEILKHFAE"
     gene            complement(<36973..>39123)
                     /locus_tag="HG536_0F00240"
                     /db_xref="GeneID:59326915"
     mRNA            complement(<36973..>39123)
                     /locus_tag="HG536_0F00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284478.1"
                     /db_xref="GeneID:59326915"
     CDS             complement(36973..39123)
                     /locus_tag="HG536_0F00240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140374.1"
                     /db_xref="GeneID:59326915"
                     /translation="MGSAKKPSLRQRAKEMAPLQYAARAKRSLQGGIVNLYSRMSMLL
                     FRRRSNLVLILLVVIGVLVGRSAMRENLTPSIGRSWQNVEVVERKPDLLHVDVSQLLK
                     RKPLGRSPVTERMLRQEYTKEDITGFVSNLDVDKLVARKKKQADKDHAKIDAKLNLND
                     YRNLATCKDLAYLSSIYHSTEKVLLEDDLKTLRAKLRSEKNFLTNEIANEDAEKGLTE
                     NEIIQQKWFQFGTSAVWLEREQCYVAYSRVIYAPSGVRDEPHLSLVRAQAFDKDWKEI
                     KGKRIPYVDMPIPKDMPEALKKIDKELGLSDCQEHRKDSSEYESCVVENAKNRLLAQN
                     RKDKIMSKYYMTYPTVLNIPFNPWGDWRGPEDPKVILRKAKNYEEPVVMFNIWDDHLE
                     RRVMVAFMPHRKVDPLIKLKVMGREQRGAEKNWTPFFHRNSGESSVSRGFLHFIYSFS
                     PLEILKCSLNDGFCEMVFEADTLRITEGNRFDGFRGGTQFVPLPDVLPQVRGQQIWIG
                     FPKQHISDCGCGDRYYRPMFSVLAEHDGVYSQELLVPALGFNIDVISWDLKGTYCKAV
                     NILSPNAIAHWDVVQQDPHSKIYEDYLTISVSEADINTRVVTIRGLLNYILNMYREKE
                     LQEKFEISEQADAIVGQTLQCLKASAFNYCKLYGEAHPEPKEDDQDDFPPDDFRPDDF
                     QQDEESSSEKSPDDRDNDDNSEDRDDHRQDDASD"
     gene            complement(<39556..>43638)
                     /locus_tag="HG536_0F00250"
                     /db_xref="GeneID:59326916"
     mRNA            complement(<39556..>43638)
                     /locus_tag="HG536_0F00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284479.1"
                     /db_xref="GeneID:59326916"
     CDS             complement(39556..43638)
                     /locus_tag="HG536_0F00250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140375.1"
                     /db_xref="GeneID:59326916"
                     /translation="MFHSLTKLLLLGLSLKSALTAAAAVPNTQLTDSLQRRNVQCSDF
                     GPQCPDLNFDWHALISDIMPYSMDLLSVEWMGSNTYEVSIRVQGQEFIDLKYLWSLKI
                     IGVQGPQGTVQLYGKNENVFLIDNPTDYVATFQVYGQPDPSDPCKVLMPNFQIQYEYM
                     QGDCAAFWDFWIWGATSFDLMTGCGHDNFNNANSDFPQFYWSKQCQPCGGASGSSALT
                     STSGTSKTSGIASSRSSNPSTLSSIASSKASATSSASTGSTSAQAASSVTRTSSFSAP
                     ASKTSDLSTVLKSASRLTGTGVSSISSSKPTGPSSGATSAVSSKPSGPPSGASSGASS
                     KPSGPSSGATSGVSSKPSGTSSVPSGSTSGQGASDVTRTGASSGASSKPTGPSSGATS
                     GVSSKPSGSSSGATSGASSKPSGTSSVPSGSTSGQGASDVTRTAASSGASSTPSGSSS
                     GATSGASSKPSGTSSVPSGSTSGQGASDVTRTGASSGASSTPSGTSSGATSAVSSKPS
                     GTSSGATSGASSKPSGTSSVPSGSTSGQGASDVTRTGASSGASSKPTGPSSGATSGVS
                     SKPSGSSSGATSGASSKPSGTSSVPSGSTSGQGASDVTRTGASSGASSKPTGPSSGAT
                     SGVSSKPSGSSSGATSGASSKPSGTSSVPSGSTSGQGASDVTRTAASSGASSTPSGSS
                     SGATSGASSKPSGTSSVPSGSTSGQGASDVTRTAASSGASSTPSGSSSDATSGVSSKP
                     SGSSSGATSGASSKPSGTSSVPSGSTSGQGASDVTRTAASSGASSTPSGSSSGASSGA
                     SSTPSGPSSGATSAVSSKPSGTSSGATSGASSKPSGTSSVPSGSTSGQGASDVTRTGA
                     SSAPSSASSSPSRASSYSFSTVTTTKDGVTTVYTTTCPISESKSSGSTETPSTVTTIT
                     TTISGVTTVYATTCPLTEMPVTGKTLTATTAATTSNGKGLSYTTEAPVNTVEFSSTIS
                     TVTTTSSGKPIVYTTQVPVNKNGAVSTDSTVTTTSNGKEIVYITEVSASQTGGTSTVS
                     TVTTTSNGKQIIYTTSVPVTGASAASTVSTVTTTSNGKETVYTTNVPASQTGAASTVT
                     TVTTTSNGKETVYTTNVPASQTGGGSTVSTVTTTSNGVTTVYTTTCPLSEVSATGGPS
                     TVTTVTTTSNGKETAHTTSVPVTEASAASTVSTVTTTSNGKETAYTTNVPVTEANAAS
                     TVSTVTTTSNGKETAHTTSVPVTEASAASTVSTVTTTSNGKETAYTTNVPVTEANAAS
                     TVSTVTTTSNGRETAYTTSVPVTEANAASAAVTTNQNAGTAPTAGTAESTTTLAPSGV
                     QSTTGTQQTAAASLQPYKGAAKKLSVNAAALLLAVPLLFL"
     gene            complement(<45697..>50970)
                     /locus_tag="HG536_0F00260"
                     /db_xref="GeneID:59326917"
     mRNA            complement(<45697..>50970)
                     /locus_tag="HG536_0F00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284480.1"
                     /db_xref="GeneID:59326917"
     CDS             complement(45697..50970)
                     /locus_tag="HG536_0F00260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140376.1"
                     /db_xref="GeneID:59326917"
                     /translation="MFHSLTKLLLLGLSLKSTLTAAAAVPDFQLTDSLQRRNLQCTDF
                     GPVCPGLNFHWHEDNVGIMYYSMDLLSVEWVGSNTYQVTIHVKGQEQICLKYLWSLKI
                     IGVQGPQGTVQLYGKNENTYLIDSPTDYTATFQVYGQPDPNDSCKVLLPNFQIQYEYC
                     QGDAAQYASSWHWGATSFDLMTGCDHDNNNNANSDFPQLYWSKECQPCGAASTSSISS
                     STTSTSKTSSSSSSTSSSSTSTSSTSKTSSTSTSTSSTSTSTSSSSSSTSSTSTSTSS
                     SSSSTSSTSETCTKHFETSSTSRTCTRHLETSSTSGTSTTLTSTSSAPSSAPHGASSI
                     FSSSTTAQGASVVTTTGSSPAPSGPSSASSSAPKPSGLSSAPSSAPRGSSSAQSSAPS
                     SKPSGPSSASSSAPSSAPSSAPSSAPSSKPSGPSSAPSSKPSGPSSAPSSKPSGPSSA
                     PSSASSSAPSSKPSGPSSAPSSKPSGPSSAPSSKPSGPCSGTSYTLCSKTTTESGSTT
                     VYTTTCPVTGVCVTSSPSSAPSGPSSAPSSAPSSGPSGPSSVPSGPSSVPSGPSSVPS
                     GPSSAPSGPCSGTSYTLCSKTTTESGSTTVYTTTCPVTGVCVTSSPSSAPSAPSGPSS
                     APSSAPSGPSSVPSGPSSAPSSAPSGPCSGTSYTLCSKTTTESGSTTVYTTTCPVTGV
                     CVTSSPSSAPSAPSGPSSAPSAPSGPSSAPSSAPSGPSSVPSGPSSAPSSAPSGPCSG
                     TSYTLCSKTTTKSGSTTVYTTTCPVTGVCVTSSPSSAPSVPSGPSSVPSVPSGPSSVP
                     SGPSGPSSAPSGPCSGTSYTLCSKTTTESGSTTVYTTTCPVTGVCVTSSPSSAPSVPS
                     GPSSVPSGPSSAPSSAPSGPCSGTSYTLCSKTTTESGSTTVYTTTCPVTGVCVTSSPS
                     SAPSGPSSASTSAPSAPCSGTSYTLCSKTTTESGSTTVYTTTCPVTGVCVTSSPSSAP
                     SVPSGPSSVPSGPSGPSSAPSGPCSGTSYTLCSKTTTESGSTTVYTTTCPVTGVCVTS
                     SPSSAPSAPSGPSSAPSAPSGPSSAPSSAPSGPSSVPSGPSSAPSSAPSGPCSGTSYT
                     LCSKTTTESGSTTVYTTTCPVTGVCVTSSPSSAPSAPSGPSSAPSSAPSGPSSVPSGP
                     SSAPSSAPSGPCSGTSYTLCSKTTTESGSTTVYTTTCPVTGVCVTSSPSSAPSAPSGP
                     SSAPSSAPSGPSSVPSGPSSAPSSAPSGPCSGTSYTLCSKTTTESGSTTVYTTTCPVT
                     GVCVTSSPSSAPSGPSSASTSAPSGPCSGTSYTLCSKTTTESGSTSVYTTTCPVTGVC
                     VTSSPSSASTSAPSGPCSGTSYTLCSKTTTESGSTSVYTTTCPVTGVCVTSAERSSTV
                     STVTTTSNGVTTVYTTTCPLSEVSATGKPSTATTVTTTSNGKEIIYTTEVPASQTGST
                     SITSTVTTTSNGVTSVYTTICPLTETSVASTVEKQLIISTVTTTSNGKETIYTTEVPV
                     TTAGAASTVSTAITTSNGKETIYTTNVPVTEAITASTVSTVTTTSNGKETAHTTSVPV
                     TEASAASTVSTVTTTSNGKETAYTTNVPVTEANAASTVSTVTTTSNGRQIVYTTNVPA
                     SQTGAASTVTTVTTTSNGKETVYTTNVPASQTGSASTVSTVTTTSNGQEVIYTTEVPA
                     SQTGAASTVSTVTTTSNGQETVYTTEAEAPASQTEQPAAGGASGAVHSTASVAHPQET
                     TTASFSSYEGAGSKLNFGATGLLLGLPLIFL"
     gene            complement(<58129..>59229)
                     /locus_tag="HG536_0F00270"
                     /db_xref="GeneID:59326918"
     mRNA            complement(<58129..>59229)
                     /locus_tag="HG536_0F00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284481.1"
                     /db_xref="GeneID:59326918"
     CDS             complement(58129..59229)
                     /locus_tag="HG536_0F00270"
                     /inference="similar to AA sequence:RefSeq:NP_015517.1"
                     /note="ancestral locus Anc_7.548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140377.1"
                     /db_xref="GeneID:59326918"
                     /translation="MSTRLQFAKQALRRYTVSATDGSGKISTLAVKVHGGSRYATKDG
                     VAHLLSRFNFQNTSGKSALRLVRESELLGGKFESTVDREFITLKATFLKEDLPYYVNA
                     LGNVLYKTSFKAHELKETVLPAARHDLMVAETCPLRKAEDLLYNVTFRKGLGNTVLYD
                     GVETVSLDDIRAFADKVYTKENIEIVGQGVNEADLKKFVSDSLLSSLPTGSPLAASVA
                     PKTYSGETRARFAHADSVAAIAVPVAKESFGEYELLSRYVTSPLSDLAPLVHSAKLQR
                     FNNIGLFTLFVKSPDATQVAQNIKKVVSELKKGKDISVAKDYAALKFALENDGAAVPA
                     ELKIDSAGTFKLDKFNYVAVGDVSNLPYADEF"
     gene            <59910..>61823
                     /locus_tag="HG536_0F00280"
                     /db_xref="GeneID:59326919"
     mRNA            <59910..>61823
                     /locus_tag="HG536_0F00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284482.1"
                     /db_xref="GeneID:59326919"
     CDS             59910..61823
                     /locus_tag="HG536_0F00280"
                     /inference="similar to AA sequence:RefSeq:NP_015516.1"
                     /note="ancestral locus Anc_7.547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140378.1"
                     /db_xref="GeneID:59326919"
                     /translation="MASVAPVGSTQASATPAATPTPAASNAADDTVTLSSLEQRTLNP
                     EWFLYTELARFYLGERAALIIDLLISKGRLSVFEILERSPSLDARSIRTALVSLIQVR
                     CVRYWEEVAPSGRSTTYYYFNEDGLLLFLYSGLIIEEVSQQVPQSDLAAQIAQSILSL
                     GSITVKDFLHNFESSKNEILSVFVQLCESGFLSPLSKLHYAPLNDLWTHLYEKEYDAI
                     PRTSTLSDLKKRTEAKGKAKVEFQKLLSAANDTSSILTVDPETSLRTVVNTAPLVLNL
                     ERFLKSRRSKQLVKLAKTRTGSVPAEIYKVALAISERKTPPLVDPMKRTGLLQELDEA
                     KAIEEDLELMEEKTQGVTFNAIDISKYLPSTFDLRGTMVSTLKGTRNSNDTGGQPNKR
                     LKTEDGFVIPPLPKNINNEVDQNEDEDFEDFDDNDPDPHSISLINNHLRLLASSSIPF
                     LKESRPGVYYVPYSKLVPALKSSVYDYLLASTLGPSAMRIRRCICANSLVSEKVINST
                     ALMKEKDIRSTIASLVKYNVVEIQEVPRTADRAASRAVFLFRSKERHAYDFMKQNLAW
                     NIGNLLFKKEKLKEENIDLLTKANRDDVKGRESELLLPSELNQLRMVNERELNIITRV
                     CRVLSLWEVFKFF"
     gene            complement(<61894..>66087)
                     /locus_tag="HG536_0F00290"
                     /db_xref="GeneID:59326920"
     mRNA            complement(<61894..>66087)
                     /locus_tag="HG536_0F00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284483.1"
                     /db_xref="GeneID:59326920"
     CDS             complement(61894..66087)
                     /locus_tag="HG536_0F00290"
                     /inference="similar to AA sequence:RefSeq:NP_015515.1"
                     /note="ancestral locus Anc_7.546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140379.1"
                     /db_xref="GeneID:59326920"
                     /translation="MSTVKDLLKEAKAELAREDYEEAAKISLQVLKQDQSNYFAQVFL
                     GKSYSCMEGKAREAVHRYKVAIELAPENLLAWKGLFLFLNGGPVVPEVVSYDEYFDLS
                     GEYARILCEQQQSQVELIHELRAFRKKKPDSRESFLWHMVPGNPMAEQLGRHLITPQA
                     ALKELIDILDSKEKAYVSKIVSRERLKFSAQDPDYQIKMNSLAWDVYQNSKLDHLFNQ
                     LINITDDDDERAELETRWLEYRLLVLKSMPKEIKSSFYEQVKRMVDDMVLVDHRSSTA
                     WRLYFEWQDYADLDNMDQELILKFFKKFPLEPLAIILYAWLSSNLSKYDIKKLNASLD
                     QPSEPEEGRELADIDESEKNALNDMMEKENETSGLLEEEVVDALLDNIPKAQNSILAN
                     RIVSQYYLLSKEYEAALPYVKTGISVIAYNIRDLGGRFANSKKQFTLSLAILYTYIDP
                     PKNHNAALSLFEKILADDPDNTHAKLGKGLIFVERAEWEKANVLLSEVSAQFPDNMEV
                     LSELAWNEAQLGLLEEAVSKFKTVLAASEGTDLRSAEFRALNLWRQAKVYIMLEERDG
                     SEDLNYVKVAFKQLVNSIKVLDTFAANYSTLGDIYSSFFEDKVRAFKCYYKAFELNAR
                     DATAAKYMAEHYANLTNWQAASTVAKRLISAESNRKKLKDMNWAYRAVGIFYLETQDE
                     AASIEWFQGALRINPTDVESLIGLGQAYHACGRVEASTKVFDRALEIDSEHFHCQYLK
                     AQSLAAMGEYVESINILERITALSPREEIYQIMLASVSVDYAIDLYSQGLLTKSIAIS
                     EGVIETLQYAIIELHCSGQLLWLVLSKALGLFVTIASKVDKLPIESLVGIFRAFDATE
                     STRVIDDIDGITFDQVLSAIDDSSISIACKFLILSAKYSFSTTKLEEQSRTVRSSLWH
                     NVGSAELTAYHVLKEVKYRDAAIACYKASIHQQSNAVESWIGLGVATMDVNYRVAQHC
                     FIKASALSPRDADVWFDLAVLGLKNNDVEFSKDVLNRSQSLSPQNSSPWLGFALVHEM
                     EGNIVDSHRMFAHAFVLSNGKSKVAQLLYAKSVLERRIGDSFDERDLEAAEELATAAY
                     GLDQYFKENPRDNFALQCALLIFERLHLYPNAHRVSNDLVELLEIKFEKAQSDEDLYN
                     YAIIKAQIARIKLGFGEFQLAIDDAKISESILTEFAGRDTSMISLSNQISLSLANFFL
                     QNYDETLQSLQEVLKASKTSRHLSILTAKILYDMGSDEAKEIALEELMEYVSQNGPEL
                     LVGFTIAAIAIVEQKTDDLKVILGELTGMSLSNLIADKHKDLPYLIEQIKARLELKAK
                     PVTSWQRSSFFFMNDHSTWTAVDKKISLRVAADGQNKINVNQLSALYCMQKDVRSVQR
                     SLFLAPWNKTAISALRQCF"
     gene            <66228..>66710
                     /locus_tag="HG536_0F00300"
                     /db_xref="GeneID:59326921"
     mRNA            <66228..>66710
                     /locus_tag="HG536_0F00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284484.1"
                     /db_xref="GeneID:59326921"
     CDS             66228..66710
                     /locus_tag="HG536_0F00300"
                     /inference="similar to AA sequence:RefSeq:NP_015514.1"
                     /note="ancestral locus Anc_7.545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140380.1"
                     /db_xref="GeneID:59326921"
                     /translation="MQADEPLKFSQLSQNHIKTLKDAFEMLDDDGDSRISERDLRTVF
                     GSVGQKVTDEQLHEMLQVGSTQQPNEGIAFSEFLSLMSRTAGSFSEDSEIRDCLRTLT
                     DDQDLRVPLDDLVVRLKEAGFQDPEGEFAGIFKDFSAVSQVSGRKTFKGTQFLNTISE
                     "
     gene            complement(<66784..>67344)
                     /locus_tag="HG536_0F00310"
                     /db_xref="GeneID:59326922"
     mRNA            complement(join(<66784..67246,67325..>67344))
                     /locus_tag="HG536_0F00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284485.1"
                     /db_xref="GeneID:59326922"
     CDS             complement(join(66784..67246,67325..67344))
                     /locus_tag="HG536_0F00310"
                     /inference="similar to AA sequence:RefSeq:NP_015513.1"
                     /note="ancestral locus Anc_7.544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140381.1"
                     /db_xref="GeneID:59326922"
                     /translation="MSDYEEVFNDGAENFEDFDVEHFSDDENFGKANNVNGGVVDQNE
                     VKAENGHTVITGGNGADEFQNYEQSRRKTLKEKAIPKEQRITTPYMTKYERARILGTR
                     ALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
                     "
     gene            <67492..>68880
                     /locus_tag="HG536_0F00320"
                     /db_xref="GeneID:59326923"
     mRNA            <67492..>68880
                     /locus_tag="HG536_0F00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284486.1"
                     /db_xref="GeneID:59326923"
     CDS             67492..68880
                     /locus_tag="HG536_0F00320"
                     /inference="similar to AA sequence:RefSeq:NP_015512.1"
                     /note="ancestral locus Anc_7.543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140382.1"
                     /db_xref="GeneID:59326923"
                     /translation="MSCSSRGTSTDYQLYVAIGCSGMAARGSAGTESSQSLSLELNTW
                     KNDDSLCLSRSNTSESLQSLASTVSTTSSLARSKNYFCDYEGCNKAFSRPSLLTEHQQ
                     AVHQGRKPFKCELCDRSFAKKSHLERHLHAHAEDKPLHCSFCQKGFTTAQQLKRHEIT
                     HTKSFKCPYEGCQECFYKHPQLRSHIMAIHEKNLSCKVCGKEFQRPYRLRNHMAKHHN
                     PEVQNPYQCSHGSCASCFKTWSQLQAHIKNDHPKLRCPICAKPCVGESGLRMHMNVHD
                     ENLVKRNWKCDICSDVLFAKKSLMLEHYADKHTEEFAEIQRRLDNQAGGREFLQDDGE
                     VFENPFRQSKKRRLNEIKLVRSEMMLENYLSEGKGAVDLLLNTVGRKLRCTFDKCYRT
                     FKTEERLKKHIDRHKIHELKLKVLQEKTSLEENRTSARNDETDVQKDNVGGGTQSETD
                     TTASASEPVALI"
     gene            complement(<69171..>71201)
                     /locus_tag="HG536_0F00330"
                     /db_xref="GeneID:59326924"
     mRNA            complement(<69171..>71201)
                     /locus_tag="HG536_0F00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284487.1"
                     /db_xref="GeneID:59326924"
     CDS             complement(69171..71201)
                     /locus_tag="HG536_0F00330"
                     /inference="similar to AA sequence:RefSeq:NP_015511.1"
                     /note="ancestral locus Anc_7.542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140383.1"
                     /db_xref="GeneID:59326924"
                     /translation="MSSLRSDKEIIELIDKFFVKSTSLICAAKCSRFQTGSDLAPQFD
                     EEWLLSETDEDLELPEIIQQWSRFDGGRDLPPLVIETYLDLRRVDPSQWVTLKDDEGN
                     VWNVCKGTKKSEIVLERWLIELDKNSASFKSHKPTMEESNSFSGQLVLLFRYLYTLIQ
                     LLPASDLHASLCKAADVQGVSSPIDVSTRILDGSKPILSKGRIGLSKPIISTYSNIVN
                     ESNVPSHLEQRKITPVWTKFGLLRISVSYRHDCRFEVHDTEGENPSNQYISEPTARRL
                     SANRSPSLSPQARGSSISSMDNPSFQRRPVAISRQLQVFKVGSVGSVPTSQSQMMIRN
                     PSSSSSAVANLQAQRSNNSPIPSSSTIHVQDMNNEGTTVGSASKYSSSFGRIRRHSST
                     KYSEHAERPVKPNKPQEDQSDTLLDFVKLIDEKPELKLNKNRSATMDISNSLMKFQSL
                     KPTNDFISENLSMSTSMDPSHVSQRRRSSSHSPIPSFSPAINYPSIPSRFSQTSLNEN
                     PIGSRVSSNEISKEPQDIRRSSLSSHHSSSVSSHRHSTIGKEAINCDQRIRDDSHILH
                     DDDEEEDDALLMNHTVSSDLRPRKHSYAKSAENVASSITRNRLPIPQPSQHPQPITTA
                     IPAFAKLHRPGKNPSVLPESEKKKGVSDINSPPDDEDEDLLFFMSDMSLSKM"
     gene            complement(<71666..>76282)
                     /locus_tag="HG536_0F00340"
                     /db_xref="GeneID:59326925"
     mRNA            complement(<71666..>76282)
                     /locus_tag="HG536_0F00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284488.1"
                     /db_xref="GeneID:59326925"
     CDS             complement(71666..76282)
                     /locus_tag="HG536_0F00340"
                     /inference="similar to AA sequence:RefSeq:NP_015510.1"
                     /note="ancestral locus Anc_7.541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140384.1"
                     /db_xref="GeneID:59326925"
                     /translation="MIKDRVLLLRLSDSGEPLVSCSYGLGVLTLPSMPPTSSSDMPLF
                     TVRLLVGAGSPVARDGLIWHNCPPDHVTRFRRNKFYKKVIESSFHRDDLVDLEVFKPG
                     SYCFYLSFRNDKEELETTRKFYFVVPPVLHINGRFTQLNSIALQSVVSKWMGKDWDSV
                     FEQIAAKKYNMVHFTPLQRRGMSNSPYSIYDQLVFDPDFFQDASEVEKMVKRLHSKYN
                     MLSLTDVVFNHTANNSPWLREHPEAGYNFETAPHLIAAIELDQALLDFSRRLTELGYP
                     TDLKNTDDLCLVMEGIKSHVIGSMKLWEYYVIDIETTIDQVKELWERPSSDDAVDIPK
                     DIVGDNLVQVAQFVRDRLTGEKFGTLGKRNGNSLYVSKFTAVLKCLYGEVWDDLLLNK
                     MRKILNEVNLPLYAQYDDDVSEILEQLFNRIKYLRIDDHGPKQGPITDQVPLTEPYFT
                     RFKDKNGKDYALANNGWIWNGNPLVDFASDKSRAYLRREVIVWGDCVKLRYGRGPQDS
                     PYLWERMSKYVELNARIFDGFRIDNCHSTPLHVGEYFLDLAREVNPNLYVVAELFSGS
                     ETMDCLFVERLGISSLIREAMQAWSEEELSRLVHRHGGRPVGSYKFLPLKNFPFPADL
                     KLGRNFKLQPNNSVLSTSEVIIPKILTAIPPHALFMDCTHDNEMPNQKRTVEDTLPNA
                     ALVAFCSSAIGSVYGYDEIFPKLLDLVQERRTYDVKSGMGIAKVKAKLNEIRFEMSKL
                     SVDIEDAEMHVHHDGQYITFHRTDAKSGRGWFLIARTKFHEGAEEQPLPLTQLSHTTC
                     KFKFAYSLRKTGDLPVDDHYIKGIPTELQEINGVEVAFDEEKKLSTINISDYFPQGSI
                     AVFQTQQIGVDETLDHFIRAGAIDATAKVNLESLNAILYRSEPEEYDISGGKVGAYDI
                     PHYGKLVYCGLEGWVSVLQPIIFSNDLAHPLSDNLRNGFWALDYIVNRLDYYMQEAGI
                     PEIRKWLQDRIERIRSIPYYLVPSYFALIVGVLYGCCRLRAMQLMSGNIGESTTFVQS
                     LSLTSIQMISRMKSTSILPKENVPAMAAGLPHFSTDYMRCWGRDVFISLRGLLLTTGR
                     FDEAKNHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFLQAIQDYVNIVPRGELI
                     LKEKVTRRFPLDDTYIPFDDPQAFSYSSSLEEIIFEILSRHAKGIKYREANAGPNLDR
                     VMKDEGFNVEIHVDWSTGLVHGGSQFNCGTWMDKMGESEKAGSVGIPGTPRDGAAIEI
                     NGLLKSALRFVIALHNTGSFRYTEVERADGTKITFVDWNKLLQENFEKKFYVPQDPSD
                     DPKYDIDPKIVNRRGIYKDLYRSGKPYEDYQLRPNFAIAMTVAPELFTCKFAAHAINV
                     ADDVLRGPVGMRTLDPSDYNYRPYYNNGEDSEDFATSKGRNYHQGPEWVWLYGYFLRA
                     YHHFNFITDPRAQNGPKTKPSSFLYQQLYSRMIKHTEWIADSPWAGITELTNKDGELC
                     NDSSPTQAWSTACLLDVFYDMWSAYEDVDEPEMPMPDQLAKTLR"
     gene            complement(<76540..>77343)
                     /locus_tag="HG536_0F00350"
                     /db_xref="GeneID:59326926"
     mRNA            complement(<76540..>77343)
                     /locus_tag="HG536_0F00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284489.1"
                     /db_xref="GeneID:59326926"
     CDS             complement(76540..77343)
                     /locus_tag="HG536_0F00350"
                     /inference="similar to AA sequence:RefSeq:NP_015509.1"
                     /note="ancestral locus Anc_7.540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140385.1"
                     /db_xref="GeneID:59326926"
                     /translation="MSITNSVIVPAYHEKLNIKPLTTRLFAALGNEGSKTTELIFVDD
                     NSQDGSVEEVESLKKQGYNVRIIVRTDERGLSSAVLKGFREAEGEYLICMDADLQHPP
                     ESVPKLLDSLRNHAFVIGTRYAPGVGIDKDWPLYRRVISSTARMMARPLTSASDPMSG
                     FFGLQKSYLDRADPRSINSQGFKIALELLAKLPLPANANAALGEVPFSFGVRTEGESK
                     LSGKVIVQYLQQLKELYCFKYGANNLVLFLLFWSILVLYCVYQIYSLLF"
     gene            complement(<77495..>77834)
                     /locus_tag="HG536_0F00360"
                     /db_xref="GeneID:59326927"
     mRNA            complement(join(<77495..77767,77826..>77834))
                     /locus_tag="HG536_0F00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284490.1"
                     /db_xref="GeneID:59326927"
     CDS             complement(join(77495..77767,77826..77834))
                     /locus_tag="HG536_0F00360"
                     /inference="similar to AA sequence:RefSeq:NP_015508.1"
                     /note="ancestral locus Anc_7.539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140386.1"
                     /db_xref="GeneID:59326927"
                     /translation="MSDFTPTNPKPFLRDLIDKPIVVTLKFNKTQYKGRLVSTDNYFN
                     VRLRDAEEVVDGKSKGPVGEIFIRCNNVLWIGQDLEQGSAAQSTQQTLE"
     gene            complement(<77963..>79144)
                     /locus_tag="HG536_0F00370"
                     /db_xref="GeneID:59326928"
     mRNA            complement(<77963..>79144)
                     /locus_tag="HG536_0F00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284491.1"
                     /db_xref="GeneID:59326928"
     CDS             complement(77963..79144)
                     /locus_tag="HG536_0F00370"
                     /inference="similar to AA sequence:RefSeq:NP_013564.1"
                     /note="ancestral locus Anc_7.538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140387.1"
                     /db_xref="GeneID:59326928"
                     /translation="MWAREKWVLFACVVTRLLVSLLFPSLQQQLDKSVEFSTPFTSYR
                     SLREGVYMLNNGFQPYNGGVVHQAPLLVAMMSFIESDALVALLYALLDAVVAYQLTCI
                     AQCFAASVDIPIWLPSLLYSFNPLVLLSCVSRSSVIFTNLCISTAVLSALQGEIVVAS
                     IAIATAGYMSLYPMLLLIPLLSLFDGKSAKTKAVICSSLTAVSLLALSNVICYRSWDF
                     LEATYGALVRFDKLFPNLGLWWYFFIEMFEAFLPFFKAVFNVVVLSFVGPITLRFYKQ
                     PFYAFVLSLGWIVITKPYPTLGDAGFFLSFIPFFKPLYGYLRYSVLSCLLLLHAVLLS
                     PIFYHLWVGLGSGNSNFFYAITLVYALALASTVVDLCWAMLRMDYDQGKPNYTLKITQ
                     I"
     gene            <79588..>81861
                     /locus_tag="HG536_0F00380"
                     /db_xref="GeneID:59326929"
     mRNA            <79588..>81861
                     /locus_tag="HG536_0F00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284492.1"
                     /db_xref="GeneID:59326929"
     CDS             79588..81861
                     /locus_tag="HG536_0F00380"
                     /inference="similar to AA sequence:RefSeq:NP_015507.1"
                     /note="ancestral locus Anc_7.537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140388.1"
                     /db_xref="GeneID:59326929"
                     /translation="MDFETNEDINGVRFSWNVFPSTRTDANKNVVPVGCLYTPLKEYE
                     ELNVAPYNPVVCAGPQCKGILNPYCAIDPRNNSWTCPICNSRNHLPAQYANMTQENMP
                     IELQHTTVEYITNRPVQIPPIFFFVVDITAEQENLDALKESIATSLSLLPPNAYVGLI
                     TYGNVVQLHDLSSQGIDRCNVFRGDREYQLEQLVEMLTGQRPSSSIGAMPNAKITPFS
                     LNRFFLPLEQVEFKLNQLLENLTPDQWTVHAGHRPLRATGSALNIASLLLQGCYKNVA
                     ARIILFASGPCTVAPGLIVSSELKDPLRSHHDIDSDRASHYKKACKYYNQLAERVAQN
                     GHTVDVFAGCYDQIGMSEMKQLTDSTGGILLLTDAFSTAIFKQSYMRLFAKDEEGYLK
                     MAFNGSMSVKTSKELKLQGLIGHASAVKKSDGNNVSDSEIGIGGTSTWKMSALSPNHT
                     YAVFFEIANTAAATPVVADRPRLAYTQFITNYQHSSGTNRVRVTTVANQLLPFGAPAI
                     AASFDQEAAAVLMARIAVYKAESDDGADVIRWIDRTLIKLCQKYADYNKDDPSSFRLA
                     PNFSLYPQFTYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSME
                     DDPQPVLLDSVSVKPNTILLLDTFFFILIYHGEQIAQWRKAGYQDDPQYSAFKSLLEE
                     PKLEAAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDSYQDASHGGSTIVLTDDVS
                     LQNFMTHLQQVAVSGQT"
     gene            complement(<82052..>83095)
                     /locus_tag="HG536_0F00390"
                     /db_xref="GeneID:59326930"
     mRNA            complement(<82052..>83095)
                     /locus_tag="HG536_0F00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284493.1"
                     /db_xref="GeneID:59326930"
     CDS             complement(82052..83095)
                     /locus_tag="HG536_0F00390"
                     /inference="similar to AA sequence:RefSeq:NP_015506.1"
                     /note="ancestral locus Anc_7.536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140389.1"
                     /db_xref="GeneID:59326930"
                     /translation="MASVPDSRKNEQLSEEEIALYDRQIRLWGMAAQARMRSARVLLI
                     NLGSIGTEITKNVVLSGLGSLTILDNQRVTEEDLSSQFFVGQSDVGSYRLDAARSRVL
                     EMNPRVQINFDTDSFESKEMSYFSGFDLVLGTQMSRDGMIRLNKITRHYGIPLYMAGC
                     NGLFAYIFIDLIQFDAEERKLKSSNATSLGKTSANTEIVGVEDQRQEEGETKYYEIIT
                     TRNYFKTFEDVLRTASLAGKLNRRQMKRVSSAVPLTFALFSNKQCQTSGELKREALLA
                     CQQLQIPESVLKDSYVEQFFEQAGVEFSPVAAIIGGAVAQDVINILGKRQAPLNNFVV
                     LDGITLDMPILEV"
     gene            <83333..>85270
                     /locus_tag="HG536_0F00400"
                     /db_xref="GeneID:59326931"
     mRNA            <83333..>85270
                     /locus_tag="HG536_0F00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284494.1"
                     /db_xref="GeneID:59326931"
     CDS             83333..85270
                     /locus_tag="HG536_0F00400"
                     /inference="similar to AA sequence:RefSeq:NP_015505.1"
                     /note="ancestral locus Anc_7.535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140390.1"
                     /db_xref="GeneID:59326931"
                     /translation="MDLLEILDTKPVPAIVDARTLGIAEDTSGDYWLPTTMCLYQKEL
                     TDQIVSLHYSDILRYFETNDYKEDVIVESMKTMCLNSAYVATHPYLLIDHHMPRSLIT
                     KDIPGQLAETSGKFTALRDLMNLVQEYETDTAIACRPGRTMDLLEALLLGNKVCIKRY
                     DKHSIKSKQRARSFPCTCHIFPSHGLKLEKNSLKTSGQFDMLICLDPTVDTTNEQIQR
                     ILRHKRNPKSSEAVAPIVRLATINSVDHCELYFGKQYQRNSREFLESVTAAVVVLRDR
                     VGILPPDLRPIYSQNLRYLINWLEDPSIPWPLPNVYRVNKYTSMDVERSLLTEVHYSQ
                     VEDELDAAFNGKKRGRSKTEKGTGRPADVSSFYSSKRLKNDYTTNPSKQNMAELTGIT
                     TADEASHADYHLSSGILTHRLIQSMGQTYVDLAIQTREYRSYIEMDAIQEAHKSTLYD
                     KLSEVEDKVAAIVAKEKDNMLQANRIDDVNENKRQEIQKVEANIERLLGKLSDKAGKF
                     GQLKELYERCSSLADCIDKEKNVSKSKESEQEYTLKECERADCSISDSKAELDAITEN
                     SKRLREELNSAFDQSNIERQEIEQRIATMLPAIEIEKAYCKDLNNKLSQIVDQLNSMP
                     QSRLGLLNGKGSSSRRHKNTA"
     gene            complement(<85323..>86729)
                     /locus_tag="HG536_0F00410"
                     /db_xref="GeneID:59326932"
     mRNA            complement(<85323..>86729)
                     /locus_tag="HG536_0F00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284495.1"
                     /db_xref="GeneID:59326932"
     CDS             complement(85323..86729)
                     /locus_tag="HG536_0F00410"
                     /inference="similar to AA sequence:RefSeq:NP_015504.1"
                     /note="ancestral locus Anc_7.534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140391.1"
                     /db_xref="GeneID:59326932"
                     /translation="MADQRGIAYEDLEIQIDDKPNKDGVNVQETLRRLHFQTDQRYHQ
                     VPTEDLEVRRLLRLLREPESTAGENEYARRGRLIELLVSNKAHMNTFEATLLDKQSIA
                     EGSDTYEDEEDEEFYTPARQELIKARKFLVGFSIHNARKRLKRETQDAISFDMKREIK
                     ERRNLAQRLKNLALAGSQVASTRPISHVRLSPDDCYAAIGSWDGSLKTISTKNLEVLS
                     VVEQAHNGKVGEVDWNATGDLLATGGEDGQVKLFSAAAGELRPTIAFEGHERRVAGTK
                     FHPSGKYVASCSFDKTWRLWDIQTQQELLLQEGHSREVYCIAFHSDGALLCSGGFDCT
                     PVAWDIRSGKSVMSLAGHMKPVYSVDWSPNGYHLATAGGDGTVNVWDVRKSTQAQTIL
                     AHDSTVSVVRFNKLNGKFLMSGSYDKNIKVYSSDNWVNVAVLKGHVDKILTLDIDLNG
                     NMVVSGGWDRSVKLWTQD"
     gene            <86835..>87812
                     /locus_tag="HG536_0F00420"
                     /db_xref="GeneID:59326933"
     mRNA            <86835..>87812
                     /locus_tag="HG536_0F00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284496.1"
                     /db_xref="GeneID:59326933"
     CDS             86835..87812
                     /locus_tag="HG536_0F00420"
                     /inference="similar to AA sequence:RefSeq:NP_015502.1"
                     /note="ancestral locus Anc_7.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140392.1"
                     /db_xref="GeneID:59326933"
                     /translation="MTEELRLLKEKHIKYIEALDKKQDSYEYWLTEHLRLNGVYWGLT
                     ALCLMDAENTFDKTQVIDFVLKCYVEATGGFAPFPRHDAHLLTTLSAIQILKTYDSLD
                     ILSPDQVKKCIEFVRGNQLEDGSFQGDKFGEIDIRFVYTALSTLSILESLTPEVVEPA
                     VKFILRCYNFDGGFGLCPGAESHAAWAFTSLGALAIVDRLGDLTDEQLNEIGWWLCER
                     QVPEGGLNGRPGKLPDVCYSWWVLASLALINKLEWIDYEKLREYILRCQDEKKGGISD
                     RPDNEVDVFHTLFGIAGLSLMGFEDLKPIDPVYCMPPSVTKTIRKYPYE"
     gene            complement(<87863..>89914)
                     /locus_tag="HG536_0F00430"
                     /db_xref="GeneID:59326934"
     mRNA            complement(<87863..>89914)
                     /locus_tag="HG536_0F00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284497.1"
                     /db_xref="GeneID:59326934"
     CDS             complement(87863..89914)
                     /locus_tag="HG536_0F00430"
                     /inference="similar to AA sequence:RefSeq:NP_015501.2"
                     /note="ancestral locus Anc_7.532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140393.1"
                     /db_xref="GeneID:59326934"
                     /translation="MLNSGNVLPVKIHPPLLRPMAYRVLSKKYGLNIKSDGLVALADV
                     VGSMFGMHWKKNADTVRFLETFALVWRQQERGLFVDEQGVADVVNEMKERERANEPVP
                     VVESTNKVRNVTIDGMLVKDTQRVSEGESEAAVLVEDSEQQASSVSDLANDQIANEEH
                     LDWRNYFKVINAADQAKVSYDPVKLTFVFTPARRDHNSDFGASLASRICDTNASARVF
                     PNRFHLVRNKVMRNENFQDMDDFNPLSSIVAIQRDLDKSSASVSAAMSITQIKNLLGR
                     DGQNFLLLGLLSRNSKGHWCMEDPSGCIEIDISQTLPTGGLYYVPGCIVLVEGIYFTV
                     GNKFHVSSITHPPGEKREQTLEAIGNLDLLGLHGQTSSNYISRLDNELKIRLYYLEKE
                     LTDHRIVLLGGDIFLDEMDTMQALRKVLTPLDDDPPTMIVFHGSFTAVPVHASMNSKN
                     ISSTVQYRNNFDELADLISQFENIAEASTLVFVPGVNDAWGSMVSMGAAHILPQQPVP
                     SRFTHKLRKVCRKIIFASNPARMAYLSQEIVIIRDDITERFKRHSVPFPMEILAQSHD
                     KSANPEVTAIRQLIKADDQLPMKVRESRKLVKTVLDQGHLSPFLTSIRPIAWSNDNAL
                     TLHPIPSTLIFCDTTAPRFDLTYNGCKALNPGKFMIGRRARYIEYNPSMKKASMEEVF
                     F"
     gene            <90224..>91201
                     /locus_tag="HG536_0F00440"
                     /db_xref="GeneID:59326935"
     mRNA            <90224..>91201
                     /locus_tag="HG536_0F00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284498.1"
                     /db_xref="GeneID:59326935"
     CDS             90224..91201
                     /locus_tag="HG536_0F00440"
                     /inference="similar to AA sequence:RefSeq:NP_013562.3"
                     /note="ancestral locus Anc_7.531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140394.1"
                     /db_xref="GeneID:59326935"
                     /translation="MLESVKKYVGEVLSSDPRKRDFGDLEEVKRRRQRQSPMGQRNRV
                     KLGGRSRIKTHANFAGNGSRRMPRKERMIRYSEGAGANARIREPAGGLKAVWKSLKTF
                     FSSEDQDLGLMQKACTNLDSMVSPSKRLSGAEERRQLKERIARSEAFKRKVLQVKYDS
                     EMLKELRVGRSRQRADETAAHNLSDDQVTLLQKKIAHLESELKNSREDLRITQKRLKF
                     ANEKNALLESLLDDANIDREYVKSRRDIKNIQRDNLIPESELPPSPRRAVNPLYTSSP
                     MRNGSKDESAAATDFYSKYPKIPETEALAKNQKNDSLSPIRIDYSKYSM"
     gene            <91244..>92653
                     /locus_tag="HG536_0F00450"
                     /db_xref="GeneID:59326936"
     mRNA            <91244..>92653
                     /locus_tag="HG536_0F00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284499.1"
                     /db_xref="GeneID:59326936"
     CDS             91244..92653
                     /locus_tag="HG536_0F00450"
                     /inference="similar to AA sequence:RefSeq:NP_015499.1"
                     /note="ancestral locus Anc_7.530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140395.1"
                     /db_xref="GeneID:59326936"
                     /translation="MLSITTLVKELLASIQPYPPKGCSESSPINGCPAELQGFMSTGD
                     FLTKGIELIQKAIDLDTATQYEDAYTAYYNGLDYLMLALKYEKNPKSKELIRTKFTEY
                     LNRAEQLKQHLDAEEENKKSKIDSRGNNGNARKISDDDNSDDSKKLRGALSGAILTEK
                     PNVRWEDIAGLEGAKDALKEAVILPVKFPHLFKGNRKPTAGILLYGPPGTGKSYLAKA
                     VATEANSTFFSISSSDLVSKWMGESERLVKQLFAMARENKPSIIFIDEVDALTGQRGE
                     GESEASRRIKTELLVQMNGVGTDSEGVLVLGATNIPWQLDSAIRRRFEKRIYIPLPDL
                     AARTKMFEINVGETPCSLNKEDFRTLGQMTEGYSGSDIAVAVKDALMQPIRKIQMATH
                     FKDVSDDPHHRRLTPCSPGDEGGFEISWTDIGADELQEPELTIKDFLKAIKTTRPTVN
                     DEDLRKQQQFTNDFGQEGN"
     gene            complement(<92723..>93322)
                     /locus_tag="HG536_0F00460"
                     /db_xref="GeneID:59326937"
     mRNA            complement(<92723..>93322)
                     /locus_tag="HG536_0F00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284500.1"
                     /db_xref="GeneID:59326937"
     CDS             complement(92723..93322)
                     /locus_tag="HG536_0F00460"
                     /inference="similar to AA sequence:RefSeq:NP_013561.1"
                     /note="ancestral locus Anc_7.529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140396.1"
                     /db_xref="GeneID:59326937"
                     /translation="MSLVGKFPDHLIDLIKTSKYVHVATASKDGMPSVSLMNYIYVPS
                     SKTYISSDRSSDYIIFATLDNTEKYANILVNPMVSLLFHDWVTAKNLSVRKHSVSQTP
                     TPEPSHATTTGVPESSKLLNLLQELNQAELFQMSATIRGHGTIIDPSSDESKHYKDLL
                     LRANPDAHVFIQSDKTVIVKVKIESAKVTDNENNTSIYK"
     gene            complement(<93564..>94505)
                     /locus_tag="HG536_0F00470"
                     /db_xref="GeneID:59326938"
     mRNA            complement(<93564..>94505)
                     /locus_tag="HG536_0F00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284501.1"
                     /db_xref="GeneID:59326938"
     CDS             complement(93564..94505)
                     /locus_tag="HG536_0F00470"
                     /inference="similar to AA sequence:RefSeq:NP_013560.3"
                     /note="ancestral locus Anc_7.528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140397.1"
                     /db_xref="GeneID:59326938"
                     /translation="MTKELKTGELVLCKVGSFPPWPAVVVPQRLLRKDVYRKRRPNCA
                     AVCFFNDPTYYWEQPQRLNKLEPTAIEEFLTGNSKAKNQQELLEAYRQARDFTNLHDF
                     LVNRAKEESRFEELKREIGDEEIMAGEDPFLSKTDSKKRKQSSPPASDKRKRTRDDGN
                     NRDGTIHDSSDDSNGRLREQKPNSKRSHTEDEKKNKLDLDRRIEICMLFRRRLQKNLV
                     QRDSSPTDDEIAESHKMLHKIHANVDNKPPFFDLDALRQSKLHKLLKVIVNDSDLEEF
                     HPICKSILMKWAHYISELKAEKAKTEQRSTSSPASGI"
     gene            complement(<94863..>96683)
                     /locus_tag="HG536_0F00480"
                     /db_xref="GeneID:59326939"
     mRNA            complement(<94863..>96683)
                     /locus_tag="HG536_0F00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284502.1"
                     /db_xref="GeneID:59326939"
     CDS             complement(94863..96683)
                     /locus_tag="HG536_0F00480"
                     /inference="similar to AA sequence:RefSeq:NP_015497.1"
                     /note="ancestral locus Anc_7.527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140398.1"
                     /db_xref="GeneID:59326939"
                     /translation="MTRETVELHPVRSPETESFLKRVEEYDSQRRSASKSKPPLKEKP
                     DRLKCSFPEESIEKARRLLEGESPRELDRMRSTRNTFDAPSSELAYKSAYNYEKSFSP
                     PRKHHSLAELGLEVELSPLGGGRSGKTFVVSEEDFLLLQRLKSSKQNDIALLDQEAGK
                     KDYPSRGRPRNEETTPPSFPIRPRLRDKLQIPDDEAEAPSLPARKYRGKMENSLLSGG
                     GSQTERPAKESPVSPPKRKDARPEQTRSLAPPPVSPKHRGTIDYKNLPKNQYQHSANS
                     VTSSSSTFIDSLEKNKLTVISQVSPIKTRERSPVFRKDFVDSVHLSPKLESTLQLTSS
                     KVSLPIFESDSFIKSAIKTTGTSPTGSCIKAQSRPALPKKPIRLQNVGDEKAEDKHDS
                     REENEINNTKLKAIEKPKPKVPVKKDTLVIPKLRPVTVQTRKNENSTDSEVAQLASPK
                     TLKKVEVSNIKKREAVPPEALIKMNQLNRSTSPSRPHDHYNEQTEALAKLGRLRKLKD
                     APPVPKRNISLPEALKKAEMLRNMPNRGKKLSPEQHFRNELNSVLKTPRSEVTSEVAI
                     RDAQIHPTSHLDSGDSAKTLIHPNKTRSRGPKRKLPTKVS"
     gene            complement(<96924..>97327)
                     /locus_tag="HG536_0F00485"
                     /db_xref="GeneID:59326940"
     mRNA            complement(join(<96924..97032,97107..97237,97310..>97327))
                     /locus_tag="HG536_0F00485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284503.1"
                     /db_xref="GeneID:59326940"
     CDS             complement(join(96924..97032,97107..97237,97310..97327))
                     /locus_tag="HG536_0F00485"
                     /inference="similar to AA sequence:RefSeq:NP_001106949.1"
                     /note="ancestral locus Anc_7.526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140399.1"
                     /db_xref="GeneID:59326940"
                     /translation="MKPIVSATSAWACTILSAFGVVILSVIAHLFNTNHESFVGSIND
                     PEDGPAVAHTVFLAALVYLIFFAFCGFQVYLTRRKQSIALR"
     gene            97831..97904
                     /locus_tag="HG536_0Ftrna8I"
                     /db_xref="GeneID:59327391"
     tRNA            97831..97904
                     /locus_tag="HG536_0Ftrna8I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:59327391"
     gene            complement(<97996..>99396)
                     /locus_tag="HG536_0F00490"
                     /db_xref="GeneID:59326941"
     mRNA            complement(<97996..>99396)
                     /locus_tag="HG536_0F00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284504.1"
                     /db_xref="GeneID:59326941"
     CDS             complement(97996..99396)
                     /locus_tag="HG536_0F00490"
                     /inference="similar to AA sequence:RefSeq:NP_015495.2"
                     /note="ancestral locus Anc_7.525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140400.1"
                     /db_xref="GeneID:59326941"
                     /translation="MSIRSAGGRPMGKKSKLPMSAVEEPLAEWRFPQPVFQMVLHPER
                     PMLLCGLADGHVYCYSYDAARLQQTLAENKKQRDRDGQQSLWTCVEAGDEESPEGVRL
                     EWRTRRHRGSVRCMCLDADGTYVYSVGTDNVLKKARSDTGKVVQKVTLREQTCGFTKM
                     AKSATHAYLLLGDEDGNVTVVNSETLKRTNRIVKIHGGDAINDIFQFAKRSVHKYISL
                     GQTTLAYWDARECGDDDAKRKVVVSDNQEDEMLCGAFVDPEAGDTVVCGMGEGVLTVW
                     KPNKNDLEDQMNRIKICQNESVDCVVPTLQDDDAVWCGCSDGKIYKADVKRGRVVEVR
                     THSDDDEVTFIDLDYEYRVVSGGMDKIVLWQSIDEKDASSSESDAEQAPTAESDNDVS
                     SDAEITDDSSSDSEDGTVLVGLSREELIAELDKDLAGDDTDEQKPEEPRKNKNKKRKL
                     AGKQASSHGIAKFEGL"
     gene            complement(<104183..>104845)
                     /locus_tag="HG536_0F00520"
                     /db_xref="GeneID:59326942"
     mRNA            complement(<104183..>104845)
                     /locus_tag="HG536_0F00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284505.1"
                     /db_xref="GeneID:59326942"
     CDS             complement(104183..104845)
                     /locus_tag="HG536_0F00520"
                     /inference="similar to AA sequence:RefSeq:NP_015494.1"
                     /note="ancestral locus Anc_7.524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140401.1"
                     /db_xref="GeneID:59326942"
                     /translation="MPTPHRNRTWWRPSYSSSIRARRQPAGAAHQPGTQPSYRRSASA
                     SPARRCLRSCAASRPDKPPTLHSPDKMSEPGGLQNELAAVEQQVGAVIESFVELGVSV
                     YDFPGTSEASQGMVTNLKRNVDRVARLNRQSCDPRSQLAEVSIPLEVVQYIEDGRNPD
                     IYTREFVEAVRRSNQYQRAKMHGLRQLRDSLAEKIVDEFPDLENCVQSIVRQADGKET
                     SK"
     gene            <104938..>105747
                     /locus_tag="HG536_0F00530"
                     /db_xref="GeneID:59326943"
     mRNA            <104938..>105747
                     /locus_tag="HG536_0F00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284506.1"
                     /db_xref="GeneID:59326943"
     CDS             104938..105747
                     /locus_tag="HG536_0F00530"
                     /inference="similar to AA sequence:RefSeq:NP_015493.1"
                     /note="ancestral locus Anc_7.523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140402.1"
                     /db_xref="GeneID:59326943"
                     /translation="MGASRVFRLNNGVSVTQEQLDHWNRWLSKTSGPQEVIRWAVMTF
                     PHLYQTTAFGLTGLATIDMLAKLRSEDSEVQVPLIFVDTLHHFPQTLDLLAVVQERYY
                     TPVGQQVAVFRPEGCASEKEFAAAHGEFLWERDEDKYDFLVKAEPARRAYKSLGCTAV
                     FTGRRRSQGAARSALQFVEVDELNGIVKINPLADWTFDQVRQYVDDNNVPFNELLNYG
                     YRSIGDYHSTAPVQDGEDERAGRWKGKNKTECGIHETSRFAKYLESTSTAK"
     gene            <105981..>106328
                     /locus_tag="HG536_0F00540"
                     /db_xref="GeneID:59326944"
     mRNA            <105981..>106328
                     /locus_tag="HG536_0F00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284507.1"
                     /db_xref="GeneID:59326944"
     CDS             105981..106328
                     /locus_tag="HG536_0F00540"
                     /inference="similar to AA sequence:RefSeq:NP_015492.1"
                     /note="ancestral locus Anc_7.522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140403.1"
                     /db_xref="GeneID:59326944"
                     /translation="MGNFRFPVKTKLPPGFLNARVIRDNFKRQQFAENEVTTKALKFI
                     ARNTTLPARARLEAQLKLTTMPNYTRLTQIRNRCVETGHARFVLSDFRLCRTQFREKA
                     RKGELPGVKKGVW"
     gene            complement(<106570..>107202)
                     /locus_tag="HG536_0F00550"
                     /db_xref="GeneID:59326945"
     mRNA            complement(<106570..>107202)
                     /locus_tag="HG536_0F00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284508.1"
                     /db_xref="GeneID:59326945"
     CDS             complement(106570..107202)
                     /locus_tag="HG536_0F00550"
                     /inference="similar to AA sequence:RefSeq:NP_015491.1"
                     /note="ancestral locus Anc_7.520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140404.1"
                     /db_xref="GeneID:59326945"
                     /translation="MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVF
                     ENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQE
                     KWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEALKAEGQQPVTSAEGQSVADQIGATG
                     YYECSAKTGYGVREVFEAATRASLMGKSKSNGKTKKNGSEKKKKRKCVLL"
     gene            complement(<107648..>111442)
                     /locus_tag="HG536_0F00560"
                     /db_xref="GeneID:59326946"
     mRNA            complement(<107648..>111442)
                     /locus_tag="HG536_0F00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284509.1"
                     /db_xref="GeneID:59326946"
     CDS             complement(107648..111442)
                     /locus_tag="HG536_0F00560"
                     /inference="similar to AA sequence:RefSeq:NP_015490.1"
                     /note="ancestral locus Anc_7.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140405.1"
                     /db_xref="GeneID:59326946"
                     /translation="MTFENDQRFLNRRDAIWFCFGELSVIQDNDGPLSYHGIDDDVDI
                     SKRVEEDPQVILRAVLPKLYFKRCNTIEGKKPRKCLSLVLPRYRTEERKAPVLITTRN
                     ATSTSDAKPYAHLRAMEEVFDISNDPETLEDSEIEELLHQSPLEGPEGDELEKSSATT
                     LERIYLLVTENSICRVGDVMPLFTHRGIDECQVFNLGDANPIIVVTLTTGHLYGMTIN
                     KTLEYVTLNYCLDLGSDGPWCVRRHQHAKEFMTFNGREGVCKFFEIGNQGQVQAVNNL
                     VLDDCTILECIFFPNENDSHFFLFIAALQSNRLMYYCIEWDTSEPKVKKVHYLTYWTD
                     HTFEACAPLSDNKILVFYVGVLEVISANQLMSGETNFNRSEAGNLRAIRDHFYAPKLL
                     ELLKRERAEEFSKFEHCLVVGALSGHINACLVDGNDQTTIYSLTRFKGLSGLCSMDER
                     ADLDNEYPLIVISYGRTIELFIDIGEMRPTTSANLVSSFSALTFKHTMDSSSEGTSEI
                     MVVPPRKRWGRHASEIWLTSPTAITNFQTSGSLRKVYRICKLRHISFFNSARCYPLNG
                     LQPEFRNRLSRDLGKLGQQAYIIFGTDRTPVSTAPSSTCLTLDLSTAEPQLTEVDDLM
                     IRTDEECFEVFLTSRFLIQVSRRSIYAQSLKFGIDDEPIIYSPGWRIDGVARFEQAVI
                     IWNDKERQMQYIEDINCIDKKEFPAINLSDDGMTGIEEGQLECQLVRGSDGKIIVYLA
                     GNGKLIKLSPNLSGPAKAITLCSGQIKTMTCLKDWLCFIRNGGEIIAVRHSDLSMQSV
                     DLDFQFSDIRLRKMNDCSCLVFSTQEVAVFTLADTDSFRYCFYELNLPYETNVNASIV
                     DVQVDEVNGKVFLQRFDGLHVLEMSYYSWNRSKYILRSTRDMNKKFIFVEKINRMLVV
                     NFDSRKWDCIKLSNGKTLSLNPSVLFEETASLVDVVEIPTEDKSVTLVLNFGKLIKLV
                     HLLPQRGKIIVKQGHKVCFGFPILPFAAIRPDGGLYILRAEHKNETQLDEATILAVEV
                     SETGLKFTQGLTFYIEDVRQIKEFKIYGRDIIVNHAGYNTIFLLKDIRKSMLRKQIKI
                     IALEVDPGFSLRSLHPLNGDCFVAAVQSREPSVTLSHLLFFHRSDVELQSSLDGMPAG
                     QQYDYFERAAAAHTAQVSSRLQNSTDAEAGEDDETDEMDEMDEIDAFARPAQPAPGVR
                     HNDAHLGEPYSTITLAYHVKDLAYDAADQKLLVLATDDSVAVYQLDTGAEHRAAGTPA
                     SV"
     gene            complement(<111651..>119381)
                     /locus_tag="HG536_0F00570"
                     /db_xref="GeneID:59326947"
     mRNA            complement(<111651..>119381)
                     /locus_tag="HG536_0F00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284510.1"
                     /db_xref="GeneID:59326947"
     CDS             complement(111651..119381)
                     /locus_tag="HG536_0F00570"
                     /inference="similar to AA sequence:RefSeq:NP_013559.1"
                     /note="ancestral locus Anc_7.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140406.1"
                     /db_xref="GeneID:59326947"
                     /translation="MVYGEIAIRLILLSILVWIAFRVLLRFAFGVSVSYVNIFRLQIG
                     RLAIRDVLYIGSIQFIPSDKKFLVRDVTIFHRKPGDDVSKKKRNGSSGNLSARLSSLS
                     PRYYQWIIKFIDGLHIMCFNVKLESSQVNLATVRMHPRMVQSRNVLRVSFVMTGLAFN
                     GDVLLEDVSLTSRCQVLTDSVGKGLPLKDLCVDLKVGDVKLPLDSLSSWQTEKKTVEA
                     VEQLTIEERVEAGKHYLISTINQVCDSLQALTRFTASIDQISIEMIPMTSEPDLVALN
                     EFLSLDVFVETFFLNVERIDTSVPGFKLLFREDDTPFKFNSTLSGFSVSMNVKETCNS
                     AQLQNFKVLEVPNVSLFGSSNLLSQRFAYGESGELENAVCSIKGHISSPTVDVDVDHL
                     SFYKCFKSNISVFKSILAPPECTRYKESYSTFLISKKITFEYFKALLPLINIKMTLED
                     PRLVVSDQKDFLIHKLSALMLNYETQRFNADEDDKKNQVHHAVNCSIEMIGLTSQHVV
                     QEFDYVHTILVIDSIAWKNSIKIIPELLFAAQINVDTFTVDLSELPTMIVLNAIFKKL
                     DSRYLDVEQNYFMDYYRKFAETLSETEKECSKIGRSLKCQKILPSELFFQELPELFDY
                     FKIDFRQVQFTFGARSVFMPPCVFSNIDPQSSEDFVDGRLRKYCLETDKIQIALFGNR
                     TQWHNKVETGRTTMSKSGQAGSYKHYQNEGLDDISTSEETEVQHLWNFNTLINDLSST
                     IISETTCANNELSARKVSKVAVLSIKVFPETSTFEADGDRYIAVQVENKRLKSVLSLM
                     NLFLIISGVHTVKQIFGHDVCSHSRESLAKKHFMAVSQKRRKRFYHYIKWAELKNLLQ
                     FNISSELITNIFVLPNGLTARFQATSVFLTLKDLTEFSLNGQQLQLCIESPLVPNHWV
                     RLLTVLRYNISLNADAIIEQMGSGFGSFESLSPAVILENEMWHISIPHKFELYTLIDN
                     IPTVYKTLKQMIHSFKTSKNDCVIFPHPVKSPSLPKVKLKSKRWLFSIEDDPFEAELN
                     MICQIGLEEQKSRLAKLEEFERRTAAEVLKQTQSKVSESQKMASIKVSDIIQRIRALK
                     RRFHLKASNSLTHPDHKNDMNINEEKVEEHEIFISSEIEDAYNRLLENFSTSWINRIM
                     HYKQKEKDEYDKNFPFLWGEFDTTTLPEDFNHRVLPFRTHPFLANLIVEGIDVDIFQP
                     SFGIDGIADFIHEVGKGAPKDAEYTIMLPMYFNFKFTELRWHLKDYPLPLVYIPPLGM
                     TQVGISGNHFHGDLIIAEDMIRSSNEVREVFVPLVPSSDGGKDSYYSITVPRTLTSAK
                     LYTKLDFDIYSNGTTQVTWGGGYQPAIQQTMQCLDNFSKPPIDPSPKLGFWDKLRYIF
                     HARVKVSWKKKGKFDVCLKGGKSPYKIGPDAAGFILGFAENVMLDCNEKDDPLDFLSC
                     KADTVHFSTPNHFARPLLVWSRPSDQTVFIPSHDNTNLQQHASFYYLLDLEKTTKEAS
                     ERATMASRYIEKTGISLAGGVLLKVGIVLERLIKGSLERSRSFKPHYEARLCNPRAVP
                     DPDKHDSYAKFRSHFIHMSFLLLSRSDSAYNTMQLSPASIHLFMNWWRSFAGNLPVRR
                     GQLFGFQSISPKFGEHLCTISYHADVSPLYITHLAHSIHNSHELRKSNRETIEFSGLK
                     AKTDNFVMDLHQRKEVMLKYQEGLDKTKKIMSLKLLEGDISTVELDIRAIEASFRLAK
                     FIEEKAEAKFNIPDGDMSWYDPSDFKEVNFIDIENYVPDLKMVRLLYARQFMYLRRAA
                     YGDTFQVDPATHKRIVPFKNNLSHKCVLGEPLKLPFVSLKKRRDLLIKHKKSLEEKIH
                     SPEGRSNIELLKHNLEESDRAICGVDQMLEDCNSLNKLAMGFDKSEVEFNYPFVEKLQ
                     SSVISAREFENRYHVCGMLLRWNEDTRNIVFKYLHYRSLTRQFASLTEQHCLKIISKI
                     INSETSHQENESQSSKLDFNRGTQFAEDLNNATEETVNKILEDIFNNGISKLGSDTEY
                     AVQHNHIVQFINPQIQLISDKAADTCLVVTTPTIMLKVLSFGVERAKYDDDVFLRRYG
                     IHFTKANVFHFSKSDYEFDDQDLLEMDFAIDGYGQDKGVQWPPWLSINLCLEPTALAS
                     NAIMKDLSAVVIYDNASQFTNVYALKQGNFKDTVSVYIPKIILTSDSKRYMTLYSMIT
                     NLLIYMEPENAELRKQIEKWTLGYYPEDVSQMHRLVSEIHRNLKMLSDIENEFSFRRP
                     ILDEADKMEFDTVRNERADNLLRLYILMRVFSSGLGPAENQSRTLLWNAHLKETIFHM
                     LESDSSPFVDVAVAKLHFQREESSNGFNKSSITAEMAQVFHLQRNATYKNVLGPYIPN
                     NRYSKSDEHLIKISWVMNRPIGGIKVIKHAETNLADFSLGLEEETINRLIAWLVPKED
                     LSMKMNGQKEQQEQADVESAYDVELADDYMNFSGEKGPDLREMVQRSGVFFIIENITI
                     NSFLLCISFRGRGAKRMINVTDFMFHFPKLTFENQTMRLIDLFMHLRKMILKDIIRHA
                     VKFLETKVRNHPPKLTDDMPLKQLSRYESYTHAEDLQD"
     gene            complement(<119876..>123424)
                     /locus_tag="HG536_0F00580"
                     /db_xref="GeneID:59326948"
     mRNA            complement(<119876..>123424)
                     /locus_tag="HG536_0F00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284511.1"
                     /db_xref="GeneID:59326948"
     CDS             complement(119876..123424)
                     /locus_tag="HG536_0F00580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140407.1"
                     /db_xref="GeneID:59326948"
                     /translation="MLHSLSSVLLLLLASEAATGVIAVAASSDASIAPDAPAAEGMKP
                     SKSKPSHVDPPTGKPSEPPESERPTSKPPSSKPPTSAPPTSQPPSSKPPTSQPPSSGP
                     PTSKPPTSAPPTSAPPTSKPPTSGPPTSQPPSSKPPTSQPPSSKPPTSGPPTSQPPSS
                     KPPTSQPPTSGPPTSKPPTSAPPTSQPPSSKPPTSQPPTSGPSTSKPPTSGPSTSKPP
                     TSGPPTSGPPTSKPPTSGPSTSKPSTSGPPTSKPPTSGPPTSKPPTSGPSTSKPPTSG
                     PPTSGPPTSKPPTSGPSTSKPPTSGPPTSGPPTSKPPTSGPPTSGPPTSKPPTSGPPT
                     SKPPTSKPPTSGPPTSGPPTSKPPTSKPPTSGPPTSGPPTSKPPTSGPPTSKPPTSGP
                     PTSKPPTSGPPTSGPSTSKPPTSGPPTSKPPTSGPPTSKPPTSGPPTSKPPTSGPPTS
                     KPPTSKPPTSGPSTSKPPTSGPPTSKPPTSGPPTSKPPTSGPPTSKPPTSGPPTSKPP
                     TSKPPTSGPSTSKPPTSGPPTSGPPTSKPPTSKPPTSGPPTSGPPTSKPPTSGPPTSK
                     PPTSKPPTSGPPTSGPPTSKPPTSKPPTSGPPTSGPPTSKPPTSGPPTSKPPTSGPPT
                     SKPPTSGPPTSGPSTSKPPTSGPPTSGPPTSKPPTSGPSTSKPPTSGPPTSKPPTSGP
                     STSQLPSSKPPTSGPPTSKPLTSGPPTSVPPTSKPSTSGAPTSKPPTSGSSTLKPSGS
                     SNSIVPPSYTTSTITTTVSGVTTVYTTTCPLTLSTVTTTVSGTKSIYTTLCPITTTPA
                     YTTSTVTTTVSGIPTVYTTTCPLTLSTVTTTVSGTKSIYTTLCPITTTPAYTTSTVTT
                     TVSGIPTVYTTTCPLTLSTVTTTVSGTKSIYTTLCPITTTPAYTTSTVTTTVSGIPTV
                     YTTTCPLTLSTVTTTVSGTKSIYTTLCPITTTPAYTTSTVTTTVSGIPTVYTTTCPLT
                     LSTVTTTVSGTKSIYTTLCPITTTPPKVTISGTTVINGLTTLYTTICPYSTTVRVEGG
                     KVETLTTTYQPWVPYATVQNGDTVTVTKECTECRPQTTTYYSTEGAQTHTYTKVYVPA
                     TTYLTVEGGTTIYTSTKGTPQTSTYLTTTGGVTKVSTILYTEAPPTTAPASTTASVAT
                     PASQSSTSQATIFQGIANKLGAGLSGLALAAPLLLL"
     gene            <124551..>125849
                     /locus_tag="HG536_0F00590"
                     /db_xref="GeneID:59326949"
     mRNA            <124551..>125849
                     /locus_tag="HG536_0F00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284512.1"
                     /db_xref="GeneID:59326949"
     CDS             124551..125849
                     /locus_tag="HG536_0F00590"
                     /inference="similar to AA sequence:RefSeq:NP_015489.1"
                     /note="ancestral locus Anc_7.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140408.1"
                     /db_xref="GeneID:59326949"
                     /translation="MAPPKKTVKMDLNSFLNDDTFGSSWAEEEVDLNKITIPIENLKA
                     NTIPLEELAAAKSSGVGGGNFRGSRLDPALGGGRRDFSDRVEYPVPDHPPYRAIINNI
                     PWDISPEGVQAWVEDGLQKPGSVEEADLPRSMKDPTRLKGIAFITLKEREDLVQTLTF
                     NGTKLNERTVYVSVAAPRREGFRGGDDFDWNGARGSNFQASRDSAGPELDWGAARGSN
                     YQERRERREEPNLDWGAARGSNYQERRERREEPNLDWGAARGSNYQERRERREEPNLD
                     WSAARGSNYQERREKREEPNLDWSAARGSQFQERKPRREEPNLDWSASRGSQFRERKP
                     RKEEPELDWGAARSAQIPERKPRVNVNRKVAATETTEDKPKIQKSAFDVLSNEDEDDE
                     ESEQQEEAAEEKKAPVDQLAQKTSKLSVEDNGEWETVGKN"
     gene            <126087..>127832
                     /locus_tag="HG536_0F00600"
                     /db_xref="GeneID:59326950"
     mRNA            <126087..>127832
                     /locus_tag="HG536_0F00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284513.1"
                     /db_xref="GeneID:59326950"
     CDS             126087..127832
                     /locus_tag="HG536_0F00600"
                     /inference="similar to AA sequence:RefSeq:NP_015488.1"
                     /note="ancestral locus Anc_7.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140409.1"
                     /db_xref="GeneID:59326950"
                     /translation="MEAVDSEFGSLRKSKGKASSGRILKDSAIDHEQKSMLQKLTLLP
                     IKKVSSNKVKKPNHISETRESTSLAEMLIERQSENMRMVRKTPASDLAVSRKLAKPLD
                     PDFKRFKHHLLRAIYQGLPSQDIKVPSYLQDVQAELNRILSQAIVQKESHSTIIVGPR
                     ESYKTFLLDHEMALLANEYAGQFITIRLNGFIHSEQSAINGIATQFEQQLRKLRGTTD
                     DTANGSDISSGSLTEVFEKILRVLDSTSIRNQNRSQKNGAVMKITVVFIFDEIDTFAG
                     PVRQSLLYNLFDMVEHAKVPVCIFGCTTKLNILEYLEKRVKSRFSQRIIYMPQIESLE
                     QFVELTGELLTVSRPSEYKYAGLWNQKVKETLADEKGNFYKLAKINYETFRSLPHFKN
                     GIVPLIYGAEDFESLCKSLETCDIINKYEINQLGSSLSATVASLSDLQLAILICAARA
                     ALKAKDEVMNFNLTYAEYESMTKSLNARIPTVAHAGTSRDASSVLLDSAIKLWKKKDV
                     KNVWETLISLNLLTEKSAIGLRESAMAVFYASNYQLQGTTIPFDLRQYQTHVTLSDLR
                     RIVPSSSLYYPWTQL"
     gene            <128219..>130099
                     /locus_tag="HG536_0F00610"
                     /db_xref="GeneID:59326951"
     mRNA            <128219..>130099
                     /locus_tag="HG536_0F00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284514.1"
                     /db_xref="GeneID:59326951"
     CDS             128219..130099
                     /locus_tag="HG536_0F00610"
                     /inference="similar to AA sequence:RefSeq:NP_015487.1"
                     /note="ancestral locus Anc_7.515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140410.1"
                     /db_xref="GeneID:59326951"
                     /translation="MEAARKTDFKYKIGKVKQTPSVQKDPKTGLSFIQLKATPDEKVY
                     GCTKFSGHYKEEKKLGQGTFGEVYKGTHLETQRQVAMKRIIINVEKDLFPITAQREIT
                     ILRRLDHKNVIKLIEVVYDYSPSAGDHSEQQQPSTKSSLSKSFYMILPYMVSDLSGIL
                     HNPRINLQLSDIKNMMLQLLEGINYIHCQKYMHRDIKAANILIDHNGVLKLADFGLAR
                     VYYGAPPNLRFPGGAGSGAKYTSVVVTRWYRAPELVLGDKTYTTAVDIWGVGCVFAEF
                     FEKKPILQGSSDIDQGHVIFKLLGTPSEADWPLARYLPGAELTRTKYPGNLKERFGSF
                     LSDAGLDFLRKLLALDPYKRLTAMSAVHHPFFKEDPLPSDRLALPNEESHESDIKRYK
                     EEMQQAMSQKAPSAPQGHVIETGNFPKAPKPPLPKAPARNAFPKGPAAMPGAKAPLKG
                     HSNSQPQNRTSSRYENGTGVASNAGYRAGPTGGYRETSRYNPNAVPRNPNVHPRVPPR
                     PQGSRYDARPAATAGFNQTRPRLEFSTDRSKTSSQDPIDKKAETKRWAAQPKAAPQDP
                     LQMYPALPQAPAKSSSNANQHPNQDQAQQDANTVPSGSPVEPHPENQSGSKGPSNIAD
                     FY"
     gene            <130386..>132527
                     /locus_tag="HG536_0F00620"
                     /db_xref="GeneID:59326952"
     mRNA            <130386..>132527
                     /locus_tag="HG536_0F00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284515.1"
                     /db_xref="GeneID:59326952"
     CDS             130386..132527
                     /locus_tag="HG536_0F00620"
                     /inference="similar to AA sequence:RefSeq:NP_013557.1"
                     /note="ancestral locus Anc_7.514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140411.1"
                     /db_xref="GeneID:59326952"
                     /translation="MLRHSRSYYRIGDRRKKNSIYCCTGGMNYSNLGGRSSRTFTRTP
                     SGMTFTEDIKAIFSVLIICLDLKDESKPSRRWYMPLQKTSYPYSFSFEEGVDRMQDLK
                     LTVDMTTTSVDISFKIQPEVACQLIETFMEAKLLHTPADRTRNAPKPKCILQPTPKGV
                     SILQKYVRDIGLKNLPSILFSDCNSMELFTFERSSVTDSIIYSDPLVYILLNKMMGPS
                     PNVWSPTNSYERIPSLSKLLEYNTDIFSFENVSYRGCEGLSSQKREQSPSWLDQVPEE
                     RLHDENRVSPLAHKFFTNPDSDSHVQYYSIDAGLRICKSKVFGNPKVVFDYCFTTKAI
                     WQWIMDCTDIMHPKDAVSAAALFLKAGLIVPISLPPSDNPCRKFCISRTSYYTLTRRA
                     WDIVQWNTAKGIRASISKISNGESDLQDEQTSASSLTICADDSKGMKRPASSILDSDG
                     RACTPGYQVKGIDDILRDPGMKYLFRQHLENEFCSENLEAFIDIKKFLRKMGLLKKLI
                     QSKKATDLKSKKARARCSGSNIRAAIDSALARQANECLELGYHIYSSYIVINSPYQLN
                     IDHGLREAINAVMLHSEPASTSDLGFHLETSKDNEKLSIEYQMNALLPSVESIPDQKS
                     SLTQCVEGHGCASNDSSSGKGEGNKKISNVAGSFTEDKKLSKTFNVLKELYPLLETVN
                     RDLYHLMRKDSLQKFKASSLYQEAVSFMEIT"
     gene            complement(<132904..>134472)
                     /locus_tag="HG536_0F00630"
                     /db_xref="GeneID:59326953"
     mRNA            complement(<132904..>134472)
                     /locus_tag="HG536_0F00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284516.1"
                     /db_xref="GeneID:59326953"
     CDS             complement(132904..134472)
                     /locus_tag="HG536_0F00630"
                     /inference="similar to AA sequence:RefSeq:NP_010942.1"
                     /note="ancestral locus Anc_7.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140412.1"
                     /db_xref="GeneID:59326953"
                     /translation="MSDLQDREPSIIINGNLEPEVEAEFEEDHIGEEVDQVEDEKPKK
                     KVTFGGLEEADDEEKRKREFEEGGGLPEQPENPDFSKLNPCSPEIINRQATVNIGTIG
                     HVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCQDPTCPEPDCYRSFK
                     SDKEINPKCQRPGCAGRYKLIRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNES
                     CPQPQTSEHLAAIEIMKLKNVIILQNKVDLMREESALEHEKSILKFIRGTIADGAPIV
                     PISAQLKYNIDAVNEFIAKTIPVPPRDFMISPRLIVIRSFDVNKPGAEIDDLKGGVAG
                     GSILNGVFKLGDEIEIRPGIVTKDERGKIQCRPIFSNIVSLFAEQNDLKFAVPGGLIG
                     VGTKVDPTLCRADRLVGQVVGAKGHLPNIYTDIEINYFLLRRLLGVKTDGQKQAKVRK
                     LEPNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEVNEKIALSRRIEKHWRLIG
                     WATIKRGTTLEPVF"
     gene            complement(<134695..>137241)
                     /locus_tag="HG536_0F00640"
                     /db_xref="GeneID:59326954"
     mRNA            complement(<134695..>137241)
                     /locus_tag="HG536_0F00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284517.1"
                     /db_xref="GeneID:59326954"
     CDS             complement(134695..137241)
                     /locus_tag="HG536_0F00640"
                     /inference="similar to AA sequence:RefSeq:NP_013556.3"
                     /note="ancestral locus Anc_7.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140413.1"
                     /db_xref="GeneID:59326954"
                     /translation="MSTSQSESDQSVFEGNGATRRISSAVGGIGRKKFACVECRQQKS
                     KCDAHERAPKPCTKCAKKGVPCILKKDFRRTYKRARNEAIEKRFKELTRTLTNLSSEE
                     ILKRIEQEQQALLNGQNFTKEKVKHLKRTVPSESSALYAVSPLVIEGSSNDDAAFADR
                     SNAEAAAPSDVLTEEQLKCSPKSLGDIHMSSRDIAELFQEFVTKYHPFLPVVDISKGA
                     ERIYTLSPCLFWVILLIGLRRRFGATDLMIRLSSLVKSILAEITISPIIRYTPSEADE
                     PVLNVASVYSVQAFLLYTFWPPLTSSLSADTSWNTIGTAMFQAIRVGLNCAEFSKEYA
                     TANSELINEQVRTWVCCNVVSQIIASSFGFPAYVSFDHTVVNAARENQDSHKHHRMPS
                     AIKQMAQIAHFEYQVISTMNSNPASELGMVASEQKQPLLQVLNQQLTQLEANLRDSKM
                     DSIGKFLLLVAKVHLLTYYFTDSLSSLKKDFTDVRLMSLSEIESNFETKRGLVRVYNA
                     AIDLLNHSTSMWQRDPTIIKYFPGVFVLNIWQSACIISKLAHSSLSAVLDRDRGKKAY
                     QDAISLTFNASVLKHDMAYRSSAIMRSIWSMFANMHADWQKGKDSREEKVASDFNLGI
                     SIKSRMSVSVFFDSLSILREKCGMAKVRREAVNDEDYEEDDDEDEPLRRSEEHDSAPT
                     RTSSRERRLSTVRHPEESARKIIKTIPLDPNPINAAHGSPGSSLTSPSSQATEVLSLN
                     GILSNRSPRDRLDSSLFTGPDTTASHALEPRGGPPVPSLFSPPQHSTETAQDGPDNQA
                     FDDQAPPKQDDDTLPQSPPFLMEHWDNWESDSVWKDVDILMNEFAFNPTV"
     gene            <137504..>138817
                     /locus_tag="HG536_0F00650"
                     /db_xref="GeneID:59326955"
     mRNA            <137504..>138817
                     /locus_tag="HG536_0F00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284518.1"
                     /db_xref="GeneID:59326955"
     CDS             137504..138817
                     /locus_tag="HG536_0F00650"
                     /inference="similar to AA sequence:RefSeq:NP_012658.3"
                     /note="ancestral locus Anc_7.511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140414.1"
                     /db_xref="GeneID:59326955"
                     /translation="MNVLREISSASRDIKLLWASVFFRLFAYGLTNQVLTLFLNGINL
                     EESEIGVFMSLTLIGDVLCSYVLTWYADSWGRRRILVYGSVMMVLSGIAFAYSENFHV
                     LLFFAIIGVISPSSDEVGPFKSVEESMIAHLTPNNRRPEVYAIHALVGTTGAALGAIA
                     CGAFIDVVKYTGMYTEDLQCYKLVFLVYALLAFVKVIIMLFLSDRTELDCDHAELSSP
                     EALIEDEMAPLMQSAEQRNRGLSKDTKSILIKLLVIFMVDSLGMGFMTSGWMVYYYAK
                     QFLMSSFALGTLFFVSKIVTASSTIPSSAIAKTLGPVKATLLVQVASGVFSILIPLAH
                     NCLPLSILLLNLHFATTAMDVTPRQILLTNLIMPQDLTKVMGVVNIGKTLARCVGPVF
                     TGLLASADRLWLCYVISGGLVICADCLLAFWFLHVDLELTKQLNS"
     gene            complement(<138905..>141568)
                     /locus_tag="HG536_0F00660"
                     /db_xref="GeneID:59326956"
     mRNA            complement(<138905..>141568)
                     /locus_tag="HG536_0F00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284519.1"
                     /db_xref="GeneID:59326956"
     CDS             complement(138905..141568)
                     /locus_tag="HG536_0F00660"
                     /inference="similar to AA sequence:RefSeq:NP_010941.1"
                     /note="ancestral locus Anc_7.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140415.1"
                     /db_xref="GeneID:59326956"
                     /translation="MSAVSMSSSKVLEENVGTFTYEQDLPKLPLPEVKRTLEEFERSL
                     QPLYCSDGFCNRTEAEQLREFAEGVDEFSRSEVAEKLQSKLREFDAENDCYLDNIHLD
                     INNNTFRDEQDDLLPRNPFLVLADDAQPGISQADRSAVLVYSALRFVSALRHGVLPPD
                     VNARSGRPLSMRAYKNLFGTTRCPVFTAGEVENFDLEKPYSESDLDEIWQTTDDEDDA
                     ELSSLPPSIDQSIPGSPPPGVHRDVFTRHGITLKNYPESKHILVISKGQYYTLDVLDG
                     DDDLIYNVSSLASVFDFILEDSHEPYTFKKSTALGSLTSYSFRNWKYARKRLQKKYPD
                     ELRMIDSALFVLVLDQSFPSDSGNETISPTTSEDCKRLFYGTSVIDERGHQVGSCISR
                     WYDKLQLIVTADSKAAVIWDSFTCDGSIVLRFTSETYTESVLRLARDVNAGDPRFSLW
                     PSVKESNMLASANSSKTETDLKSSVKKIVWDFSHILNTHVHLSETKLADLISKHDIFH
                     VSIPFGRRSAQRLGINPDSMVQVALQVAHYALYGRMVYGLEPISTRGYKNSRSCFINI
                     QSMELLELCQEFISNSVDESGKLRKFREACEIHSDKIKKAKLGDSHEKHYNALRYLYK
                     FHEYFGINLDSNDKRMAEQVFDNSLVTSFSAPELIVANCGNAATTTFGITPAVSQGFG
                     IGYIIKDDQCDLTVTSQFRQGGRLMYMLNWVLSEIRAFWKNTNESSYNKAGVKISPVI
                     DKLYEMDNALNNLKSSRKNGSSKVIRGYGFFDMHGHMDSRSSSRINSQSNSSVHLSDM
                     TSNVSLNNGSLHIPKHSSAALSVPTDKEKQDTGYEIQQIQPIDKNESDEDMLFTESRT
                     ATRRRNNVINSKFEIDFDRSGVGRKVEATFD"
     gene            complement(<142074..>142751)
                     /locus_tag="HG536_0F00670"
                     /db_xref="GeneID:59326957"
     mRNA            complement(<142074..>142751)
                     /locus_tag="HG536_0F00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284520.1"
                     /db_xref="GeneID:59326957"
     CDS             complement(142074..142751)
                     /locus_tag="HG536_0F00670"
                     /inference="similar to AA sequence:RefSeq:NP_012657.1"
                     /note="ancestral locus Anc_7.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140416.1"
                     /db_xref="GeneID:59326957"
                     /translation="MSDTEAPVEVQEEFEVVEEFTPVALATPIPEEVQQAQNGIKLFN
                     KWSFEDVEVKDASLVDYIQVRQPIFVSHTAGRYANKRFRKAQCPIIERLTNSLMMNGR
                     NNGKKLKAVRIVKHTLDIINILTDQNPLQVVVDAITNTGPREDTTRVGGGGAARRQAV
                     DVSPLRRVNQAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELE
                     RVAKSNR"
     gene            complement(<143262..>144635)
                     /locus_tag="HG536_0F00680"
                     /db_xref="GeneID:59326958"
     mRNA            complement(<143262..>144635)
                     /locus_tag="HG536_0F00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284521.1"
                     /db_xref="GeneID:59326958"
     CDS             complement(143262..144635)
                     /locus_tag="HG536_0F00680"
                     /inference="similar to AA sequence:RefSeq:NP_012656.1"
                     /note="ancestral locus Anc_7.508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140417.1"
                     /db_xref="GeneID:59326958"
                     /translation="MTVWRKCLSLGARYLSTSAESSRGLIQYSRTTDKSYIRIRGPDS
                     PKFLNGLLTSKIVPFFTKKNLTTINPDQGQDPNANTVPQFDETGRNWGIYNELSYNGS
                     YISRFGQYSGILNSKGKLVTDTIVYPVPLTCLTQRSERYPEYLLEFDTSIVDHILNLF
                     QIHKLTSKVRIMKTEDLISWDLSIRLPSESQNPWIANLLDPSTMTKTPEEALFFAKSV
                     GSALFNGNESSVVALYIERRTDEILETHGSAAQCFRVVTDSDVPDISQILNPVGLPFS
                     FTVEKKEPSYFRKLRFEAGYVDSARDFKPETLLPLELNFDYLPNAVSADKGCYVGQEL
                     TARTFATGILRKRLVPVTLTNSNELSLLSDDKRYPEILIDSKHDNNSLASVSTPFGAT
                     PSKPRRSRPAGSLIAYEGDKGVALLRIEHFKKAFEGDQEEKLFHVKVDGKIVEINPRK
                     PFWLEGN"
     gene            complement(<144955..>146451)
                     /locus_tag="HG536_0F00690"
                     /db_xref="GeneID:59326959"
     mRNA            complement(<144955..>146451)
                     /locus_tag="HG536_0F00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284522.1"
                     /db_xref="GeneID:59326959"
     CDS             complement(144955..146451)
                     /locus_tag="HG536_0F00690"
                     /inference="similar to AA sequence:RefSeq:NP_012655.3"
                     /note="ancestral locus Anc_7.507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140418.1"
                     /db_xref="GeneID:59326959"
                     /translation="MVLIPNSSRVALQAAKHFTSIRGLATAAPVAGKVRAVIGAIVDV
                     QFEQENLPAILNALEIERPNGKLVLEVAQHLGENTVRTIAMDGTEGLVRGDKVLDTGA
                     PISVPVGPETLGRIINVIGEPIDERGPIKAKERRPIHAEPPEFVEQSTAAEVLETGIK
                     VVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDL
                     YREMRETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDAEGQDVLLFI
                     DNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVP
                     ADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVA
                     TKVQETLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIEG
                     KLVRLKDTVASFKAVLEGKYDHLPENAFYMVGGIEDVVAKAEKMAASA"
     gene            complement(<146949..>147803)
                     /locus_tag="HG536_0F00700"
                     /db_xref="GeneID:59326960"
     mRNA            complement(<146949..>147803)
                     /locus_tag="HG536_0F00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284523.1"
                     /db_xref="GeneID:59326960"
     CDS             complement(146949..147803)
                     /locus_tag="HG536_0F00700"
                     /inference="similar to AA sequence:RefSeq:NP_010940.3"
                     /note="ancestral locus Anc_7.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140419.1"
                     /db_xref="GeneID:59326960"
                     /translation="MGYTLTILGCGVMGQALLSAIYNAPKAAEETAHFYPSTIITCNH
                     DELSTKQVVDLVATFGESPNGIQVESSYGQNEEAVKRASVVILATKPFYVEPVLNECR
                     YPYEKHLISLAAGWTISQLRGYWGGRVSRVMTNTPAKYGYGCAVVSHAPEVNSKEKQL
                     VAQLISHVGKYIELPEKNMDAATALVGSGPAFVLLMIESLMESGIQMGIPLKESKECA
                     LKVLEGTVKMVEKSGEHPSALKHQVCTPGGTTIAGLCVMEDRGVKSGIIRGVEEASKV
                     AAQLGQKK"
     gene            <147997..>150339
                     /locus_tag="HG536_0F00710"
                     /db_xref="GeneID:59326961"
     mRNA            <147997..>150339
                     /locus_tag="HG536_0F00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284524.1"
                     /db_xref="GeneID:59326961"
     CDS             147997..150339
                     /locus_tag="HG536_0F00710"
                     /inference="similar to AA sequence:RefSeq:NP_012653.1"
                     /note="ancestral locus Anc_7.505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140420.1"
                     /db_xref="GeneID:59326961"
                     /translation="MELIPTLCPTAEEFSNPIEYLSEPKIQRIGHIYGMVKIKPPEGF
                     NPPFSINKDSFKFNVRIQHLAELNITNRGRMFFMKQLNNYHRAQRGKRSQKLTKPYIV
                     CSGNQRLYFYDLFLNILGHLSPKSGPDVKREYTSKRKRGRSSSNSCTDGNTASVAPLA
                     PLQDLLSDTNLWRSISRILKIPAQELQSVFEQYISKYYSYLALQAKIRGAADFTKLLY
                     TEEYPKSLLSDDESEESSSEEEGNDEEGCVVCDLPNKPTKMILCDSCDKPFHLACLTP
                     PLISIPKGEWICNNCIVGNGYYGFREESRFYTLSEFQQQCNARQQELTVDPVTGKRLS
                     VEEMETKFWNYVNNLENSITVKYGADINGVEPGEISGFPSLAYVPENLSESQKREFAA
                     YTDHPMNLLNLPNAKGSLLPMFDRKISGMTVPWIYVGSTFSTFCWHLEDQYTLSANYQ
                     HEGAPKIWYSIPEYSSADFNNLMKNLAPDLFDKQPDLLHQLVTLISPYDKRFKDAKIK
                     CFKAVQNPNEYIITFPKCYHAGFNSGYNFNEAVNFTLDSWVPYGIEAIGDYQLTGKQC
                     VFDMFELMLNVVIEFLKGNSFFQKKEGLLRTSYSELLDLLNSKTKLIKQLPDISVNDT
                     FLKEIVRNSGSKGVVNKIPSPKAEADGSALFKSQADHIGSEDFDVFCTKCHTICFLAF
                     IIHYKSPVTRKRRKMHSLNATQINALKRERGLEVLCLKDYLKLVNETYDKHGDDGDKY
                     NDNNDNNDPFKNDVLNYIRDPQEIRDILRAAGLKIERAKI"
     gene            <150561..>151118
                     /locus_tag="HG536_0F00720"
                     /db_xref="GeneID:59326962"
     mRNA            <150561..>151118
                     /locus_tag="HG536_0F00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284525.1"
                     /db_xref="GeneID:59326962"
     CDS             150561..151118
                     /locus_tag="HG536_0F00720"
                     /inference="similar to AA sequence:RefSeq:NP_012652.3"
                     /note="ancestral locus Anc_7.504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140421.1"
                     /db_xref="GeneID:59326962"
                     /translation="MAAISSVNGLFFRVTFLFSLAFFCFKNVNSVLQNSYMLVFTQAM
                     NLPGLAISQYSAQLGLFGILFLFASISDLIPLLENNKKYFHSIVPLRLTIFFALTACS
                     YLWESNLYLHNNAVFTYCFIEVWVNFVILGALREERNEELKSQNRYSNDAAMEDELED
                     ENSNIVLTSAQEIEQIEELPGDSNN"
     gene            complement(<151199..>153205)
                     /locus_tag="HG536_0F00730"
                     /db_xref="GeneID:59326963"
     mRNA            complement(<151199..>153205)
                     /locus_tag="HG536_0F00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284526.1"
                     /db_xref="GeneID:59326963"
     CDS             complement(151199..153205)
                     /locus_tag="HG536_0F00730"
                     /inference="similar to AA sequence:RefSeq:NP_010939.1"
                     /note="ancestral locus Anc_7.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140422.1"
                     /db_xref="GeneID:59326963"
                     /translation="MERDSENGNDENISVDSGIQLALDPDLISLPLNSSTVTPATTIA
                     DATGDDKLDGQKTTANASENLVFPMGRRNNEQALFRNPYAIFKQMPMQEFIPLLLHQR
                     GPGFKFADLSEKDLIEEIKKEQQTTAAEETALPELSAADQDDDSAMDVDSTSNLTRET
                     DGSGKDEHSRDRFEEEEELMSQEQFLTARKEMVEHVNLALNESSLALEFLSLLLSSVR
                     ESAGTASMSPFLKKTVPVGSLNSDKLPLAHQTREEIVSSEILSRGWKLRSLNESRSLL
                     KEKYSSLCKIIEREHQYWTKISKHTSNKDVLFKMRDRVNGMRLLGIKYGYEDSGSTYK
                     HDRGIAVLRNNPELNILELVPSNTTETSEVNHNERFVRVRIFTKIASEDDYILTGESS
                     VNKLFSSHDNFNGLEDIENQINKLKAFAFEQELMYQLKKESSRLISYGVTIESESKIV
                     MELPNEKFEVELISRDDNSVVNHDQDAPKVNDRRATLMVTTLRLLLVVMFKKNLRQRL
                     TSSTRPQSSKGFKDVLLLRPILGRLRHHNYKILLKKILRDYVLDIIEGSSINEFSSDN
                     PKSGATKALDDNIAKLSKEINAFGCLLNTSSTSFRVDVPGKGTLLLVLESPNYCNAVV
                     TIKFESSSNKVSFDTSFSEFKEIEEFLHFVVTEYMKDKESVKRE"
     gene            complement(<153430..>154947)
                     /locus_tag="HG536_0F00740"
                     /db_xref="GeneID:59326964"
     mRNA            complement(<153430..>154947)
                     /locus_tag="HG536_0F00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284527.1"
                     /db_xref="GeneID:59326964"
     CDS             complement(153430..154947)
                     /locus_tag="HG536_0F00740"
                     /inference="similar to AA sequence:RefSeq:NP_010938.1"
                     /note="ancestral locus Anc_7.502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140423.1"
                     /db_xref="GeneID:59326964"
                     /translation="MAVDLMEVDSPAESGRNDVKFAEEKNVNEVIQVLQEVARTSVTL
                     DPYFVWKGLKELNGMRARCLNEETLLALINLLYPDSSAFKAPLLKAINREKKCTVPNA
                     DETREGYPASFYEVVEDKSIEVAAEVNSFVHLLVTRYLLDNKKLEALNSFNKKVVIPK
                     ILALYNQRTLDLINAKLWFHVVLCDEARGERANLETRSSMIKFLKVASLKHNSETKAM
                     LISLLLRSFLATGEIEAAADFMAKVEFPNSADVSSSLEARYYFYMSKINAIQLDYSTA
                     NEYIIAAIRKAPNTANSLGFLQQANKLHCVIELLMGDIPDLSFFHQAGMQRSLEPYYD
                     LSKAVKLGDLKKFTSAIAKYKPQLIKDGNYQLYVRLRSNVIKTGIRIISLTYKKISLR
                     DICLKLRLDSEQTGEYMVSRAIRDGVIEAKINHEQGYIETSELLNVYDTDEPQAAFDE
                     RITFVNQLHDESLLAMRYPEDNKGKNNANDEDEFLDGELLEDLSDFSDIDGLGFL"
     gene            complement(<155118..>156494)
                     /locus_tag="HG536_0F00750"
                     /db_xref="GeneID:59326965"
     mRNA            complement(<155118..>156494)
                     /locus_tag="HG536_0F00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284528.1"
                     /db_xref="GeneID:59326965"
     CDS             complement(155118..156494)
                     /locus_tag="HG536_0F00750"
                     /inference="similar to AA sequence:RefSeq:NP_012651.1"
                     /note="ancestral locus Anc_7.501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140424.1"
                     /db_xref="GeneID:59326965"
                     /translation="MTVFDQVQGLLDKPDIPFKSIIAGISIGKFVFETYLTYRQYKVL
                     SKKTLPKVLENEIDDETFLKSEEYSRAKAKFSVVVDVYELVQKLVFIKIDAFPRLWKF
                     GVQLANFILPAKFHAVSTVAQSLCFLSVLSNLSTILDIPTSYYQHFVLEEKFGFNKLT
                     VKLWITDMVKSVALSHALGGPILYGFLKIFEKFETNFLWYICLFTFAVQVLAMVLVPM
                     YIMPLFNKFTPLEDGELKTSIENLAKSVGFPLDQIFVIDGSKRSSHSNAYFTGLPFTS
                     KRIVLFDTLVNESSVQEITAVLAHEIGHWQKNHILNMILFSQVHVFVIFSLFIGVYRN
                     LSLYNDFGFFIGAPGSVLSSSSKVFTPEWPIIVGFMLFSDLLTPMECFMQFVMSLVSR
                     LHEFQADAYARGLGFSKQLCQALINLQIKNLSTMNVDPLYSSYHYSHPTLPERLTNLG
                     YVSEKKKR"
     gene            complement(<156685..>157512)
                     /locus_tag="HG536_0F00760"
                     /db_xref="GeneID:59326966"
     mRNA            complement(<156685..>157512)
                     /locus_tag="HG536_0F00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284529.1"
                     /db_xref="GeneID:59326966"
     CDS             complement(156685..157512)
                     /locus_tag="HG536_0F00760"
                     /inference="similar to AA sequence:RefSeq:NP_012650.1"
                     /note="ancestral locus Anc_7.500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140425.1"
                     /db_xref="GeneID:59326966"
                     /translation="MIGLLKEDPFLRFSLFPNSDNLYLLHGHEIIGSLVFYQVVYAYV
                     APWFNRLVFRERYRSIRDAKTRIDFDIHTVSSVQCLVTFYTIAPTLFLPMDLNVVTYR
                     NELVCLASALAVGYFLWDLLVCVRHFNLYGFEFLAHAASSLYVFMLSLKPFCQAWVPK
                     FLLFEASTPFVNNNWFIAQLSRGASKPVVPMWVNALNGLLLLVTFFSVRILWGFVGVS
                     ILAFQMWKVRTALPVIQSAILCALNMILNTLNLFWFYKMLKLAKKMANGSSRAAKSM"
     gene            <157883..>158911
                     /locus_tag="HG536_0F00770"
                     /db_xref="GeneID:59326967"
     mRNA            <157883..>158911
                     /locus_tag="HG536_0F00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284530.1"
                     /db_xref="GeneID:59326967"
     CDS             157883..158911
                     /locus_tag="HG536_0F00770"
                     /inference="similar to AA sequence:RefSeq:NP_012639.1"
                     /note="ancestral locus Anc_7.499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140426.1"
                     /db_xref="GeneID:59326967"
                     /translation="MSGVSPQLVCLGNPLLDYQATVSPEYLKKYGLKADDAILVDAKS
                     GDPKMAIFEEMLGFDDVKFVAGGAAQNTARGAAYVLGRNQVGYFGSVGEDKYSERLLQ
                     ENNAAGVVSLYQFQKEIGTGKCAAMINGHYRSMVTDLGAANHFTPDHLDRHWDVVEKA
                     KLFYVGGFHLTVSPEAILKLSKHAQETGKPFVLNLSAPFIPQFFKGPLEQVLPYTTYV
                     IGNESEAASYAESFGLPADQRDLVSIAKHIVGDSKDRTVVFTQGLDPTVVYSAQGAKS
                     YPVRPLESSKIVDTNGAGDAFAGGFMAALTQGKPLETAIDMGQWLAALSIQEVGPSYP
                     KSKLEYQA"
     gene            <159094..>161088
                     /locus_tag="HG536_0F00780"
                     /db_xref="GeneID:59326968"
     mRNA            <159094..>161088
                     /locus_tag="HG536_0F00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284531.1"
                     /db_xref="GeneID:59326968"
     CDS             159094..161088
                     /locus_tag="HG536_0F00780"
                     /inference="similar to AA sequence:RefSeq:NP_012640.4"
                     /note="ancestral locus Anc_7.498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140427.1"
                     /db_xref="GeneID:59326968"
                     /translation="MMEWAIKLSHPHLLYSETSLSLGFALASTFHVVLCFVLLGLAAS
                     EYLCPNVAKLAEITGHGNGPLMAVLLAWCNCSPDLFSNFMSWTSTSTPSSGVALSVGE
                     VLGACGIILCVVEGSIFVIMSSAQLELSSGQKLNVLRDLAFTLVAILLLLYLSIRQKI
                     SALDCLVMLTIYVSYLFAKFKWRIGEGQETEFDNGDENYRGQELDGANLPSRIKPSLI
                     SAMEINDILSMLQSSRTASTRSQGELMTLNAEDNAFTVLEEARPSTEPLRQSDVSEFQ
                     ELPRSSPAAFGPYFDNPEQQDGEMLIEIPLVKRRGGIQKWKRGFFKLFVPHLLNFRQK
                     SAIDAILSVCTAPFATLLRLACPQTTNILEVDNNTGKYTATNVDITLLFVQSIFCPVF
                     SFAVISCIMAKGMSFMLWILSFLAAACLFFLALIFYRSLLSFNRFSLLQPSWNVASDS
                     DELGDERRMVEKLGNVISMIFLSFGIVNATLCISLIANSLIELLEIYQRITKASQAIL
                     GLTLFAWGNSVGDLISNIAMCRLYRKKPQAVGQNVGKIATKFFLISCTSCIGGVLLNS
                     MGGIGLSGLISMTFVHQSSNKWLFLRAVDLHDGEHSHNYKLIISCAAIILQTILLAIF
                     FGASGRLHNYVRGKMRIAGLCMCSIWAIATTCNVLLEILQ"
     gene            complement(<161402..>162706)
                     /locus_tag="HG536_0F00790"
                     /db_xref="GeneID:59326969"
     mRNA            complement(<161402..>162706)
                     /locus_tag="HG536_0F00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284532.1"
                     /db_xref="GeneID:59326969"
     CDS             complement(161402..162706)
                     /locus_tag="HG536_0F00790"
                     /inference="similar to AA sequence:RefSeq:NP_010937.3"
                     /note="ancestral locus Anc_7.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140428.1"
                     /db_xref="GeneID:59326969"
                     /translation="MGICGSKNTEVTEPAVSRQRDGGRENVLSGQGRPSNNPTSSDSN
                     DTRVEKGDHACPADVSATNSSERSKKDEEVKVLLLGAGESGKSTIIQQLKILHQNGFT
                     QDELLEYRSVVFRNLLDIGKELIEARTKFEVSLESDSGITEKDLQGFYRFDANDDRKT
                     DGENATVKNSENGAISQPVEKEPSESESDQSLSNLVQFPAELADTLRKLWNLPSTQQL
                     IEGKHRSEFYLMDSASYYLENLTRIARSDYIPNEQDILRSRQKTSGLFDSVFDLGSNL
                     KLHIYDVGGQRSERKKWIHCFDNVTLIIFCVSLSEYDQLLLEDQDQNRFQESLVLYDN
                     VVNSRWFARTSVVLFLNKIDLFAEKIQKVPLENYFPDYTGGQDINKAAKYILWRFVRL
                     NRANLNIYPHVTQATDTSNIKLVFAAIKETLLENTLKDSGVL"
     gene            <163691..>164275
                     /locus_tag="HG536_0F00800"
                     /db_xref="GeneID:59326970"
     mRNA            <163691..>164275
                     /locus_tag="HG536_0F00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284533.1"
                     /db_xref="GeneID:59326970"
     CDS             163691..164275
                     /locus_tag="HG536_0F00800"
                     /inference="similar to AA sequence:RefSeq:NP_012991.3"
                     /note="ancestral locus Anc_1.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140429.1"
                     /db_xref="GeneID:59326970"
                     /translation="MLSVAAQFACRRSLMPGLGVNTRSVSLGVRSLSNNADKGIEGNS
                     DLTWIDFFKMRRQQRRINVGSSVFTAFLGCNASWAYLSTMQIDPTQTLLGFDPLMVIT
                     AGIAASGALGYLLGPLVGSQIFQMLNRRRLPGFDIKNKEFLKKVIENRVDASSQSFSN
                     PVPDYYGEKIGSIGEYRQWLRDCHAYRRKAKEFL"
     gene            complement(<164382..>164771)
                     /locus_tag="HG536_0F00810"
                     /db_xref="GeneID:59326971"
     mRNA            complement(<164382..>164771)
                     /locus_tag="HG536_0F00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284534.1"
                     /db_xref="GeneID:59326971"
     CDS             complement(164382..164771)
                     /locus_tag="HG536_0F00810"
                     /inference="similar to AA sequence:RefSeq:NP_012384.1"
                     /note="ancestral locus Anc_1.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140430.1"
                     /db_xref="GeneID:59326971"
                     /translation="MSGVNDIKSKLTVNRNDIWLLVLSVFVPPVPVLIRKGFFSRDFL
                     LNLLLFITFVIPAIAHAAFVVVETSEERNRDFALVPSHDGQEEATGPSNGDFNVDLEA
                     NSQSHDLPEYDDVVTAPVAATDNKVQK"
     gene            <164993..>166735
                     /locus_tag="HG536_0F00820"
                     /db_xref="GeneID:59326972"
     mRNA            <164993..>166735
                     /locus_tag="HG536_0F00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284535.1"
                     /db_xref="GeneID:59326972"
     CDS             164993..166735
                     /locus_tag="HG536_0F00820"
                     /inference="similar to AA sequence:RefSeq:NP_012386.1"
                     /note="ancestral locus Anc_1.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140431.1"
                     /db_xref="GeneID:59326972"
                     /translation="MLLECDRPAFPLRRLPDELVLEVFSHLAQPDRLKMCTLSRRFNR
                     IATKLLYRRIYLNDSNVVRSDYMNVAVNWTLLSIPSFLNEEDSRKIANMKLRKLIHSL
                     SVNPRNLRSVQWIRINWDLDARLQKTILSILCSRGTSLQRLENVTDPACNEIIANGAV
                     SMSRVISLDMAPPNPLPEIPVPEEYIPSLQKYLNARISSSLSHLTLFIDPAKLFNYIH
                     PLKQKLQIIDLKLHWRREFFDRKYFIKRVREPALKKMSDIFDVRTLKTLTIISWNESL
                     IAREIQMIMEFKEFVNLEDLSLISIKQNFDVLVTLFYNLPKLKRLKMDFLEDSLPETK
                     NSEIFLTILKVCNNLQFIDMRYEEMDPQIIALEETKFQLHQECYCSSCVHVFENILKK
                     KLFLFPDDYYLTDIHDIAAKDIFKMMKFLSLLPYSKACDCYPSVRTQPMNLDEFVSRM
                     NKNLLFYRQTRGQLVAPAGRRSDTEVSDLGRLALSLPHAPLTRQDVIDCYHALIHHYR
                     ATYVAFLKGFPKLRFLMLNDIPTVVVEEHKERIFQPIFYHENYQTNLTGWSKSWKRHK
                     GSNGDTVTRKATVF"
     gene            complement(<166824..>169310)
                     /locus_tag="HG536_0F00830"
                     /db_xref="GeneID:59326973"
     mRNA            complement(<166824..>169310)
                     /locus_tag="HG536_0F00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284536.1"
                     /db_xref="GeneID:59326973"
     CDS             complement(166824..169310)
                     /locus_tag="HG536_0F00830"
                     /inference="similar to AA sequence:RefSeq:NP_012990.1"
                     /note="ancestral locus Anc_1.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140432.1"
                     /db_xref="GeneID:59326973"
                     /translation="MQGKADSGQPSVRKRNRLTVVCSNCRRRKSKCDRQQPCSNCIRL
                     GNQDTCRYTKELRAGKGRILIDARIDKKLSSSRQGTSSDSSPNAVNFHSTQDNTPEHI
                     NIVPNGRFIEVKRSAMTMFSLLSDIAIEHRDPYLKSLITFRMLAIDMTVNRIHGSRQH
                     ASSNPGLPQSFAPLSIFDSDGDPLSSEGSFKRHQLIHRSLFDKFGRHRKNDASKFDES
                     EKFITENLPPRSILYESILPFFESYLLSIVPIFHMELLKHEIAEFYDNWERTKKISVK
                     SFDHIVYCLTLLITKVCQLSINFSKFSSKLQSPIQHLNTDKYIAIVNHFLFEMRSLRK
                     CTLMQLQCLILLRVYHWCAPEDGDGEVMQHGQILLGTIIASCKEMGISWLSLLTPDDY
                     FFKLDPQCRPSPAIMSRDDYERVLRMIWCYVLYWDRKMCLINGQECFIEKSFEYAETD
                     PNALWHQKVVTLDSTVLRINNLLNDFPGKVDRKAVDYEIDHALELFNSLKDKRDEQLN
                     LEYELMLGLCKLTFSHAKMVHYEYQTDVPNFHETAQDVWNQIVHLAGVFHSYCDETDR
                     RLEPFTKFYTNKIVGIVANRLCILIPAMILRMNRFSIADSVERNIMVKFLFGVSSLYF
                     NEFGFDYYRCFKKMFTAKISYKILNRPADKEPWQIILRFLLHDLEKVRSGKKTDDVDI
                     VRRIPLLVDLQEALRKLPDATGHDVVKTWNDDIYPIGKLSGDFKLDLQTDKLQAFLLD
                     RYANSFNIFASFYDRASQRLADTAEDANNELNVHALQNHWVPISLAMPNSEIQSNGSN
                     YSPTTSTDLELANYELIQEMFEPLDFISYF"
     gene            <169522..>170961
                     /locus_tag="HG536_0F00840"
                     /db_xref="GeneID:59326974"
     mRNA            <169522..>170961
                     /locus_tag="HG536_0F00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284537.1"
                     /db_xref="GeneID:59326974"
     CDS             169522..170961
                     /locus_tag="HG536_0F00840"
                     /inference="similar to AA sequence:RefSeq:NP_012989.3"
                     /note="ancestral locus Anc_1.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140433.1"
                     /db_xref="GeneID:59326974"
                     /translation="MVHPRIVPWPDSEELVELKEWFYAEKFSGRASDMDMRTRAIQRV
                     KCYQSKGSQYLPHVIDSTAQITSAVLLDEERLARGKDSMFAVRLSYAMALIRFVNGLL
                     DPTQQSQFAIPLHTLAQRVGLSSWFVDLRHWGTHERELPSIDMLRMAAREALEWLWEH
                     YWNDDELQEDENSANEEESEENEGFIAEIKRLVQAGAALEEALIEHRWVWEDGNKNLI
                     SSTNFAVEDGKTTNHRTQSTSPHQRIHGYVGDCREHWRRSTERKQFVEIAFEKGRPIL
                     FELFMAKLAGFDLEVLQWVAQSYREQTAGGKSTLLRRKYASWTELKRKYLRGYVSNLN
                     LHNLAANWSQWEAVINEHSSFLTLWICASLLKRLQDHKCQAISRKKRRKRKQTDSFIE
                     LESRITALVERLSKRFSSSDAKLYDLPPSEHTTNTASTQPSMAGASDILSDLAGLRQR
                     LEKPSTSRAHEIKLWDPHPNWEPRPFGIL"
     gene            <171671..>172276
                     /locus_tag="HG536_0F00850"
                     /db_xref="GeneID:59326975"
     mRNA            <171671..>172276
                     /locus_tag="HG536_0F00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284538.1"
                     /db_xref="GeneID:59326975"
     CDS             171671..172276
                     /locus_tag="HG536_0F00850"
                     /inference="similar to AA sequence:RefSeq:NP_012387.1"
                     /note="ancestral locus Anc_1.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140434.1"
                     /db_xref="GeneID:59326975"
                     /translation="MSRLSKEYVSTSEEENEGATVEFAPPAGYVRCKHLKKFHKKKSD
                     EQLWLIKVPSSLDISKLKKLPIDFSGKENGEAAITSEGKSYTVNMDVTQREEQDSSNL
                     TLLVPDESRDSLRVGGDKSKSWGFDRVFSVSEAAAVPRIEYEELRVPRSDVVKVEGLQ
                     VRHFASGYDEKEKSKKRGATDSSAAPSKKHKKKDKKKSKIK"
     gene            complement(<172300..>173238)
                     /locus_tag="HG536_0F00860"
                     /db_xref="GeneID:59326976"
     mRNA            complement(<172300..>173238)
                     /locus_tag="HG536_0F00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284539.1"
                     /db_xref="GeneID:59326976"
     CDS             complement(172300..173238)
                     /locus_tag="HG536_0F00860"
                     /inference="similar to AA sequence:RefSeq:NP_012988.1"
                     /note="ancestral locus Anc_1.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140435.1"
                     /db_xref="GeneID:59326976"
                     /translation="MNKNSDPLLANLNAFKSKVKSAPVLPTKSSITSSNGSVSRSSPK
                     KRSALQREEANIDGKAVQPTLSKDKENEDDEEEEEESPSKKVRPGSLAAAALQANQTD
                     ISKSHDSSKLLWATEYIQKKGKPVLVNELMDYLSMKKDDKVLELLKKLDKIQHDPKKG
                     TFKYMSTYDVHSAQELLNLLRSQVTFKGISCKELKDGWPQCDETINELEEESKILVLR
                     TKKDKTPRYVWYNNGGELNRIGEDFVKMWENVQLPQFAELPRKLQDLGLKPASVDPAT
                     IKRQTTRVEVKKKKQRRGKITNIHMAGILKDYSHKA"
     gene            complement(<174025..>175149)
                     /locus_tag="HG536_0F00870"
                     /db_xref="GeneID:59326977"
     mRNA            complement(<174025..>175149)
                     /locus_tag="HG536_0F00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284540.1"
                     /db_xref="GeneID:59326977"
     CDS             complement(174025..175149)
                     /locus_tag="HG536_0F00870"
                     /inference="similar to AA sequence:RefSeq:NP_012388.1"
                     /note="ancestral locus Anc_1.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140436.1"
                     /db_xref="GeneID:59326977"
                     /translation="MRRAFSRLSCQLLKRAESDELQSTIRFLARGSKPAISSLIDRSN
                     GGEDVKGDPEEEAKHVERILKILNSTLPEVEPRKRHVEVHYDILFSQLKKIVESSIEA
                     TDREGTRQRVESNNVSESLYDELMLLQYTNKLTGAGQIAKIVLAKGFAEWSRVWDNIS
                     LFSENQRRDLSLLLYFRSGNSDIPQAFEEVWFRDYHRLHIITQRLLWRCVARKIDVGA
                     DFALAVKQQVDRVRHWTTKDLVVLYQSLFAKAHMLPQNLADDAEPALSRNQQLFIKTL
                     RMLSPYESSERKIRKGMVRLVKLSIENKVASESPEITTGLSIYQYRFIRSLDLTVQEL
                     HSACEGKKQLERLRHSLASILATIHDEEQEVKSHMSVKFI"
     gene            <175611..>176825
                     /locus_tag="HG536_0F00880"
                     /db_xref="GeneID:59326978"
     mRNA            <175611..>176825
                     /locus_tag="HG536_0F00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284541.1"
                     /db_xref="GeneID:59326978"
     CDS             175611..176825
                     /locus_tag="HG536_0F00880"
                     /inference="similar to AA sequence:RefSeq:NP_012389.1"
                     /note="ancestral locus Anc_1.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140437.1"
                     /db_xref="GeneID:59326978"
                     /translation="MEEESTFYPDDFNLELADAVKKSWSEPQERCQSSTLFSPVGTPP
                     AGSSAGSFVSSNNQGSLVTPPMTSNGVPDESCPGRNVERHYSLTENTHESISDIMVDL
                     SLGDAQEATPESQLQPRPVRRGSIQDVHRVRHLLNPRSSFSGASTDEPTVPREENVGW
                     VTILADDRPETMKPIIILDRSLQAVKSKYRLHVLHDRQTNAAELAACGIKTVCFDETL
                     PKSFRCAIGSSSVLSLFVVLVDRLELACYLAPTCMVMENVDELLESEEICDEIDNETC
                     VLLTKESSEGEAKNCLQIMILRPCNDLAMCVKELFTVYGDHGEERKVSYKDDFDVLRT
                     LFDHTWGHLSSDEYCTTPNFQQFTDKQYKIVDYRLLKPWIESEESATNSLCERWRLAW
                     QDFELSWRDSSL"
     gene            <176971..>177855
                     /locus_tag="HG536_0F00890"
                     /db_xref="GeneID:59326979"
     mRNA            <176971..>177855
                     /locus_tag="HG536_0F00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284542.1"
                     /db_xref="GeneID:59326979"
     CDS             176971..177855
                     /locus_tag="HG536_0F00890"
                     /inference="similar to AA sequence:RefSeq:NP_012390.1"
                     /note="ancestral locus Anc_1.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140438.1"
                     /db_xref="GeneID:59326979"
                     /translation="MVSFSNSEEQEIFERVFAEIPSLIKDKCDGYDELYGYKLNPDDE
                     DATASAFYKKNVAEALILKLCKAYRFQHEEIVSNFVKIMKWRSEFNPLSAAFLESHNK
                     ELQEVGILASYPEGEPNNRVVTWNLYGHLVKKKHLFKDADKFVRYRIGLMERGLRLLD
                     FLDSENDYMTQVHDYKGVSVLRMDSDIKKCTKQIIAIFQQNYPELLFAKYFVNVPTLL
                     QWFYDIVKAFVDKETMKKFVVLNDGSRLGNYLQHCPKNPYGGLDVKNTLQEENVAEVR
                     PTEYALYLLEKQNNEDID"
     gene            complement(<177912..>179090)
                     /locus_tag="HG536_0F00900"
                     /db_xref="GeneID:59326980"
     mRNA            complement(<177912..>179090)
                     /locus_tag="HG536_0F00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284543.1"
                     /db_xref="GeneID:59326980"
     CDS             complement(177912..179090)
                     /locus_tag="HG536_0F00900"
                     /inference="similar to AA sequence:RefSeq:NP_011802.1"
                     /note="similar to Saccharomyces cerevisiae BIO2 (YGR286C)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140439.1"
                     /db_xref="GeneID:59326980"
                     /translation="MFSRGVRALSTASGVCMRANSSMAAAAAAATSQPNPSGFAKSAL
                     EYAMSLEEPCHSWTKEQLASIYHTPLIELVHNAQLQHRKWQDASKVQLCTLMNIKTGG
                     CSEDCKYCSQSSRNDTGLKAEKLVQVEEVLKEAEEAKRNGSTRFCLGAAWRDMNGRKS
                     AMKRISEMISKVNDMGLETCVTLGMLNEEQSKQLKEAGLTAYNHNIDTSREHYKNVIT
                     TRTYDERLETIKNVQNSGIKACTGGILGLGETEEDHIGFLYTLSNMSPHPESLPINKL
                     IAIKGTPMADEMAKPSTKKLEFDEIIRTIATARIVIPQAIIRLAAGRYTMKETEQFLC
                     FMAGCNSIFTGKKMLTTKCVGWDEDKAMLKKWGLEPMEAFQYDALEEQRKKKLQAAAA
                     "
     gene            <180309..>180785
                     /locus_tag="HG536_0F00910"
                     /db_xref="GeneID:59326981"
     mRNA            <180309..>180785
                     /locus_tag="HG536_0F00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284544.1"
                     /db_xref="GeneID:59326981"
     CDS             180309..180785
                     /locus_tag="HG536_0F00910"
                     /inference="similar to AA sequence:RefSeq:NP_012392.1"
                     /note="ancestral locus Anc_1.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140440.1"
                     /db_xref="GeneID:59326981"
                     /translation="MSADHSRDPCPIVILNDFGGAFAMGAIGGCVWHGIKGFRNSPLG
                     ERGSGAMSAIKARAPVVGGNFGVWGGLFSTFDCAVKAVRKREDPWNAIIAGFFTGGAL
                     AIRGGWRHTRNGAITCACLLGVIEGVGLMFQRYMAWQAKPMAPPLPESSSPQPLQA"
     gene            complement(<181031..>183184)
                     /locus_tag="HG536_0F00920"
                     /db_xref="GeneID:59326982"
     mRNA            complement(<181031..>183184)
                     /locus_tag="HG536_0F00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284545.1"
                     /db_xref="GeneID:59326982"
     CDS             complement(181031..183184)
                     /locus_tag="HG536_0F00920"
                     /inference="similar to AA sequence:RefSeq:NP_012394.1"
                     /note="ancestral locus Anc_1.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140441.1"
                     /db_xref="GeneID:59326982"
                     /translation="MQSELQANCNEEGERKNETIWNPLFMSPDGNSQQQQQPPQQQHV
                     NFNFVNPWGVKNGEKINLTEEQELLISCGDENIDSTARRKSSLVVPPARAPGPNPFEY
                     DDAKAYPNVHGQRQSQRPMFFPQQQLQQQSFNSGRFVPPGVFNPQDAQRRQSVAVVHY
                     PQNLPNVSNAPGVSTPPMAPMVSPYRRLSAYPPSTSPTTSLQPPYKQLRRDGAVAAQQ
                     VVIPQMQKCTSRSDLAPTVNPTPKFRRASLNSKTISPLIALTKSLITTYSLCSHDFSY
                     QTSKNPKRVLTKPSEPKCNNGYDNINSDYILYVNDVLGTEQNRKYLVLDILGQGTFGQ
                     VVKCQNVLTKEILAVKVVKSRTEYLNQSITEAKILELLNTKVDPRNEHHFLRLHDTFI
                     HKNHLCLVFELLSNNLYELLKQNQFHGLTIHLIRSFTTQLLDSLCVLKDAKLVHCDLK
                     PENILLCSPDKPELKIVDFGSSCEERRTIYTYIQSRFYRAPEVILGIPYSTSIDIWSL
                     GCIVAELFLGIPIFPGSSEFNQLTRIINCLGYPPSWMMDMGKNTTKFLRKWDSNEINN
                     GSTSKEAPKYKLKTVEEYNEEYGAQEQPSKQYFKWDSLQDIIAHYRISKKIKNNNVLV
                     EQEMQDRRCLTHFLQGILNLNPLERWTPQQASMHPFITQQAFTGEWYPPGSFQGTATA
                     ASSLAGMSSRPGNIRHPSLQEGATREFNKLRIGED"
     gene            <183714..>184436
                     /locus_tag="HG536_0F00930"
                     /db_xref="GeneID:59326983"
     mRNA            <183714..>184436
                     /locus_tag="HG536_0F00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284546.1"
                     /db_xref="GeneID:59326983"
     CDS             183714..184436
                     /locus_tag="HG536_0F00930"
                     /inference="similar to AA sequence:RefSeq:NP_012395.1"
                     /note="ancestral locus Anc_1.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140442.1"
                     /db_xref="GeneID:59326983"
                     /translation="MNVPVSTIQTRRRLKKVEEEENAATLQLGQEFQMRQLNHQGEEE
                     ELIALNLSEARLVIKEALVERKRAFRRTQHKRKAKKRDRSNAVNKQEDDSTLVDGREN
                     DVGPNGQHYGDGSRDSDLDDEEDEEDDNAFMHTETREKELESLDALLEQTTGGNNKDL
                     KNTMEYLTNFSRFRDQETVSAVIQLLKSAGLHPFEVAQLGTLACDTADEAKTLIPSLN
                     NKISDDDLERILKELSNLETLY"
     gene            complement(<184446..>185714)
                     /locus_tag="HG536_0F00940"
                     /db_xref="GeneID:59326984"
     mRNA            complement(<184446..>185714)
                     /locus_tag="HG536_0F00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284547.1"
                     /db_xref="GeneID:59326984"
     CDS             complement(184446..185714)
                     /locus_tag="HG536_0F00940"
                     /inference="similar to AA sequence:RefSeq:NP_012396.1"
                     /note="ancestral locus Anc_1.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140443.1"
                     /db_xref="GeneID:59326984"
                     /translation="MKDKTIQLAIVLLTVLGGLFIQSLFTTAQHCNNRYKIENAFFEN
                     SKHAVEKYDGIRRRSLLKPLKLSTNTYDDDVLSAGNSIIPTKENATLLMLVRNFELSG
                     ALKSMRSLEDRFNRDYHYDWVFLNDLPFTQEFMEATTAMASGNTHYALIPSEDWDRPN
                     WIDEQLFEDRLELLRDRGVLYGGSKSYRNMCRFNSGYFFRQKILDSYDYYFRVEPDVE
                     YFCDFPYDPFKLMRHNKKKYGFVISLYEYEDTITTLWDTVEEYLDTFPDDVAMVNNSY
                     NFITDSGIIGKFSPIIDSNTDYNLCHFWSNFEIGDLNFFRSDRYKRFFDFLDSKGGFH
                     YERWGDAPVHSIAVSLLLNRDEIIHFDELGYFHAPFSTCPTSYYLRLQQRCQCDAQAA
                     SNIDISPNSCLMRWWKNGDGKRFLKDNQTN"
     gene            complement(<185912..>186778)
                     /locus_tag="HG536_0F00950"
                     /db_xref="GeneID:59326985"
     mRNA            complement(<185912..>186778)
                     /locus_tag="HG536_0F00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284548.1"
                     /db_xref="GeneID:59326985"
     CDS             complement(185912..186778)
                     /locus_tag="HG536_0F00950"
                     /inference="similar to AA sequence:RefSeq:NP_012986.1"
                     /note="ancestral locus Anc_1.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140444.1"
                     /db_xref="GeneID:59326985"
                     /translation="MNNEVQSTGNRNFITLMVSPIRLDKDGVAVRALESLLAHCESDR
                     NLKQDKNVHMILYMGKKMGIQKDYVPRIIPLRSCKLNKPKDLRILLITKDPSNKYRAA
                     LTADSATSDLFKEIISIKNLKRRFRGAKMSHIYKEFDLIVADFRVHHLLGDILGNRFY
                     HGNKKLPFVIRFSRMVPAKGQKMPDECDPSYVRAQLRSICKNTSYVPNNDNCLSVKIG
                     IIGKTSVAEMIENAHDVMEFLTDKNKRPQGGVIKGGITSVFVKTSNSPSLSIYEKARE
                     TTDEPRDEPLRL"
     gene            complement(<186972..>188159)
                     /locus_tag="HG536_0F00960"
                     /db_xref="GeneID:59326986"
     mRNA            complement(<186972..>188159)
                     /locus_tag="HG536_0F00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284549.1"
                     /db_xref="GeneID:59326986"
     CDS             complement(186972..188159)
                     /locus_tag="HG536_0F00960"
                     /inference="similar to AA sequence:RefSeq:NP_012397.1"
                     /note="ancestral locus Anc_1.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140445.1"
                     /db_xref="GeneID:59326986"
                     /translation="MSEGITEVEESQIQTNYDKVVYKFDDMNLKNELLRGVFGYGFED
                     PSAIQQRAILPIVEGHDVLAQAQSGTGKTGTFSIAALQRIDSSLKSPQALILAPTREL
                     ALQIQKVVIALAFHMDIKVHACIGGTSFQEDAEGLRDAQIVVGTPGRVFDNIQRRKFK
                     TDNIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPKDVLEVTTKFMRN
                     PVRILVKKDELTLEGIQQFYINVEQELYKYDCLTDLYDSISVTQAVIFCNTRRKVEEL
                     TQKLKADNFTVSSIYSDLPQQERDIIMKEFRSGSSRILISTDLLARGIDVQQVSLVIN
                     YDLPTNKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELETFYSTQIEELPSNIAE
                     LFT"
     gene            complement(<188429..>190159)
                     /locus_tag="HG536_0F00970"
                     /db_xref="GeneID:59326987"
     mRNA            complement(<188429..>190159)
                     /locus_tag="HG536_0F00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284550.1"
                     /db_xref="GeneID:59326987"
     CDS             complement(188429..190159)
                     /locus_tag="HG536_0F00970"
                     /inference="similar to AA sequence:RefSeq:NP_012398.1"
                     /note="ancestral locus Anc_1.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140446.1"
                     /db_xref="GeneID:59326987"
                     /translation="MVSARCAVATLLYSTDYLPGVFTLGHQLAKLLRNKGNIRTCLVV
                     SKELWSGALSELSKTLVRLLYNDIVLVDPLQDQDSTVERNAENLRLLNRPELSFALIK
                     ARLWELTQFDRVLYLDADTLPLNEEFLNIFELIPQQESRQIGGAPDIGWPDMFNSGVL
                     MLRPDINLASELHKFILSHTSIDGADQGILNQFFNPYCAETDQGPSRYSWVRLPFIYN
                     VTVPNYGYQSSPAVRYFQSQIRLVHFIGENKPWKGWLSGSSADGYVSRWGQVYNEFLE
                     RFGLTQFFEEMGLQRPTAPEPRQENAAPLANWEEFHQRVMQQEPESIESYDSGHLNVW
                     RVEPPQESAAKVINLDGFDKPAMQQEPEGTKTVVSKHQHVSHAESPQESAVQVVDWDS
                     FNKRIMQEEPESTESYDTGHVGSWHPGPVVARDHTERVFPDVDQYDTNELTKQLGEFS
                     VAGTSDSSSAPAPDEEVAPQITATSGLPIPLSAAHRSATLQNAARKQLSGRVVERVFP
                     NERDLPHFSQPKITGTRPEDQDNVQPVPRVEEVLEMIKEDCEPDPVPRHVFDWEETNY
                     LQEVERVFPD"
     gene            complement(<190315..>190748)
                     /locus_tag="HG536_0F00980"
                     /db_xref="GeneID:59326988"
     mRNA            complement(join(<190315..190554,190725..>190748))
                     /locus_tag="HG536_0F00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284551.1"
                     /db_xref="GeneID:59326988"
     CDS             complement(join(190315..190554,190725..190748))
                     /locus_tag="HG536_0F00980"
                     /inference="similar to AA sequence:RefSeq:NP_012399.1"
                     /note="ancestral locus Anc_1.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140447.1"
                     /db_xref="GeneID:59326988"
                     /translation="MENDKGQLVELYVPRKCSATNRIIKAKDHASVQINIAKVDEEGR
                     AIPGEYITYALSGYVRARGEGDDSLNRLAQNDGLLKNVWSYSR"
     gene            complement(<191015..>192766)
                     /locus_tag="HG536_0F00990"
                     /db_xref="GeneID:59326989"
     mRNA            complement(<191015..>192766)
                     /locus_tag="HG536_0F00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284552.1"
                     /db_xref="GeneID:59326989"
     CDS             complement(191015..192766)
                     /locus_tag="HG536_0F00990"
                     /inference="similar to AA sequence:RefSeq:NP_012982.2"
                     /note="ancestral locus Anc_1.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140448.1"
                     /db_xref="GeneID:59326989"
                     /translation="MLAGLIKRAPAIWFCVRFSSFGRKIAKFSPMMAVEDGSSAKRSL
                     SPSLLHKKTKKPKLKKYKAKKVDPTSPSGVLQFEINDLLVEHALTEDHVKNDVSAILN
                     DSSRDGPVVQAYHREVQNVKVLKITSSGDGLGIIDNPVEEGKKQIVVIPFGLPGDIVR
                     IKVFKTHPSYVESDLLEVTTKSEMRNDDLINCKYFGKCSGCQFQFLEYDSQLELKKKT
                     IIRAFKHFAPRLVSEGLLPDVGDTIGSPLQYGYRTKLTPHFDVPRKSKSLQIRPPLGF
                     GQKGRPQWKKDTIEQGGHASILDIEECPIGTSVVNMGMQNERKRFTEEFSKYKKGATI
                     LLRENTTVVGSSLESGEEGSREPTGKLSEVKVRDDATDKTLIKTCVTNTRQVVTEYID
                     GYTFQFSAGEFFQNNNSILPLVTKYVRENLQIPNSQPDQDHNLVDAYCGSGLFSICSS
                     KGVTRVIGVEISADSVTFAQRNATANGVENCKFIVGKAEKLFESIDTPNDRTSVVLDP
                     PRKGCDELFLTQLAEYCPAKIVYISCNVHSQARDVEYFLKNTDNGKRYKIESIRGFDF
                     FPQTHHVEGVCVLTRVN"
     gene            complement(<192969..>193865)
                     /locus_tag="HG536_0F01000"
                     /db_xref="GeneID:59326990"
     mRNA            complement(<192969..>193865)
                     /locus_tag="HG536_0F01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284553.1"
                     /db_xref="GeneID:59326990"
     CDS             complement(192969..193865)
                     /locus_tag="HG536_0F01000"
                     /inference="similar to AA sequence:RefSeq:NP_012981.3"
                     /note="ancestral locus Anc_1.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140449.1"
                     /db_xref="GeneID:59326990"
                     /translation="MVEESSMDALVQSGTTEDQSSDRSSGLMREESAFSMPYDESSTT
                     LEEKSMQRLPTAFARTLSSIPSYSQTRRGTAMADKHLKIVVVGDRGVGKTCLLISYVQ
                     RQFPTGYVPTVFENYVTKVEGPKKKIIELALWDTGGQEEYNRLRPLSYSEVDILMVCY
                     SVGSKASLQNVEDLWMPEVKHFCPNAPTMLLGLKSDLYDQMNFGELVDLEQAELVAQK
                     LGAFSHMQCSAKSRSQVDEVFNEALNTALRGQLNDSVDLKPILKNAFKKKPNAMKKTV
                     ATSKKPPPNKKNPINKFGCTII"
     gene            <194053..>206292
                     /locus_tag="HG536_0F01010"
                     /db_xref="GeneID:59326991"
     mRNA            <194053..>206292
                     /locus_tag="HG536_0F01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284554.1"
                     /db_xref="GeneID:59326991"
     CDS             194053..206292
                     /locus_tag="HG536_0F01010"
                     /inference="similar to AA sequence:RefSeq:NP_012980.1"
                     /note="ancestral locus Anc_1.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140450.1"
                     /db_xref="GeneID:59326991"
                     /translation="MNDDDDSLVHELIRYCVLNIARLGKVNGDAEQWLTKEFNSRFVG
                     KVRSFLFGENGAIWKTVLLVAFDKEHSELFVSIDDEPAGRVFPVLLFLKDKRFIDSRL
                     TLESQISSIILPDEVAIKAITFLLGNGPSHAVEPVSKEGSHDDATESYSDRKRSLNDF
                     EISLRSVNGPLAVLDLVSEAHHKIKDIVSKGANEDNYLSFVEPELIQEPSFLNALQAT
                     ANGWLRTVKTVCQAEKGVRHDWVFDEVQYWSTVQETLVSIEKQLQSQEVKITMCILVS
                     SRRWHNVLGFPSDSGLTGKLQRVREYDRFLSSIPLRTLKSSNNMEDVRREMDCIAAAL
                     KKFRFTQYPADRFALLLEQVSHEVQDAILRVSPNLFNASYISFSEHEGAILKAIDQWD
                     GIIEESKIHLREVIRRRGDLGSFATSLKPCTNNLRDAVKELAAFRKRHYCFSQALKSI
                     DYVDYLKDLDFVYEPINVLQNTSLVKWIESRNSYNQRLGLIEEKLIKLWKKKLNQDNS
                     SGDIINQYTSFAPLMAFNPKLMSVMKNCQKELLNSVKQELTILSAKINQTDQLKQALM
                     LKGLSSMSAALVERSQLNNRMQQLQNRCEMLLGRDWKKLPGGKMLLPIFKELIQKTDL
                     GAIFEHWKGSIIKGDIEELQSPRLKIIRNQDQKYELSVNFENVQNAIFGEVKTFVFLG
                     FEVPNDIIRLADRYEQARLSAVSMLGQVQIFLSVICELDSRPFTAILLERHLVHIWNL
                     ILNAAITPWSGFEDDREIGNSEPIENSIPVQLEKGVSHLVTSFHQFEISEARLSNSLR
                     ELSRSRGEVEALLQIISSVQLTIVQVESLQPQGIDKLILSLNSSIEKILVESSRHQLH
                     DLTCDIPIITVSFESQNLTFSPCITELKIRWIRAVEAIVTKSASLPRISLEHPPIGSP
                     KSFELSYLIRDDVFRTLQHIEKKCLRALTQFERLKIVETLCDLPESDIEEYIGSDINV
                     CLDLLASLIESHTGLEKFRSKNNGELILRFASLDYRLSVTRELDYWRKVLIRLLLKLY
                     EEEATKLDQDLRVDLKDLEKHFSSHLSLATISSILGAANRIKSSYPMRCQLLRSFSAC
                     EAIFLKFHLELACDHVFLDQLESDAKALEDRLQAVDEFIESNRKSVIHLLDSKEISLS
                     EQSYSLLNDWQITKQALGGMKSIDALHMIKTFRNMFKNIADESEQLYCCSKSLAYPLV
                     QKDRLKNAFREFDQFETGYRQLNDLQNSLSSLLQRSWSLNPVEDMPNELRRQKDEIKK
                     ITDLTHQDSEAVEVIELIKSLEKDASLLRDMKNADMGPRHWKMIFSIACTSKLGNSAI
                     ESQSFTLQDIINVDLSKNGKIIREIISSAQREAGLQKSLSRIKEFWMNAQFGTFLHES
                     GMILVSDWSHIQQLCSDDLEELAAMKNSTFYCYLEQDCLELESKLATFSAIVPDWADL
                     QVNWLDLFGILGNEGKLQHLIPTESAKFRRLTSDFHDLLSRIFRLPSALDVILIPESD
                     AAFKRMLNTVRMIKSSLSGFLEQQRELFPRFYFLGNRDLLRLLGAGSDISQVSCYLSK
                     IFGSITDLEIDNHLIKGVYSAEGELLEIFHPIATDAVCGPHEWLNALDLEIRNTLVKD
                     VEKCLSAISKGENFLNCIDSHVFQVLLLTWQISWTAGVDECINKGGLFNLRKSIEDKI
                     YHLSLRPLYAENRHDRQKVRSLIIELMHCARVVTELLDAKTSTVASAIWHRAQKFYYV
                     REKAIGKVYVKQCNSVLNYSFNYIGVPERLIYTSTMEEAFSALIEALTGGFGGCLFGP
                     AGTGKTETIKALSQNLGKMVLVFNCDDSFDFLAMSRLIIGIAQIGAWACFDELNRLHE
                     SVLSSVTGHVKMIQDAISLKFSVIESMGRSINLNPDTGLFVTLNPGYEGRSHLPDNLK
                     RQFREYSIIRADIPFITQVMFRVLGFRDAAALAQRLVDLFTFLSDTCSRQKHYDFGLR
                     SVKKVLLNCTKMMNHDEKGMEETCLLRRSLTQIVLPGFNVNDECLYFRKVMEIFPQDD
                     SIAPACSFTAQLPEACEKECVILSESFLKKCQQLYHMQTSQQAIIIMGHAGVGKTAVW
                     KTTLRAMRNMDGLNNIIYVIDTKTMGKEGLYGEMNRATLEWKDGIFTSILRTVNDDSN
                     NLFGSGRVWVVLDSDLDPEYIETLNSTLDDNKVLTLPTGERIPVSSNIRLILEVENLE
                     HVTPATMTRCAILWLSIPTYSATEQLDAILAKEVKDMKVCHGVSTLLIERLQSTVGRI
                     LSRGNLSSLITKAKSLKHILGFEQSKVIPTLIRIFSNDIIMNRERLETLGEEEQIKFL
                     IFRLYQILLDVMAGDVSASDQEIIMGSLRSVFDEHYNNLSEKAHLEMAQFVDATLKYT
                     SFNDLLQERKQEHHNITKANTVIATVETLRYEKCISDMLKVGRPVVLCGRPGSGKTML
                     ISNIVSQRKNFQLVSMNFSKDTSVSHIFKTLNRHMKYVDGPKGLTLCPKDSSKNVVLF
                     CDELNLPKPDKYGAQGVILFLRQLIEKGGFWRYGVNKWVFVDRLHVIGACNPSTDFGR
                     VHMSPRFLRHVSILFIDHPSSNALLRIYESLINHSIALTPCINPRQICEASLSVYKKC
                     QSAFTPDSHPHYTCSPREMTRWVKGLYSTITDANATVPSLLRVWAYEAWRVFADRLVT
                     EEEKSRFRALLTETINEFFPEQIVQLGDTSGLLFSSWISTRYEEVSRADILAFLKGKN
                     DSFCEEKGYKLLILHDEMLNHVLRIDRVLKQVQGHAMLIGAGRTGKATMVEFVCWMND
                     IDFLRPSIHKKYGIAEFDSYLRNILLKCTVDEQRICLVIDDSSIRETIFLERMNTLLA
                     NSDIPDLFQEEQYDILMSSLKQKFESLGYSSFSEEDLYDWFVQQISRNLHVVFIICDS
                     VSEKGSQIISSPALFNRCVINWVGTWSLSTLKQLSQELFKSTTVLTVPTNKDDPALQN
                     IADMSESSLPDILSQFHQRYCFKNYQCGSPSFLLDTIWLFKRLLERKHSEMEKDKQFL
                     VNGLKKIDEAVFSFEDLTNILKQNEAGLKSKESEARETLDKILSEQNEAEQKQAETRH
                     IQLSLAKREEEAKHRHDLVQSDLKNFEPVMRAAQLGVKNIKKQHLTEIRSMTNPPVAV
                     KLILEAVCSLLGHQTSNWRSIQQFVRSDEFIPKILHFDAETKLTKEANNFVKDKYLSS
                     PEFSFEKVHRASKACGPLFQWASAQVRFGEVLEKIEPIKLEAKRLEVEALLSKEKLLT
                     AENMAKKVEESIKQSKNDYMRIFRDMEHLRSNMNTVQAKLARSKSLINNLSEEKARWE
                     RKIERFRQKAASTIGNCLISSVMYTYFGKLDEKQRSGALEIIISLLQDNKIECDPNYD
                     FISENMTIADQHIWLSHGLMNKSFFLNNLIMILDSDVVPYIIDPNSEVSSILSKRYGA
                     SLRTISFLESDFKRKFVNAVKFSNMLLINDADHFDPVISNVVISLTQKSKLARTARIG
                     DLEVSLPTEFCMFLHSTDGNKTLPSFLNSRVRVVNFSISRATIQTRAVRAALTYEAPE
                     IDFELQESIELNSSYAMRLRSLESQILNELNESKGSILESDDLIEALGKVKQESNEIT
                     IKLDKNQDVIRRVNEFSVLYANFALHCTCIYFILERFKQLHWFYEIPMWQFFSCLRDI
                     FLSCQQVSHMDTDGRLKMLTSIAYQKLYSSFSACLSERDRRTLAFIMSSMQCYSVDME
                     VLSQSFQAFLAILNGWKRDDGENTLPEELADLKGFIEKGSYGAAINWAEKGFSDKISI
                     EQLSSSNVRKSIVIATDRGSDCSSEVIRLAEAHSQSLSVIALGSPEGTAHAEQEISCC
                     ASKGGWILLQNIQMSMSWVQSFLVKKIEQQLENMDVWEKDFKIFMSCTFSGVALPPAI
                     LQQSYKVTVEGTPTILEQVKTLWKTLTAHSSEASPLIVACKFLLAWFHAILDARSRLV
                     PVGFAKSYDFNDCDLQSGLRHIKDTVNATKHETIELICEQLHFSLGRIIYGGKVDDDE
                     DLKIVQEICRTLFQPAAINCLTNLNEAHEFLPGLTLPKGLADEKVLSAFLDQVSEPTN
                     YYTSWLGLPEDAIHRFEFNAIRDAVRGAIAILQ"
     gene            <206632..>207837
                     /locus_tag="HG536_0F01020"
                     /db_xref="GeneID:59326992"
     mRNA            <206632..>207837
                     /locus_tag="HG536_0F01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284555.1"
                     /db_xref="GeneID:59326992"
     CDS             206632..207837
                     /locus_tag="HG536_0F01020"
                     /inference="similar to AA sequence:RefSeq:NP_012401.1"
                     /note="ancestral locus Anc_1.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140451.1"
                     /db_xref="GeneID:59326992"
                     /translation="MTVEESLRPRGLSNPRDFQDANFLKHPGNHPVERYQTGMSRVRY
                     AMRSYLTRFTDNQSSKLYEWQANHRTTYRDIFFAYTSLLASHTFYVLCLPIPAFIGQV
                     DLVRDMVYVLGYSIYLSGFLKDYWCLPRPRSPPLHRITLSAYTALEYGAPSSHSANAT
                     GVTFLLLWNTWRSATLGWFGKSFCSILALCYYLTLVAGRIYCGMHGLLDIISGAAIGV
                     VCFAARIAIKNLLKDFKLGDHLWFPFFSISWGLLLLFKHVRPIEECPCFQDSVAFIGV
                     VSGFECSEWLLEVLKITSDGGMGIQKGFQYFIYRLVVGVACVALWKYCVSQTLVYCTL
                     LEVLRLPDDRPEKTAAHAAANEEDECPLYIGEPKIDIIGRFFIYAGIPFVVLVICPPL
                     FSFLNITSS"
     gene            complement(<207976..>208191)
                     /locus_tag="HG536_0F01030"
                     /db_xref="GeneID:59326993"
     mRNA            complement(<207976..>208191)
                     /locus_tag="HG536_0F01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284556.1"
                     /db_xref="GeneID:59326993"
     CDS             complement(207976..208191)
                     /locus_tag="HG536_0F01030"
                     /inference="similar to AA sequence:RefSeq:NP_878102.1"
                     /note="ancestral locus Anc_1.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140452.1"
                     /db_xref="GeneID:59326993"
                     /translation="MIAQATKVAAARASVAASSRIIPSAIVAPVFKNSPGNSFSTFKE
                     YRENAKTYGPLSASLAARRHLVHGSKR"
     gene            <209179..>210093
                     /locus_tag="HG536_0F01040"
                     /db_xref="GeneID:59326994"
     mRNA            <209179..>210093
                     /locus_tag="HG536_0F01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284557.1"
                     /db_xref="GeneID:59326994"
     CDS             209179..210093
                     /locus_tag="HG536_0F01040"
                     /inference="similar to AA sequence:RefSeq:NP_012402.1"
                     /note="ancestral locus Anc_1.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140453.1"
                     /db_xref="GeneID:59326994"
                     /translation="MNTSEVIRAEEIDYESLPANASLASQLMAGAFAGIMEHSVMFPI
                     DALKTRIQSASSGAATSGLLSQISKISTAEGSLALWKGVQSVILGAGPAHAIYFATYE
                     FSKSRLIDPEDYQTHQPFKTAVSGTFATIAADALMNPFDTIKQRMQLDTSSTMMNVAR
                     QIYQREGFSAFYYSYPTTIAMNIPFAAFNFVIYESSAKFFNPTNDYNPLIHCLCGGIS
                     GATCAAITTPLDCIKTVLQVRGSETVSLEVFKAADSFTKATKAIFKIRGWRGFWRGLK
                     PRIIANMPATAISWTAYECAKHFFNPSN"
     gene            complement(<210612..>211904)
                     /locus_tag="HG536_0F01050"
                     /db_xref="GeneID:59326995"
     mRNA            complement(<210612..>211904)
                     /locus_tag="HG536_0F01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284558.1"
                     /db_xref="GeneID:59326995"
     CDS             complement(210612..211904)
                     /locus_tag="HG536_0F01050"
                     /inference="similar to AA sequence:RefSeq:NP_012977.3"
                     /note="ancestral locus Anc_1.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140454.1"
                     /db_xref="GeneID:59326995"
                     /translation="MGNAVLSMLPEGHLPGWWQDLSFISSMVSLAISVAAITRHFQNY
                     RKPSEQRLAIRVQLLVPIFSITCLAATLSPDISRLYLDPIREVYEAFVIYTFFSLLTL
                     ILGGEHRIITEICLEHIPSTHAIPLVGRFIRKIDLSDPADFLMVKRGILQYVWFKPVY
                     CLLSLVCIIWSFPLLETILLVLYNISVTWSLYNLAIFWKCLYNDLKKFNPWSKFLCVK
                     LIIFASYWQGIIIRILAHYGKLRSTKGFDTGYVYQNGLLCVEMIGFAILHWIAFPWTE
                     YSSERLPQCARLKYWIAVRDCFGGGDLIWDFKYTLMGPSYYNYRNFEPFASSSQMARA
                     NSLSRMRRLNQGFRFEDQGQGSHWVDYGSILQTPDVKSASDEAADELSEWDDDIARER
                     FISTDPNYPVVSDIGSIHRNSTDINQLRRDVNNRSSMT"
     gene            <212122..>214326
                     /locus_tag="HG536_0F01060"
                     /db_xref="GeneID:59326996"
     mRNA            <212122..>214326
                     /locus_tag="HG536_0F01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284559.1"
                     /db_xref="GeneID:59326996"
     CDS             212122..214326
                     /locus_tag="HG536_0F01060"
                     /inference="similar to AA sequence:RefSeq:NP_012403.1"
                     /note="ancestral locus Anc_1.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140455.1"
                     /db_xref="GeneID:59326996"
                     /translation="MLCNAIRFWILLSLLMLCVFGAGVATHLTYLARVIPDKFHDYGP
                     WLKAGAFFPDTLYSCKPSENLADFAERAHWPQFLISALELWQDRYGSNSSKRDSRDSL
                     RFQAFLIGIFSHQIVDSSWHSLVDGYRSHGLLRVLAETEFGGDVDEAHNYLDVMGDFI
                     VMSNVFKGIADPGWQYYTDTNWSLPREKDVMELLHRNGVNHDEISYKELNVCLMRGLS
                     ASLSEVYVTLNRRVEILNVAYGISPASRELIQDCWLGGEFDLIALLHACLPVFQNLFE
                     PHTELELQARRLQLCGNLPEVSRPLSGPDTNLDFRYDGEVVIVSSRVPQSNFGTSIAV
                     GRFEEDKKLYAAVSAPLEQSKGSIYLIALEDPAKANTAVMKPFTSMRGLAVHTYRFND
                     KDFLIVSEPGSNCIYFYRARRRILTIYDRTADAFQLQLSCVTNINGDSVPDLILSGSS
                     YGRNETGCAMLVPGSSLISYLNSDHPTEVEISALTAVRLNGEPFKKPYQHFGAALTSS
                     YSHSPSGFLYVTCQGLGMVLVYSLSGLHSNSLPRYVIMAKEITLFKKYNYDNAEILPS
                     SRHGMFGKIMLSWNYVGESFVAISQHLFNSVFIYHEIDGKVEFFLKLVLHHDSSTSSC
                     TIGFGTAIQYDDQLKSLYVSSPGSFDGKGAIWRVGMQEIINAVKIWRQDIFYVKAVSH
                     LYFANPQIDSKGVSNFGKAMQIVPDRRIIIGVPQLNYGNLQAEQLTGAIIIK"
     gene            complement(<214430..>215488)
                     /locus_tag="HG536_0F01070"
                     /db_xref="GeneID:59326997"
     mRNA            complement(<214430..>215488)
                     /locus_tag="HG536_0F01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284560.1"
                     /db_xref="GeneID:59326997"
     CDS             complement(214430..215488)
                     /locus_tag="HG536_0F01070"
                     /inference="similar to AA sequence:RefSeq:NP_012404.1"
                     /note="ancestral locus Anc_1.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140456.1"
                     /db_xref="GeneID:59326997"
                     /translation="MWNPATRRAHVSLICRWKGFHTSLAHSNWMLSNDIIRNALTSNI
                     NSRGKPTGPDGGKQPRGPLKKMTKNRPANKNKPHSRNNLAITWSNGSDRDKEAASAVV
                     SQIFRMNKAGAIKFVNSTTSKLEGTNIRSFAKGINLEKNGLVIVNFEEIDEATKVPLV
                     KLVDRKTALKRFSDEKAKQKELEMINLGLVKRRAARSSDGEKADDNVKQIRISWQIKN
                     DDLNKQKAHEITTQLKKGYKVYLYIDDKNHINSKNWTTDFDIPLRKNAQKELSAKELN
                     QRNYVLQRLMEIADEFSNQPTIEGGVETKILIKLTPKNVTMEPSSKQSLKEQRKKERQ
                     EKLQQRIERKRQRILEKE"
     gene            complement(<215794..>222477)
                     /locus_tag="HG536_0F01080"
                     /db_xref="GeneID:59326998"
     mRNA            complement(<215794..>222477)
                     /locus_tag="HG536_0F01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284561.1"
                     /db_xref="GeneID:59326998"
     CDS             complement(215794..222477)
                     /locus_tag="HG536_0F01080"
                     /inference="similar to AA sequence:RefSeq:NP_012405.2"
                     /note="ancestral locus Anc_1.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140457.1"
                     /db_xref="GeneID:59326998"
                     /translation="MSVIIPTAPVTPPLEATGDRLVALELKDGTSLLGYSFGAEKSAA
                     GELVFQTGMVGYPESITDPSYEGQILVITFPLVGNYGVPDRQLADEIVEGLPRYFESN
                     RIHVAGLVISHYTEQYSHWLAKSSLGKWLKEEGVPAVYGVDTRALTKHLRDKGSMLGR
                     LALQRSSSTNVDVGSPLWRDSFDVPQWYDPNVQNLVAQVSTKEPHLYLPPTDHERVKL
                     QKGPDGKTLRILAIDVGLKFNQIRCFVNRGVELMVVPWDYDFTQEQYDGLFISNGPGD
                     PSVLTDLANRLTAVVQSKKTPIFGICLGHQLLARANGFSTMKLKFGNRGHNIPCTSTI
                     SGRCYITSQNHGFAVDAESMSDGWEPLFTNANDSSNEGMYHKELPYFSVQFHPESTPG
                     PRDTEFLFDVFIQAVKDHKSTGILKPVEFPGGKIEDNRKAHPRVEPKKVLVLGSGGLS
                     IGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFLPVTAEFVRKV
                     ILHERPDAIYVTFGGQTALSVGIEMKDEFETLGVKVLGTPIDTVITTEDRELFAQAMA
                     EIDEKCAKSQAANSVEEALAAVKNIGFPVIVRAAYALGGLGSGFAYNEQELIDLCNVA
                     FASSPQVLVERSMKGWKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQT
                     LTDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKA
                     TGYPLAYTAAKLGLNIPLNEVTNSVTKSTCACFEPSLDYCVVKMPRWDLKKFTRVSTA
                     LSSSMKSVGEVMSVGRTFEEAIQKAIRSTEYSNLGFNETALDIDIDYELKNPSDLRIF
                     AIANAFAKLGYSVDQVWEMTNIDKWFLNKLYDLVKFSKKVADFGSKENLPPIVLKQAK
                     QLGFDDRQIAKFLNSNEVAIRRLRKEYGITPFVKQIDTVAAEFPAFTNYLYMTYNAAA
                     HDLDFKDNGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRANKIKTIMVNYNPETVSTDY
                     DEADRLYFETINLERVLDIYEIENSAGVVVSMGGQTSNNIAMSLHRENVKILGTSPEM
                     IDSAENRYKFSRMLDQIGVDQPAWKELTSMEEAEEFADKVGYPVLVRPSYVLSGAAMN
                     TVYSRDDLESYLNQAVEVSRDYPVVITKYIENAKEIEMDAVARDGELVMHVVSEHVEN
                     AGVHSGDATLIVPPQDLDPETVNRIVVATAKIGKALKITGPFNIQFIAKNNEIKVIEC
                     NVRASRSFPFISKVVGVNLIELATKAVMGLPFTPYPVEKLPDDYVAIKVPQFSFPRLA
                     GADPVLGVEMASTGEVATFGHSKYEAYLKSLLSTGFKLPKKNILLSIGSYKEKQELLP
                     SVKKLCNMGFKLFATAGTADFISEHGIPVQYLEVLNQEDDEKSEYSLTQHLANNKIDL
                     YINLPSANRFRRPASYVSKGYRTRRMAVDYSVPLVTNVKCAKLLIEALSRNLNLDVSD
                     RDAQTSHRTVTVPGFINIATFAANSSNVIKGPAELKEVTRLSLESGFTYCQLMARSLA
                     GPIISDPTSLKSAFSASQDSAYTNFSFTVAGTANNVDTIAQTANEVSALFLPFRELKN
                     KVSTVAALLKNWPIEKQVIAEAKTSDLASVMLLASLQNRSIHITGVSNKEDLSLIMTV
                     KDKDSKVTCDVNIHSLFVSQDDYPEALFLPTKEDQDFFWQNLDAIDAFSIGALPTLLA
                     QITGNKVDVGLGIKDALPLLLSAVEEGKLTIDDIVERLHENPARIFNIPEQLDAAVEI
                     DLDHSFKHTKRWSPYTKGGLNGGIERVLINNETVVLSGDLVSSAPTGKLITTAKVIPG
                     IPATPSSANETPLSIQPPSGVRRRFSFSNERLNSFTSVDGEAENVFDQPLEQRLMSSR
                     PPKELIAPGAIENLIRTNNPFKGRHILSVRQFKRSDFHALFAVAQELRAAVERQGVLD
                     LMKGRLITTIFYEPSTRTSSSFIAAMERLGGRTVNINPSASSVKKGETLQDTIRTLAC
                     YSDAIVMRHPDEMSAHVAAKYSPIPIINGGNGSREHPTQAFLDLFTIREELGTVNGIT
                     VTFMGDLKYGRPVHSLCRLLQHYQVRINLVSPNELKLPNALRKELAEAGLLGVESEII
                     NPDIISKSDVLYCTRVQQERFENKDEYERLKDVYVVDNKILSHAKKHMAIMHPLPRVN
                     EIKEEVDYDHRAAYFRQMRYGLFVRMALLAMVMGVEL"
     gene            complement(<223295..>226933)
                     /locus_tag="HG536_0F01090"
                     /db_xref="GeneID:59326999"
     mRNA            complement(<223295..>226933)
                     /locus_tag="HG536_0F01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284562.1"
                     /db_xref="GeneID:59326999"
     CDS             complement(223295..226933)
                     /locus_tag="HG536_0F01090"
                     /inference="similar to AA sequence:RefSeq:NP_012406.1"
                     /note="ancestral locus Anc_1.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140458.1"
                     /db_xref="GeneID:59326999"
                     /translation="MLGRRLSHVPSFASLNIPYRKSFGHKFRDAIANCGSRMKPIRKY
                     IFPNFLAVHYFYIIMVTIIASILMYPVKDFRYIDILFLAAGATTQGGLNTVDTNKLSL
                     YQQIIVYLTCICCTPIAIHGCLAFVRLYWFERHFDNIRDSSKKNYKMRRTKTILERQM
                     TNRTISRRSQRTGQSRLPTAASGNDDNFQEKLFSGKKLYRDEGEPATADQQAEPSEST
                     RKDGLDLNGSSGSSSNTANNNNAVLYPRGDLTFEEPGIRRRSKPREGFVGRRKSTEIS
                     PEDMYRSIQMMQGQHQEDSEDEGPALVISGPNDRGSSYFENNEPQNDGQQGEVHESTN
                     HYKESNSSDVSEEAANKEAELTKKSMGESDHEDLGKGVPHGDESAKPAIQFDVSALPK
                     RPMKNRYGTSIRGPTLQRRRSSRGLLKHLSKGKAIGQKLRRRLSSNTMERPSAKQPKS
                     HIDEEEASDKDNMEEYFADNESDEEEEDLKTHNFSHPFERIHTSDEIGSSHVSSSSKM
                     PRSLTMDAHQAKNLDDLTQSPEFQRLIYRDWKRRHRKPNPLRRKSWTAKKSESEYSTG
                     FPWMQDTFNSDDQASNDHELNQEDSVHSFDAENDLAERSSNDENKAINDDPDEQRNRS
                     SLDEELGYYGLTIDPDFSGSPRPRIARTMSTNYLSWQPTIGRNSTFAGLNKAQKEELG
                     GIEYTSIKLLCRILVIYYVGFMILSFVLLLPWVLSMPKYKRIIREDGVSPTWWGFFTA
                     MSAFSDLGLTLTPDSMNSFNEAIYPLVVMIWFIIIGNTGFPVLLRFIIWVLFKLSPEL
                     SQTKENLGFLLDHPRRCFTLLFPSAATWWLLITLVGLNSFDLVIFLILDFGAPVLKPI
                     GKGYRVLDGLFQSVSTRTAGFSVVDISQLHPAVQVSYMLMMYVSVLPLAISIRRTNVY
                     EEQSLGMYGKMEREDTLHSEESDSSEGSAGDSNLPRAQAKKKKKDPSTESFIGAHLRK
                     QLSFDIWFLFLGLFIICLCEGGKIKDPTKPDFNIFAILFEIVSAYGTVGLSLGFPNFN
                     TSFSGQFTTLSKLVMVAMLIRGRHRGLPYALDRAIMLPSDRLEHVDHIEDLKLKRIPR
                     SASDNVDPVTAYFKKKTSQLNNLFGRLRSTVAKPENSALHSYEDNHDRPDYNLPGARN
                     STRDPLDSSSRHAAPRGDPSLPSSMHSTSSMESPGSLHHLDGLSARRKERSDDEPLDT
                     NIPVSYQE"
     gene            complement(<227413..>229332)
                     /locus_tag="HG536_0F01100"
                     /db_xref="GeneID:59327000"
     mRNA            complement(<227413..>229332)
                     /locus_tag="HG536_0F01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284563.1"
                     /db_xref="GeneID:59327000"
     CDS             complement(227413..229332)
                     /locus_tag="HG536_0F01100"
                     /inference="similar to AA sequence:RefSeq:NP_012407.2"
                     /note="ancestral locus Anc_1.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140459.1"
                     /db_xref="GeneID:59327000"
                     /translation="MKEQFSKLTVNQEGKDEVERGDSSVASSGMQSSGGSAAKVGGGG
                     PSSSHYNNINANLHARVKAFQEQRALKRSSSVGSNKGDTEAAARAKGNQNMQQIVNKP
                     LPPLPASSVAESDGEVEQPRVQATAAHRNVAAVPDLLKPHYDRKSGALPTAQQASNAP
                     ENLAQFNPNRKAPRRPPSARNVIPNVSSKPAQGLSARRGLQLPMGAMSLRLPGKVEKH
                     STSLATQEFASAPSNSNHLTSSGGGGSGNRSNPGSLINGVQSTSTSSSNEEQRDTEGT
                     APRNSNSNSGGLFANFSKYVDIKSGSLNFAGKLSLSSEGIDFSNGYSSRITLEELEFQ
                     EELGHGNYGNVSKVLYKPTNVIMAMKEVRLELDEAKFRQILMELEVLHKCQSPYIVDF
                     YGAFFIEGAVYMCMEYMDGGSLDRIYDTSPEIGGIDEPQLAYITHAVIEGLKELKDVH
                     NIIHRDVKPTNILCSAKHGTVKLCDFGVSGNLVASLAKTNIGCQSYMAPERIRSLNPD
                     RITYTVQSDIWSLGLSILEMALGRYPYPPETFDNIFSQLSAIVDGPPPKLPRDKYSPE
                     AQDFVSSCLQKIPERRPTYAALLEHPWLTKFKDVDVQMSTYITSRLEKRRELLAERGE
                     KELPKHLPALHMGGL"
     gene            complement(<229809..>230108)
                     /locus_tag="HG536_0F01110"
                     /db_xref="GeneID:59327001"
     mRNA            complement(<229809..>230108)
                     /locus_tag="HG536_0F01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284564.1"
                     /db_xref="GeneID:59327001"
     CDS             complement(229809..230108)
                     /locus_tag="HG536_0F01110"
                     /inference="similar to AA sequence:RefSeq:NP_878103.1"
                     /note="ancestral locus Anc_1.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140460.1"
                     /db_xref="GeneID:59327001"
                     /translation="MNFSITSKFALLTTIIRTSNLRCPHSSALLEEAVPQTSPSTSRT
                     PQPMIFFFKQIRDIFAKSHSTLQQIQLSRRAFFRLLGYLASCAVISLASQSKLLH"
     gene            complement(<230257..>231975)
                     /locus_tag="HG536_0F01120"
                     /db_xref="GeneID:59327002"
     mRNA            complement(<230257..>231975)
                     /locus_tag="HG536_0F01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284565.1"
                     /db_xref="GeneID:59327002"
     CDS             complement(230257..231975)
                     /locus_tag="HG536_0F01120"
                     /inference="similar to AA sequence:RefSeq:NP_012408.1"
                     /note="ancestral locus Anc_1.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140461.1"
                     /db_xref="GeneID:59327002"
                     /translation="MTMFTQTGGLVEEGHLQDQVLTPLQPHTILLKDGETVATMYPIP
                     ANADLLPVGLLAFLLDEFNMEIEKGDSFPYYETLSLKQFKEAWFHADGHIAVMVLGEV
                     PELDYSMENDLSDLENNYGTDIETMRQTSQYKKRKKRRNLNLNIQWEKQCLGIFSLQP
                     AYPGRSSHIVTGTFLVNAGIRGKRIGRTLVETFIEWSKRLGFTSCYFPLIYGTNVGIR
                     RILESLNFKRIGKLPESGILKGFDVPVDSFIYGKEFTHITKSIDLLRDPQKTNDIAKY
                     ERLKYYLETGKYPANCDRNEKARLRVSSRTHSVLNGKLMTRGREIVFEPDRQRQIAME
                     MHAVEHQGINKITTRIVERYHWKGIKNTVSEVIAQCHRCKMRHQDGVGVIVKPGKSVK
                     QAHMFAAHSESTDDDLDHSAQLSRMAAVVVGSLQADVDDHESAKDSTPADAEERQSAT
                     PQVTSLDFDKLDKSHNQLMQPMLSTEQSMNAFNRFMEEEQQRKRRKFTSVNSNADNNP
                     ENFEQETPGTVPVLDKNDQNLMDDAILGLQENVMAAVELAHKGRTAEQTPDSADDDAG
                     GASVFY"
     gene            <232572..>233066
                     /locus_tag="HG536_0F01130"
                     /db_xref="GeneID:59327003"
     mRNA            <232572..>233066
                     /locus_tag="HG536_0F01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284566.1"
                     /db_xref="GeneID:59327003"
     CDS             232572..233066
                     /locus_tag="HG536_0F01130"
                     /inference="similar to AA sequence:RefSeq:NP_012409.1"
                     /note="ancestral locus Anc_1.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140462.1"
                     /db_xref="GeneID:59327003"
                     /translation="MKESSGVQPGSKAAEIVQTPVGRLGLEICYDIRFPEQSLELRSK
                     GADILCFPSAFTMKTGEAHWQLLGRARAVDTQCFVVMPAQSGKHDTGSGADSSQDYVE
                     RISWGHSMVIDPWGRIIAQSGCNGEELIIADLDYTVLEKVRADMPLWEQRSAAAKAAD
                     QRAK"
     gene            complement(<233074..>234222)
                     /locus_tag="HG536_0F01140"
                     /db_xref="GeneID:59327004"
     mRNA            complement(<233074..>234222)
                     /locus_tag="HG536_0F01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284567.1"
                     /db_xref="GeneID:59327004"
     CDS             complement(233074..234222)
                     /locus_tag="HG536_0F01140"
                     /inference="similar to AA sequence:RefSeq:NP_012410.1"
                     /note="ancestral locus Anc_1.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140463.1"
                     /db_xref="GeneID:59327004"
                     /translation="MSVFSEYKDCIEEGDLVLVWISRDNIKPIRVDSNEIFNTRYGSF
                     PHKMMIGQRYGSQIAIRTKGANKFAFIHVLQPTPELWTLSLPHRTQIVYTPDSSYIME
                     RLNCNPRTRAVEAGTGSGSFSHAFARSVGHLYSYEFHGPRYEEALKEFREHGLVDADK
                     NVTITHRDVCRDGFRIRREDVTSHQFGEDEGEVAIGANVVFLDLPAPWDAIPHLEEVI
                     CSDEKVGLCCFSPCIEQVDKTIEALNKHGWSDLQMVEIQAKQFESRRQMVRTVDDAIE
                     RLRDVKRRKSEGLERRKRMCESLVSDQPEADETEEKRPVTEKTKFNPFGKGARVKEGD
                     ANYKWKEVTKVEPEIKSHTSYLTFAFKVANKSRDEEAVQKILESTESK"
     gene            complement(<234348..>234857)
                     /locus_tag="HG536_0F01150"
                     /db_xref="GeneID:59327005"
     mRNA            complement(<234348..>234857)
                     /locus_tag="HG536_0F01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284568.1"
                     /db_xref="GeneID:59327005"
     CDS             complement(234348..234857)
                     /locus_tag="HG536_0F01150"
                     /inference="similar to AA sequence:RefSeq:NP_012411.1"
                     /note="ancestral locus Anc_1.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140464.1"
                     /db_xref="GeneID:59327005"
                     /translation="MSDRGSAEPVQLAATHGSQSKKISEGEADLYLDQYNFTTTAAIV
                     GSVDRKIFVLLRDGRMLFGVLRTFDQYANLILQHCVERIYLTEANQYAEETRGLFMVR
                     GENVVMLGEVDIDKEDQPLESMERIRFSDAARTKTHSDETRFKRETAKGKQLARYGLL
                     YDFHKSDMY"
     gene            <235074..>235475
                     /locus_tag="HG536_0F01160"
                     /db_xref="GeneID:59327006"
     mRNA            <235074..>235475
                     /locus_tag="HG536_0F01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284569.1"
                     /db_xref="GeneID:59327006"
     CDS             235074..235475
                     /locus_tag="HG536_0F01160"
                     /inference="similar to AA sequence:RefSeq:NP_012975.3"
                     /note="ancestral locus Anc_1.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140465.1"
                     /db_xref="GeneID:59327006"
                     /translation="MSMLRSLQHQPKVISLFTHNLENGKATEAILQVLKCDAGEKYNV
                     ELDTKFPTLDQLKYMNSINPNVLRSQIPKLSELLARKSHDSVFHSELKECVAKGYWSG
                     KHPLWVDWEERRMGNDAESIRKLLEPENKPE"
     gene            complement(<235520..>236767)
                     /locus_tag="HG536_0F01170"
                     /db_xref="GeneID:59327007"
     mRNA            complement(<235520..>236767)
                     /locus_tag="HG536_0F01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284570.1"
                     /db_xref="GeneID:59327007"
     CDS             complement(235520..236767)
                     /locus_tag="HG536_0F01170"
                     /inference="similar to AA sequence:RefSeq:NP_012412.1"
                     /note="ancestral locus Anc_1.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140466.1"
                     /db_xref="GeneID:59327007"
                     /translation="MAERKSTEADDVFEFLESLPQTGRDGTGDKGDKQKSKNNEDIME
                     FLDELEKSNLSLSKKGRDAEKPKQETAEASKETAATERPGAESKRKEAEAVEEPLHDP
                     ITSLSKWWSSSGSATVSSFWNKTTEQASSIKTKLAQDQLDLSSKLSAAAITDLARNLQ
                     KMVARETDEVLRIHLVHDLVNFPQLQYNVEQKFDQVLSSQVQGGIRIFVDQWGHPHKS
                     AEDAQSKSTSVRKLNIFNGKIADGEKLAFANLDNAIRLFDTAHEEYMKQQEQSREHTA
                     DDGSSKDGISDIFISILPIAVPGNNQKAGDDIPTTDSVHAGNFSFTIILKDITNGISS
                     ITRSQGFPMKWVGWLEGESNWKPKHAREQPKEEDASSGAAAEDDEEEIVDPSDWVKEW
                     VEDGLFLSLGVVAQNYVIERMGF"
     gene            <237266..>237763
                     /locus_tag="HG536_0F01180"
                     /db_xref="GeneID:59327008"
     mRNA            <237266..>237763
                     /locus_tag="HG536_0F01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284571.1"
                     /db_xref="GeneID:59327008"
     CDS             237266..237763
                     /locus_tag="HG536_0F01180"
                     /inference="similar to AA sequence:RefSeq:NP_012413.1"
                     /note="ancestral locus Anc_1.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140467.1"
                     /db_xref="GeneID:59327008"
                     /translation="MPSKNSINRPKLTTNLNRKTQSLARKRDQRERAGLLQPARSSEK
                     SKSGQVKSVPLELYFHGKVGQTAGNQALTTKTLSKKRAKKIERNLKYAEQRKLLAELQ
                     DKVANEDGMEVDVQAGKSQKREEKKSSLAKMKDALWRVIDDSSSQGLVLNGGQGTTLG
                     GPVFC"
     gene            complement(<237797..>238513)
                     /locus_tag="HG536_0F01190"
                     /db_xref="GeneID:59327009"
     mRNA            complement(<237797..>238513)
                     /locus_tag="HG536_0F01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284572.1"
                     /db_xref="GeneID:59327009"
     CDS             complement(237797..238513)
                     /locus_tag="HG536_0F01190"
                     /inference="similar to AA sequence:RefSeq:NP_012414.1"
                     /note="ancestral locus Anc_1.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140468.1"
                     /db_xref="GeneID:59327009"
                     /translation="MVKPIIAPSILASDFANLGCECHRVINAGADWLHIDVMDGHFVP
                     NITLGQPIVSSLRRAVPRADDASNVGKKPSAFFDCHMMVEEPEKWVEEFVKCGADQFT
                     FHYEATRDPLALVKLIKKQGCRAACAIKPGTPVDVLYELAPHLDMALVMTVEPGFGGQ
                     KFMIDMMPKVEKLREKFPDLDIQVDGGLGRDTIPHAAKAGANVIVAGTSVFTAADPAD
                     LISFMKSEVRGNLASKGLLT"
     gene            <239008..>240315
                     /locus_tag="HG536_0F01200"
                     /db_xref="GeneID:59327010"
     mRNA            <239008..>240315
                     /locus_tag="HG536_0F01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284573.1"
                     /db_xref="GeneID:59327010"
     CDS             239008..240315
                     /locus_tag="HG536_0F01200"
                     /inference="similar to AA sequence:RefSeq:NP_012974.1"
                     /note="ancestral locus Anc_1.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140469.1"
                     /db_xref="GeneID:59327010"
                     /translation="MSAPIRTKPKSSMKIDNAPTPHNTPASVLTGSFLKNGNPLKAEG
                     AVDGGSGKGEAIPQTISEEDIQSALSNQPFLLQSIQDKLGSLVGQDSGYVSQLPEIVK
                     DRLYGLKKIQNDLFALERDFQMEMFALEQKYLSKYSPLHERRYKIVSGREEPTAEEVK
                     KGRELAMEEGEEEQAEDRAKNEEEQQDIKGIPSFWLTALENLPVVSETITDRDAEVLD
                     YLVDIKLEYLSDGRPGFKLVFTFDEDTPFFKNKSLTKTYFYQKELGYSGDFIYDHAEG
                     DEIQWTDNESNPTVSVEMRKQRNKATKQVRTIEKITPVDSFFNFFDPPKVPTREPTAQ
                     DADDADEQDEDELQELEERLALDYSIGEQLKDKLVPRAVDWFTGAALEFEFDNELADD
                     EGFEDDDDDEAGEDDDEDEDEEEDEEEQDDFAKKEAAPECKQS"
     gene            <240876..>241829
                     /locus_tag="HG536_0F01210"
                     /db_xref="GeneID:59327011"
     mRNA            <240876..>241829
                     /locus_tag="HG536_0F01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284574.1"
                     /db_xref="GeneID:59327011"
     CDS             240876..241829
                     /locus_tag="HG536_0F01210"
                     /inference="similar to AA sequence:RefSeq:NP_012972.3"
                     /note="ancestral locus Anc_1.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140470.1"
                     /db_xref="GeneID:59327011"
                     /translation="MAGSNVKVVVNKDTRDKFARNSPTLNHLYKYPAVSKTLNQVVSL
                     PVVSQVLSLFILAALKVKHALVDSERSPRFVKVAYGSLSEMSLRLDELVNLLLFREGI
                     DAFMKGWSAHSKKPGFWLVYFWIDYVANVSNILLNQFVVQPFKLGVKDKGAETSSGAE
                     TTPGDESLPHVSQLTSTTKSISKELHDKLQADYIAPTADFAKQKYESLVKPTAEKLNS
                     EYIEPTKAQLSNITRPTRAHAMETYKTVSATYESNLSKSESVPRAIVSTGIDLKNLTL
                     ENLKSNRTELEKDAQEAIEHKKETLGQAAEEKVDSLGNTVG"
     gene            <242054..>242698
                     /locus_tag="HG536_0F01220"
                     /db_xref="GeneID:59327012"
     mRNA            <242054..>242698
                     /locus_tag="HG536_0F01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284575.1"
                     /db_xref="GeneID:59327012"
     CDS             242054..242698
                     /locus_tag="HG536_0F01220"
                     /inference="similar to AA sequence:RefSeq:NP_012971.2"
                     /note="ancestral locus Anc_1.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140471.1"
                     /db_xref="GeneID:59327012"
                     /translation="MSNHDHTFQGRKKKLSGWVRRMIQPAKDASARNQLVSDEILGEE
                     TDLQASTASRSPNDDDGVSMKVLWDSGPVRAKSEPRSIERDSEQEPVDNVSITPLFSM
                     CSSSVKSSTFSDSYSIQSTRATVVSGRTVETNSSTMAIPPASILGRTRASSITAPASS
                     NSSVGPATPTSVAQPYHSHHRHYQGPSSRPSSMRHIQIQRDPSSDTINSSSTIK"
     gene            <242901..>243821
                     /locus_tag="HG536_0F01230"
                     /db_xref="GeneID:59327013"
     mRNA            <242901..>243821
                     /locus_tag="HG536_0F01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284576.1"
                     /db_xref="GeneID:59327013"
     CDS             242901..243821
                     /locus_tag="HG536_0F01230"
                     /inference="similar to AA sequence:RefSeq:NP_012418.1"
                     /note="ancestral locus Anc_1.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140472.1"
                     /db_xref="GeneID:59327013"
                     /translation="MSGKDGLARRKPVEQVDASLDQPINVEAPPTIYGSAITPGLATA
                     SLNLSVDFIKQQQSLANRGMIHHYITKAVLVVVASIYLGRTITLPRNLSSGSVAEFAY
                     QFMLFNRYPLGTSIALLALTFLCLLTVYSRVTETFFKSKISEATADSGKSCFGMNLRE
                     YILKPEKGPRDAQADNTYVIVYRETPIAVISLSENKSLSSEDSLVMGISALGCRKVYL
                     TSGILEDLLDWAMIRTRAIAKNGKYGESMKILLNVYSFDDHTKKTLKAKGFSLVASSK
                     IKESRVLGGLFGFEKELWGVQFHIEASEKE"
     gene            complement(<243841..>245178)
                     /locus_tag="HG536_0F01240"
                     /db_xref="GeneID:59327014"
     mRNA            complement(<243841..>245178)
                     /locus_tag="HG536_0F01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284577.1"
                     /db_xref="GeneID:59327014"
     CDS             complement(243841..245178)
                     /locus_tag="HG536_0F01240"
                     /inference="similar to AA sequence:RefSeq:NP_012970.3"
                     /note="ancestral locus Anc_1.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140473.1"
                     /db_xref="GeneID:59327014"
                     /translation="MRCLKVITRSTVVVLGQSERELMRGPWFRKLVVAITIAAVFAVF
                     RISSEHFVDSDSGSRLIIRRSQIQRVPNQDASLSIPFLDKVSNFWYVGGGTEIRNNEF
                     IRLTRAGSSGHHGLILSNGLGDNTIDNFETVVKFRISPKAGNMRSRLMGDGMAIVITP
                     EKDFLLQDLASSYARRQYEINSGGIVAGDTQMMGLPKNLPGLALIIDTYKNDGKAGTP
                     IPFLDIILNTSPSTQAYDADSDGAKTTAIKINQNKIRLKKSIMTGETVQLRLIYIESE
                     NFLKIDIQYTREGNYWIELVHTHLPTVLPRNIESNQRYIGISASTGELSQTVDILGIE
                     TNEYHLKGKDGLSKDFLREIELYFLQEFNDKIVMEKDDFQRWKMAKSRPLYQTKEKAS
                     VKPGRHGSFVQTFAFFFTILICIYLASVYIRVSIKHFLNANRGSTKRSRALPR"
     gene            <245530..>246348
                     /locus_tag="HG536_0F01250"
                     /db_xref="GeneID:59327015"
     mRNA            <245530..>246348
                     /locus_tag="HG536_0F01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284578.1"
                     /db_xref="GeneID:59327015"
     CDS             245530..246348
                     /locus_tag="HG536_0F01250"
                     /inference="similar to AA sequence:RefSeq:NP_012969.1"
                     /note="ancestral locus Anc_1.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140474.1"
                     /db_xref="GeneID:59327015"
                     /translation="MGKVPTPRCIIVRHGQTEWSKSGQYTGLTDLPLTEYGVGQMRRT
                     AASIFSNKFIDPDTITYVFTSPRTRARQTVDLMLEPLTEEQRSRIRIVVDEDLREWEY
                     GDYEGLLTHEIVALRKSRGLDQERPWNIWRDGCENGETTQQIGLRLSRALARIQNLHR
                     EHQAKGIACDIMVFAHGHALRYFAGLWFMPCAEKACETAEERAQPKTYHDATVPYVAL
                     NKYKYLDYNPNFLLDAGGIGVLSYSHHNIDEPALALAGAFVSPPEEESQHGDVK"
     gene            complement(<246547..>247638)
                     /locus_tag="HG536_0F01260"
                     /db_xref="GeneID:59327016"
     mRNA            complement(<246547..>247638)
                     /locus_tag="HG536_0F01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284579.1"
                     /db_xref="GeneID:59327016"
     CDS             complement(246547..247638)
                     /locus_tag="HG536_0F01260"
                     /inference="similar to AA sequence:RefSeq:NP_012419.1"
                     /note="ancestral locus Anc_1.241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140475.1"
                     /db_xref="GeneID:59327016"
                     /translation="MRLSSLLLLSSGVLGAPAVHHKDRHNEKREVVVVTRYVDQTGGE
                     ASHPAVQSTLSSGPAATGAATTTSSSAAASSAASSGASSGASSGGSGGVHGDLADFSG
                     PNQEFQDGVIPCSQFPSGQGVVKLDWVGLDGWASIMDLNGNTASTCKEGFYCSYACQA
                     GMSKTQWPSEQPSDGRTVGGLQCKNGFLYRANPNSQYLCEWDQNSASAINKKSQSICM
                     CRTDYPGSENMVVPTVVDAMGSKPVSVVKEDSYYQWQGKKTSTQFYVNNAGVSVEDGC
                     IWGEPGSGVGNWAPVVLGAGYTGGITYLSIIPNPNNRNPPNYNIKIVANEGSSINGDC
                     KLENGVYTGSGSDGCTVSVTSGSASFVFY"
     gene            <249522..>250337
                     /locus_tag="HG536_0F01270"
                     /db_xref="GeneID:59327017"
     mRNA            <249522..>250337
                     /locus_tag="HG536_0F01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284580.1"
                     /db_xref="GeneID:59327017"
     CDS             249522..250337
                     /locus_tag="HG536_0F01270"
                     /inference="similar to AA sequence:RefSeq:NP_012420.1"
                     /note="ancestral locus Anc_1.242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140476.1"
                     /db_xref="GeneID:59327017"
                     /translation="MSIVSLLGIKVLNNPANFSDPYEFEITFECLEPLKHDLEWKLTY
                     VGSSRSLEHDQELDSILVGPVPVGVNKFVFTADPPSAELIPASELVSVTVILLSCSYD
                     GREFVRVGYYVNNEYDSEELRENPPAKVQVQHVVRNILAEKPRVTRFNIVWDNENEGE
                     MYPPEQPGVDDEADEEDDEEEEEEEEEEEEEEDDDEAEEEAEEEGEARELEAQEAEEE
                     DEEAAEQAIDAADQHAGEDEDPPEINEEDDDLPSLKKRKIEGEDEAASTPQDV"
     gene            complement(<250367..>251122)
                     /locus_tag="HG536_0F01280"
                     /db_xref="GeneID:59327018"
     mRNA            complement(<250367..>251122)
                     /locus_tag="HG536_0F01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284581.1"
                     /db_xref="GeneID:59327018"
     CDS             complement(250367..251122)
                     /locus_tag="HG536_0F01280"
                     /inference="similar to AA sequence:RefSeq:NP_012967.1"
                     /note="ancestral locus Anc_1.243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140477.1"
                     /db_xref="GeneID:59327018"
                     /translation="MERPNDYEGQESSETFDIKFERPVFIRQGKNVELKREKRVQKPL
                     KSACKPSHGTRVKNPSSKPLIFVQEDLDNSQSTCSDEESLKPPKKATNRETYYEYGES
                     VGGYRFVGTEREMLDFESSKGANRIQKSDSFDAQSFDRPNLSEKQRFSTHDYIVRYWN
                     QDKGGSALYFPILSANRGEHIHINDLTADRVEQFYLHSCSQLGFDLPSILKRERLKWH
                     PDRLLGKLAPEDAGTVRKITRLFQIINELWESQ"
     gene            complement(251227..251299)
                     /locus_tag="HG536_0Ftrna7A"
                     /db_xref="GeneID:59327387"
     tRNA            complement(251227..251299)
                     /locus_tag="HG536_0Ftrna7A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:59327387"
     gene            complement(<251581..>253986)
                     /locus_tag="HG536_0F01290"
                     /db_xref="GeneID:59327019"
     mRNA            complement(<251581..>253986)
                     /locus_tag="HG536_0F01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284582.1"
                     /db_xref="GeneID:59327019"
     CDS             complement(251581..253986)
                     /locus_tag="HG536_0F01290"
                     /inference="similar to AA sequence:RefSeq:NP_012433.1"
                     /note="ancestral locus Anc_1.264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140478.1"
                     /db_xref="GeneID:59327019"
                     /translation="MSIARLWGSLRSYATKPELRKLRNIGIIAHIDAGKTTTTERMLY
                     YSGKISRIGNVDQGDTITDFLPQEKSRGITIQSAAVSFNWQKDHQINLIDTPGHADFT
                     FEVIRSVKVLDGCVTILDAVAGVEAQTEKVWKQSQRSPKICFINKMDRVGAGFSRTVK
                     ELIAKMNTRVALINIPLFVQEPQDQVPRFAGVIDLVNMKVIEWDPEDCDKINVTDATT
                     AGAEIQEQLLRGRESLIETLGEYDENLIEFFLEEANGDYLKVPPELLNGSIRKATLAK
                     FVTPVLCGASFRNIGVQPLLDAIVNYLPSPLEASLPETNHPTLPVKLDPKLGALMNNN
                     KNLCVLLAFKVITDPIRGIMVFVRVYSGTLHAGNTAFNSNTGKKFKIGKLVIPHANVY
                     EEVSTLYPGQIGILVGTTVAENVSTGDTIVTHSLKKDGLRSLDSKRELTVKINPIAIP
                     PPVFSVCVEPRTLGNKKSMEDALGTLTREDPSLHVSFDEETGQTLLSGMGELHLEIAK
                     YKLVNELNADVEIGKVMVSYKETIDGKTPEETISSDAGYQLTVSILPLPLHEDTLDVV
                     ARSIHETWYPLGIDNNYLIMENHRKYTTEELWPFQISFQAVINALISSSIVALQKGGK
                     IARYPLHSCAVKVKGDWTLPPDIENPAEVLKLSRKLILTAISNIPQDQFSVLEPVMDL
                     DISVPQKDMGSVIQDLTGSRNANILSIDDESGIDNNDQNIEFQKIAQEQFLPPDPTVK
                     LANLGSEGSSMKFIKAQVPLRDMVSYTNRFRSLTQGRGSFHMNYSGMDKVNKDRLSSI
                     LNE"
     gene            <254327..>255250
                     /locus_tag="HG536_0F01300"
                     /db_xref="GeneID:59327020"
     mRNA            <254327..>255250
                     /locus_tag="HG536_0F01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284583.1"
                     /db_xref="GeneID:59327020"
     CDS             254327..255250
                     /locus_tag="HG536_0F01300"
                     /inference="similar to AA sequence:RefSeq:NP_012951.1"
                     /note="ancestral locus Anc_1.263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140479.1"
                     /db_xref="GeneID:59327020"
                     /translation="MSQFSITETYLKFLEEDPEMTMPIAAIESLVTLLRVKNPETAAE
                     MINTIKSAANELTQSIPNSISLKAGCDIFMRFVLRNTHLYGDWENCKEHLIENGQLFV
                     SRAKLTRDKVAQIGLDFISDDDTILVHGFSRAVFTLLKHAAEKFIRFRCVVTECRPTS
                     QGKQLYSLLQEKGIPVIMVVDGAVGAVIDQVDKVFVGAEGVAESGGIINVVGTYSVGV
                     LARNARKPFYVVTECHKFVRMFPLSPDDPSMQGKSLDFTRKNDDDEPQEMLRGPRLDY
                     TAQEYITALITDLGVLTPSAVSEELIKMWYD"
     gene            complement(<255299..>256072)
                     /locus_tag="HG536_0F01310"
                     /db_xref="GeneID:59327021"
     mRNA            complement(<255299..>256072)
                     /locus_tag="HG536_0F01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284584.1"
                     /db_xref="GeneID:59327021"
     CDS             complement(255299..256072)
                     /locus_tag="HG536_0F01310"
                     /inference="similar to AA sequence:RefSeq:NP_012950.3"
                     /note="ancestral locus Anc_1.262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140480.1"
                     /db_xref="GeneID:59327021"
                     /translation="MSSENQLFVTDEEDKLAEEHIAEEPPAVPQETHDDEAVEEGDDP
                     VIQEFALNIAGRDELLHVLQYANKAKKIGNRTADHPFIGACRYKPNSSVWELDIPVDD
                     GAFFNKQRAEDNWGKADVQTLRGVGVENSGQYAGFVSNGEVYLVPVEKVAQLRPFFKY
                     IDKASSDRKQEDAKRNVNPASQKSQVVTMSVKSVNDPTQHRLAGALLAHKVAEEEEPT
                     ELAWAENTFEHFKESVVAEANSHVLKPLGDEKNYEENLV"
     gene            <256292..>258451
                     /locus_tag="HG536_0F01320"
                     /db_xref="GeneID:59327022"
     mRNA            <256292..>258451
                     /locus_tag="HG536_0F01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284585.1"
                     /db_xref="GeneID:59327022"
     CDS             256292..258451
                     /locus_tag="HG536_0F01320"
                     /inference="similar to AA sequence:RefSeq:NP_012949.1"
                     /note="ancestral locus Anc_1.261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140481.1"
                     /db_xref="GeneID:59327022"
                     /translation="MSDDDGMLLNFDTNADFGEKTVAKVTGGRWKDRRRLKMMVTGQQ
                     PNKKRKIEKARENDRERQEIVPREASVGKNVEVEAKNARTAPLVAGPQVVSSLFTSNR
                     EISTSSNDNARDESAVHKPSNAPLFKDTFESVGVQELLVNHLKEKMRIQKPTSIQKLV
                     FSYLLLADEGRDKDLFINAQTGSGKTLAYFLPILSRILQMNVRVDRKSGCFALIVAPT
                     RELASQIYSVISMLTNCCHYLVPCLLIGGERKKSEKARLRKGCNFIIGTPGRILDHLQ
                     NTQVIREQLSHTLRYIVLDEGDKLMELGFEETIRDILNILHQVPVSTERYPQLPSRIV
                     HVLCSATMQNGAAKLGDVALNDYKLLSTRKKKHDDAINEAPDQLLQRVVVVPPKLRLV
                     TLAGGLDEIHRKHKQTKSSQTSRTMVFLSCSDSVEFHYETFSSNDAYHRNLVGESVRL
                     MDKGNSILPSFLSDTDPDVVFYKLHGSLSQPIRTSTLESFSKDSASTKGKHLIMFCTD
                     VASRGLDLPHVGTVLEVDPPFSTEDHLHRIGRTARAGQSGEALLFLLPGEEEGYLGKI
                     KPYHPKGWKLLKYDEDLLKPAFQETSVRRSDRNDKPDGTIHDWDTNATTWHLNVERRV
                     LEDSTFKSLAIKAFTSHVRAYATHISDEKAFFNIKLLHLGHLAKSFGLRERPKGIGAQ
                     NSSEKDSSKKTPKENTKNKMFRLARMAVKESASEFNY"
     gene            <259263..>260933
                     /locus_tag="HG536_0F01330"
                     /db_xref="GeneID:59327023"
     mRNA            <259263..>260933
                     /locus_tag="HG536_0F01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284586.1"
                     /db_xref="GeneID:59327023"
     CDS             259263..260933
                     /locus_tag="HG536_0F01330"
                     /inference="similar to AA sequence:RefSeq:NP_012432.1"
                     /note="ancestral locus Anc_1.260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140482.1"
                     /db_xref="GeneID:59327023"
                     /translation="MGDSLESFPRGLKGFKRSKTDHDILEGVLRDTITPSFVRKMTKK
                     LPLELKQTRKPIQTACGFCHEKHLQCDVGRPCQNCLKRNIGYLCRDKIRKPRKRSCTS
                     ASNNELVKAVKVDAGSVQKTGESALGSDEPLDDAASDMMDMKTEENEDDSAKTSDEAL
                     PRMHSFSTLLNNHFNTFLHDPVIPNMLGSHPETKGPHHESNKIEDAIDFGSMWATNEY
                     MKLNDIAGIMPSDDKRPEDMVDKEPTDDIPPINRSSSSQLFQYLNVGPTVPRSDSRPF
                     ISLEMDKMGSMNRIDVAKTDQLYNADSSNPSPQNLRETELTPYKIRQLIKTPKDLFEK
                     QHLIKPHNYRTAYKDLLRCLHRMFLGSYASDSLESFQGDTEQNQKMQLRRKQLRHIAR
                     SIVDRYAPIFVTLTSNMIEDDLLMQELILQRTLLEFENMAKLVTCTPICIWRRSGEIC
                     FVSNEFLSLTGFSKKEILNERRFIAEFLDHQSVVDYYDLFHEYLAFGSKNGTKSTTAD
                     GQAIFGECNLLVSNGSFLKCAGCWTAKRDSFNISLLVVGQFLPIFDVE"
     gene            complement(<261016..>262560)
                     /locus_tag="HG536_0F01340"
                     /db_xref="GeneID:59327024"
     mRNA            complement(<261016..>262560)
                     /locus_tag="HG536_0F01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284587.1"
                     /db_xref="GeneID:59327024"
     CDS             complement(261016..262560)
                     /locus_tag="HG536_0F01340"
                     /inference="similar to AA sequence:RefSeq:NP_012948.3"
                     /note="ancestral locus Anc_1.259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140483.1"
                     /db_xref="GeneID:59327024"
                     /translation="MTKLQAIEYAVGAVSQILPLEENEVKDLCEQVLQGNSSNSESIA
                     QRFLEILGQSDLAFEFVIRFNEILSQQDEPKIRNERIYQESTEPTERSPLKTATAPKP
                     QVERSGALKEVASLKLSSTPLVEAKSGQNSNTKPKTSKKELIQEIDQVWKFLQLDHDE
                     KNVTKFACNCQGNLHPLFEAAPNCLSCGKIICAREGLHLVRCSFCSTEFIPLEERLKI
                     VQLLKREKEELMSESSTKKSAMQQQQSNRRNRYSKGLKISSGMGTNLFTEQDRLFDLV
                     ERQRERERKREEVLRNEEEEQRKEAEIRRREERERDLDPDLIEAQERLNKLLYFQDTS
                     AERTKIIDNAADFSMSNDSGVWGTAQERALMLKKQQRNLRKWEKLEGERNGKRDKYVV
                     SMDIGPNGKVTMKEVRRGKEKSTAESDDDIDGISDEDDLRDLRDIQKLKGEVESSKQE
                     QNSNLQSKVWDYEKDRKQWEPPKYMPSSSIKKSVATPHDKGADRDRKHRVQMDQDNQS
                     IWELIA"
     gene            complement(<263806..>264204)
                     /locus_tag="HG536_0F01350"
                     /db_xref="GeneID:59327025"
     mRNA            complement(<263806..>264204)
                     /locus_tag="HG536_0F01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284588.1"
                     /db_xref="GeneID:59327025"
     CDS             complement(263806..264204)
                     /locus_tag="HG536_0F01350"
                     /inference="similar to AA sequence:RefSeq:NP_012431.1"
                     /note="ancestral locus Anc_1.257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140484.1"
                     /db_xref="GeneID:59327025"
                     /translation="MAHRAFIQVVITGASVFGKAFAEAYRQAAAQSVKQGANAARARS
                     ASAEYGGITLDESSKILNIESDKDMTPDKINERFKYLFEVNDAEKGGSFYLQSKIYRA
                     AERLKWELAQREKAKEPSENSDETQPPKSQ"
     gene            complement(<264407..>266830)
                     /locus_tag="HG536_0F01360"
                     /db_xref="GeneID:59327026"
     mRNA            complement(<264407..>266830)
                     /locus_tag="HG536_0F01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284589.1"
                     /db_xref="GeneID:59327026"
     CDS             complement(264407..266830)
                     /locus_tag="HG536_0F01360"
                     /inference="similar to AA sequence:RefSeq:NP_012430.1"
                     /note="ancestral locus Anc_1.256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140485.1"
                     /db_xref="GeneID:59327026"
                     /translation="MSVKGFDEQSLIDDASTLLLFSKARSGSGGGGINTDGSGVKSLS
                     SSPKEAPVEGSQSVVRSTPLSRTSTERGTLSPRNPMGSVGPASAALLQDDGFECHRSG
                     SMSPKSSDGSGNSNSKQKGMVAAAALAAAATVPLPLNTERRRKSKHEVERIVETGSKN
                     LRHEWPVPDSFVVDIDSGVISCICGYDDDDGFTIQCDHCHRWQHAICYNIKDIETAPE
                     DHLCNTCEPRRLDPKKARRRQLERRQALGSRNNRDAGTAGGGGSKDDAGAGGLGKDSD
                     NNELHSEAVSNEGKNSETETGYDKISRRGSYASDVQNNVSSTENAGRKRKNDGETGQM
                     DDAKRRKDNISYTSAKEAYSAMFLPIDRYEFKDKYAKLFIEKHNDDDWVIPYNKKVFE
                     PLSVEVKPYAEVNNSKVFPGYSKLGVYLKEFCHQKSFICEFLGEVDFQRGYLMDPRNH
                     YRIWGTTKPKVLFHPHWPLYIDARLCGNLARYMRRSCNPNVELATAKMPDTNEVKFVL
                     RAIRDIQEGEEIHIGWQWDLRHPIWQLINKTATFESLNDPDKYLLIHSIDTVLGACEC
                     ACGNNNKECNLLKVKKFSQSLYRSVKSKMNNRYKLNEILNQYQGKRRRQPPILKRLAN
                     ERLQNSERASELIAEYDEKKAKCLSNATYDGVVVAESLPTGETIKPYKWVLMNKYHGS
                     RNGVFEGSPASSFNKAPTPLTFDEQKVTDLNKLPIPIVLEIPIESPSMKGKLQIDYSN
                     KAAAEVPSKEKPPVPSISATGKTIDPVRTETKSGSASANTLPDLADAYKNPLKKKLSF
                     ADYRKKQHK"
     gene            complement(<267393..>269330)
                     /locus_tag="HG536_0F01370"
                     /db_xref="GeneID:59327027"
     mRNA            complement(<267393..>269330)
                     /locus_tag="HG536_0F01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284590.1"
                     /db_xref="GeneID:59327027"
     CDS             complement(267393..269330)
                     /locus_tag="HG536_0F01370"
                     /inference="similar to AA sequence:RefSeq:NP_012429.1"
                     /note="ancestral locus Anc_1.255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140486.1"
                     /db_xref="GeneID:59327027"
                     /translation="MLSKKVNRDSLPITPPDIDNPPSYIPLKSIDGRYQIIEELGNGS
                     FGSVSLARAHFDIGKNHNDGKMYRKTLLNQAGMDHENAICKRQGLVAIKTMMTKLSTL
                     HDYTRVREIKFILSLPANRHLIQIFEIFIDNKNFQLHIVMEAMEQNLYQMMRHRRRRV
                     FSIPSLKSILAQILAGLHHIHEFNFFHRDIKPENILISPSTRYFDKDWLLEGNYTDNY
                     VVKLADFGLARHVTNKNPYTAYVSTRWYRSPEILLRNGYYSRPLDIWAFGCVAVEITI
                     FKPLFPGSNEMDQIWKILEVLGTPHTTKESEKTGYISNGGQWELAKTLAQRLNMKFPY
                     VEGSGLQDLISSSQLQSLADVIKRCLRWDPNERATATDLCSMPFFRDTVAAVPKVVSS
                     TRNTEQAQIFAGIKPSQSNHKRQLIFHSKELEESHLTRPLKINDGETKLKKSFSMSEF
                     LQNHSDDIPLNDPPPAIDTDSTISDNQDEIEFCQISSTFENDHFLKDLPSLRINDGSI
                     NESKDNLKRLTDDIDAMNKQNETDFLFDTPQVSNSKNYVHYTNQNPELNLLSNNVLIN
                     SDHSSLQPVNRLLDNMSIDDSFNNNDINGNCNDNNNNNLNVIPRSFMLQQDTPNGNHI
                     ISGNHIELASETSQHFGNITF"
     gene            <270088..>272661
                     /locus_tag="HG536_0F01380"
                     /db_xref="GeneID:59327028"
     mRNA            <270088..>272661
                     /locus_tag="HG536_0F01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284591.1"
                     /db_xref="GeneID:59327028"
     CDS             270088..272661
                     /locus_tag="HG536_0F01380"
                     /inference="similar to AA sequence:RefSeq:NP_012427.1"
                     /note="ancestral locus Anc_1.254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140487.1"
                     /db_xref="GeneID:59327028"
                     /translation="MSDSEMSSTKRPSFLAKIGRGRSGNSDSRIEQKRSESFDSDSGS
                     DLEPGTTRSEGLPSFRQTGEVRGSKSDQLIELDAVRTIRNTSGNYEAADENEDSEDMD
                     RRYSEKLARFGGRRASATSSSDSSTDYKNVRFKSHADEYEDDEIKSVKSSDDEGRFDH
                     FKQFFQRGASQRRGMKSLNEENGDEDDAGGLVSRFISNLGQNGGLAPGFPKDSQEKER
                     DVEKTGGQEDIPMVDFNETAQQIVQAHSGLNPNDGHAEAAISDGETAYDSGSQTPSHI
                     SFVAPPMEHYIDGDQSNEAIDSDSYDPYIESTAYVAPPTRVRGGVLGSLLKLYQNEDI
                     NSNYSSVSLEESVPDTVTATSSVTPPSSKLKLSKAANLKKLKNLPHRKGTAEPSDSSK
                     NDLPSFKNTRPKGKKSRIPKFKKKLATEAKITVHIADLLQRHRFILRMCKALMLYGAP
                     THRLEEYMIMTSRVLEIDGQFLYLPGCMIVSFGDATTRTSEVQLVRCAQGLNLWKLHQ
                     VHMIYKQVVHDTMSAAEGNMLIDRILQEKNLYPPWICVFLYGFCSAMVTPYAFGGNWI
                     NMAVSFFMGSCVGALQYIVSQRSNMYSNVFEVTASVVVSFCGRAFGSIPSDICFGAVT
                     QGSLALILPGYIILCGSLELQSRNLVAGSVRMFYAIIYSLFLGFGITLGAALFGWMYK
                     GASNETSCPYPISDWFRFLFVPAFTIGISLINQANWTQLPVMVIISCSGYVVTYWAGR
                     HFQHSTEFTAALAAFVIGLMGNLYSRIWKGLAVSAMLPAIFVQVPSGVASQSSLLSGL
                     QSANQLTNHNGTAAESDLSSSMSFGVTMIQVSIGITVGLFMSSLFIYPFGKKKTGLFS
                     L"
     gene            <272922..>278225
                     /locus_tag="HG536_0F01390"
                     /db_xref="GeneID:59327029"
     mRNA            <272922..>278225
                     /locus_tag="HG536_0F01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284592.1"
                     /db_xref="GeneID:59327029"
     CDS             272922..278225
                     /locus_tag="HG536_0F01390"
                     /inference="similar to AA sequence:RefSeq:NP_012426.1"
                     /note="ancestral locus Anc_1.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140488.1"
                     /db_xref="GeneID:59327029"
                     /translation="MSSLKSQLAVVAASNATLAVDRKRRQKLHSASLIYNPKTASTQD
                     YDTIFENAVEALNDLIEIDPHFEIFTRSLFSESSMSIDRNVQTKEEIKNLDNAINGFL
                     MLVSSKWHLAPTLHATEWLVRRFQIHICNAETFLLSTINYYQTPTFKRILNIVKLPPL
                     FSPLSSFVRNDRSCSNMAIIKLFNDMEFLKLYASYLSKCIKKKTTYTGQMLFTSCCFI
                     NLIAYNSNDEGKLNGLVPIFLEVSAKLLAASSVDCQIAAHCILVVLAASLPLKKTIIL
                     AATETILANLDNLEVKKSSLATICKLFQTLKGPGNVDQLPAKLYGLLESKIGLEYLLE
                     YLSNSDPSRCDKFVTSYIRAIARYDHAKLSKIIEILKQMKLERFEERLIITDLIHLSE
                     ILEDKSQLILLFEYFVSINEDLVLRCINALNMSGELFEIKLTTSLFRPNEQSSDGDVL
                     KELTTEKGPDGKMRTSTFKEFLEKHSPSINTSNKSMLENGDNNFGELLSLFIESVGKN
                     FPAGLFLSSFFTTLEGRITFLVRVLISPAAPTALRLVALTNVSKCINSIDKESNVFTL
                     IPCLICALSDVSKPVRMGIKKILNQIAKRPFTKHYFMGNRIYGENKEIPLLSPKDSES
                     WLNHFLNEYLVENYDITTLLVPKKNDKIYMLFWANQAVFMPLPYPKMILFKFINKHIN
                     STGSNTAIFADFISSYLSSRKKWKAFCQNNKTNFDQFESSVVGLIAPKERNDFMIDFI
                     NDALKSEDESLISIISERLEAIFESLKFNQQLKIVQNILETAANGDPAYDAAGVLQSL
                     PLDTNVFVSILTQNRIHSDSELSELPKKRRRRSSANRVALQKEEISHIAEAHLRKLTV
                     VLETLDKSKADGSESLLSTLLSLVSDLEMLEKDGGLPVLYAQETLASCLLNTIDSLSR
                     ANAPKSKNVRADVVVSAIRNSTSPQVQNKFLLVVGALAGLDSETVLHSVMPIFTFMGA
                     HSIRQDDEYTNQVVESTIKTIVPALLKNSQDDVQDEIEFLLMSFTTALQHVPKHRRVR
                     LYSTLINSLNPSKAFAPFLFLISQQHSMDVNNFRVGDARTLVEFTRSLMCNLDVLEQL
                     NGLREFLDLLKLLKVASEDPEKKECLQSRALFTNGILNFTATEFSSFLQNALAFIDKT
                     MAESEDGSHSINGSIKIMVCSALLDTQNDPSYVKRVKSSFGSILEAILDFIKGMNNYS
                     PGGNEDMVSKAELKDARKEASTVLYHLLSHILTIMPISDFVDAVSPLLSECKDENVKY
                     HLMLVIGTKFASEGPEASSKAEEVVKMLLEIATTQKDSFDIVQVSLNTVGSLINAFGP
                     QLENSMVIDALKASIDSLASPSTEVIISSLTVITNCVQILGVKSIAFYPRIVPPSLKI
                     FKDSQSDSDDYLKEQLQLAILLLYAAFIKKLPNFIMSNFEDILKVIYYSSEVNVSTRL
                     SLISLIVENIDLKEILKVLHRVWEKSVSNCEEPIAISLFLSSLQSTVEAIDKKSATSQ
                     SPIFFRLLLALFEFRSISDFDDNTISRIESTVYQVANTYVLKLNDKVFRPLFVILVRW
                     AFDREGVSNTKMTEIERLTSFFKFLNKLQENLKGIITSYFTYLIEPVSDLLRKFIDGR
                     ISDINLRRVVLNSLTSSFKYDRDEYWKSTSRFEAICEPLVNQLSNVESVIGKYLVKAI
                     ASLAANNNRVNDHNKLMHKLLVNHMQSSCSSNEKLWTVRSLKLIYSKVGESWLALLPQ
                     LVPTIAELLEDEDEEVEHAVRSELVRVVENVLGEPFDRYLD"
     gene            <278449..>279186
                     /locus_tag="HG536_0F01400"
                     /db_xref="GeneID:59327030"
     mRNA            <278449..>279186
                     /locus_tag="HG536_0F01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284593.1"
                     /db_xref="GeneID:59327030"
     CDS             278449..279186
                     /locus_tag="HG536_0F01400"
                     /inference="similar to AA sequence:RefSeq:NP_012955.1"
                     /note="ancestral locus Anc_1.252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140489.1"
                     /db_xref="GeneID:59327030"
                     /translation="MATLPTVNRDLHQNVRDGLSVPTVLRRLYKTPKNLDFETATWEM
                     INLVFKPRKAFRSFYYQHQTKRQWARDDPSFFILQVGLLILSSMVWSIVYGHSFLGFI
                     KMMLNMVCVDFFLFGFVTATSFWLILNRPRFKFRSAAESQVEWAYCFDVHCNAFLIIW
                     VLLYFLQFLLLPLIKLHRWIGLFVGNTLYCLAFAQYFILTFYGYSQLPFLKKINFILF
                     PALAFAVLYMVSLLGIDLSTKLSFHKY"
     gene            complement(<279281..>280669)
                     /locus_tag="HG536_0F01410"
                     /db_xref="GeneID:59327031"
     mRNA            complement(<279281..>280669)
                     /locus_tag="HG536_0F01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284594.1"
                     /db_xref="GeneID:59327031"
     CDS             complement(279281..280669)
                     /locus_tag="HG536_0F01410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140490.1"
                     /db_xref="GeneID:59327031"
                     /translation="MSINSPLHSKFSATTKYENNESLRSTLPHSLAPHEVSQRRNNGV
                     NSLYRMAIKNRCSAGVISIETFCEDYSSLLGPAQKPVTPPKADRVPALNVTVYHQPQP
                     RNKITPIRHYEHNMNHSLAATEFNAPQAHITQLSRPPLRGRRSDYAGTIAIERGDVAP
                     NNCHSSGRKKITRDETPSRSLSKVEYEDTGIDIHELLYDEILSAVNDDIFDVDFTFDN
                     TWADNVSHATCANSYSLQTSFQPSRNHSTPCICSQVTSCPASIGQQEQEDDLATRVST
                     SKRRISGSKTRNSRFQLKLDNLRLRHESSQEPCGISNCEEEHKEVPRMRYWFRTANLR
                     TKLIFECVNRELKHITRRSLYAINSGEKTLLSILKRISAEHPQHKTRIATSLEEKLTV
                     QPAFGHIKRPQSDVQLSDFLQKTLNQANNDANFREQLAVTLLDQELQSCIIRGRDSSR
                     NLWMQSEKFEFD"
     gene            complement(<281047..>285645)
                     /locus_tag="HG536_0F01420"
                     /db_xref="GeneID:59327032"
     mRNA            complement(<281047..>285645)
                     /locus_tag="HG536_0F01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284595.1"
                     /db_xref="GeneID:59327032"
     CDS             complement(281047..285645)
                     /locus_tag="HG536_0F01420"
                     /inference="similar to AA sequence:RefSeq:NP_012956.3"
                     /note="ancestral locus Anc_1.251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140491.1"
                     /db_xref="GeneID:59327032"
                     /translation="MVAGGQANGAVVPGISDADELGRDTEDREAVEEQKTEFDDEAGY
                     KNLMFHEVPNSAVGERETEQEQGGRRKSFMQDPQLDIWRKEFKQAFRKVAVLSRLKGM
                     RGGRQRRRESVALQHAGGDERDKYTQRLASDLIDSLMAGCPAALFPSTQFLRDEHGQR
                     RAPLLLAMLGVRVEPLYFNGDPDGANKGADNAVGHDEEDDYSSVFSGIFSKGEDDTKK
                     FFKVHLEYGIGENRLKWCVIKSYKDLSTLHGKLKLVSFQQNTINKLYIDRNGYHRFRL
                     PHFPRKDDHEKSMFQNRKSGLKRVSTSATASSVNSSLNLAMDRICVKHLQDLIDEPED
                     LNQPMHLRVERYLRLLNIALCLRPQANRLFQFYELSPIGNLLSYEENHQSKQGYLIIR
                     STAKAQGWRVSHFRVNDLRDMIERHTTKWFLVRHSYILYVSDLHSTTPLDVFLMDSKF
                     RIKFSGSRKDKESSNTTEPDWNGKSYSKITTKLLITLYNGERKMQIICRSESSLKQWV
                     SSITHVANQTIWTKPHRFDSFAPVRKNAFCKFLVDGRDYFWALSEALNMAQDVIYIHD
                     WWLSPELYMRRPVNGNQEFRIDRILKERAEKGVKIFIVVYRNVGNIVGTDSLWTKHSM
                     LSLHHNIHLIRSPNQWLQNTYFWAHHEKMTVIDNTIAFMGGIDLCYGRYDTPEHVLRD
                     DHENLNDQNFPGKDYSNARICDFHDLDKPFESMYDRKKIPRMPWHDVHMMTVGEAARD
                     MARHFVQRWNYLLRQKRPSRPTPLLTPPCDFTRTQLKNSPFFRMLKPRSTCEVQVLRS
                     AGSWSLGLKETEKSIQNAYLKLIETSEHFIYIENQFFVTTSHWDSVIIENKIGDAIVD
                     RIIRANSEGRTWKAFIMIPLMPGFDSPIDQPEASSVRVIMQCQYQSISRGETSIFSRL
                     KKVNIDPLQYIQFFSLRKWSTIGKNDKLVTEQLYVHAKVLIVDDRSCIIGSANINERS
                     QLGNRDSEVAMIIRDTDLVKSKMNDKDYYAGRFAFELRKRLMREHLGCNVDLVEIVER
                     LFGHLEELAKMNYKTLHTAADQSKKNEKLNSAMIELAYREVFDVEHSEAWEIRYANDP
                     QSGDNGIVNFTSNDDTTAGGPLNSVSQELNGKSKLPDREASSTTIKNYHSFNYRAGEE
                     NIGIRDNKPISTDPRLTNNEKHRDDVAGLGVDGWKKVTKKFKENVTEQLRDWAVAALG
                     SDSAKHKKEARLSFLPDRNDIEEYLRDDLITYEQKWDMLKRITYLQHLAYKNMENAKV
                     NSSTGSAGTDFKYSNESKANHKAHDEILEEQELDDDCIDELLVQMAPNFQTRETFSQK
                     LLNLRFIDPYSFDDPICGSFYEDMWFSIALRNSLLFRLVFHCQPDNAVQSWRDYKEYN
                     RMAQEFSDNQDALIELEKFTRPTASSGNTFSTADALGKGDLPVRKDATGSVERGTTIG
                     EVPQSVIHNDITSMADARANAAQSRRSKATALRMRLSGSLLFGFNQRIFDKYTARRIL
                     ERVHGHLVVFPTEWLAKEVESKNWFYNVDRIPPIDIYD"
     gene            <286305..>287660
                     /locus_tag="HG536_0F01430"
                     /db_xref="GeneID:59327033"
     mRNA            <286305..>287660
                     /locus_tag="HG536_0F01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284596.1"
                     /db_xref="GeneID:59327033"
     CDS             286305..287660
                     /locus_tag="HG536_0F01430"
                     /inference="similar to AA sequence:RefSeq:NP_012425.1"
                     /note="ancestral locus Anc_1.250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140492.1"
                     /db_xref="GeneID:59327033"
                     /translation="MSGTTAAAAASDRADGRAGGSGVQGFYYPFQGAGGKGSLALSSS
                     CSPGCSAGESPTGQEASVSSSSSSSPGVGNGAKQAGDGDGKSKVGHGTQHSHNQPHHS
                     HSPVCKNCLTSTTPLWRRDEKGAVLCNACGLFLKLHGRPRPISLKTDVIKSRNRKGAH
                     HQHNHASEGSGSLAEPQHRRSSSDDRKRKQQPGTGSEAKGKKSKVAEDPETRDVCSAA
                     NTLETLMSGDASKPRIKPKLKQEASHQMPSPSQSATQLPHLSALLENVRSGSKPAPGI
                     LETLSDRSAVSSPSIFAQGHQVANQVPLHVNPLNEPVKPGTSEIVPVVHAPTTQPAAP
                     VSQSCSSTSLVRAGSMSQRYTSPPQSLGTSVPMVQTASALPVSVATPLPLSSVNESAR
                     SVHTGQSPLSILYKNEEEVIRLKTRINELELVTDLYKRHIFDLDEKCRELELEIESLK
                     R"
     gene            <287822..>288430
                     /locus_tag="HG536_0F01440"
                     /db_xref="GeneID:59327034"
     mRNA            <287822..>288430
                     /locus_tag="HG536_0F01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284597.1"
                     /db_xref="GeneID:59327034"
     CDS             287822..288430
                     /locus_tag="HG536_0F01440"
                     /inference="similar to AA sequence:RefSeq:NP_012961.3"
                     /note="ancestral locus Anc_1.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140493.1"
                     /db_xref="GeneID:59327034"
                     /translation="MSRNPSAGLENTLFQLKFTSKQLQKQAQKASKEEKQESNKLKKA
                     LNESEEIARIYASNAIRKKNERLQLLKLASRIDSVASRVQTAVTMRQVSGSMASVCRG
                     MDKALQSMNLQQITMIMDKFEQQFEDLDASVNVYEDMGISSDAVIVDADKVDELMSKV
                     ADENGLELKQSARLDELPDLEQPEINEEKEDKLAQRLRALRG"
     gene            complement(<288506..>290161)
                     /locus_tag="HG536_0F01450"
                     /db_xref="GeneID:59327035"
     mRNA            complement(<288506..>290161)
                     /locus_tag="HG536_0F01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284598.1"
                     /db_xref="GeneID:59327035"
     CDS             complement(288506..290161)
                     /locus_tag="HG536_0F01450"
                     /inference="similar to AA sequence:RefSeq:NP_012424.1"
                     /note="ancestral locus Anc_1.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140494.1"
                     /db_xref="GeneID:59327035"
                     /translation="MNFGNQTPTIVVLKEGTDASQGKGQIISNINACVAVQEALKPTL
                     GPLGSDILIVNSNKKTTISNDGATILKLLDVVHPAARTLVDISRAQDAEVGDGTTSVT
                     ILAGELMKEAKPFLEEGISSHVIMKGYRRAVELATAKIQEICVDISNNDSDSRKLLER
                     CAKTAMTSKLIYKNADFFVKMCVDAVLSLDKDDLDDKLIGMKKIPGGSMEESLFINGV
                     AFKKTFSYAGFEQQPKKFKNPKILSLNVELELKAEKDNAEVRVENVEDYQAIVDAEWQ
                     LIMEKLKQIESTGANIVLSKLPIGDLATQFFADRNIFCAGRVASDDLDRAILAVGGAI
                     QSSTTDIKGEHLGTCEVFEEIQIGSERYNLFQGCPKAKTCTLLLRGGAEQVIAEVERS
                     LHDAIMIVKRALQNKLIVAGGGAVEMEVSRYLRNYSKTIAGKQQLVINAFAKALEVIP
                     RQLCENAGFDAIELLNKLRMAHSKGEKWYGVDFETESVGDNFAKFVWEPALVKINALN
                     SATEAANLILSVDETITNKGSQPANAGMAPPPGAGRGRGLPMQ"
     gene            complement(<290465..>292594)
                     /locus_tag="HG536_0F01460"
                     /db_xref="GeneID:59327036"
     mRNA            complement(<290465..>292594)
                     /locus_tag="HG536_0F01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284599.1"
                     /db_xref="GeneID:59327036"
     CDS             complement(290465..292594)
                     /locus_tag="HG536_0F01460"
                     /inference="similar to AA sequence:RefSeq:NP_012423.1"
                     /note="ancestral locus Anc_1.247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140495.1"
                     /db_xref="GeneID:59327036"
                     /translation="MSSNEQLSQLGRALSTTAAALFGSQNMEDTILSYSSPYKRALHQ
                     AMTNIGSDGAAISLGWKGKNGPGTFQSLYSSQDGKSFFRNKITDSKTSFKVLSYLSDD
                     LLHDIPGDEAETKADPHSRLLLKENGEAKGKKKSTTQDPSLFQGFEASLPIINEALKH
                     QSSSSGSEIKTIRGPELNDTEFNDNNGIGEQFILPDGLKPERITESYSRRYLKAVSSQ
                     VTDSLDLLEIQKKVAASEIREIDGKLERLRKIRESVFKRIARIEQNELFLENNLDLVR
                     DRLSFLEEYGLEMENGTENDDKGEISPEVSEQTDFKDSDMGNARSEEDISDKSIVVEE
                     SSNTSALMSRSIYMKLKTKDESPVKKLRNFYHDNNKKRRKTFPTLQQYYSRGSKINAF
                     KGAHNESITCLDFDVPFGTLCTAGHLDHSIKIWDLSQKKQIGQMSGHKASISCMQMDN
                     RYSMLITGGRDAVLKMWDLNLGAQLYQEQSDVIPSTESACVYTFDSHVDEITALSFDS
                     AYLVSGSQDRTVRQWDLSSGKCLQTIDLSFAGRLSQNNSASSSSMLTPTDISPIIGAL
                     QCFDAALATGTKDGMVRLWDLRSGKVIRTLEGHTDAITALKFDSRNLITGSLDRSVRI
                     WDLRTGTLADAFAYESPVLSLDFDSQSIVVANREATVQVVDRNDDKHWQCGAQDSSDS
                     STAQFVRYKDGYMVEGRSNGDVAAWAL"
     gene            complement(<292814..>293671)
                     /locus_tag="HG536_0F01470"
                     /db_xref="GeneID:59327037"
     mRNA            complement(<292814..>293671)
                     /locus_tag="HG536_0F01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284600.1"
                     /db_xref="GeneID:59327037"
     CDS             complement(292814..293671)
                     /locus_tag="HG536_0F01470"
                     /inference="similar to AA sequence:RefSeq:NP_012963.3"
                     /note="ancestral locus Anc_1.246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140496.1"
                     /db_xref="GeneID:59327037"
                     /translation="MSLSFDLCIEEITRSIDSLSTLYFKPPGIFHNAVVHHDESEGYS
                     SIITKLIRDCNPKEELSLFKMDTQKRVHTRKDGRSGILDFLIERDTHLKRARRLGLPD
                     QKPIIYVPKEFYLKQHDEVLAKKRKTVKGFSFEVDSAADADKYNPNIYGLLFSKFDDP
                     NVISLIRALQNGSVTVDAREESSRRKTMFVEDFPTEAMLQVLFEISNQWPLAEYKQAY
                     SRCLNDYKDISTEIETLKDEIRTQEDQLQALAKNIPSSSHVVTRLIEKEKKDIEALEL
                     QLKEAPEQS"
     gene            complement(<293806..>294966)
                     /locus_tag="HG536_0F01480"
                     /db_xref="GeneID:59327038"
     mRNA            complement(<293806..>294966)
                     /locus_tag="HG536_0F01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284601.1"
                     /db_xref="GeneID:59327038"
     CDS             complement(293806..294966)
                     /locus_tag="HG536_0F01480"
                     /inference="similar to AA sequence:RefSeq:NP_012964.2"
                     /note="ancestral locus Anc_1.245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140497.1"
                     /db_xref="GeneID:59327038"
                     /translation="MVNLNTVQPRNGRNCYIALGLEGSANKLGVGILKHPVLPQHEQG
                     DFSYDCKAEILANIRDTYITPPGEGFLPRDTARHHKNWCVRLIKRALQEAGITNPTLD
                     LDVICFTKGPGMGAPLHSVVIAARTCSLLWDVPLVGVNHCVGHIEMGREITKAVNPVV
                     LYVSGGNTQVIAYSEQRYRIFGETLDIAIGNCLDRFARTMKIPNDPSPGYNIEQLAKN
                     CKRKDQLVELPYTVKGMDLSMSGILVYIDSLAKDLFKGNKKNKILFDSKTGEQKVTVE
                     DLCYSLQESLFAMLVEITERAMAHVNSNQVLVVGGVGCNVRLQEMMRQMCEDRANGQV
                     HATDERFCIDNGVMIAQAGLLQFRMGDVLTDLKQTIVTQKFRTDEVYVDWRE"
     gene            complement(295090..295161)
                     /locus_tag="HG536_0Ftrna8D"
                     /db_xref="GeneID:59327390"
     tRNA            complement(295090..295161)
                     /locus_tag="HG536_0Ftrna8D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:59327390"
     gene            296632..296704
                     /locus_tag="HG536_0Ftrna8R"
                     /db_xref="GeneID:59327392"
     tRNA            296632..296704
                     /locus_tag="HG536_0Ftrna8R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGU"
                     /db_xref="GeneID:59327392"
     gene            complement(<296862..>298856)
                     /locus_tag="HG536_0F01490"
                     /db_xref="GeneID:59327039"
     mRNA            complement(<296862..>298856)
                     /locus_tag="HG536_0F01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284602.1"
                     /db_xref="GeneID:59327039"
     CDS             complement(296862..298856)
                     /locus_tag="HG536_0F01490"
                     /inference="similar to AA sequence:RefSeq:NP_012434.1"
                     /note="ancestral locus Anc_1.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140498.1"
                     /db_xref="GeneID:59327039"
                     /translation="MGLLSLGTPLEYLESRKHNEDVRDDGIEQLLYVFKAASRRDGDP
                     LYWGDEVEYMMIEFDDFGKNATLDVRHDEVLTALNTDDYALCVAHNVHFHPEYGRFML
                     EATPNAPFKGYPGKYVEFNMRQRRVVAGMAYDRLAKGESGRFGILTLATFPRMGCPDS
                     INVASPWDHKNMASCSLFLPDEVINRHIRFPTLTKNIRTRRGEKVCIHVPMYKDEKTP
                     DADDTVYRRDWFPREDAESELAARPGYIYMDSMGFGMGCSCLQTTFQAPNLDKARYLY
                     DSLANFAPVLMAASAASPIFKGWLADQDVRWSVISDAVDDRTPRERGVEPLLPKCNKG
                     GFGAIAPELHDKVQRIPKSRYSTVDLFLGGNKFFKRSYNDTDVPVNEKVLSRLQENHI
                     APLDYDLARHFAHLYIRDPLVIFQESIQQDNQNSTNHFENIQSTNWQTLRLKPPTQES
                     VPENKDKLGWRVEFRPLEIQLTDFENAAYSLFTFLLADFFLTFTEEINAYMPMSQIWV
                     NMDRAHKRDSLINTKFFWKDSFESDGSKTSELTIDDIFHSESNGIFPRFINPILIHRG
                     FIHKSWEELKMSADHLRLYYYLKLISDRASGKLPSTAKFLRDFVLNHPSYERDSRVNK
                     TVNYDMLQMCSHISNLDDSRGELAQFLGNEIAMYLVNSRL"
     gene            <299760..>302021
                     /locus_tag="HG536_0F01500"
                     /db_xref="GeneID:59327040"
     mRNA            <299760..>302021
                     /locus_tag="HG536_0F01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284603.1"
                     /db_xref="GeneID:59327040"
     CDS             299760..302021
                     /locus_tag="HG536_0F01500"
                     /inference="similar to AA sequence:RefSeq:NP_012436.1"
                     /note="ancestral locus Anc_1.267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140499.1"
                     /db_xref="GeneID:59327040"
                     /translation="MNFLWKSKSDSSKSPVAKNSKQNGASGFFPENEIVSFEQPKKSS
                     GTPYSLKEFPRIVEHQFGESLGNRTRLLRELANTETLELGPPDMVHVTLFDNFYKEEI
                     GEYFYITGVDMSSESMPLAFLKMLKFDRSERQQTNESQVSTYCCVNIFRQLDIRIRYE
                     SEKSYQVSAVDCRTGTGIVQVNDEIWEETFVSCCLRSVITNVDPVRKLPGLVEYPLAV
                     SHGGASSCLRLIRTLCKFLPRFLECGWDSSRSVHPTVLHNYLTETLLTFLSVAPGLAD
                     QTIEILEALEETDPENKLYYSTVIIAVMEQDGERDLDMISRMNGLIEPLLSQLDAAAP
                     RDSDALLVVNCLSEILNLQAKFLIKRGDLGLATSVAKTSCELSSDSFESWFYLSRCYI
                     LQGDYERALITINCMPHLPEFNKMKRALCYDPSLVGYYKRPLGNSVPRCDLNSVEMNN
                     LSATLKISKDEKLREIIFGRIAMPNESERGRISEIWDQACLNFGPVYGPHSHNLINFA
                     SPTEVKSVADLRLLARSTMAKQLSWFRDRVYELLMEITTKTGWNGLLQLRSKLFVMEK
                     EYDGDGLAKIGAGDKMSTGLKKKRLCERWLDQLFLDLYEDLRISTSSEGRGDVMYNGL
                     EWELLGIILLRTWQWQDAVTCLTTSIMARFDIVSCRKLLELYMRRTDTVTISFDPDTI
                     LELLTQKISYESRFYDNFQILNLQVLYRLSEDLGIEIVRNRVKILPFAERGIIALVES
                     MLDWIKEMGCDSR"
     gene            <302566..>305850
                     /locus_tag="HG536_0F01510"
                     /db_xref="GeneID:59327041"
     mRNA            <302566..>305850
                     /locus_tag="HG536_0F01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284604.1"
                     /db_xref="GeneID:59327041"
     CDS             302566..305850
                     /locus_tag="HG536_0F01510"
                     /inference="similar to AA sequence:RefSeq:NP_012437.1"
                     /note="ancestral locus Anc_1.268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140500.1"
                     /db_xref="GeneID:59327041"
                     /translation="MSGSFWKFGQDYSTESAISKLLNKAFIKISEENRSENEEMARGL
                     SYERRGEAADANDEDLRESRGKEGLSQTEGCEHNEEEGQVLDDEEEEEDGEGHNSILG
                     RSDDNIEDNEFSQNSLPTNEAAYAIYAPNLDVLDELLDDEELYTELMCSNFKLLIYLK
                     YPEVLGKLIDYVINQNIAEENREGPVLPEEISGDPVILQELEQPKQKKADEEHEEEAR
                     KEIDSASEVSEETSLTLPPESEEQIESRRACMAAEILSADVWPISSAIMENADLLSKL
                     WSIMDHSPLTIVASTYFMKINERLLDMDITSMMDFILKQQNIVERFLAHVANPPLMDF
                     LLKVISTDKPDTPTGIIDTLKKQDLIPKLLDHLNPEYSTAVQSAAGDFLKAFVTISAN
                     SNNELASGIGPNELTRQLVSEEMMEKLIKIMLKGGTSLSNGVGIIIELIRKNNSDYDF
                     VQVMYTTLETHPPSDRDPIYLGHLVKLFARYMPLFKDILVQTTLPPLETPFGSIEPLG
                     FERFKICELVAELLHCSNMTLINEPNGESTVRERDIARIKVLQSEKVNDSTYNMEAHN
                     DEESETKELDEQIVAKLNSLRLESDEGEVINSETATEESDDTAQGESNDVEVHSEESS
                     DSEVTEKSLRENPIVGDQLKIALHDTEIISTILGMFFRFAWNNFLHNVVFDIVQQIFN
                     GPLKTGYNRFLLADLLVQANITKLIMDGDKKCADYEKETGLRLGYMGHLTLIAEEVAK
                     FSAYVEEMKVVFSDPAISESLNEPSWKEYTETVLAETREKYNTVLGDFADDEEEEENP
                     DDSINEHDADEEAVIQENYNDQQGGLNGLKSYRSFLESAHEGDDAERNDLEGSRYYEY
                     INGDGTKSRLHLDPSVDYDVPEEGAEELLPNEDCPADDDNQFSNYMSHQLGRNFTGST
                     HYDDDGFADDQEEEEEEEEEEEAEGEEEPWAAASSAFSLNGKSRRSLPSKAETYGKNV
                     FEHQFELEGEDDYMDPNDDGQSYAKPNHPLYSNLITPTTSHRPGEALYSKDEAEDDIS
                     DDSDAELEEMGSHGDLKGTSSEGDSEHGYSLCRSTSKDNLPWDECERDRLMEVVNYNR
                     QQNAGQ"
     gene            <305971..>306666
                     /locus_tag="HG536_0F01520"
                     /db_xref="GeneID:59327042"
     mRNA            <305971..>306666
                     /locus_tag="HG536_0F01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284605.1"
                     /db_xref="GeneID:59327042"
     CDS             305971..306666
                     /locus_tag="HG536_0F01520"
                     /inference="similar to AA sequence:RefSeq:NP_012438.1"
                     /note="ancestral locus Anc_1.269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140501.1"
                     /db_xref="GeneID:59327042"
                     /translation="MGNIKMPLKSGKTAMPRKVSSPFRFLPLYNFLSALSWGFILYNV
                     VSIFPKVGQPQFYSDTKQFVTYIQCGAVIEILNSALGIVRSPLLTTCAQVASRLLVVL
                     GIFQCVPDTEAAKTILYVTLLTAWSITEVVRYLFYFCTLCFKNGPPVPLTFLRYNLFL
                     VLYPLGVASELLIIHSALPLAESTYGAPYKWALIAGMLAYVPGFPVLFGHMLAQRKKV
                     MKSLSNAGYDKTK"
     gene            <306955..>307461
                     /locus_tag="HG536_0F01530"
                     /db_xref="GeneID:59327043"
     mRNA            <306955..>307461
                     /locus_tag="HG536_0F01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284606.1"
                     /db_xref="GeneID:59327043"
     CDS             306955..307461
                     /locus_tag="HG536_0F01530"
                     /inference="similar to AA sequence:RefSeq:NP_012439.2"
                     /note="ancestral locus Anc_1.270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140502.1"
                     /db_xref="GeneID:59327043"
                     /translation="MLQMFRRTATPMLSTASKLLAPRSLIQMSAIRAFHNTATAREKS
                     VETSKQLDVGPLKLSNELYAIFRVHNRPYLVTKGDKVILPFKLKQADVGDTLNLTDVI
                     TLGSRNYKLVDYPIDHSLYTLKATVLEKTKRAFEVREVTKRRNRKVRHAKSKGDLTVI
                     RISELKVN"
     gene            <307631..>311956
                     /locus_tag="HG536_0F01540"
                     /db_xref="GeneID:59327044"
     mRNA            <307631..>311956
                     /locus_tag="HG536_0F01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284607.1"
                     /db_xref="GeneID:59327044"
     CDS             307631..311956
                     /locus_tag="HG536_0F01540"
                     /inference="similar to AA sequence:RefSeq:NP_012440.1"
                     /note="ancestral locus Anc_1.271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140503.1"
                     /db_xref="GeneID:59327044"
                     /translation="MPFLKKITGSSHSHSRSGSASSIKTWSVESPSSSDKYGSRPSKG
                     PKKPTTFDYRSSVASSGSYGSASGYTQRLPAAQNAEVGSYGSELTGSSQLCGKHVTDS
                     TDGGSDSRKSSGGSVNSLSVNRLILSWDTTDPDEWTVQRVLSWLKFHEFPESWINFFR
                     KQQLSGHNFIKLLAYENFAVYEKYLPQSSNASYSSFQQLLKQTMSKNVTDNHIRQRSL
                     GKSKDSTSSNESLRARPKKVHTQEELLSSRSTSESALLSTKSQSLSEDEKTMSSVPLR
                     SHQKTTSTSALYRRSLISLRGSTSGNLLEGKTPSSIKLSIPSRPHSIVDTSEPSAKSG
                     SPPSSPYYSGIFRRHQKSSSSESSLLNTLFGSASNSNLSDDFEKLNNLKSDVTIDNLS
                     KSKPNLNEPNSSISSKQSSGIAEEKSSLWGKLRRRSQLVGLNNFPQTPQMQVTQPKAT
                     SLGNTEVEWAATSSDASVGTLTPGNADLIAQGASLGTPRNNHTRKLDEGNNYSPNSFL
                     LDKKFYPWRNKSAQNDNYILITKDNKSFIPMNIDMIQTLEQLKESIILMLGINHSEIT
                     LHLTDFGCEIGSALPDDILERLRSSLFLNTAGKLFIKDQAKGRSRVRPATLDRELNQS
                     LRQSQSRASFRSVSNNMLGSNDEVSIVSSSSDITSFDDLASGPVRRYPQTPNHYCETV
                     PNNSGEEPNYWNCKDTFPEIAKSPRPLRSSSTIQKDRSIGPDLPMEKARVGTFEILRK
                     DDGNEIDFNKRRESPYIQPKLAPRREAPKPPTNSSPQRSTSPSNQLQIPRVRRSSTNR
                     QATNNTKLSVKTNLITSNDAVSPSADSVVNSYTPGSSHVLVPQPYRGANEGSRKSKSD
                     QDQILNPVSTFISKQRSNRSNSNASNTSSIFTIRSQPLKKGNSKRIISSASAADVFEE
                     NDITFIDAPELSDTEDDNSVSSDEIIWSNHGTNKPEDKNIQKLQKTSGIETSDAESMI
                     PSLAGGEADEKNGVDRKMTLRPSPEVVYQNLEKFFPHANLDKPVLEGVTPPVSPKSMD
                     NKAMCKAYESEESRMEDAAVTSSPTRRSPQAPCAEDRGNRKDRLPKRAKTIRTIAHEA
                     SEARKQSMKVRRQNTKLWGTRTVEVTDKRMVSINKTKNSQGQYKEFAWIKGEMIGKGS
                     FGAVYLCLNVTTGEMMAVKQVEVPRYGSQNEAMLHTVEALRAEVSTLKNLDHLNIVQY
                     LGFEVKDNINSLFLEYVAGGSVGSLIRMYGRFDEPMIKHLTTQVLSGLSYLHSRGILH
                     RDMKADNLLLDQEGICKISDFGISRKSQDIYSNSEMTMRGTVFWMAPEMVDTAQGYSA
                     KVDIWSVGCVVLEMLAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQFGRDFL
                     DACFEVDPEARPTADQLLRHPFLHLDQPFDFKSTKLAKLIRSNDRVNSTKLRAGSQDK
                     CQLQV"
     gene            complement(<312027..>314645)
                     /locus_tag="HG536_0F01550"
                     /db_xref="GeneID:59327045"
     mRNA            complement(<312027..>314645)
                     /locus_tag="HG536_0F01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284608.1"
                     /db_xref="GeneID:59327045"
     CDS             complement(312027..314645)
                     /locus_tag="HG536_0F01550"
                     /inference="similar to AA sequence:RefSeq:NP_012441.1"
                     /note="ancestral locus Anc_1.272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140504.1"
                     /db_xref="GeneID:59327045"
                     /translation="MASSVGGVIAGQNPFVFETRSPVTLWLFQACLIMVVCNLVHIPF
                     SRIRQPKVISEVIAGVILGPTVFGQIPNYTATVFPQASIVGLNLTANIGIILFMFFLG
                     LEVDTGFIKKHLKKAMSIGLASLCVPFGFGCLFAVPLYNTYVPGRGSAGHVKFTVFMV
                     YIAVSLSVTAFPVLCRILNELNLIKERAGIVVLGGGIVNDILGWIMLALSVILSNASS
                     NPVNTVYILLCTFGWFLFIAYPVKYTLRWSLLRTRELERSKPSPVATMCVLFIVFISA
                     YFTDIIGVHPIFGAFMAGLIVPRENNYVVKLAERMEDIPNIVLIPIYFAVAGLNVDLT
                     LLNEGRDWGYVFASIGIAISTKVVSGTIAARLHGLFLRESTAVGILLSCKGIVEIVVL
                     TVGLNAGIITRKIFGMFVLMALVSTFVTTPLTLWVFPESYRNEIRFKKSDEKDTSEAP
                     SSVILAVDEDEAAVPGLHSFEDVKNFHITEVISITNSIETISSSLELINSLVIGKPGT
                     TPSLISVRHKECSRKSSSSSSRPSLSKVKKLTRVWSRNNDDAETALTVIEEDVLGFEL
                     EIPLRAVHLRQLTERTADLLQSSSLHNEDPDFTVNTDSILQIFDIFARLSHIQFSSEV
                     IFSTIREGAANIASMRMKPTDLILLPLRGAFADISGTEIPPREHYAHFSQFYSHILGL
                     NDLSSGFFSTISSSLKANFALLISNRGDRAYIDRSKERGFHLLLPKPNLTSSDFLALH
                     LLLLMCHRNRAGGVLPRGTIYINSMNSAFIDQLHELFNDRGCANDGAVDIQTINCDQK
                     TEADSAALPFIDTVLETGMSEKQLSDLEENTVIVAESSFEGEIPFSEEVKNVILRGAN
                     DKFNVLVVHNNVKDVR"
     gene            <315251..>318667
                     /locus_tag="HG536_0F01560"
                     /db_xref="GeneID:59327046"
     mRNA            <315251..>318667
                     /locus_tag="HG536_0F01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284609.1"
                     /db_xref="GeneID:59327046"
     CDS             315251..318667
                     /locus_tag="HG536_0F01560"
                     /inference="similar to AA sequence:RefSeq:NP_012443.1"
                     /note="ancestral locus Anc_1.274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140505.1"
                     /db_xref="GeneID:59327046"
                     /translation="MESNAVLKEILSSLNRQQRVAVQFDHAKALQVIAGPGTGKTKVL
                     TSRVAYLLLHHRIKPQDIIVTTFTNKAAKEMIERLSKMLQGSGIRVSDIMIGTFHSVC
                     LKILSRFGHKIGLRKDWRIVDESEIDKIMQEMIEKMPDSIRDQANSMARKVNLCLPKK
                     GTDEWAVHPKAVKKQISRLKAFAVIPEEYQKDNHHDQALAYFYEKYQAELSKLNALDF
                     DDLLMYAFRLLTTERCLPYMQHVLVDEFQDTNGIQMDLMFLFAKGNHHLSRGITVVGD
                     PDQSIYAFRHALAQNFEAMANKCPIECSRVILIENYRSSQKILDTSETLIKQQSRGRA
                     DRLPLRAQFDCEFAPVYIDFPAAFLEGPSLIREMLYLKALPNLFTFNDFAILVRQRRQ
                     IKSIETALIEHGIPYKIIRGHAFWELKEVVSMLNLLKCVFFDNERHTMLSVLQYPARG
                     LGAASAGKIKAILDDYQGTAFHGLKKISENTLKIGIPAKAMQVVKDFIAMINYCQTLS
                     KNPNSTTLNDIFEKLYEGSGMRHEYLYNDGKKKSEIQGDEDPNYSNPRHKNVMILKSY
                     FTGNGMSKSFEATTEAKSPQELLKTRSDNTGSQANTVKNHIRDFFLSLSLFSTETSDA
                     GMGKKDEQEKNGFVTISTIHGAKGLEWPVVFIPGCEEGIIPSIFGDEKAQENDEDEDE
                     DQDQESVAGSESSRIEQPVSPRKAQSFTTDSSLDEERRMFFVAQTRAKHLLYHSAATG
                     GGRSEGSPSRFLTTDLLGTMTDHQGLFDSVEVIKKFYVNLGREPPMESRQFQLTRLVQ
                     DYAKFIENRRERFVWNGDFVVNMFKFDITKNVQAGYSTSFTTAAAQLQYSNGPSSDKY
                     SNEGTAEGKTVRTSPKNSSSNRNTAAKSPKRAYAPPLKDKGDIRLISPTKNIAPVSPT
                     GSPAKKRSYAPTYRPSRNAPNALACKRKLFAPTQEKVQLKMEKSLSSRDLEDSFDERA
                     SASEKSFSPANKFGSKSSSNLKEENESKAMMTESLSRKSEIGRRSKRMLYATPIDISG
                     QNTSNKIDQSKETPNSSYFSGEDSLNTTAAELLHNPNDVLVDTRPIIASAKTLADAAR
                     KPTKSRESRDTGSSNKVKLESSSSQCDIFSQLSRAKKKTKLSDGEIIIID"
     gene            complement(<318775..>320229)
                     /locus_tag="HG536_0F01570"
                     /db_xref="GeneID:59327047"
     mRNA            complement(<318775..>320229)
                     /locus_tag="HG536_0F01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284610.1"
                     /db_xref="GeneID:59327047"
     CDS             complement(318775..320229)
                     /locus_tag="HG536_0F01570"
                     /inference="similar to AA sequence:RefSeq:NP_012444.2"
                     /note="ancestral locus Anc_1.275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140506.1"
                     /db_xref="GeneID:59327047"
                     /translation="MSSLKQRKEDFVTGLNGGSIAEINLVTSIALTAYICWNLLSVCS
                     NANIFADFALNWICLLLSITTYSSDIALLQILIIIPCLITVFLSRNNKRHPKNEPRGK
                     DKRLDTLRLTRKPFISAYRGHMLVLTSLAILAVDFQIFPRRFAKVETWGTSLMDLGVG
                     SFVFSNGLVSARVLLKQKSDPSVRPSVLKRVLSALKSGAALLILGLLRLYFVKNLEYQ
                     EHVTEYGVHWNFFMTLALLPPFLVLVDPIADRVPRCIIAMIISVVYEFILTKGEGVLE
                     YLILAPRNGFLNANREGIFSFWGYCSIFLWGQTAGFYLLGDKPTRNNLYKPSVDVLCR
                     PAGDMERRVWDKITTVSPLGGLFFWAFVGIAITQVTMAFDPYYVSRRFANLPYVSWVM
                     AYNTGFLLCYCLIHKLFSGYKREQEVPETLDAVNSNGLFTFLLSNLLTGFTNMSTSTI
                     DASSKKALAVMMVYAIAIAVISTFLYKKKIYIKL"
     gene            complement(<320353..>322200)
                     /locus_tag="HG536_0F01580"
                     /db_xref="GeneID:59327048"
     mRNA            complement(<320353..>322200)
                     /locus_tag="HG536_0F01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284611.1"
                     /db_xref="GeneID:59327048"
     CDS             complement(320353..322200)
                     /locus_tag="HG536_0F01580"
                     /inference="similar to AA sequence:RefSeq:NP_012445.1"
                     /note="ancestral locus Anc_1.276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140507.1"
                     /db_xref="GeneID:59327048"
                     /translation="MKPFRNVTFCPTGFNDEEISKSISRKILKLGGCYSKDLTRQVNV
                     LVIGKTKETNKYRFAVRHRHDIVFIDLRAIDVLYERWLAGDDIIGEQPGVVDPVASAL
                     NTLKTRYSAGPLDNFYIFIGRVDSFSKERLEEICHTLKCHKCNSSHFVKDCKSRNDHK
                     TVVFVTDSLQGARVEAAIEQQIPIVHYKWILDCQRRNAALEFDPYYLLPRIPENLTFD
                     EIGLESCNCWDNLSKPTPEIDHNITGAPASSNLFQKFKVEGDRIWEKAMSKSDSNDVL
                     NQGAARLSPPPEVQENQPRADESIFQGATFNISHRFSEQQTDILRRVIEQNGGVLQAE
                     SQYLVIPSDFPLDLLENDEISNQTLVTEFFIERCLNYKLLIRPPDSWSKPFLRNRNVT
                     LVPSRTLLHDEGQSLQVAITGFHGVELLHLNKILKVMEPMGIKFVEYLNKKTDLLLIN
                     LPALPSIPRDHPLWKNQYRDLFTAQLEHGNDSSNQILRNSLKRKIQFVKQEHSIPVVT
                     PAFLIDLLARTSSSNSSRQTVCLNNISWCIICPRGSKESFGIELVLGKDSSLSKEELK
                     SKSPQKATRSARKRRNSSSTDPAKRKTRIADKRAGDAIDLPAQHALLPT"
     gene            <322686..>325628
                     /locus_tag="HG536_0F01590"
                     /db_xref="GeneID:59327049"
     mRNA            <322686..>325628
                     /locus_tag="HG536_0F01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284612.1"
                     /db_xref="GeneID:59327049"
     CDS             322686..325628
                     /locus_tag="HG536_0F01590"
                     /inference="similar to AA sequence:RefSeq:NP_012446.1"
                     /note="ancestral locus Anc_1.277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140508.1"
                     /db_xref="GeneID:59327049"
                     /translation="MTSYERESDSASVNHKGVTCSENGRIEEGGERSGAVTKRKYGNP
                     EAPPETKMLLVTKNKKIRHSQACDRCRLKKVKCDGLKPQCSQCKKANFRCTTSDRLTR
                     RGFPKGYTEMLEMEVVRLQKALDELGGGSNEDDGVTLEEPKKEPKIPKKPSKTKFAEN
                     EEAEKVIAEPQFPFINDTFHYYDNYVQGQNYLGHRTWDLLQKNFAVSDSVHHSRDINE
                     EEITKNTHMFIMTNLLQLQPNSFWLPRFLTTRYDDNLHRLKQAVVSRVQSFNKYQNSL
                     VPLLYPFEEWQCSFDQLLNHDSRPDPTSILALLFIVQINWVCLDDALLFKVTKMICSS
                     TASSLKSLQTLLLACFYFMGDQSSKEDRVNVFASELLHMAYGIVLDLGLYINSNKLIP
                     VTKKEAIQDHDSRIVTFWTFQFLDSWWSLIQGLPKSNFMVDEFHPRSISSLNIPTLKP
                     LSLLLNFTANSLDGCNLLHTLSTSSGKGKSKLIYLAESFRQLLVQWKLYHQLQDHEDE
                     FNSEELYRPVTLTKPDVIEIQLTLFYLVVSLLSDRKPDSCDFPSEAPSVTSNLEDIAY
                     EILSLYYLLLVDQSGSESESLPPMQFNLQHILPCPNRDLINSCLWILHEWAMAPQGDN
                     ELEGQLNWKYDKYRKFLLQWCHLYFIEDPEDPILAHLSLSFKIRLKEVAPNSKKCKEE
                     YLQKVDQFINKTSSFVGRSNLLRSNSHAVMDQFDMFSQIDLPSNMLHDLNAVPMHGQN
                     LEKGSPPAQLTHNDNNNIIDMSNFRSQILIEHEETDDGYAEDDDEDDEEDDLKPLEIP
                     FSSKRAGSLFHTKHNLPPSHRAPPSAGNSHRRRTVDHIILENSNFGSQTQLPAMKKQN
                     RDSLNEATVQPNLHSPDLIGTYQNYSVKLPARKAMSTNSGGRNLSTRLHENVLPPPPL
                     PHHETLFDPTIRIDSTQGTNTGSTHSSHTPQIVETPRAFVDMLLLQPSEARAVIKSTP
                     PCSTTIER"
     gene            <325766..>326620
                     /locus_tag="HG536_0F01600"
                     /db_xref="GeneID:59327050"
     mRNA            <325766..>326620
                     /locus_tag="HG536_0F01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284613.1"
                     /db_xref="GeneID:59327050"
     CDS             325766..326620
                     /locus_tag="HG536_0F01600"
                     /inference="similar to AA sequence:RefSeq:NP_012947.1"
                     /note="ancestral locus Anc_1.278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140509.1"
                     /db_xref="GeneID:59327050"
                     /translation="MNIRKRVKINVQSSAETGTIDAKRLNKVRLSLFRDDDDDDDLKD
                     APTRVLKKKRDQQPSEIAAPEESHISYNDLFSRKSASKPSFERVLNLEDMAEEDDSEP
                     AAVACMEETELRHSRNQDDEKVYVSLLDKEDKLEIIDTMKRQGGPEEQDELDEHELEL
                     LDDGTLPLSSRELLLSRSRKKQAIEEAIRMQDEEGSATWETRMLSKGTGDSRHSAVIA
                     ALPRLYSSDSSDDDESDVVGLSQAIASIALRKRQLEKQLIALKAQKASLQQQQATLIH
                     RLDQWPQI"
     gene            <326891..>327862
                     /locus_tag="HG536_0F01610"
                     /db_xref="GeneID:59327051"
     mRNA            <326891..>327862
                     /locus_tag="HG536_0F01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284614.1"
                     /db_xref="GeneID:59327051"
     CDS             326891..327862
                     /locus_tag="HG536_0F01610"
                     /inference="similar to AA sequence:RefSeq:NP_012447.1"
                     /note="ancestral locus Anc_1.279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140510.1"
                     /db_xref="GeneID:59327051"
                     /translation="MSAIRHLVSIKDLEDQEFVTLIERAEYFKKIFKSDESAEFQKNH
                     LKLLGKTIALIFTKRSTRTRISTEGAATFFGAHPMFLGKDDIQLGVNESFYDTTKVVS
                     SMVSCIFARVNSHNDILQLCEHSKVPIINSLCDMYHPLQAICDMLTIKEHLDYSTNKL
                     KVAWIGDANNVINDMAIACLKLGMDVSIATPAGIELDSGIAQVGKEIAARKNLNFILT
                     HDSVEAAKGAHVLVTDTFVSMGEEYAKAAKLKQFEGFQIDEQLAKHADPNYKFMHCLP
                     RHNEEVSDDIFYGKHSIVFDEAENRLYAAMAAIDVFVNNKGNFDDLK"
     gene            complement(<327945..>330407)
                     /locus_tag="HG536_0F01620"
                     /db_xref="GeneID:59327052"
     mRNA            complement(<327945..>330407)
                     /locus_tag="HG536_0F01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284615.1"
                     /db_xref="GeneID:59327052"
     CDS             complement(327945..330407)
                     /locus_tag="HG536_0F01620"
                     /inference="similar to AA sequence:RefSeq:NP_012448.1"
                     /note="ancestral locus Anc_1.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140511.1"
                     /db_xref="GeneID:59327052"
                     /translation="MRENNVPLRPTSESIRELVRELENAAQLASRGKATKRVCDLFDS
                     TKKVVSWKFQEWDYGKNNIQLPCNARGLFILDDPENPEIVARGYDKFFNIGEVVSTKW
                     EAIEAHTVGPYDVTLKSNGCIILISALSDGTIVVCSKHSTGPRTDVDRSHAESGREYL
                     LKQLKEADVDPEAFARELYELNITAVAEYCDDSFEEHILEYKGDKAGLYLHGINLNQR
                     TFATWPMDRVSQFASKYGFKPTAHFAIEDVSSLKNFLDECSERGSYDALEVEGFVIRC
                     HCREDGQDFFFKYKFEEPYLMYRQWREVTKDYITTKCRIFKFRKHKFITNQYLDFVIP
                     ILDNNPELCERYMRGFDIISLRNMFLQHYGMTAMEILNYEKVKELELRNAVDFDKVDE
                     NTKFLIFPIAVIGCGKTTTALTLKNLYPDSWAVVQNDDITSRDKSMLMKKSLELLATP
                     NIKCVIVDRNNHQYRERQQLFTWLADLKEEYLPYDTNIKVIGLSFIAYENLQSVRELT
                     LKRVLARGDNHQSIKSSVYGEKKVVGIMQGFLNRFQPVVESKSPDNKFDLIIPLRVSH
                     TNSSLENARKTLLNLNSSYPQLVPSMPSEEEIEKAFAKSLTYKPTIIKHVKGKGSTNP
                     KERQATFYSAHIRERQAMIDEIQKALKSAYLSERGKECMEKLFKQDKFQPEFHITLSH
                     VSQAKKGTEDQRCTWKNFASRYQKMISTNEEKDESMAPITTADTVKFKLNKLCWDEKI
                     VSVIADLPEHPIIDCNGQIVPQLKAGNAVSHITIGILQPGVAPFYSNKLCQRVLKGSD
                     KNTWSIDFDCCAQFEAEVRINF"
     gene            <330665..>332539
                     /locus_tag="HG536_0F01630"
                     /db_xref="GeneID:59327053"
     mRNA            <330665..>332539
                     /locus_tag="HG536_0F01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284616.1"
                     /db_xref="GeneID:59327053"
     CDS             330665..332539
                     /locus_tag="HG536_0F01630"
                     /inference="similar to AA sequence:RefSeq:NP_012450.1"
                     /note="ancestral locus Anc_1.281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140512.1"
                     /db_xref="GeneID:59327053"
                     /translation="MPDSIDIDEADVLVYSQGLERASRVTMQINKSLKSIARTSGHSS
                     DLFTPIVTRNNVLSTLQRNIESVLNSVASVKDLANEASKHEMILRKGFREMGLKQYIK
                     AIYKLEDMLDDIKADSGKRINSSEFTGIRTHLEEMIKDSETTLKAYFVSLVGSIKPFD
                     PQININKKIPFPYYKDNQLAEMALIIDYFHNTVSASAPIEDVFIQERSEIILKCMAFL
                     EPFAKKVPTNSSAPYEKESSGMLSYSEALLGFIANEKSLVDDLYSQEPGLKTKVFSGI
                     IVPLLSAYIKLIDVNLEFVRKSLENTGILSFELADSIHSVKRLLKTGPLDNYRALLDC
                     ADSVHRVTQSLFRDAIQRIDVKVSQISAIPADNGVTEATVDTMSRLRKFSEYKTGCLG
                     AMESMTREMWLPSPYREKEFTYQDTQNLKEPSALLSCFLSDCIDILVASLEKRAQRIL
                     APSLEPDISGHSSNKKIPKPRIGFFIIMNITLIEQIVEKSKLNELLGSDGHGRMEKLK
                     KKYINYLISDWRDLTSNLMDSVFVDSTGKISSKDKDQIKEKFKKFNEGFEELVSKYKQ
                     YRLSDRALKATLRSEIVALVMPMYERFYRRYKDSFKNPRKHIKYQPDEITAILNQLGK
                     "
     gene            complement(<332837..>335791)
                     /locus_tag="HG536_0F01640"
                     /db_xref="GeneID:59327054"
     mRNA            complement(<332837..>335791)
                     /locus_tag="HG536_0F01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284617.1"
                     /db_xref="GeneID:59327054"
     CDS             complement(332837..335791)
                     /locus_tag="HG536_0F01640"
                     /inference="similar to AA sequence:RefSeq:NP_012451.1"
                     /note="ancestral locus Anc_1.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140513.1"
                     /db_xref="GeneID:59327054"
                     /translation="MPELHSVFSPVFPVDKDVDVSGDAEPLAQTGSVQVFLQLAEPVV
                     FIQGFELPQQNDKPPSILRGSLVVRVLKPTRLKSISLSFKGYSRTEWPEGIPPKRQDF
                     VEINDIVNHTWPFYQADNRVPSGLVGRKSGLGANASSFGDHACLLHESGASMYKPLPQ
                     TAAHRSKHQSISSLNGLSSLSLASANASDARSVTDAVSNTGRSLSPMSLLRRATSPAP
                     KADDHRSRASSVTTSLISDLLSGTFVSASENTSSATNGDIHGVNTGNDNVYSSGSGNE
                     NFVFQPGEYIYTFEQAIPSSYPETVRADFGYVEYQLFVSIERFGAFKSNITARLPVTL
                     VRTQSDTSIEETEPIAISRDWEDQLHYDIVIASKDIILDAFLPLAFHFSPLDKVTLHR
                     IRIYLTETMEYYCKNKKVHRMEPTKKFLLAEHDGPRLPGTSETGALKAKNMGNLLLDE
                     STGDLVNKNFEYQVFVPSILNNHQQLHPDTGLENIKANHWIKLCLRLSRMVDGKRKHY
                     EISIDSPIHVLNRLCSHANTLLPSYDSHISINEQALSAHAQFGNTSNISLYHNSNIFF
                     PKEVLQSPVLSPEVHPLDLKVGSQSRNLSPRPRRRRDSKADDSTMLSSPPFQANIYQP
                     DQIQRELTSPQAIPLSPVTSPHVRPLYLPDAPPSFDFDLNETPTLNITKELPRNPPSY
                     VDVMKADGIESDHRHKSRPAVKPPKIVFSRSEETLADTRKPLDHSQRKSIEAGFSRRK
                     FTGADDDGDITSGFIFQGVSQASANLPSAVLRSPASNGMNLNVEVKKDRRNSISGILP
                     STIRNSNPSFNDMSALLTNNCDNNGENQLSRTTSAYSDSSCERSARSSVDSTLLFANA
                     NNMEPLLHHTETRHNISTDNIAFQSRDSINNYASSPIDSSVDITALYDRNSNGWHPLQ
                     ANAEDTLSPVVSPGYSAIVANSNHVFEDFKNALHQNDGSSRDLHEDSVSTLRQSNESS
                     SGRPTSPFQYDA"
     gene            complement(<336049..>336459)
                     /locus_tag="HG536_0F01650"
                     /db_xref="GeneID:59327055"
     mRNA            complement(<336049..>336459)
                     /locus_tag="HG536_0F01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284618.1"
                     /db_xref="GeneID:59327055"
     CDS             complement(336049..336459)
                     /locus_tag="HG536_0F01650"
                     /inference="similar to AA sequence:RefSeq:NP_012945.1"
                     /note="ancestral locus Anc_1.283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140514.1"
                     /db_xref="GeneID:59327055"
                     /translation="MTQQISHKKSLRFSRLNRDRRQLLKEYYKLEQPGSAEGKEQPQE
                     EQRPTVNAEAAQEHVEDAAADDRPIAECDFAELVRLHNKLLKKEAEMNNSIKSTIYEN
                     YYDLVKVNELLKEISSANEPLLDRLKETIELLRG"
     gene            <336703..>338820
                     /locus_tag="HG536_0F01660"
                     /db_xref="GeneID:59327056"
     mRNA            <336703..>338820
                     /locus_tag="HG536_0F01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284619.1"
                     /db_xref="GeneID:59327056"
     CDS             336703..338820
                     /locus_tag="HG536_0F01660"
                     /inference="similar to AA sequence:RefSeq:NP_012452.1"
                     /note="ancestral locus Anc_1.284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140515.1"
                     /db_xref="GeneID:59327056"
                     /translation="MFDKKKRQHATADLPEQAMNDSLRAAQVIFQRHTGSQASLSSGS
                     TGSVNQTSSRAKARKAGYGTGISRPGHQQAFRSSSSVPRSALSLAPSSGSSQQQLSRP
                     VSPLASGSAHAAAAMAHSRESDRQQEELLALAVLPQVPKRALSSSKIAQDSARRNPSS
                     GDFTGSHGGTREKLPVSRSQTAALSPSAASFILRRTVSQASSASQSQSEVRQPPLQPA
                     STPSSTNTVPTVDRERLKKLEVRTLAGRIPPPDIYFETKSDDVELEQESAGSDKDTGS
                     FSQQLSSSSNGSSSSALSIALDGSSYLADEGDLDLEEQESQSDTGEYTGSENESPEQS
                     LIHLPEHAFSVSSLPAESEDNSSSAAVRTNATYGVLNRLGHGNVTYQGTLPDLIPNHT
                     RRTRIERFRTKLFGAKSRSDEASNKELSKSSVTADEDGRAVVTTNHNLRFRTTMRGRG
                     RHSSNDFDNAYDGAPEQLDRTITNNYHAGVLTDSDDDDTDSIDDHEDDKKRKRRAARL
                     KRRLKHTAVPYSHHLHHHETRHHMSRKGFNEDKPWKSHKDVGFVTPAERKRYEGMWVS
                     NRCLYLELLPWWSSVISGQSAPPVSLPEDGLILSLVVKDIWARSNLPNDLLRQIYEKV
                     DTRGDGTLDRKSFIVGMWLVDQCLYGRKLPKKISQQVWDSVDRYVVNVLNSTAMKHMG
                     KSKKKLMKQEIKNIKKDIKNVHL"
     gene            <339127..>341466
                     /locus_tag="HG536_0F01670"
                     /db_xref="GeneID:59327057"
     mRNA            <339127..>341466
                     /locus_tag="HG536_0F01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284620.1"
                     /db_xref="GeneID:59327057"
     CDS             339127..341466
                     /locus_tag="HG536_0F01670"
                     /inference="similar to AA sequence:RefSeq:NP_012453.1"
                     /note="ancestral locus Anc_1.285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140516.1"
                     /db_xref="GeneID:59327057"
                     /translation="MFRVFGALTGRGNTTPEMSQEEKTKLILKQAHDFEIALQAMDYV
                     LDDRAQEGLQLLRDNEPEDGSDQTINVLARGVIEFLEATLGFEAEEMKKASATLAKAE
                     QLSLKSRQDAQKLQLHSSSLYPSGTVYAVTYTESCLLHALLMLFSESMMEAAKALLKL
                     RKAYSMLQEIFEAMKKAEKSRGLSSEDPNESQTSFSSCDSPFASADIPYALSAEEQED
                     HDLLEYAEKVHHMRMKRLCGAHIGNSPAINRLRDELGLGAMRNLPKEEIKEFTHVFDD
                     LDVTEATIDEFIHSGVNLCFGILQVVLSLIPPAIGAVLSIVGFHGSREEGLRLVWRAT
                     RQRNVHGCIGLLGLMFYYDGPFQFTDDDFDIPAASSTSTTLGNSKSQANLSASSLLQK
                     TRSSRSTSVVSLKKKATNDSLSSLRRNETSESTNSLKKLSSLQDGDLDGPTLLHPGKI
                     LVDALLRSRALFPNSALWLLNEARMLSARGRLEEAVQLLDSIDVQSIAMRQVKSLLVF
                     DRAITLSHLHRYERAAEDLLSLINISDWSHAFYTYYAGCCYLENWRMCQLGVLESDKA
                     EFYKKKALELIFGAPSLLGKKTFKSKNLPLDRFMLRKVEQYKTMQQKLGVSDALDAIA
                     TSPVHEISYFYNGYNRMTKEGLELSNKMLLEYHNPAIDSKNVDQELIKDFLVALSLRR
                     LGEVEEGCNLMDEKLLPNFFSMDRGKVRYIKKTEDPWLYPAALYERALFSWKLHGIDG
                     LPESREWLLRAQGYADDYELSTRIGMKIKAALDRVEHSL"
     gene            <341832..>343478
                     /locus_tag="HG536_0F01680"
                     /db_xref="GeneID:59327058"
     mRNA            <341832..>343478
                     /locus_tag="HG536_0F01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284621.1"
                     /db_xref="GeneID:59327058"
     CDS             341832..343478
                     /locus_tag="HG536_0F01680"
                     /inference="similar to AA sequence:RefSeq:NP_012942.3"
                     /note="ancestral locus Anc_1.286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140517.1"
                     /db_xref="GeneID:59327058"
                     /translation="MDLLDSEDNCSLLCDDDYDDDDSIDLYESQTTATGSMGDNVCHK
                     LNSLVSDDSGFEIDEELLNEDVEDDLLSHHMKSNDRAPEGNTSSLKYECLTMQDIFDR
                     MLERVHHLQPIFSMPAEDILLLMQRYDWNEERLLEEWTEKMDKLLIEAGLSADDLGSG
                     AGGNVRGIKRKAKFECFICCEDKPTETFALECGHEYCIECYRRYISDRLNQGKVITCM
                     DCPLALKNEDIDAVMGTASSARLMNSSIKSFIQKHNRNYKWCPYADCKCIIHLNDTTY
                     LQECTRLHRSWFVTCKLSHSFCFGCGYEIHAPADCNVANAWVKKARKESENLNWVLSH
                     TKECPKCSVNIEKNGGCNHMVCSSCKYEFCWICGGDWAPHGRSFFQCTMYKNDDEKQK
                     TSVENSKRTLKRYTFYYRVFNEHEVSAKLDWKLGQTVGQKVKVLQEKMGVSWIEGQFL
                     ADSLKILNEGRTVLKWSFAAAYYSDASHNLTKIFVDNQILLSNAVEHLSELLQIKDQE
                     AIMKRKPEFYNKSGYVQNRTRALIECGRDLLRKGICKPAD"
     gene            complement(<343551..>344987)
                     /locus_tag="HG536_0F01690"
                     /db_xref="GeneID:59327059"
     mRNA            complement(<343551..>344987)
                     /locus_tag="HG536_0F01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284622.1"
                     /db_xref="GeneID:59327059"
     CDS             complement(343551..344987)
                     /locus_tag="HG536_0F01690"
                     /inference="similar to AA sequence:RefSeq:NP_012454.1"
                     /note="ancestral locus Anc_1.287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140518.1"
                     /db_xref="GeneID:59327059"
                     /translation="MSNPGLQVYGGDEITAVVIDPGSFTTNIGYSGSDCPQAILPSYY
                     GLKDPEEEDQSKKRIFSEQSLCIPRPDYEIKPIVENSIVVDWDAAEEQWSWALKSLLY
                     LESNSGIPALLTEPIWNTLENKAKSLEMLLESLQFEACYISSTPTCVSFASGRPNCLV
                     VDVGHDSTSVSPVVDGMTLSKSTMRNFLAGKFINELIKKPLKGKDLVPLFEIAQRKPT
                     FKKRSFDFKVHSSLYDYANSRGFLQECKETLCQVAPDPLPQMKSQLESMSKRSIEAPW
                     TEELVFDNETRFGFAEPLFTPHEEDLPEDWPTSPNGIVETWHNDYVPLKRNKPNGKPD
                     KPSAEEGAPVEDASSTAETTNENGKRPIETDSPKIAIPGVADLVNESIMATDVDLRAS
                     LAHNIVLTGGTSSIPGFSDRLMSELNKRLPALKFRILSTGHLRERQYQAWLGGSILTS
                     LGSFHQLWVGKQEYEEVGPERLLSDRFR"
     gene            complement(<345175..>346812)
                     /locus_tag="HG536_0F01700"
                     /db_xref="GeneID:59327060"
     mRNA            complement(<345175..>346812)
                     /locus_tag="HG536_0F01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284623.1"
                     /db_xref="GeneID:59327060"
     CDS             complement(345175..346812)
                     /locus_tag="HG536_0F01700"
                     /inference="similar to AA sequence:RefSeq:NP_012941.1"
                     /note="ancestral locus Anc_1.288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140519.1"
                     /db_xref="GeneID:59327060"
                     /translation="MLKSKSPSLVKHAVTKRSLASINTGTVRPAAPKSHPFRRFLVRS
                     SVAISLFYAGGVALSQYNDDFGDLFVENVPFAETLVDSFESYRDATMSFHPLTLEELR
                     NKFGGMLGGKVSSVPNEGVKAQDADESGLKATVPASIENKDVGSANSTAKNDAVLVYL
                     NPISVALDSDLAASSKFGDLVKELNDTIKVINDQKIAVAKEQLSDITEAHQRLTVSVL
                     EFNKDFDAAVREGVSAKTAEALKELTDKYERKLRDDETQLISKFRREFNNYKVELEER
                     SSKQLAEDLKTNEQTLLAKHANEVALLSITQVEEFNKILKEKLDEERNGRLSHLKDLD
                     TGVGKLLESVEKLNRILMKKEAVTQLTLTLEELRGKLQSSEPHALNIEPQLKQLKSLS
                     DILPDKPKPCCKSKGLSPPLIDVAIAELDNLTAGTQILTNEQLYNRWNLLAADFKTAS
                     LLPPNAGILGHTFAKLCSFFLFTKEGSSPTNQDLDSVFSRVNENLRLSKLDKAVEEAV
                     ALQGWPHVLCQDWIKDARRKLEVEALVDVLDCELRTL"
     gene            <347975..>348661
                     /locus_tag="HG536_0F01710"
                     /db_xref="GeneID:59327061"
     mRNA            <347975..>348661
                     /locus_tag="HG536_0F01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284624.1"
                     /db_xref="GeneID:59327061"
     CDS             347975..348661
                     /locus_tag="HG536_0F01710"
                     /inference="similar to AA sequence:RefSeq:NP_012939.1"
                     /note="ancestral locus Anc_1.289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140520.1"
                     /db_xref="GeneID:59327061"
                     /translation="MDCNSSGRSGNRVMLQFKLVLLGDSSVGKSSIVYRFVKDSFDEF
                     RESTIGAAFLSQTIKISGSSEQSETVIKFEIWDTAGQERYKSLAPMYYRNANAALVVY
                     DVTQQDSLTKARAWVNELKNKVGDEDLVICLVGNKIDLCDGDEDKRAVETGEARDYAA
                     EQSLLFYEVSAKTGSGVRQIFESIGEKLYETKKDELAAARNRQMGSSKDQVNVQLQRP
                     STNDPTSCCY"
     gene            complement(<348789..>352400)
                     /locus_tag="HG536_0F01720"
                     /db_xref="GeneID:59327062"
     mRNA            complement(<348789..>352400)
                     /locus_tag="HG536_0F01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284625.1"
                     /db_xref="GeneID:59327062"
     CDS             complement(348789..352400)
                     /locus_tag="HG536_0F01720"
                     /inference="similar to AA sequence:RefSeq:NP_012455.1"
                     /note="ancestral locus Anc_1.290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140521.1"
                     /db_xref="GeneID:59327062"
                     /translation="MSLTFENETNLETPPTSNDSNSAITLNAEGEAGSQQVAEETAQP
                     KPLPSLKDLPSLGSNAGLVNTKINWGPNVKPAAAPSISSSPSPSPSSLTSGSRPMRSK
                     TIQEAFSLDLQSQLSIGKPEFSRIVQSVKQNHNVSVESTLSKSSRTFLISGVPQNVYA
                     ARRELVRKLTKPITDVIQVPSNCKAAIIGSGGKNIREIQDSCDVRINVAKENNPDSYD
                     EDLDDYTADVSIHGDIDSVKLAKSKIMKIVKEEDKHATIQFTVDDEKLLPFVDLSAVG
                     FKDDVKVQFLKNSATVVIQGPREDAKEAKQNIKNYLLSLSNDVVSEQVTIPTKFQFLI
                     DDKEIKEKFNVIVQYPTQADDEKVSFVGPRSRVREAIEFARTSSKAYAVDTLDISKSH
                     GKNLAHAKNLALFFKKYDYLKNLQEAHPTIKIVLPSPEVLAVSDCVNIHISGKAEEKE
                     EIKATRKELISLVNQISPLDTTVIDDVDYELFHKEIKHTLVGQEELAAFVQFGDFYPG
                     NDAILLIALSSNEDFKPSAEEIAETLKKVSAALNDIRKKQDALETRTFELAADTQDLL
                     LNENSATLKLILEDISQEEGHLQIKLHTPTENELTLKGNERAVNIANKAIESVVKAPS
                     QKFKDVIEIPANAVSRLIGTKGANTQQLRQKYDIQIDVPSESESGKPVSVTLTGLQYN
                     VEHAKVFIAAEAKKWADIITKELIAAPKYHRNLLGPQGAYRNRLQDKYNVRILFPRNE
                     DIITIRGPSRGVAKAYQELEALLDFEMENGHKSIIKVPAEHVPRIIGKNGDMINDIRA
                     EFAVEMDFLQKTTDSQVQESGEVELEITGSRQAIQDATKKVKDIVAEASDFVKETLDI
                     DRKYHKTIVGAGGRTLREIISKAGGDEYRNKTVDVPNANSDSQLIKVEGPKKFVDIVV
                     KEIKKLVEEGENSIKAELDIPAERQGALIGPGGVVRRQLESEFNVILNVPNKGESGKV
                     TLQGLPDNVEKAKSKILSEIIRDNFDHELSVPANLHEFVSERGAFIQNLRTELSINVR
                     HGNGAKKANKISRKALNIPTERVRGSDEEKIKFTIEDVTLDDSNEVGEISWRLSYEPV
                     DLTAILGEGEEQKEDGKDEANKKQSAINKAVQLIEERIALAPQATSAGYIWSSDTKKF
                     NKIVGPGGSNIKKIREASGTIINVPKRSDKVNDVVYIRGTSEGVKKAGELILKALKN"
     gene            complement(<352697..>353497)
                     /locus_tag="HG536_0F01730"
                     /db_xref="GeneID:59327063"
     mRNA            complement(<352697..>353497)
                     /locus_tag="HG536_0F01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284626.1"
                     /db_xref="GeneID:59327063"
     CDS             complement(352697..353497)
                     /locus_tag="HG536_0F01730"
                     /inference="similar to AA sequence:RefSeq:NP_012456.1"
                     /note="ancestral locus Anc_1.291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140522.1"
                     /db_xref="GeneID:59327063"
                     /translation="MKVTQLSLLAVAAAAVNGAVVTVTQQIPATVQGIVYVENGQTHT
                     SYSSVGGAATDAADQVQSTSTNAVAQVAQATSVATSFSTRDTTTVSPATTSSSGETST
                     AEAVTTTSTTSSTPSSSSPSSSALSDFASTILNAHNSKRSLHKDTPSLSWSDKLASYA
                     QDYADKYDCSGTLTHSGGPYGENLALGYDVTGSVDAWYNEIKSYDYNNPSFSSSTGHF
                     TQVVWKSTTQVGCGIKQCNNAWGSYVICSYNPAGNMIGDFADNVEPLK"
     gene            354312..354384
                     /locus_tag="HG536_0Ftrna8A"
                     /db_xref="GeneID:59327389"
     tRNA            354312..354384
                     /locus_tag="HG536_0Ftrna8A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:59327389"
     gene            <354510..>355418
                     /locus_tag="HG536_0F01740"
                     /db_xref="GeneID:59327064"
     mRNA            <354510..>355418
                     /locus_tag="HG536_0F01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284627.1"
                     /db_xref="GeneID:59327064"
     CDS             354510..355418
                     /locus_tag="HG536_0F01740"
                     /inference="similar to AA sequence:RefSeq:NP_012936.1"
                     /note="ancestral locus Anc_1.293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140523.1"
                     /db_xref="GeneID:59327064"
                     /translation="MTKSDQEVIYLYARDDHPKVKLTREQEFTGVQDLVEYFHSIQDT
                     FYVEFETSETITENLKLRCISYGGDEFDGSVPFYILEYDEILDSFYVWKSEGQWQLNK
                     LISTLYTDHSIKGSHKFVERVKESSFFEKHPRKELINCVLDKLNVDWSQIDIDQFWIQ
                     LDSIVKLDEDAEQNELSFKSLVSMAVLKTRVVENKAHLERAVKQYHKCMRSKDKDVRN
                     QESPEVKADLSPTSSASPSPTYALDNEGEQDDQIVTNFNRHFKLMAEDYETFDLKSWA
                     AFPQRTKKGKSTRKSQPKNCISKVKS"
     gene            <355805..>359317
                     /locus_tag="HG536_0F01750"
                     /db_xref="GeneID:59327065"
     mRNA            <355805..>359317
                     /locus_tag="HG536_0F01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284628.1"
                     /db_xref="GeneID:59327065"
     CDS             355805..359317
                     /locus_tag="HG536_0F01750"
                     /inference="similar to AA sequence:RefSeq:NP_012459.1"
                     /note="ancestral locus Anc_1.294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140524.1"
                     /db_xref="GeneID:59327065"
                     /translation="MLKLQIVLEPPSVRNGPIPFGFASSTADSSQVMAAGSLYGSGGP
                     RNADTSLPFPSNFSAANTTLYPSHFAQLKRRKFLHFTRSSNTLLDLSTEIAEKCEKMY
                     PSLTEEIEILSLQDSSGCDLDPDFYVKDVFNIDNTVRVILKNELDIDESAPVSLYRSR
                     KKKKLNNGLGQSQMQSQAPANSAQSLPPASSSSTNGGILQIAKKRASGTIKRHPINSN
                     MRISTPLAHQIYPPPSTNRVASNNSDEEDVAERSFLPPPAQPQSPPIRISSGIEKSKR
                     IRSAMDEDTVSRSETVDPDKTKQQRLLSGTPVRPAMTPNRVTLTGQRVVSEHVSNSDS
                     RSGSIFATNSTLNNKANGTTSTRIVSGMLSIPEPRIAEIEKELREGPSSPATLLPAVP
                     DRIPMKEPYQKITDQVSDESSSDEQGSDAHGKVSALRQTSIADNGSPVKDSSHGEDHL
                     RNVHLADLPVSRSPSVPAQRKTSLEAKVENKSAGALAQSTGTDEPLRKLNFSEEEEEE
                     EGEEEEQEVKRREDKEGSKINAERKTAQRSTDGEDEEGENTVLITRNDTEDKSTSNSS
                     IQKAEFLKLMENESNELPLWLQDTVSKTTSKSKPYTTVLHKDIDNSKPDPRNIMPKHT
                     PRSAAKKAAQLLSGKQNRNSNDVDTQRGTASSSSSDIETASSLDDDYDDKISIKENNS
                     IKTLNLHPLKERVISEQESKSPVAENQQPSQSTDLSTNGGIDRENGIVSSQKPPASDV
                     NTELATNLPHASREKPDAEKSFTKTSNEPVPENKSLNLRGENRDGKGSTNMPDSSTQE
                     SSGKSHLSNTSSGKPEKLLPSESQAKLTKKQEAEIKRREREAARAAKLEAAQKLKAEK
                     EAMKIAKQKAKEEAKLAREAEAAKKKLERENKKKMKLDEARRKKHETATKKNNQASSK
                     INEHENPTKPQSTPLQDGADRLKELKAKFTKSRAYVPAGLVPQKISRSNHDSESDSIE
                     TSSDDSSSSSDEEDSAASKKSRRLIVDTPKGSLSSVSPQKPVKHLPGVEDVPQSTQQT
                     SSSTQETPNKIPVTRLMDMSSPNSTTQESSGRSSFLQGLPQKVRPSLSSLSDLVSRGV
                     PDVREKSAATSQVNFQKAAESSSDDSNDEDEDSVSETSNSDSDNSSTDGSSFISAKSA
                     STALGKKKRGSGGFASLLKDSRKA"
     gene            complement(<359451..>363122)
                     /locus_tag="HG536_0F01760"
                     /db_xref="GeneID:59327066"
     mRNA            complement(<359451..>363122)
                     /locus_tag="HG536_0F01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284629.1"
                     /db_xref="GeneID:59327066"
     CDS             complement(359451..363122)
                     /locus_tag="HG536_0F01760"
                     /inference="similar to AA sequence:RefSeq:NP_012461.1"
                     /note="ancestral locus Anc_1.295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140525.1"
                     /db_xref="GeneID:59327066"
                     /translation="MHIKRVVIKGFKTYRNETIIDDFSPHHNIVIGSNGSGKSNFFAA
                     IRFVLSDDYSNLKREERQGLIHQGSGSVMSASVEIVFHDPDHRIMLPSGVAARPDDEI
                     LVRRTVGLKKDDYQLNDRNVTKGDVVRMLESAGFSMSNPYNIVPQGRIIALTNAKDKE
                     RLQLLEDVVGAKSFEVKLHASLKKMEQTEQKRSQIAAEMKELNEKLDEMEEEKKELEK
                     FNSLERNRKVFQFTLYDRELNDVINQIEKMDDEYGDTLQSSREYIKELDKREEMVAET
                     SKKLRDLESLIKIKETAELTEVKAKDNELSNELASLTVKIKDLKRQIDSYDEQTVVDE
                     NNLNIINKAIESKQAQLSTINPRFEALSKDEILYKVQLAELQEKQRELLLMKGKYAHF
                     KTREERNQWIEEEQHNLEQSLRKLEQSRDQVSEEREISIKNIGIIDEEIQELEDSVRG
                     PGVLAELDDIDRELKNCKTRYAEKLDERKELWRSEQKLQTISETLLDAVKNSERNVNE
                     TMARSLASGIASVKEIADKLKLPEDSVFGTLGELIKVSDKYKLCAEVVGGNSLFHIVV
                     DTDETASVIMKELYRMRGGRVTFMPLNRIFNDPNISYPPNTQASCTPLIKKIKFDAQF
                     ESAVKNVFGKTIVVRDLSTGAKIAKSYKLDAITLDGDRADKRGLLTGGYHDYHKRTRL
                     DSLAELKTARTQHKRTCKELDQIREKLHSVDAEIDALNGSIRQATQKRETILTNVEGF
                     RAKLNNKRSEKLFLEDTLKSLAAKFEKANINIKAAQEKIQSYSQDLASTFENQISPQK
                     QMELQTLESSLREVQAKLNTTTEALHGITTQRDSLSAELNAKLLPQRSELETKMRRGG
                     DPIVRELKNDLQMMIDERNALQSEKAQTAKEIARLQSELDSLREERATNQRHLEKANS
                     QQASLLKKLQSFQKDAEKAMVKKTTLISRREELQLKIREVGLLAEDTLNRFSSLSSEE
                     LLSRLNDVSENMSGLKNVNKNAFENFKKFHDKRVDLEDRAKELEDSKLSIQNLIIKLK
                     QQKVAAVDATFKKVSENFSAVFEQLVPRGKAKLIIHRESNSANDDDSADRDIDMEASD
                     EDSQTSSVYTGVSISVSFNSKKNEQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLF
                     DEIDAALDKQYRAAVANIIKTLSSKAQFICTTFRTDMLQVADKFFQVKYQNKISTVVE
                     VDRQEAINFIRGRGRLAEV"
     gene            complement(363576..363703)
                     /locus_tag="HG536_0Ftrna14L"
                     /db_xref="GeneID:59327377"
     tRNA            complement(join(363576..363620,363665..363703))
                     /locus_tag="HG536_0Ftrna14L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUG"
                     /db_xref="GeneID:59327377"
     gene            complement(<363848..>365110)
                     /locus_tag="HG536_0F01770"
                     /db_xref="GeneID:59327067"
     mRNA            complement(<363848..>365110)
                     /locus_tag="HG536_0F01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284630.1"
                     /db_xref="GeneID:59327067"
     CDS             complement(363848..365110)
                     /locus_tag="HG536_0F01770"
                     /inference="similar to AA sequence:RefSeq:NP_009846.1"
                     /note="ancestral locus Anc_1.296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140526.1"
                     /db_xref="GeneID:59327067"
                     /translation="MSEVTETFSFNHLAYLVFESVLQVVIIAVVGFWSAYAGLLPKSA
                     QKVISAINVDLFTPCLIFSKLARSLSMAKILEISVIPLFFAVSTGVSYLSGKIMARFL
                     QLDTDETNFVVANSIFGNSNSLPVSLTLSLAYTLPGLTWDQIPNDSRDNVASRGILYL
                     LIFQQIGQMLRWSWGYNVLLRWSGENPENMPPSQLAAHMESGRFGEDEAESTMVSEID
                     TSLVSSNSFWSKTWSKTVYLINGFRSYLNPPLYAMIVSVIVASIPPVQHEFFQKDGFV
                     NNTFSEAVAQLGSVSIPLIIIVLGSNLFPSDDTFRKTHKHKKLVIGSIVGRMILPSCF
                     LLPIIAVAVKYINVSILDDPIFLVVGFLLTVSPPAIQLTQITQINEFFEAEMASILFW
                     GYAVLSLPVSIVVVSAAIYVLQWANISH"
     gene            <365762..>367618
                     /locus_tag="HG536_0F01780"
                     /db_xref="GeneID:59327068"
     mRNA            <365762..>367618
                     /locus_tag="HG536_0F01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284631.1"
                     /db_xref="GeneID:59327068"
     CDS             365762..367618
                     /locus_tag="HG536_0F01780"
                     /inference="similar to AA sequence:RefSeq:NP_012462.3"
                     /note="ancestral locus Anc_1.297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140527.1"
                     /db_xref="GeneID:59327068"
                     /translation="MLYVLYFGFCLLASVALGESCDLKRLESLSGTLKYDATSLNQYQ
                     KIIAQLDRCTTDQDGEDIQKGVLLRRLYYRSGIIQLSLNQGLNAIESFEHAVDGDDSF
                     SDLARSRLRKLYVEFGMWDRIDSSDDTRRAFMDLERSARSRWAASHDHSLIDGDLHKL
                     LEISPSCLKTRSLLLETLFHRLAGSLDVLIGHEIIRNYERLLETHGSRFTLDKRLHIY
                     HSLAIIQAFILNTEPTHLRKCLALDMDYEPCRRLALLNNKLSKINPSRSEVLDPDVYG
                     FGNNAFDWHKLVSFYLKDQTPWIRVARRYKNNYELILAEVANAIEQLLPRGIVTGRPN
                     ATDFTKFIDMALCQAASESATDRVSAQPFCKLAMKEILPKETIEQLHKSAKKDGLDLE
                     RILTETWQSYPHLAIYMIQFILDSRKGVSSVVEDKLYHFFQHQGLSKSSKRLIQSLYH
                     KLSSMIRIRRQKQQQRQGQHQRQRQQQQQQWFYNQQQQHQRQEHTVPPNGPRTDRDYY
                     KILGIPESASSKQIRKAYLDFTKKYHPDKQGQLSEEEENKVHEKMSQINEAYETLYDD
                     QKRREYDQARSTFRSGSTNQHMFRQGSPRGGTSKFGSNFAMNFKPNFKFNFG"
     gene            complement(<367699..>369339)
                     /locus_tag="HG536_0F01790"
                     /db_xref="GeneID:59327069"
     mRNA            complement(<367699..>369339)
                     /locus_tag="HG536_0F01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284632.1"
                     /db_xref="GeneID:59327069"
     CDS             complement(367699..369339)
                     /locus_tag="HG536_0F01790"
                     /inference="similar to AA sequence:RefSeq:NP_009845.2"
                     /note="ancestral locus Anc_1.298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140528.1"
                     /db_xref="GeneID:59327069"
                     /translation="MKFSLANVATAAVLLTKVGSAFVLPEFFQEAFVPIRGDEQAFWE
                     FLWGEDELEDLDPELIEPEGFPKPHIPYFLKPMVESEKLQEKITVEDLNATALDILKI
                     ANASTKHYGHPTRVIGSPGHWKTIRYILKQFDDMKDYYEVSVQAFHALAGKIESFNLS
                     DAKTGETFPNTTAFSLSPPAEPFVGELVQIPNLGCDASDFESVTPEPPFEKQKKKIAL
                     IERGLCPFGNKSELAGQFGYSAVVIFDNDPKAEGGLHGTLNSISKHSVSTIGVTHETG
                     KKLIERILLNKHYFLEFAMDSYVKKIKTKNIIADTKHGDEDNIVALGAHSDSVEEGPG
                     LNDDGSGTISLLNVAKQLTHFKINNKVRFAWWSAEEEGLLGSTYYANNLTKEENLKIR
                     VFMDYDMMASPNYEYEVYDANNKDDPKGSEELKNLYIDYYKSKNLTYTLVPFDGRSDY
                     VGFIENGIPAGGIATGAEKKNVNNGKVLDKCYHSLCDDISNLAWDAFLVNTQLIAHSV
                     ATYANSFEGFPERDNATVKTEVVGGEPRFKYRADYLIV"
     gene            complement(<369587..>370042)
                     /locus_tag="HG536_0F01800"
                     /db_xref="GeneID:59327070"
     mRNA            complement(<369587..>370042)
                     /locus_tag="HG536_0F01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284633.1"
                     /db_xref="GeneID:59327070"
     CDS             complement(369587..370042)
                     /locus_tag="HG536_0F01800"
                     /inference="similar to AA sequence:RefSeq:NP_009844.4"
                     /note="ancestral locus Anc_1.299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140529.1"
                     /db_xref="GeneID:59327070"
                     /translation="MSFFMRLFSRRQRQSREAHGNAGSRVHTHEEGEFVHVSLSAPAK
                     SKRPEAEEEDADVSSWEMAQVLGRRPAAVVGRRPATMSSLDAHKKQAKRRDLTGRKSA
                     NVSRPGERAVEELHCMEDSAELDMFDDKRNRIIKRSHRRKMNFPDKYKF"
     gene            complement(<370325..>370981)
                     /locus_tag="HG536_0F01810"
                     /db_xref="GeneID:59327071"
     mRNA            complement(<370325..>370981)
                     /locus_tag="HG536_0F01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284634.1"
                     /db_xref="GeneID:59327071"
     CDS             complement(370325..370981)
                     /locus_tag="HG536_0F01810"
                     /inference="similar to AA sequence:RefSeq:NP_012463.1"
                     /note="ancestral locus Anc_1.300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140530.1"
                     /db_xref="GeneID:59327071"
                     /translation="MSLPDHLQSTFSPEEIQFIVENEPIKIFPRITTRQPARSGAKGG
                     SPPIRCTLITTDDASINQLVATRSSEVALWLALLLKQQNKCSIIAPQWLTLQALDRSI
                     QFEKTHPDRFSAMPWNWLVLAQLLFKRAPDDFHDPVHDLRSKVQDLREIRQLKVLKGL
                     RHLNESHLQLDNLSLLEVNELRPFVLDTMDRLREIHSAANQDTIQPAPADQHGYPEPL
                     "
     gene            <371164..>372870
                     /locus_tag="HG536_0F01820"
                     /db_xref="GeneID:59327072"
     mRNA            <371164..>372870
                     /locus_tag="HG536_0F01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284635.1"
                     /db_xref="GeneID:59327072"
     CDS             371164..372870
                     /locus_tag="HG536_0F01820"
                     /inference="similar to AA sequence:RefSeq:NP_012464.1"
                     /note="ancestral locus Anc_1.301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140531.1"
                     /db_xref="GeneID:59327072"
                     /translation="MWRQILGGGFRYDQPNAAAKKLILSVLNSTATKREAKDYLKKYA
                     SDSPKINHCLVLIRHLKSAEPSVLSRLSGAVKKLRMLGLRPIFIIPPSRHVSWDAETL
                     DTLLTNSRLRPIHLQSALFKAPDGSYTSLLSSQTRVFDSDALNLIPIIQPNVIEESTA
                     TVKCTDNVVEFVKNMLPKGGSPYIDKFFILNTVGGIPSDERRNNAHVFINLSQEYEQL
                     AANLEEKVAAVSKREPDSEGLLDRLALHLKEDELNSLQNQYEEHLEDLKLMNVVLSRL
                     SNKSTGLITTIGAASLTSDRKNPLLYNLLTDRSLISSSLPRFKNNPSYSDDGHCWYEI
                     SNESQEGDDATPREKNQEDAVLVTTVFKKGVHIKTFSYDTLTQFNSVGLPNKFYKKSE
                     PADQHCDEGLKVNVTKLKQILDQSFGRSLDLEHYLNRINGRIASIIVIGDYEGIAILT
                     NEGPPDNSFVYLDKFAVLPHLKGSLGISDIIFNLMFKYFPKELLWRSRSDNIVNKWYF
                     QRSVGVLDLSIDLSNGNRKKSQFKLFYHGDPGANEDPFQNKDRLIEYATYIRDISPSW
                     AK"
     gene            complement(<372936..>375446)
                     /locus_tag="HG536_0F01830"
                     /db_xref="GeneID:59327073"
     mRNA            complement(<372936..>375446)
                     /locus_tag="HG536_0F01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284636.1"
                     /db_xref="GeneID:59327073"
     CDS             complement(372936..375446)
                     /locus_tag="HG536_0F01830"
                     /inference="similar to AA sequence:RefSeq:NP_009843.3"
                     /note="ancestral locus Anc_1.302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140532.1"
                     /db_xref="GeneID:59327073"
                     /translation="MTIGERRPSLLFDNYEEVHQKSANSALKEVIEKNRLKIPYKPEE
                     LSIDDLDMMPLSTSFDKQMLLGSPMYLDPEEQEEKHSMVMEDYAKHGSHSSQPIPSDC
                     STLYLSDAIDGKESFEALTEIRVKYILASTQDSVSNIKYDLDKMFLYPKPLPKFWKFD
                     KDKRLNENQPDSSDDEQVGGPVKPGYYFPSPTEDQYMRQEELGVPKRLGRVHYTGELF
                     ELDHFKEKFEAHKRKYRRRVTALDYSNLPTFQEFRDDFLTLAEIARCSPLSEIAQKRI
                     KYLVNKFDLFQHLNCKAEILENKRVPLRDFYNSRKVDRDYLLSGCATQRQLSEFIWEK
                     LNVEPHRVVHKTYRGEKLTLSQVFEYGSGPGDPMAIGLKVIDDEFLKWYRNVYLITSH
                     LIPSADAEKVLTGKELRFYLLAKIFLEFDNYLDGEYLAEIFILYCVHTLEKSKYQLAQ
                     ISVDFQFYHPNEGSWWEKFSRWIIKWKLVSHNIRWNVRLSRVFTKLFHLERVGNFQDY
                     LDLIFDPLFENEKGNNIGLDFFLMNVGCLDLVVSSTDDYLWQDFADINAVPRDWSAKG
                     DNPPISYYMYYIFAQLARLNSMRYKKNLSTICLRNDCSTLLNRTSQAGSDLNFTDQFE
                     SLICNFMLCDAGLLQAEAICDSTPLITYLFYLCQIPVIASPLSSVSSVASQTSQEEVF
                     TLLGDTHKKATRDITKEEQSTYTTNPFMNMFKMGMKVSLSSKSVLFNSSYTMEPMIEE
                     YSVAASIYLLNAADLCELSRTSVLCSSYEGFYKAHWIGVGVRRRTPFQVDNVGYVNKW
                     YDREVDTSARHNVPNIRRNYRRETWNQEWAFIREQLGQ"
     gene            376168..376239
                     /locus_tag="HG536_0Ftrna3C"
                     /db_xref="GeneID:59327380"
     tRNA            376168..376239
                     /locus_tag="HG536_0Ftrna3C"
                     /product="tRNA-Cys"
                     /note="codon recognized: UGC"
                     /db_xref="GeneID:59327380"
     gene            <376554..>378104
                     /locus_tag="HG536_0F01840"
                     /db_xref="GeneID:59327074"
     mRNA            join(<376554..376563,376645..>378104)
                     /locus_tag="HG536_0F01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284637.1"
                     /db_xref="GeneID:59327074"
     CDS             join(376554..376563,376645..378104)
                     /locus_tag="HG536_0F01840"
                     /inference="similar to AA sequence:RefSeq:NP_009842.1"
                     /note="ancestral locus Anc_1.303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140533.1"
                     /db_xref="GeneID:59327074"
                     /translation="MAGYRLVDIAKPFLPILPEIEISYEKVPFDDKIVYTICSGLIYL
                     FGQFPLAAISKDEVRVQDPLYFLRGVFGAEPRTLMEFGLFPIISSGLILQLLAGMKFI
                     SVNFKLQQDRELFQSLTKLFALLQYFVLANIFIFSGYYGENLSIVQIGLLNLQLVGAG
                     FFAILVSEIVDKGFGFASGTMTINTIVIATNLIADTFGVSQVTVDADGHKEAQGSVIN
                     LLQGMRSKHKTFLGGLVSAFNRDYLPNLSMTLIVLGIGATVCYLQSFRLELPIRSTKA
                     RGMNNVYPIRLLHIGGLSVTFSYVLLTIIHLLAFVLIQLVARNDPTSIICKVLGHYET
                     VNNLLYVPSFPLSLLTPPRSFFSGLFQQPLTFAVYSGFMLFTGIWFADQWQAMSGTSA
                     RDIAAQFKEQGITLTGRREQSVAKELEKVVPVASTTGATLLALVTIVGEFLGLKGKAA
                     GMVVGVATGFSLLELISLDYQQSGGQSALAQVLGAPGRF"
     gene            complement(<378294..>378731)
                     /locus_tag="HG536_0F01850"
                     /db_xref="GeneID:59327075"
     mRNA            complement(<378294..>378731)
                     /locus_tag="HG536_0F01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284638.1"
                     /db_xref="GeneID:59327075"
     CDS             complement(378294..378731)
                     /locus_tag="HG536_0F01850"
                     /inference="similar to AA sequence:RefSeq:NP_009841.1"
                     /note="ancestral locus Anc_1.304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140534.1"
                     /db_xref="GeneID:59327075"
                     /translation="MRITAVNYFRESPITLLTRPWKKFRDGTLFYGASKSGTKRTALT
                     TKQGNKTMYKGTRSSGIGRHTRYGGYTIQWRKVRTFVTPKNYNIDLKPLVSHNVPELK
                     HQFKGFSKGSLDSKLYFTKLREYIQNGRLQSDASDPKCYTERG"
     gene            <379590..>381245
                     /locus_tag="HG536_0F01860"
                     /db_xref="GeneID:59327076"
     mRNA            <379590..>381245
                     /locus_tag="HG536_0F01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284639.1"
                     /db_xref="GeneID:59327076"
     CDS             379590..381245
                     /locus_tag="HG536_0F01860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140535.1"
                     /db_xref="GeneID:59327076"
                     /translation="MRPQGTQQALLERQVSDDPTLTAEVDGLKELETFLHLEDKDTVM
                     HSIFDSPGPSSDVIDLLDIADDSPIIRELGQQADLCPNQDRGCHYTATAGTTLDDEGI
                     LTSDFENFSSPPTSTRGRKLSFDTPPQRTAQTVVDFDFLQTNQTNTPFSVSSTGALEM
                     DAQRADDDSFFGEIWQEPATQKNNNDNLYCNKPNFKVGKPKWYYHPAPVQSFISSNSM
                     DLNYLFHCEDLQSMNNVMPSLNSAGPNSEAFYDNASREIVERRHQSLPNNRFSRHLPE
                     QVQVHTSKPSTGRPRKEKRIKCLKRDSTVTLEQKLDYFRLVMEDARNNGIPGIFLRDH
                     AASELSLEKQEHCALELVLPNFHLIAKHLDTMISTRKSSFRTIWRVTREQFDNKVCLN
                     FYLSDEVRPVAKDDIEISVFVLIVPGHSTKYLVTSCQYLELVNFVLGKNYNHLINDNL
                     AETTVGSDGKMISTQKHHASRVRSHVKKFLRRHVVKDLRKYTDLDRSDAREFEYRMAL
                     HNLVLQCYQKKPFESKVSIALMELENVEKALLKQAEFFTFKKV"
     gene            complement(<381395..>383194)
                     /locus_tag="HG536_0F01870"
                     /db_xref="GeneID:59327077"
     mRNA            complement(<381395..>383194)
                     /locus_tag="HG536_0F01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284640.1"
                     /db_xref="GeneID:59327077"
     CDS             complement(381395..383194)
                     /locus_tag="HG536_0F01870"
                     /inference="similar to AA sequence:RefSeq:NP_012466.1"
                     /note="ancestral locus Anc_1.305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140536.1"
                     /db_xref="GeneID:59327077"
                     /translation="MTTAVKIPQPGAINHEIPSPDEEEQLLAKIVFGDTSDFQENIKN
                     FDLELLLNEQEDEIAETYADGYRSGSEDDDEDVNPDLNRIQDDQLFFVDDGEMEVDED
                     VVVDESEPSEESSGELMGDDEDAWQDSDDEGVSVSIVTSNRSKKLRKSYQESQISGRD
                     YIRRLRAQFEKIYPKPSWVDDVSDEEQADGNESDKENEQAVDGDMNALSKILGTLYEY
                     KDISHRLLPPKTLDIVRLKDANVAHPSHSAIQSLSFHPYKPLLLTGGYDRTLRIYHID
                     GKTNHLVTSVHLRGTPVQTCCFYASPLGGFRDKPDVQRIFSGGRRRYMHSWDLSNALT
                     HSSSLGAVAKIDKLSRMYGHEDTQRSFEKFKVAHFHNFNTNQTHGIILLQGNNGWINV
                     LNGETGVWMTGCKINGVLTDFCIDYKPVSKDKFQTILIAANTYSEIWEFNLNDSGKIH
                     RKWKDEGGVGVTKIQVGGGTNSDNIVTTRNGGVRANRWLAIGSESGYVNVYDRKSFSN
                     NPRPVAALDQLTTTISSLTFSPDGQILCMASRAIKDALRLVHLPTCSVFSNWPTSGTP
                     LGKVTAVSFSPHGEMLAVGNEQGKVRLWSLNHY"
     gene            <383828..>386494
                     /locus_tag="HG536_0F01880"
                     /db_xref="GeneID:59327078"
     mRNA            <383828..>386494
                     /locus_tag="HG536_0F01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284641.1"
                     /db_xref="GeneID:59327078"
     CDS             383828..386494
                     /locus_tag="HG536_0F01880"
                     /inference="similar to AA sequence:RefSeq:NP_009840.3"
                     /note="ancestral locus Anc_1.306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140537.1"
                     /db_xref="GeneID:59327078"
                     /translation="MASSNNPELVHKWGHGYSIISIISFPKRNLLFAGTQDSKILAFT
                     LYTYELVKTIQLGDDQELNTRSSVLCLERSNDENYLFSAGADSLVRVWSLYEIGGTVQ
                     VREVATVYSVTDIGDIFSITYLDSIQTLVFGCQNASMLYLGNIFDKLLAAEENSPCDL
                     NRLPHRRYDKFFDSSGPTGQPSQKQVASDKFHEKALQNGPCNLILEISSENIINYAHN
                     GFVYSISKLCLSCSSLLRNDSTSEFEHNHPHEFERKKSLCRSHSDISECIITGGGDGI
                     SRVWCLTKNVNGVVSVSSLGTVLDNEETVLAQATDFPFLYCGLSEGIIKIWDLTTKQL
                     VSTLHTPDKSDIISISVYKNHVFAINEGGITLFHDKEVIHWNEHQDKMLSSDLFERRI
                     GPNEMQLSFLVGGNDGTLRLWNLSEVLKNSLTEIENQASELGRRKSIALARGSSLKPD
                     SEHMLATLRDLIGMQSVSQSPSTVEQLESRRCATYLSKLFSKFGAKEVHLFPLESGHN
                     PVVFASFIGNGKNKQKILWYGHYDVIPAADRNRWNSDPFTLTCENGYMRGRGVSDNKG
                     PLVAAIHSVATLLKAGELRNDVVFIVEGSEEIGSPGLELVCTQSKELIGGKIDWIFLS
                     NSTWVDEEHPCLNYGLRGVINAKIKVWSDEPDRHSGVDGGLHREPTADLFNIISKLQD
                     DQGRIQIPNFYEPLKDISAYDRHRFKEIVDIVQFENNVEVDDLIKNWAKPSLSVTTMT
                     MSGPGNVTVIPQSATVGLSIRLVPEQSVCEVKKALTEYLQRCFQELSTPNYLQISIEN
                     CAEAWLGDPTNHAYQVFKEEMTKTWEMEPLFVKEGGSVPCVRALERIFNAPAIQIPCG
                     QSTDNGHLDNENLRIKNWTNLAEIISNVFRRL"
     gene            <386664..>388397
                     /locus_tag="HG536_0F01890"
                     /db_xref="GeneID:59327079"
     mRNA            <386664..>388397
                     /locus_tag="HG536_0F01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284642.1"
                     /db_xref="GeneID:59327079"
     CDS             386664..388397
                     /locus_tag="HG536_0F01890"
                     /inference="similar to AA sequence:RefSeq:NP_009839.4"
                     /note="ancestral locus Anc_1.307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140538.1"
                     /db_xref="GeneID:59327079"
                     /translation="MSDISSDDGAVYNSVPPDIVQAALPFLSPQDIRSLSHTNRYFYK
                     LLNYKSSETLWHDLFCKVYETSYSDDEPFGDKIMLQNFSSLSWQERFKLRSEEAKLHT
                     WGCLKHARLGFTATSNPHIPEADVNGIGRRLRYGVNTPELVPWFSSDESKLNGDSSIV
                     QLSGGGFSFQILTRSGKLYTTGSTFSGGHVGPGPAEGQHDFNPFREAVHNLEASFPHT
                     RDIVLAPVGLPGSFPGRSTQHHGPTPTLGPHSNIYEELEQMDRNSAQTVPNNEHIKRV
                     YPRNAFEIFTSDSNSFKVDKEQLDSIKFVAVSSGRSHFIAMDTKHDLYSWDSPDSDYG
                     VKLAFEGLPPRETNPIWKIASGWDLNCIYVHQVGLVVWNKREALKKGELCSKADYSII
                     PQTGEITGPRKVIDFACFQGDCVFYITNDGENLWKYSHGLVQQIKLPIAGKFVRISVC
                     YSLLVLFTDNECYTVKIENGNVDNETLIELKLEDPDDRVISLATGDYHNIALTLKGQI
                     YAWGLESQLCGCLGLGSPEHVVEHENIGRWDSIRNMRVAKPTKICLDREYVCVAVSAG
                     GWQSGALIIKR"
     gene            complement(<388447..>389340)
                     /locus_tag="HG536_0F01900"
                     /db_xref="GeneID:59327080"
     mRNA            complement(<388447..>389340)
                     /locus_tag="HG536_0F01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284643.1"
                     /db_xref="GeneID:59327080"
     CDS             complement(388447..389340)
                     /locus_tag="HG536_0F01900"
                     /inference="similar to AA sequence:RefSeq:NP_012467.1"
                     /note="ancestral locus Anc_1.308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140539.1"
                     /db_xref="GeneID:59327080"
                     /translation="MSFKVSEDVAVCGGRLLKLSHFSQVIGTIMNVNVYLPKQYYSQT
                     DNKVIPAVYYLSGLTCSPQNASEKAFWPFQADKYGFAVVFPDTSPRGGDVPGDPEGSW
                     DFGVGAGFYVNATQKPYDKHYQMYDYIHKELPTSLDEYFSNGSRLDFVDNVAITGHSM
                     GGFGALAGFLKNYDANRYKSCSAFAPIVNPIKVPWGRKAFGGYLGADEEAWKGYDPSE
                     LVKKVSNRGNDRILIHQGTKDPFLESNLKPELLLEASKGTSWEGKIDLKLVDGFDHSY
                     YFVSSFVPEHAAFHAKNLGLI"
     gene            complement(<389631..>390932)
                     /locus_tag="HG536_0F01910"
                     /db_xref="GeneID:59327081"
     mRNA            complement(<389631..>390932)
                     /locus_tag="HG536_0F01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284644.1"
                     /db_xref="GeneID:59327081"
     CDS             complement(389631..390932)
                     /locus_tag="HG536_0F01910"
                     /inference="similar to AA sequence:RefSeq:NP_009838.1"
                     /note="ancestral locus Anc_1.309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140540.1"
                     /db_xref="GeneID:59327081"
                     /translation="MSKKQEYIAKIKYQNNLPPPLLPPKLLKYKVNDGEEPDSAELIT
                     SLYSKTSVTPLVKLNNDLGMPLDLMQVPGLLNNMDTKYLYELDGVKLAQQDRVLLRAP
                     GADRIPKTDMSKVTFLRRTEYISTAITSHGHGEEKKKRPASQLDESEESLSAPQIVEK
                     VESGFDAMTKDLSQLQHPVKKKVHAVKTWNLLPDTASMDQSYFTLKLVGSAALHSSEK
                     QKLALSTAIFRPVELEEDEWISMYATDPKHSDVLSKNMEKKIDDNLQDEENEGKIYKF
                     KRLRDFDMKQIPRQGHAGDFGELALVLNDEKGIAYYRPLRSRIELRRRRVNDVIKPLV
                     REHNIDQINVTLRNPTPQEANVRDRLRMKFDPIDFANVDEEEEERERETDNQESSAPA
                     AQEPPSQEPQATQDSKEPDSLAEDPEKQDAKETEQAKEIQA"
     gene            complement(<391158..>392105)
                     /locus_tag="HG536_0F01920"
                     /db_xref="GeneID:59327082"
     mRNA            complement(<391158..>392105)
                     /locus_tag="HG536_0F01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284645.1"
                     /db_xref="GeneID:59327082"
     CDS             complement(391158..392105)
                     /locus_tag="HG536_0F01920"
                     /inference="similar to AA sequence:RefSeq:NP_012469.3"
                     /note="ancestral locus Anc_1.310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140541.1"
                     /db_xref="GeneID:59327082"
                     /translation="MGLFGGSEDKNIDKVNQRILEDELAGPVADKVGSISDSMSSIWK
                     DSSSLWSDAVENPDKFLRDISGLQNHKERDVWENFAMSASDAVGSLLDAFGLPGGYGN
                     PRRIKYLMDDPFTSEEIVAQGVTGLFNYRTPTELQFTECNQVGGLSVWNTKGWWRCLF
                     PEKEVSKRLADQKDQLPFILTKEKAENDHAHKFGLFFPEYTGYLTWKSHMNQLIRERR
                     DKQAAAAKDKPVPATPEDFMIETERRPDDKEKRVIGTSEYVTYTYTPEGQNEMKKTKT
                     YYDNGTVLVKSQSKLTPADDGKPQVETSEKIVRVEDDEK"
     gene            complement(<392225..>392911)
                     /locus_tag="HG536_0F01930"
                     /db_xref="GeneID:59327083"
     mRNA            complement(<392225..>392911)
                     /locus_tag="HG536_0F01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284646.1"
                     /db_xref="GeneID:59327083"
     CDS             complement(392225..392911)
                     /locus_tag="HG536_0F01930"
                     /inference="similar to AA sequence:RefSeq:NP_009837.1"
                     /note="ancestral locus Anc_1.311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140542.1"
                     /db_xref="GeneID:59327083"
                     /translation="MAENVADKVEDRMQVDEQDTMPDENPTAAEQPSSECTRVMEQLK
                     RTQPRLPISKVKKIAKSDPDYILTAGNAFMAVAFAAELFVQSLTEEMIQLSYLSSKSS
                     NSKSVRLSYQHLSECVARKENYLFLEDVVPKTKNLRTLVKENKVRYMTRPEGQQTLPF
                     REKTVEPEGEEGDEEEQDSAEEDVEDPAVEEQLKEIEEMNRVPDLPGDGNHSEEEQSD
                     HGEEDEPPAN"
     gene            <393288..>395768
                     /locus_tag="HG536_0F01940"
                     /db_xref="GeneID:59327084"
     mRNA            <393288..>395768
                     /locus_tag="HG536_0F01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284647.1"
                     /db_xref="GeneID:59327084"
     CDS             393288..395768
                     /locus_tag="HG536_0F01940"
                     /inference="similar to AA sequence:RefSeq:NP_009835.3"
                     /note="ancestral locus Anc_1.312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140543.1"
                     /db_xref="GeneID:59327084"
                     /translation="MCDFSAVQRSSSKRQNTGDDCGLGSIQIKRHDSEKGSSDLGTLQ
                     FNGISAGELCDRLRSHLSTPLPACDQMFPWLHSYSTSAPPSFPSAVSIVRSQPMCEGW
                     IQNSGILRCSMDPHDFLMNWSAEKAQPFHHSDRAAAELILKNVIREELSKVNESVVEQ
                     DLNDVVRLCSQYGVLPFLMTDALTRQTYALKKRPEVSNSRDVAVIHAPKQPGSFRRFD
                     IQPSKMVEMSPIIVVYCFVAQDCHDFTKHPCQRCYQLAKVLNIALKLVRRNYPAAQLA
                     STEIRILQYSSLEEIPKSLIGTVPMKSSTLKKHAPEQLVSHFDVVSFNNWDRDLLYRE
                     KLEMSKMSSASHVGSSVWCGNSTDYQVYKLLKKCRKANSMTIRGQPSSSFESGSIVKL
                     DNLKFNPDKLDLIDSKFFDIPEPERNWSLMIRCVESVGLPSLEKLWECFLNVSQSDST
                     NPAEISFPSSGTITLGSLNINLVKIILNTCYIIHRVSMLKSSEILMYCSDGYTETAFL
                     LVSYLIFFWDLPLEEVLIRLHCEYQRPFFLFHMDLQVLGHLQTLLRTFSPKRKENLPY
                     YETSADKGFEPLDITPEMFSKIFLFRIPPGSDFSNLKGPLPSRILPHMYLGSLEHAHS
                     PDLLKKLGINYIVSVGEHLSWAESTNSRSRASSSPILASTSASKVTGGYQARPRGYTV
                     ETQTKASLHDHSDSSFDIFEKDDFKILRIMNLGDNGKDTLTHQLEHVLSFIDDCYRAN
                     GKVLVHCMVGVSRSATVCIAECMKRLRCDVLRAYLFVRVRRLNVIIQPNLMFMYELLK
                     WQEQQLHQREIDWHILCRSISELNTNYI"
     gene            complement(<395840..>396898)
                     /locus_tag="HG536_0F01950"
                     /db_xref="GeneID:59327085"
     mRNA            complement(<395840..>396898)
                     /locus_tag="HG536_0F01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284648.1"
                     /db_xref="GeneID:59327085"
     CDS             complement(395840..396898)
                     /locus_tag="HG536_0F01950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140544.1"
                     /db_xref="GeneID:59327085"
                     /translation="MPLVKNPVVAFNGLADAIGNTPLIKLTKLSEQLGRNIWGKSELQ
                     NPGGSVKDRAALYLIKEAERLGQIDPNKPNPTIVEGSAGNTAIGLAHIARARGYKSIF
                     YMPNTQSASKINLLKFLGAEVHPVPVCPVSDPLNFNNRARDHAARLPNAVWTDQFDNP
                     ANWKAHYYTTGPEIYEQLKQNGLSCDAFTCSTGTGGTLTGVGRYLKEATNGKCQLVAA
                     DPPGSVIYSYVTQGTLDRKGSSFTEGIGQGRITKNLEASVELIDEAVFVPDEESIAMI
                     YRLLDEEGLYIGGTSALNVVAACKVAEKLPEGANVVTILCDSGHKYAERVSSKKWLKE
                     KNLFGSIPDHLLKYAVLD"
     gene            complement(<397073..>397810)
                     /locus_tag="HG536_0F01960"
                     /db_xref="GeneID:59327086"
     mRNA            complement(<397073..>397810)
                     /locus_tag="HG536_0F01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284649.1"
                     /db_xref="GeneID:59327086"
     CDS             complement(397073..397810)
                     /locus_tag="HG536_0F01960"
                     /inference="similar to AA sequence:RefSeq:NP_012472.1"
                     /note="ancestral locus Anc_1.313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140545.1"
                     /db_xref="GeneID:59327086"
                     /translation="MTVGLARKLSRTKPHRDALLKNMVTQLLQHGSIVSTHEKCKEAS
                     RLAERVISWAKKVNENPSSPLRSEIQSRLFLAGDNSKLMGRLLGEIAPNYVGRNGGYT
                     RVLHLERRLGDKAKQSVLELVNTPVIDSEGNFNRGNMKLWLLVKNTMHDESCHKPYSS
                     LTLKSLKKMLVGKTPEQLRSEILAVRRFLKEHQGEEWNETIETGVVDVLLEQMQGPGS
                     SATKKGKKNGGYAFVSQRPVRDFAPAP"
     gene            <398193..>398459
                     /locus_tag="HG536_0F01970"
                     /db_xref="GeneID:59327087"
     mRNA            <398193..>398459
                     /locus_tag="HG536_0F01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284650.1"
                     /db_xref="GeneID:59327087"
     CDS             398193..398459
                     /locus_tag="HG536_0F01970"
                     /inference="similar to AA sequence:RefSeq:NP_076894.3"
                     /note="ancestral locus Anc_1.314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140546.1"
                     /db_xref="GeneID:59327087"
                     /translation="MVLDPSKYQDRRTWKMTPAMIRARQPFFKGNMIGLALLVAVTGG
                     VYAYTYNFLHRDNDFADVPIPPIDEKELAQLKKEYEVLKANRDK"
     gene            <398542..>399612
                     /locus_tag="HG536_0F01980"
                     /db_xref="GeneID:59327088"
     mRNA            <398542..>399612
                     /locus_tag="HG536_0F01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284651.1"
                     /db_xref="GeneID:59327088"
     CDS             398542..399612
                     /locus_tag="HG536_0F01980"
                     /inference="similar to AA sequence:RefSeq:NP_009824.2"
                     /note="ancestral locus Anc_1.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140547.1"
                     /db_xref="GeneID:59327088"
                     /translation="MVFCRVDGTSKTFSRTDRYLQDVEWETRESGEMKGTKYTLEDQV
                     VLISGGSQGLGKQFAAKYYRETVNSKIIIVSRGAEKLVSAVQEITDGKVEPKELGFDA
                     EWSDKDRIGYIPCDLSDREDVARLFEVLAAKHIQLSQVLACAGGSTPKLFKDLTDVEL
                     EAGVKMNYLTALFLSHKVAQLFPKCHLVLFSSETSFFPFIGYAQYAPLKGSIKSLTSI
                     LRQEMPEMRISCVYPGNFDSEGYAVEETTKPSITKEIEGASELISCEECCNRVVRWLH
                     RGYDDITVDFIGWVLMSTDMGLNKHNNQSFLWFVQLLIGTFANFLIVPIYMLICSRNI
                     KKWHKSQDRGLLKKPHAADDAQ"
     gene            <399776..>400933
                     /locus_tag="HG536_0F01990"
                     /db_xref="GeneID:59327089"
     mRNA            <399776..>400933
                     /locus_tag="HG536_0F01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284652.1"
                     /db_xref="GeneID:59327089"
     CDS             399776..400933
                     /locus_tag="HG536_0F01990"
                     /inference="similar to AA sequence:RefSeq:NP_009825.4"
                     /note="ancestral locus Anc_1.316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140548.1"
                     /db_xref="GeneID:59327089"
                     /translation="MSTYTCNTCELQFSSSQAQREHMKSDWHRYNLKRRVAHLSPITE
                     ELFNSKVQAVSNQEAEMQSSEDKKQMTKKEARRREKEALLEKKRELLKLAEQNALKKM
                     KEQEVPQGGKAERAEPKVDESPSAEDLTEEQLAEKLMQQKIDNKVDIPLTECFFCTKS
                     KNSKTVEQNLDHMFKNHGFYIPEQKYLTDRDGLLEYISEKIGLGNVCIVCNFQGRTLE
                     SVKAHMLAKRHCRIPYEEEDEKLEVSQFYDFSSTYKQHQSVDAAETNEDDWEDIGSGE
                     EDASDDEDVPQDYIYHDGVELHLPTGIKVGHRSLQRYYRQNLRPEVELTEGQGTLVAA
                     ETRSFLTSFDRKQVQVQQRVWQTEVKDKKRHDKRAAKFINNQPHYRDQLLQ"
     gene            <401061..>403493
                     /locus_tag="HG536_0F02000"
                     /db_xref="GeneID:59327090"
     mRNA            <401061..>403493
                     /locus_tag="HG536_0F02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284653.1"
                     /db_xref="GeneID:59327090"
     CDS             401061..403493
                     /locus_tag="HG536_0F02000"
                     /inference="similar to AA sequence:RefSeq:NP_012473.1"
                     /note="ancestral locus Anc_1.317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140549.1"
                     /db_xref="GeneID:59327090"
                     /translation="MAKRIFALLVCQLVAISLFCAGFFPQKKVLKGDAKFLIEPDLQS
                     KTKPVFSKFVLVVIDALRSDFVFEESKSHFFQLHSLLEQGNAWGFTAFSNPPTVTLPR
                     LKGITTGSTPNFLDAILNVAEGDSSSNLNEQDSWVKQFVNYNKRIRFFGDDTWLKLFP
                     LDFFDEYEGTNSFFVSDFEQVDHNVTRHISEQLMNQEDWDVLILHYLGLDHIGHKGGS
                     DSQFMPAKHQEMDEIIGQIYENSGNDTLICVMGDHGMNDNGNHGGSSSGETSAAMVLM
                     SKKLQDYEVPAQQKLVRLPVKDTSTNPTYQYLTSIQQVDLVPTLATLFNFPIPKNSVG
                     VVIRETLQLLDDKLAAIKVQENFRQLQSVKRSHKDTDDVFENLDATFQKMRDIQSELM
                     RSATDYNYEFLYLGLLILLVSTMAAMAAGLQQIRLEKPFFIILTISLIVGLSSFGSSF
                     VEEEHQIWWWIATGGVLLSSLHLPDKKFTHLIILLCLRIIRGWNNSGQKHFYENTIFE
                     ILKRNPIQQWYLNFFTIFGLGLLQSDLLSFVSTLLVSMLCFVYKVSWSIVNRERVPDW
                     MYQVALKSCSIITGSTTGDVFEESLVPVARLFYKCFLTCILINLGFAKLTSKRGALNS
                     ISTLLTMLLVFQSPSSNIPMFLAYNALRNSLTKLLVEDYGSSSFVTSITSLVLQYFTF
                     FHFGGTNSIATVDLSNAYHGVSQDYNIYLVGFMMCLSNFVPSIYWSIFTWRILYSGNQ
                     KWNRFSHNKLTFFMFNCVSGCALLLACLILRFHLFIWSVFSPKLCYYAAWNIFMNLVI
                     GWILEIPLLLMN"
     gene            <403690..>403989
                     /locus_tag="HG536_0F02010"
                     /db_xref="GeneID:59327091"
     mRNA            <403690..>403989
                     /locus_tag="HG536_0F02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284654.1"
                     /db_xref="GeneID:59327091"
     CDS             403690..403989
                     /locus_tag="HG536_0F02010"
                     /inference="similar to AA sequence:RefSeq:NP_009827.3"
                     /note="ancestral locus Anc_1.318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140550.1"
                     /db_xref="GeneID:59327091"
                     /translation="MFRFIPRRFFNAGLRLQEESSRVIKSSCPAGTVLNLNVKKSGKD
                     PIALEDHEYPAWLWEVLDKEAQARKLAEDPLKLRKKQIRKANRARIKQNNFLQQL"
     gene            <404184..>406274
                     /locus_tag="HG536_0F02020"
                     /db_xref="GeneID:59327092"
     mRNA            <404184..>406274
                     /locus_tag="HG536_0F02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284655.1"
                     /db_xref="GeneID:59327092"
     CDS             404184..406274
                     /locus_tag="HG536_0F02020"
                     /inference="similar to AA sequence:RefSeq:NP_012474.1"
                     /note="ancestral locus Anc_1.319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140551.1"
                     /db_xref="GeneID:59327092"
                     /translation="MKANSHRIFGGNFVSSNASERFFITAKDGSRAVAIEDSTVRWCD
                     TSDQDYNFMPLLSKLGGFKHAVVSKDAEYVCLYSDVEFRMIEIPWGYKDASSMARAFQ
                     KCSHKLGRGEARYKQILFHPLACQQNTLVILKDDDSVTIAYWKDITGTKDVVLNLSGG
                     AYSLDSYVSDIESITFGVDGITLYALSISEGADIYSFYPCLPPVIDIPENLLDELMYK
                     SLIQYEELTAETKSEIKENTIKQLQFVSKLRGSQSGVKSREIHSELRQVRAQGPFTMA
                     PFPDEIYGCNGRMICSMPIDQNKQLLIMALDDGKVAIFFQDLEPTMNWAFAGYSFNNS
                     LVLVELIKLEIRSIKQIMVEKKLPGRFSVLADNGMVSVDTTRWSTVLAKCLDESDLRP
                     LGALDFKSETTFLQYNSTPQSVAFWSSNTEQCIVTVTATNIMTKEIIRRHEESEEIKM
                     SSEESVPKKAYEAPYSQHIDEIMQLSRRFQKELAKSPGKIIDPRDRQVPLNNESNEKQ
                     LELLTEVSKELFQKIALGQSLGAALHNRLLEQQSDLSHQLKISEELIHKRDGIQDTLA
                     WQTTRFGQLEARHSKLRTRLDKLKDNLSKIGESNKFKQMAISKKEMDWFREIRAQVLM
                     FNQNVRSYQKQHEQLAFLRKELARISTMGADNESRSREEWQELHRMLQEDTRILQKCS
                     HELNIASRQVPANP"
     gene            complement(<406331..>406771)
                     /locus_tag="HG536_0F02030"
                     /db_xref="GeneID:59327093"
     mRNA            complement(<406331..>406771)
                     /locus_tag="HG536_0F02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284656.1"
                     /db_xref="GeneID:59327093"
     CDS             complement(406331..406771)
                     /locus_tag="HG536_0F02030"
                     /inference="similar to AA sequence:RefSeq:NP_009828.2"
                     /note="ancestral locus Anc_1.320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140552.1"
                     /db_xref="GeneID:59327093"
                     /translation="MSKPSKNTEVGSIAMLSRLRICGIANAGRGFPVTRGHRRTFKTE
                     ATPSPPKLPKEEQEEFERLQKIAQSQEAIDAYNREIEGDATKESLNSPMLTKNEIGSF
                     SPEFSKTLPEFEGDKNPETGEIGGPKQDPLRHGDYSFNGRVTDF"
     gene            <406865..>408295
                     /locus_tag="HG536_0F02040"
                     /db_xref="GeneID:59327094"
     mRNA            <406865..>408295
                     /locus_tag="HG536_0F02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284657.1"
                     /db_xref="GeneID:59327094"
     CDS             406865..408295
                     /locus_tag="HG536_0F02040"
                     /inference="similar to AA sequence:RefSeq:NP_012475.3"
                     /note="ancestral locus Anc_1.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140553.1"
                     /db_xref="GeneID:59327094"
                     /translation="MRTWSLSFEDCNELDDRIYKLRVVNCIASTGRCMSGKVAKTLAT
                     MTVTRPRIVPNKYFTSHVAKDVWSLTNEAAAAAANNANNSGRELINLGQGFFSYSPPK
                     FAISEAQKAVDIPLVNQYSPTRGRPSLIQSLIKLYSPFYNTQLKPENVTVTTGANEGI
                     LASLMGIINPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKGIDERVVKGTEWTI
                     DYEQFANSITGKTKAVIINTPHNPIGKVFTREELTTIGNICVKNNVVIISDEVYEHLY
                     FTDSFSRIATLSPEIGQLTLSVGSAGKSFAATGWRIGWVVSLNPELLSYVAKAHTRIC
                     FSSPSPLQEAVANSINDALEINYFEQMRQEYTRKYEIFTSVFDELGLPYTVPEGTYFI
                     LVDFSKVKIPEDYPYPEELSDKAKDFRISHWLINELGVVAIPPTEFYIKEHEKAAENL
                     LRFAVCKDDQYLEKAVERLRLLKKFL"
     gene            <408461..>409684
                     /locus_tag="HG536_0F02050"
                     /db_xref="GeneID:59327095"
     mRNA            <408461..>409684
                     /locus_tag="HG536_0F02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284658.1"
                     /db_xref="GeneID:59327095"
     CDS             408461..409684
                     /locus_tag="HG536_0F02050"
                     /inference="similar to AA sequence:RefSeq:NP_012476.1"
                     /note="ancestral locus Anc_1.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140554.1"
                     /db_xref="GeneID:59327095"
                     /translation="MVLSNRQVYICFWIFGLVNNVLYVVILSAAVDIVGPSLPKSLVL
                     LLDILPAFVIKLVAPFFVHKLRYDHRILCLIVFSCLGMLLVSCGSLRVCLAGVALASL
                     SSGFGEVTFLQLTHYYQEVSLNGWSSGTGGAGLFGSGIYMLFTSLLEIPVTVSLLSFS
                     VLPLGFLLYYKLGVGQEEVSDSAVPFLNNDPEEINALTLAPPTGVSSVVKQNLLIDLR
                     ANMYDTCQKLKELIEPFMLPLTTVYLFEYMINQAVAPTLLFPLGQKHVPFFFRKYRDI
                     YVTYGTLYQLGVFISRSTAHLVRMKRLYLLSSLQFLNLLLVMLQSWYYIVQSPWPIMF
                     LVFYEGFLGGAAYVNTFLNILEEVENKKREFALGSVSIADSFGVLVAAFIGLRLEPFL
                     CGHQIADGRPWCSME"
     gene            complement(<409722..>411305)
                     /locus_tag="HG536_0F02060"
                     /db_xref="GeneID:59327096"
     mRNA            complement(<409722..>411305)
                     /locus_tag="HG536_0F02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284659.1"
                     /db_xref="GeneID:59327096"
     CDS             complement(409722..411305)
                     /locus_tag="HG536_0F02060"
                     /inference="similar to AA sequence:RefSeq:NP_009829.2"
                     /note="ancestral locus Anc_1.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140555.1"
                     /db_xref="GeneID:59327096"
                     /translation="MTQPLNRKRSATAVLSTARQEDGQDSANRTRARFYSISSNIIPQ
                     TLTHPDDDEGLDSTKVTAVFPPSWSHVGFQSIFNGGGQRRSKRSLRSNASLEDHSLAT
                     GKSCDSLASSAHRRDFHRSEDDISNESINTSGSSTKGKMRSTFLGIGKDNQSLGDRNS
                     RIFRTSTNRSSSSVSGSLLSTKMPNKTSSLSNIAKKLFKHRQRRVVAHDEELESVTPT
                     PLSKILHSSYARHKAPSQFIHNSSGEPKSAYSFHSLNQGGQYDKQLLPIQDENSFTAN
                     LMFLHDFLKNLSTLEANYKNFHAQELHLLEENIWTVHCTITTELFKFKRIWQLPAKVE
                     DLNRLLDFYITLKTESKASSPNGKFLDEVEEFLTSSLYILENQIVFNYANEDIMNTSL
                     KRLGVIWHIFYEQVYYDVMAVFMPLERSFQASPKYWQDRSFQESPTQHILSVDYLLLR
                     CFRDCIVLPYYQNFIDSNEGASKSFQMYIFNEEEENGVTQQDKLTLLQCFGVLNSIQS
                     NDQNQKVIEDLLEGTRRSI"
     gene            complement(<411443..>413299)
                     /locus_tag="HG536_0F02070"
                     /db_xref="GeneID:59327097"
     mRNA            complement(<411443..>413299)
                     /locus_tag="HG536_0F02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284660.1"
                     /db_xref="GeneID:59327097"
     CDS             complement(411443..413299)
                     /locus_tag="HG536_0F02070"
                     /inference="similar to AA sequence:RefSeq:NP_012478.3"
                     /note="ancestral locus Anc_1.324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140556.1"
                     /db_xref="GeneID:59327097"
                     /translation="MSLVPYKEGSVILDDPTSRSLVIVYPSNGSLEFFEKVFDTETGD
                     VDSSWNQAAKASIASFVCPQCGTEVNPSVGDVTEVKDASVGGNNVLEVLKEPRTSRRL
                     RPKGILSRKYFKLLESSHRHYSLEQNERPALGPQHQFFLPDNLFIPGYFHKFFKTLSL
                     LGNGARGSVYKVVHKIGDIELGIFAVKKIPIGNDMAWFQKCIREVKALSSLTNRSANL
                     ITYNHVWLEMNTACGLVRTLDGRQLDAVEDIPCIFILQEYCSGGNLEDFIFKDVFHKF
                     QDLQSPKERKKKFLYRRSHPNEALGLSTEQIVSILKDLATGLQELHDIGLIHRDLKPS
                     NCLLLEENIEERPIAEYYPTIIIGDLGECQMDGESRTATGATGTLEFTAPEVIIPGTS
                     QHRPTNYNEYTFASDLYSLGMICYFIVFGELPFESQLEIGQLKHSILGFALDKSSLIR
                     KHEEMHLKAIDSRIFDLMLLLLSKNATERPAAGEVILFLEKLTDKTVQVEFISSRASN
                     ELELLKDDANFSLENEGVTADYPSVADEKTEESSAEERRMPLTQYKTILCIGINSVLT
                     IMILSSSTASLTAHFSLILLGISLKTSLKSQKWILLALCAILMMDRYSRASN"
     gene            <413810..>415018
                     /locus_tag="HG536_0F02080"
                     /db_xref="GeneID:59327098"
     mRNA            <413810..>415018
                     /locus_tag="HG536_0F02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284661.1"
                     /db_xref="GeneID:59327098"
     CDS             413810..415018
                     /locus_tag="HG536_0F02080"
                     /inference="similar to AA sequence:RefSeq:NP_009830.3"
                     /note="ancestral locus Anc_1.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140557.1"
                     /db_xref="GeneID:59327098"
                     /translation="MFDPLDLYTAKEAKEEGQCEEIVGNGHANHRASDEIDVDDAEGE
                     VEDHGFLDVLDLPPAYLATPQVLLCVLGLLQPATQVNFSDINRDRDASVSVICQEKHI
                     PLEYLEQAVRYYSQQCPNADLNSASKICSRIPQMAVTHGALMLPYYTSVLKYYEDRDH
                     LLRDEIIRQASLRIAESCGRSAQPSMTRQFTFDCLERSINIHEPSLTADNLGWKTWGS
                     SFILSQKLINRLHQGHFKSPLRVLELGSGTGLAGISWLAKWVELHGEEGIEMFLTDLP
                     EIISNLRKNADINRLNNIAKVAALDWTNPSHFIEMHSSKTFDVVIVSDPIYSPDHPEL
                     VVSIIERFLSEQGTCFLEIPARARYAAERRRLRRLLEDRKFTIIREEVDQGLEDWGMV
                     EYLFLEIKHK"
     gene            complement(<415062..>417437)
                     /locus_tag="HG536_0F02090"
                     /db_xref="GeneID:59327099"
     mRNA            complement(<415062..>417437)
                     /locus_tag="HG536_0F02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284662.1"
                     /db_xref="GeneID:59327099"
     CDS             complement(415062..417437)
                     /locus_tag="HG536_0F02090"
                     /inference="similar to AA sequence:RefSeq:NP_012479.1"
                     /note="ancestral locus Anc_1.326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140558.1"
                     /db_xref="GeneID:59327099"
                     /translation="MPPSCMTDGAGGANAKKDGVSDEGVVHGHIHNYDNMTLIHGHVH
                     RTPLPASDTPADRSLLSKGIMKSGVMPQGDGSQLDEKCLGGDNENLDCQFFQFVNYHQ
                     GGKPAGWMTRDASNVGADGKQGFLQSKPSLGHLYNDQALLLPSSKRKFSHGAGEENCH
                     CPPKILEICCDATHDATTASSAATVDGIPRGVNRDELRRYKKNRRPVSKSSIDSLATP
                     NLDHLVIDNCEISSDKIVKPKDLDFEDDENDDENIFEKFCEECLNLGHEHKHGASSSP
                     ENLDSDVKDKHCQYCHHRHPHDYSRARAPLPRENSSTTLSSTHSTHSELDLLGDGETY
                     HSAQGSASNVPPLTAKKYPSHFMNSQLDLQILDDLCNISSLYEVPFANHMNHHSHHHH
                     HISENEGNQGINLLESTIKCKPSFASSNNRHNHHHHRVQLQNCTAHCQPSDTSRESAS
                     NGLNGDDITSEWDNKNYSFERSTIPKTGSPVSGDMSYQTSVPKIEDCGNMPQEPTIAF
                     NWLFKKDENAIQCKWDQCPESFSSLIDLQRHMLRDHVADEDASCYWIPCTFKGEDTCS
                     LINHINSDHGINFGLNITTSDSCIKPMTVAQDCHPPVLQAHSNKPEETSQVPKFQCKW
                     GDCTAELDSAASLTKHLEEHLDRGKSEYQCLWRGCNRKFAQRQKLVRHLKVHSGYKPH
                     KCQVCGKCFSNEDTLTQHMRIHSGEKPFECHICGKRFAVSSSLKIHIRTHTGEKPLEC
                     KICGKRFSESSNLSKHMKCHKKKYSCSHCKRGFDTIEKFQAHEARCFKKSK"
     gene            <418226..>418912
                     /locus_tag="HG536_0F02100"
                     /db_xref="GeneID:59327100"
     mRNA            <418226..>418912
                     /locus_tag="HG536_0F02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284663.1"
                     /db_xref="GeneID:59327100"
     CDS             418226..418912
                     /locus_tag="HG536_0F02100"
                     /inference="similar to AA sequence:RefSeq:NP_012480.1"
                     /note="ancestral locus Anc_1.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140559.1"
                     /db_xref="GeneID:59327100"
                     /translation="MTSGISSVCVYCGSSFGNDSKYSEQAKALGELLHKLKWRLVYGG
                     GSTGLMGTIASSAMGPGCDGKVLGIIPNALVAKERDSGDDADVNAKLRESVDNHKGST
                     PISSKYGETCVVPDMHTRKRKMAEESDAFVAMPGGYGTLEEIMECITWSQLGIHGKPI
                     VLFNIDGFYDRLLEFIGHSIKEGFISKKNGLIIEVATTPREVIDKIAHYAVPDGRFNL
                     HWDDEGRNHG"
     gene            <419134..>420477
                     /locus_tag="HG536_0F02110"
                     /db_xref="GeneID:59327101"
     mRNA            <419134..>420477
                     /locus_tag="HG536_0F02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284664.1"
                     /db_xref="GeneID:59327101"
     CDS             419134..420477
                     /locus_tag="HG536_0F02110"
                     /inference="similar to AA sequence:RefSeq:NP_012481.3"
                     /note="ancestral locus Anc_1.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140560.1"
                     /db_xref="GeneID:59327101"
                     /translation="MSGLGSKAKGSKPGYTNPAFRMMGIPALRLPSRNWMIFWSVVTA
                     SVSGIAYDKYKQKQIRSHYKAAVKPLSSGSLDVNRKPRKITVFIAPPPGDYLDTSLKV
                     WKRYVKPILYYAGLDYEVIEEEKQGFIRTEVANRIRELRRQLRQAQSQNSSQEKEELT
                     AVQGGDDEFNAELAKQFKSDFDYRDVMGIFYNAQKPTVVYEDALNPDPSFAGGVICLG
                     RGAYKEYITGLHEGLLGPLDPPEASTDLPENEKAEQDKISSERDGQTANAETNDELNG
                     EQESGSGKSEETEEDKKTGSNNALKPFISPDEYSDVEFPVELSAAHNDPYIRDPATQV
                     PFLFHQAVLMIPVPNLIGFLNIPERIYRFYQKRYYAQAVSSAVADMVNQKDIRPFEHP
                     QDLALGEEEEDDWPKSWIREGEKRKSEWTRELKDDPRVIEYIRVYNKPKSDSQSD"
     gene            <420829..>422274
                     /locus_tag="HG536_0F02120"
                     /db_xref="GeneID:59327102"
     mRNA            <420829..>422274
                     /locus_tag="HG536_0F02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284665.1"
                     /db_xref="GeneID:59327102"
     CDS             420829..422274
                     /locus_tag="HG536_0F02120"
                     /inference="similar to AA sequence:RefSeq:NP_009831.3"
                     /note="ancestral locus Anc_1.333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140561.1"
                     /db_xref="GeneID:59327102"
                     /translation="MSDSHSKEPSAIRHIIDELNATLEAEVLNPLVNEQLEKCLLNLS
                     SINVLKVDPKRLLANIKRLLIASSGDSKLDYDLLLELLSKLIAISSFEDILTVFSIED
                     LATSLNSGIPALVRAANQVISRSYPKGLFANSKIVDILLDLYFDESQEISIINSIERS
                     ISNLCSDDLIRRRLMINNFPRLMAVRKKYKPTSMARLLEILSSLCSYMDHTEFSEKLF
                     VIRPEEILQSLEIDIVMFIHILVYYTKVLGEVDVIEVGGPSHNWLLRYVRSIVPTYGQ
                     IFAQLEEYSDVKYFARSYLFNFFRKLSYLEDSSIFRELDDTYIHLSPASTYLTDFLSF
                     VNPAYLFEYHPTLITRFSELTPSKLGVIRNLVADPACFAMLKDHFTAESILAMPYMEQ
                     MVLLQRFSQFSHSSEYLLHELPKVMSNLISAEDRNITESETVALRRESIENLLKYEDS
                     VWHISLKNELIKIQGGRPRSELHADIASSYI"
     gene            complement(<422374..>425586)
                     /locus_tag="HG536_0F02130"
                     /db_xref="GeneID:59327103"
     mRNA            complement(<422374..>425586)
                     /locus_tag="HG536_0F02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284666.1"
                     /db_xref="GeneID:59327103"
     CDS             complement(422374..425586)
                     /locus_tag="HG536_0F02130"
                     /inference="similar to AA sequence:RefSeq:NP_012485.1"
                     /note="ancestral locus Anc_1.332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140562.1"
                     /db_xref="GeneID:59327103"
                     /translation="MSGDDLFDVFDEQPAVIPEIAAEGVENSPVPEQNGRKHQLEDVK
                     TDGSVPEEPETKRKKQESKLVDEKKRKSTVVPVVTDAFEQEASREVDASAGLMNAATT
                     QVESDGKVKLSHQVRHQVALPPNFDYKPIGEHRRKNEARTYPFTLDPFQDTAISCIDR
                     GESVLVSAHTSAGKTVVAEYAIAQSLRDKQRVIYTSPIKALSNQKYRELLAEFGDVGL
                     MTGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVVFDEVHYMRDKERGVVWEET
                     IILLPDKVHYVFLSATIPNAMEFAEWICKIHVQPCHIVYTDFRPTPLQHYLFPAHGEG
                     IYLVVDEKSTFREENFQKAMTSISNQSGDDPNSADSKGKKGQTYKGGAAKGDAKGDIY
                     KIVKMIWKRKYNPVIVFSFSKRDCEELALKMSKLDFNSDEEKDALTKIFNNAIALLPE
                     VDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNM
                     PAKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVAK
                     GMVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLENSFYQFQNVISVPRMEKKLLE
                     LQKMADDIEIEDEENVKDYYEVRQTLDGYNQDVRHIITHPANILSFLQPGRMVEIAIE
                     NKDNYGWAVVVDFAKRMNKRNPTAEYTDHESYIANVVVNTMFVDSPINLIKPFNPKFP
                     EGIRPAHEGEKSICAIIPVTLDCIRRIGNLRLFMPKDIRASGQKEVVGKSLQEVSRRF
                     PDGIPLIDPVKNMKIEDEDFAKLLRKIEVLESKLYSNPLAQSVRLKELYESFRKKRAL
                     EDECKELKHKISESQAVIQLDDLRRRKRVLRRLGFCTQSDIIELKGRVACEISSGDEL
                     LLTELIFNGNFNELTPHQAAALLSCFAFQERCKEAPRLKPELAEPLKAMREAAAKIAK
                     IMKDSKIEVVEKDYIESFRHELMEVVYEWCKGASFTQICKMTDVYEGSLIRMFKRLEE
                     LVKELVDVANTIGNAALKEKMETVLNLIHRDIVSAGSLYL"
     gene            complement(<425842..>428205)
                     /locus_tag="HG536_0F02140"
                     /db_xref="GeneID:59327104"
     mRNA            complement(<425842..>428205)
                     /locus_tag="HG536_0F02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284667.1"
                     /db_xref="GeneID:59327104"
     CDS             complement(425842..428205)
                     /locus_tag="HG536_0F02140"
                     /inference="similar to AA sequence:RefSeq:NP_012484.1"
                     /note="ancestral locus Anc_1.331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140563.1"
                     /db_xref="GeneID:59327104"
                     /translation="MDGEPNRTTHRSNGSSQLDQLSIKYLGSILSLAAGSLCVALVVM
                     YHQEKATFIVMACSNLLHGLGFFALCLICSKRRGKTSFLSLSHLSCICIELVTLGAAV
                     CHFDNGRKHAISPNTHLHQNLIIALDALLLFALFINGMAIASLRTGTEAQATSIEDIS
                     HLGSESATQHGKFVPLKNSSQTLTPSMEIFQSIQSQCGSKLWTMKDTPASRSTDDISF
                     PSVVKHKLECFSSKDASPVSSVSRKGSSIKSRLRSSSGSSSPRASRSLISRLRSRKLQ
                     SVFDSRKKSAGDETSNKNINGRYVTRLSTIPDLSKSVLNVILSSSEGQHKQEKVTDSS
                     AEQNMQHSAILPDPALELERDAIGRINSALLPPCLRVMEIPPLSETVNSNKQAFAQGS
                     QYNDLQNATHSSPDILEANDLGEIPRIPTATHGANSSGCSTDFNMHLDFPQLVTMDMW
                     RENKERILERADQLQRHALLPAFDLSSPGLVSQNDELPGSTFSFPSKSYPTNLDTKTS
                     TDQKDFDTISALEEYFRDLNEHEEEEMQIIEDGLKHDQSSSAIGGNLSKEIIRTSTRH
                     SPTKSMISVISAASQQRYLNATGDQRRHSQSNFFLPTSSAAVYNSSSKSSPTRSQRLK
                     RIGKKLSLSNLSDTVINHSIASDATGDLFAASKHDLVRGRSIDFSYVHNLQSNHSPTK
                     SASGQSMCGSNYDRRNSLAADHGLRTASGLFFLHNGTGAANFAQDPTINTTWTDPLPE
                     GQNTSHSASTEPSNSSTTEYPDVVMSEYDRERWNTILSLESSGKLNV"
     gene            complement(<428527..>429600)
                     /locus_tag="HG536_0F02150"
                     /db_xref="GeneID:59327105"
     mRNA            complement(<428527..>429600)
                     /locus_tag="HG536_0F02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284668.1"
                     /db_xref="GeneID:59327105"
     CDS             complement(428527..429600)
                     /locus_tag="HG536_0F02150"
                     /inference="similar to AA sequence:RefSeq:NP_012482.1"
                     /note="ancestral locus Anc_1.329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140564.1"
                     /db_xref="GeneID:59327105"
                     /translation="MSLFFKSPIDIEVLFDGEESRKHVEIANAAGSGSKSLKDRLPLY
                     EDGETLSGVVTLRVKEGKRVEHLGVKVAVIGSIDMVKSQGGGSGSGSSGKRLSPSVSD
                     AKKMPVEQFICLSYDLCPPGELQHAQSFPFIFKDLTKRYESYRGKNVDVSYYVKVTVA
                     RKTTDISKAKKFWVYLYNDASKPPAAILGSSGAQSSEETSSRDPVEQDKNGKPQSGLL
                     RKEPKPVKLDIGIENCLHIEFEFSKSQYSLKEVIVGRIYFLLSRLKIKHMELSLITRE
                     SSGLQPSNYLVDSTAIRYEIMDGSPVKGETIPIRLFLGGYDLAPDVTCSYFNVKNYLS
                     LVIVDEDGRRYFKQSEIVLFRTR"
     gene            <430122..>431489
                     /locus_tag="HG536_0F02160"
                     /db_xref="GeneID:59327106"
     mRNA            <430122..>431489
                     /locus_tag="HG536_0F02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284669.1"
                     /db_xref="GeneID:59327106"
     CDS             430122..431489
                     /locus_tag="HG536_0F02160"
                     /inference="similar to AA sequence:RefSeq:NP_012486.3"
                     /note="ancestral locus Anc_1.334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140565.1"
                     /db_xref="GeneID:59327106"
                     /translation="MKSRGTMDLPPSRLDSLYKDFSNLKELNPEGYRANIDTWKAYLT
                     KNYLKGSSSLFLNCGSDLLVKLRREPQGLPRSIDVVLTSLVESDCLVAIEDFYNGIMY
                     PQEASTLMRWIRWGSWPRGKVNLRNNHDEYYLKAVKLIIKPVIEQKFEHIKIQLRNNI
                     ISEASGIADLVFSKQEFYRKCGFHRILDDAEEEREAMLFYLSRYKKLIVQDRDIIKVI
                     APEVNHLLAHLERKVTEDDRRIAALNMSLIYVESQIKTLRTQIADYAVLLKDMIINLA
                     PRETQRKYLQGKKLVERSLSRLLEQQTSLLTVKTQINLAATNALLFKALEESNKVLKS
                     INDSVGSVEKIEELLDEIKEEGEKAEEVNALIAKSPDAEDEAELDRELEEMKVETEQT
                     RKEETVIDVSEKKENKPSREANESEHLVKKLSSLNIDSKSPEPREKYPNSIQRGSKGA
                     IAEPQ"
     gene            complement(<431536..>432867)
                     /locus_tag="HG536_0F02170"
                     /db_xref="GeneID:59327107"
     mRNA            complement(<431536..>432867)
                     /locus_tag="HG536_0F02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284670.1"
                     /db_xref="GeneID:59327107"
     CDS             complement(431536..432867)
                     /locus_tag="HG536_0F02170"
                     /inference="similar to AA sequence:RefSeq:NP_009832.1"
                     /note="ancestral locus Anc_1.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140566.1"
                     /db_xref="GeneID:59327107"
                     /translation="MAQELFLSSVEEGVAKSMREGKILVLYTSAGDDVWLNSWFKSDF
                     QSRLSRHAVWLKLVRGTDQFRYFEQIFPSVVVPSLCFIRNGQILSTIEGEEDKSGGEG
                     HWGKLMATLGAGSELFSARKAPGEAKQRNLKEQVADTAQRKYHEEMQKQRKQSKEERE
                     RILRLVEADKAERRVRRKSSEDNSQGGQRQLQDNIKNIERLHADECTLLIRLTNGENI
                     MKKFDSKLKLNDVRSWVDANRTDSDCPYAFHRNIPRVTFSDSDELKTLEALDLSPRSA
                     LILKPLENARSRLNIAEAKGPGLLGKVFNGLSSWWAASGREQNERHQSSDCEEDKDVA
                     DNQGKPTQRFPDAILENNQALDSIASSSTIREEAVTASPHSSRIDSPLYSASDFHIKH
                     NPSELSLPSRCVTPNVHQFVNVEDEDNDRFAYNGNNIKLEKKKDDDKCMDG"
     gene            <433089..>434669
                     /locus_tag="HG536_0F02180"
                     /db_xref="GeneID:59327108"
     mRNA            <433089..>434669
                     /locus_tag="HG536_0F02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284671.1"
                     /db_xref="GeneID:59327108"
     CDS             433089..434669
                     /locus_tag="HG536_0F02180"
                     /inference="similar to AA sequence:RefSeq:NP_009833.1"
                     /note="ancestral locus Anc_1.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140567.1"
                     /db_xref="GeneID:59327108"
                     /translation="MSGIDDTSLPAIKDVVIGETIGQGAFACVKNAYLKVDPSVVIAV
                     KFVHIPTCKQFGLTEKDVVGEIILHSKCCNHANILRVIDCNITRDHLWIAMEMADGGD
                     LFDKIEPDVGVDYEVAQFYFQQLVNAITYLHLECHIAHRDIKPENILLDKNGNLKLAD
                     FGLASRFKRRDGTLRLSSDQRGSPQYMAPEVLMGVKYHPEKTDVWSVGVLVFVLLTGE
                     VPWELPIRTDENFEEFIRNEGNITMGRWASIEFRHLNLLRKILQPDPSKRATIQDLRK
                     HPWFLNQLSFANSEGLCSNPALLAKKLFSNLRVSLSDDEYMRFTQDPLTGTGQSIDFR
                     ATQPADSDYAGLQHDTLNLDAVGCTQKPYTQNTTELLRNDLTTSQSSRWTRFINTDIA
                     ALQFCHKNNPSFASQFRFNPIRLTKFYSVQEMEVILPLFEQALRFAKINIKPDLLSDF
                     LNLKSSLGYEGVFPLVINIRTQDARGSKLNGVIIIKIVRENLKSISFERKAGDPLDWR
                     RLFKKVALFCREVILVPD"
     gene            complement(<434743..>439641)
                     /locus_tag="HG536_0F02190"
                     /db_xref="GeneID:59327109"
     mRNA            complement(<434743..>439641)
                     /locus_tag="HG536_0F02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284672.1"
                     /db_xref="GeneID:59327109"
     CDS             complement(434743..439641)
                     /locus_tag="HG536_0F02190"
                     /inference="similar to AA sequence:RefSeq:NP_009834.4"
                     /note="ancestral locus Anc_1.337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140568.1"
                     /db_xref="GeneID:59327109"
                     /translation="MSKQPPEDRGEARKMNTFNNLISQLLNKRSPTKSQSQSKTLHLL
                     ERNQSLPPANGERQEPLDDSPTPKRRKLAQSSPIGKAPGPTPSSSKSEPAGSSIFAIN
                     NENVRLSPAAKTVAFSDEVKSSPTQRTIGSSSFLFPASKPSKSILRNGIGIEKSVSDL
                     TYDKLESSSKLAGRGKPLEHFSRAKDPSCLEFWTSGEVHNLGDARNVKEFRQVLDGGL
                     MMLARTDSESVARRFEIYATFNTIITVLPAVDASEVMERRATQVIGSLDRIVNICLPQ
                     LKAEQKKLLDAEDKKDPFVSRLYIQILRFFGSLLSNYRIVRSLTKVAPLRDRLKEVFE
                     LSSVALIHQNSNKAIIGAQFSFLADEKYGPYFMNRDEVSNIIHAVLNTKEIQSANLVC
                     EKLFLLKRLISKHTSVMLQLLPLWLPKEVLSRTLMEDDSCTITILQAAISVLLELLKK
                     SIDSSIRQHDIVKCVRESLAKDTLPEKLRNKSLNDGNMNYSTMTLEELVQKQITYLIV
                     FKKEYKLAMDLWLAMMGLLYNTTRTLLELSDSDARGWLKLNHICFLSGDSPIKLIALK
                     AWRIIIYCTWSHIKGKSSAHDFALVRILKKPFDFTANHESDLNVGEGLLYYLTGLIYT
                     TCGAPKSHKADMFPFFWNQLIAPIYSQYIFKSGNILFRSRAIKLLLKLISKEREDKSH
                     KLERKRTPVIKVISTSGVALNDIQPVPASLLQASFESVMRLIFCAIRSDLADWAANYE
                     LFISLVDLLPSELADEMHFNSFLEIALELSKAGKSSISSDMFLRLSSAMAGPFGDLII
                     RDGKIFETLVEATDHLPEHQADSKLKLLKEFSKKLKGRVSDLRIMEIFVGIDDASCKQ
                     YVSNWIGSVILSPEISPTDYKSLLRIVQSVRSAEAIENLLRFCSKFVRNVNLFELLQL
                     GEWNDEQYIRFVKVYVSYNSHRLEYPEDLFKEQLKDALGSREKAFKQVVPELIRHKLF
                     DVIKEVIASNLRLADILLSEYGSSSSAILPVDQLPNFILNLQTFSGSGQLFITKWALS
                     LDNPEELFAGGKAFFDFIFHLEPDGSVTGDRRALIDQILERLYEHGSWANLSDFIKVC
                     IACHQTSPVEQLFKIKGSRKLRLLSPAAIAFMVDKCGSLNADLKEYIKEAYYSMNVDF
                     ILEVTGSLLDLRKVECFDFWGAQFLVFFITKAQSFENSVQNECRELFKKFINILLDQS
                     DKLIIPFVGSMLKIMASDVTSYTLDLFDFLIQHSKTQPVLENLKYCNDLVEKLRKGVP
                     LEEADLVEPDGANSKDKIGKPNELIVNHLKGHEELQKSSAQGSNRHLEISKSEPEVQV
                     PATQKTDGDTRDSADFASAAAGTDSLLSSNSTDLATLPTVLNASQLENDNASSSESFR
                     NLSDSRTENPDTAIAGIEDDQNSVNRAEIAFNTDYTSETTKQESTKIKAPQPVNSPNT
                     ESSTPSGQNLKYRKESTASERNGDDFADVEMDEDDEFLKTMENKIAVGSHELQSLADS
                     QSVELPGTQPAAAARTESESKIRFPIFNFSKLASTAAKDGTPVQLEHLPHKDVVTNTA
                     QPETITDELEKQGDLSRMEEAMSQEATASLRIHFPSKKARRLVSRLRALTIEDISNLT
                     HEEKRNLRIELLDFLMNLEHEK"
     gene            <440528..>441145
                     /locus_tag="HG536_0F02200"
                     /db_xref="GeneID:59327110"
     mRNA            <440528..>441145
                     /locus_tag="HG536_0F02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284673.1"
                     /db_xref="GeneID:59327110"
     CDS             440528..441145
                     /locus_tag="HG536_0F02200"
                     /inference="similar to AA sequence:RefSeq:NP_009823.2"
                     /note="ancestral locus Anc_1.338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140569.1"
                     /db_xref="GeneID:59327110"
                     /translation="MLEDSAAVYVTDLKLVLLGESSVGKSSIVTRYITGSFQKTNATI
                     GAAFTTKTLEFPGADGIRKKVNLEIWDTAGQERYRSMAPMYFRNTDIALVVFDVTKPE
                     SLRKAQSWIDELNSYFDQDRREEVLIKLVGNKMDLDHPPTTTIGELPLYLVSAKTGEG
                     IDELIEDLVRQVPMSKYKKVETSTESKNAVHLDLHRNTRMGSACC"
     gene            complement(<441183..>442682)
                     /locus_tag="HG536_0F02210"
                     /db_xref="GeneID:59327111"
     mRNA            complement(<441183..>442682)
                     /locus_tag="HG536_0F02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284674.1"
                     /db_xref="GeneID:59327111"
     CDS             complement(441183..442682)
                     /locus_tag="HG536_0F02210"
                     /inference="similar to AA sequence:RefSeq:NP_009822.4"
                     /note="ancestral locus Anc_1.339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140570.1"
                     /db_xref="GeneID:59327111"
                     /translation="MLSRFAASNGRSVASGVRLLSSASRLKAALGTKNQVLLSKHVED
                     VDPEMFKILEGERSRQKHSITLIPSENFTSKSVMDLLGSEMQNKYSEGYPGERYYGGN
                     QFIDKAESLCQKRALEVFGLDPEKWGVNVQALSGAPANLYTYSAVMETGDRLMGLDLP
                     HGGHLSHGYQLASGTKISYVSKYFQTMPYHVDPSTGLIDYDALSMTSKLFRPRVIVAG
                     TSAYSRILDYKRFRQIADGCGAYLMSDMAHISGLVAAGVTPSPFEFSDIVTTTTHKSL
                     RGPRGAMIFFRKGVRKVTKKGKTVMYDLEKKINFSVFPGHQGGPHNHTISALAVALKQ
                     ALTPEFKEYQQQVVDNARVFGEELMKRGFKLVSGGTDNHLILIDLSNHGIDGARLETI
                     LEKLNIAANKNTIPGDKSALFPSGLRVGTPAMTTRGFKTEEFAKVAEFIDTAVKMAIG
                     LKSQESPDCEDVRSKLANFKQLCEESEQVQNLANEVAAWVGKYPVPGEL"
     gene            <443198..>443491
                     /locus_tag="HG536_0F02220"
                     /db_xref="GeneID:59327112"
     mRNA            <443198..>443491
                     /locus_tag="HG536_0F02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284675.1"
                     /db_xref="GeneID:59327112"
     CDS             443198..443491
                     /locus_tag="HG536_0F02220"
                     /inference="similar to AA sequence:RefSeq:NP_009821.3"
                     /note="ancestral locus Anc_1.340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140571.1"
                     /db_xref="GeneID:59327112"
                     /translation="MSKLLKLGSITLVSTALATSYYFYAVDRDGYHYNRSVWKKVSDR
                     TRGLLDRKQDLERSSPHTTELREVIQRPVSETFKDLWNEQVREIVRWVYSLGN"
     gene            <443596..>444312
                     /locus_tag="HG536_0F02230"
                     /db_xref="GeneID:59327113"
     mRNA            <443596..>444312
                     /locus_tag="HG536_0F02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284676.1"
                     /db_xref="GeneID:59327113"
     CDS             443596..444312
                     /locus_tag="HG536_0F02230"
                     /inference="similar to AA sequence:RefSeq:NP_009820.1"
                     /note="ancestral locus Anc_1.341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140572.1"
                     /db_xref="GeneID:59327113"
                     /translation="MGMESQEGGRPDSLIDYGDAIDYWTAVPATVDGVLGGYGEGTVV
                     PTMDVLGSNHFLRKLKSRMVVEPGFRKIGADIGAGIGRVTKDMLSKHCDVVDLLEPVT
                     PFVEQMRSELQELKDQGKIGEIYAIGMQDWEPQEGKYWLIWCQWCVGHLPDDELVKFF
                     ERCKRALQPNGTIIVKENNTPTNNDDFDPQDSSVTRSDAKFKELFESADLKLIATDRQ
                     KGLPKELYPVRMYALKPKTT"
     gene            <445076..>447139
                     /locus_tag="HG536_0F02240"
                     /db_xref="GeneID:59327114"
     mRNA            <445076..>447139
                     /locus_tag="HG536_0F02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284677.1"
                     /db_xref="GeneID:59327114"
     CDS             445076..447139
                     /locus_tag="HG536_0F02240"
                     /inference="similar to AA sequence:RefSeq:NP_009819.1"
                     /note="ancestral locus Anc_1.342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140573.1"
                     /db_xref="GeneID:59327114"
                     /translation="MNRSSDLQEQIQMPTEALNEVVQATPDQNDNGTGPIEPKSLDQM
                     LESPEIKKVMDSDVAINALLSRLKQSLLTCEEFTKFIRKKHVYEEEHVEELAKQFKHF
                     FVDTSGGSSLKKKIHEVLEFDGKLAHVKRSYVLALGKMYEEMSALLFTMTKMRKSVKE
                     NSRRLEKEVSDAIHSAEKAQSRYNSLCQDWDKLRMADPTKTKLTLRGSKTTKEQEEDL
                     LRKIDNADMEYKQKVDHSDSLRNVFITKERPKIVSELKDLILEIDTAMSIQLQKYTIW
                     TENLILNSGVTVTPFEASKSMKAVASSVTNEVDLYNFLKRYNSSGKNGLSVNRNLIPV
                     KYKKHPSMSKGVNDSKKVTRSGPTFAVNPAKNSIPKRIISTHNDSPFTPSSSIVPVGT
                     ASTPSAFKASNTNFRGSFDSSTQRSNIDSQPHIANEQHVSAPNTDTTNGSRIKTLDPG
                     NRLPSLSTTVSMATAESDRPLSHIQTSNTMPPGTQNNFKTFGVPLEGLVEFEQDMVPA
                     IVRQCIYVVDKYGLDLEGIYRKSANVLDVSKLKEDIDRDPSNVAMISPPKNYSETDIY
                     LVGSLLKAFFAALPSSLLPVEIVPDIKTCLAISDEKTRKNYMHGLIYKLPDAQYWTLR
                     ALLFHLKRVAEHEPKNRMNLKALNIIWGPTIIPPDNDEPNNVNFQIGAMEVLLDVADQ
                     AFEAD"
     gene            complement(<447226..>449517)
                     /locus_tag="HG536_0F02250"
                     /db_xref="GeneID:59327115"
     mRNA            complement(<447226..>449517)
                     /locus_tag="HG536_0F02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284678.1"
                     /db_xref="GeneID:59327115"
     CDS             complement(447226..449517)
                     /locus_tag="HG536_0F02250"
                     /inference="similar to AA sequence:RefSeq:NP_012488.3"
                     /note="ancestral locus Anc_1.343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140574.1"
                     /db_xref="GeneID:59327115"
                     /translation="MFPDEQAQDDPLKQFLTEQVDKALEGAFELFDLKTLSVKDASAE
                     ERYFKAFHEHIELTIGELCKTSVLSLKINYRGGNYNSLASESRRLHLIWEALRHKVES
                     RIKFLVDNYLKGADVSPQRYLSLVESWAYVLTNCRNFVTRILPSLQYMTVNYPSVTKE
                     ATRKLQIFDYFMIYFMNLLKDKLAEDFETFLEAFLSEQRSRSSLDMKYLNCEMPLSLM
                     FRYKISVGHTSALHVRSFYLRSVELYAAETLHIPVNMHYRENLTKILVRNAIITGSIS
                     ASLVTQSNDIILQHTIMNKNTTRKLLELLKDNTEIVTSSGADSPASQLFGVILMSYGS
                     RSMMDELWSIFKTVISITLKSVESSPTSEKQLLDACKLLVIANQSKYLEKLAHDEVIK
                     NLKGTIGIMERYLKVCESAIRKFNQVTVDGTSEPSNSGSLALNLPLIMKLPSSFLKIY
                     SRSLFRRCIVHGLPAIETLTCPSSFEYHLFSLFEREYGASPEYDGLHTLKSELLRSAQ
                     IARNFNQTQAVPLLNPLVFERKSVPSVIHENLVDDLILPPEMRHWWTRFQRFYYLIDA
                     KAPHKKLQLIDSLQHCEVQTQIQLANGAELILDLTLYQTCILTLFNDNDALSLEEMST
                     RSNISIDLLSEVVESFTRIGLFTSQNSLIILNENFSPDERKIKNGKLRVTMTTRGKSS
                     KEGSAEIVQHMEGLSSHWKQEMIKACIVRSLKGEKSGLKFDSIYAKVESQMFGISIGE
                     FKDALERTVLENSITHWRGLYKY"
     gene            complement(<449930..>451744)
                     /locus_tag="HG536_0F02260"
                     /db_xref="GeneID:59327116"
     mRNA            complement(<449930..>451744)
                     /locus_tag="HG536_0F02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284679.1"
                     /db_xref="GeneID:59327116"
     CDS             complement(449930..451744)
                     /locus_tag="HG536_0F02260"
                     /inference="similar to AA sequence:RefSeq:NP_009818.3"
                     /note="ancestral locus Anc_1.344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140575.1"
                     /db_xref="GeneID:59327116"
                     /translation="MLDLNEALIQYRERLRRLLYDKNCYCEREGHEVHRLAQFIISRS
                     TKTLGARLEWFGSVVREEFLLYSKLLVEERSAERQPWEDIATKLSNYNIRFHSICDHI
                     REIDRSIGYKFSKSLEFLLKHLMVRSLVEEKQELLECFKSACKCYVFNSEDCSSQISL
                     IYRSVRDFAVAINLSGDHESTFDHQALESFTNAALECFKEYLLSEHHFSDIYKAWIRV
                     SELNESIGYHDGHLSGIKLLFDENACHLMKSLEGILLSNDDLDALLSLRKDEEWFLEL
                     QGAYVKYREVKFSDDFERLLRSILLLNYADHCIDVPRLRNEFINGVKDVPRFHTTLIN
                     FLDISFKRNYNIIRKTVEEKPNDAQLLWALAASMLVERYTPNPQAFLQRYLKESLVPQ
                     LLMLHAKFPRYYNHKNCLQRLWIETLRERSLMEVEPYFSVIDEVLRSVKPDQTVHGSH
                     VKLARLYISESVRSRVFADHKCDDTPIWPSLRLKNQWDEEVQRFAKEKKSLKGLFSLH
                     TITMKSPFRLPSGQCLNILTNLTTASIISLFNNFESLNASDICRLLNTDQTADVVNSL
                     EKLEQCGIVKQETAKIYTINEQYKAPALAAKSGVIRCI"
     gene            <451878..>452273
                     /locus_tag="HG536_0F02270"
                     /db_xref="GeneID:59327117"
     mRNA            <451878..>452273
                     /locus_tag="HG536_0F02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284680.1"
                     /db_xref="GeneID:59327117"
     CDS             451878..452273
                     /locus_tag="HG536_0F02270"
                     /inference="similar to AA sequence:RefSeq:NP_009817.3"
                     /note="ancestral locus Anc_1.345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140576.1"
                     /db_xref="GeneID:59327117"
                     /translation="MAMNSNIDEAKKLADEFKREGYFDKLKQKILSQELNNGEAETTI
                     EQIIRHKVDTIVKGMVADDENLVFKNRGSTSALIESQLFKDNYKKLSEGNGALNVDEY
                     IQEQLNDKLLRSHIKEKLEALANNNESNE"
     gene            complement(<452278..>453111)
                     /locus_tag="HG536_0F02280"
                     /db_xref="GeneID:59327118"
     mRNA            complement(<452278..>453111)
                     /locus_tag="HG536_0F02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284681.1"
                     /db_xref="GeneID:59327118"
     CDS             complement(452278..453111)
                     /locus_tag="HG536_0F02280"
                     /inference="similar to AA sequence:RefSeq:NP_009816.1"
                     /note="ancestral locus Anc_1.346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140577.1"
                     /db_xref="GeneID:59327118"
                     /translation="MDRSQLFIKEHLLTKNFKNPEKPVKENRLQETLLLLPTDGGLSS
                     RLKRSESLLKISADNLDGKAEQHHKHRDYKRINANSKVALKNYINTNKANAQRALHIA
                     HEKKLLERKILTEYLKNHETALWNALPHFKTFLPMHEKLWVGYMRDLLNIPAKISDSS
                     KLTINGQAALMKLSMADYNGAFLKVASSRNRNLIGIEGIVIWDSQKNFIMVTRGKLID
                     ELKIIPKKGTVFNFEIPVNEHDALLYTILGDRFKYRSNDRAGRKFKSRRCDDMLHYLT
                     T"
     gene            <453494..>454726
                     /locus_tag="HG536_0F02290"
                     /db_xref="GeneID:59327119"
     mRNA            <453494..>454726
                     /locus_tag="HG536_0F02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284682.1"
                     /db_xref="GeneID:59327119"
     CDS             453494..454726
                     /locus_tag="HG536_0F02290"
                     /inference="similar to AA sequence:RefSeq:NP_012489.2"
                     /note="ancestral locus Anc_1.347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140578.1"
                     /db_xref="GeneID:59327119"
                     /translation="MLLVRNRLVPALRHQWSIGRRTLGQQASFDLEDGDEKYRELNQM
                     YVDMFTPKAADALSKAEGLEEKQKISDLNELNNDMNCLLNVGYPKLTAEELRKKVELP
                     GKFILQSLSNNPYFNLAVENYVFTNTPLSASPELSFANQRLLFYINRDSVVIGKNQTL
                     WKEVHLKTVQERGYEVLRRFSGGGTVVHDLGNVNYSFLTSREDFSREFFNRLIIAGVQ
                     RSAPDIALDLNNRGDIVLGDRKVSGSAYKIARGKAYHHGTMLIQSKLDQFRGLLKPES
                     IDGVTWNCNSVDSVRSQVQNVPLESVQQFIDMVVEEFRRVFCSDEVEDIPVFYCDEDV
                     TINGEIREYMTLLESDNWKYRKGPKFEIHLQSGNYSMTVERGIIVESSIPALLGWSFQ
                     SFIDGISDFKDVDEKLIT"
     gene            complement(<454777..>456702)
                     /locus_tag="HG536_0F02300"
                     /db_xref="GeneID:59327120"
     mRNA            complement(<454777..>456702)
                     /locus_tag="HG536_0F02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284683.1"
                     /db_xref="GeneID:59327120"
     CDS             complement(454777..456702)
                     /locus_tag="HG536_0F02300"
                     /inference="similar to AA sequence:RefSeq:NP_116685.1"
                     /note="ancestral locus Anc_1.348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140579.1"
                     /db_xref="GeneID:59327120"
                     /translation="MNVLNVLKELEQNLFLPKTLESCQLNEFSREYVCKVRYGIVDDC
                     SVLSCGCCLSNALYNDMILRTGQDQVRCPTCDCRDATIIGPVKQLRKLYQQIQNAYRK
                     LEQNDYGVESELESATDEDSAKGVTGEENSQKGTLGQGNQKSLLALFHMVASKLGSQP
                     GLPMNVTDSTRGRRRSGQRDGNECGLENDLEEMRVLDNASNTGTIPISQNSISASVKN
                     NFEALTRPISSDEEKEYYFAQCFPIYRKRSQFSTHAKFLRTKSKLFISMAISPDCTKF
                     VLITEHKWEVYSILPDKSPVLLFCGKSTGEYGPDFDHLAYPTDMSVLLVKGNNPLQKD
                     LWDHLHCKLSNDYLIISGSKNRFRVFDLNQQGLPIHSYGSSFPIRCIDINPNSNMIAC
                     GITGRDRNTGAEQALIVFHKIERNKVTSEPEFLSPSTITLPYRDPIKTLQFSDDGLYL
                     SCSTAFESRFLIISLRKFNEPRLIMKSLRSIDSSLESEGITDVKLFPGNPSLMCVTSA
                     AFNAPPIVVNTKIQDIDGVQRVAQPTMLIRLDELGSKIHKCEISPRNDSIAFLNRNGS
                     VYIMFSPTMMDSEKRRIVLVDMVADAYRAHESAALKFSADGHKLYILDRKGILYVEDF
                     SYGLPQEHEVTKCKQIT"
     gene            457006..457091
                     /locus_tag="HG536_0Ftrna2Y"
                     /db_xref="GeneID:59327379"
     tRNA            join(457006..457045,457055..457091)
                     /locus_tag="HG536_0Ftrna2Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:59327379"
     gene            <457427..>459013
                     /locus_tag="HG536_0F02310"
                     /db_xref="GeneID:59327121"
     mRNA            <457427..>459013
                     /locus_tag="HG536_0F02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284684.1"
                     /db_xref="GeneID:59327121"
     CDS             457427..459013
                     /locus_tag="HG536_0F02310"
                     /inference="similar to AA sequence:RefSeq:NP_116684.3"
                     /note="ancestral locus Anc_1.349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140580.1"
                     /db_xref="GeneID:59327121"
                     /translation="MRKSVYLDNTIEFLRGRVYLGAYDYSPQDTDEIVFFTVEDSIFY
                     NSFHLDFGPLNIGHLYRFAVIFHEILNDPDNANKAVIFYSSTSTRQRANSACMLCCYM
                     VLVQGWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGVWRAKERRLIDLH
                     SFNLETYERYEHVENGDLNLLTPDFIAFASPQEDSRLVGPNTVSSKSHLNQPFRSVLK
                     YFVNNNVHLVVRLNSHLYNAKHFEDVGIKHIDMIFEDGTCPDLSIVKNFVGAAETIIN
                     RGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMVVGPQQHWLYLH
                     QNDFREWKYTMKLSLVPDDIIGGLYPLISIEKYRAQKKKLKDHKKSQGSGQDDNEMVD
                     LAMTPPSVKKSSNNFRSLAVPQNSPGQPRKGQNGSNTIEDLNKKMTHTSVNPTAAFPG
                     RSDAVVDNNSDNEMQSENIEIDTSKKAGHKSSEPLLNDSADSGAILRQLLPKNRRIAS
                     GRRITSASGGVRKISGTAKK"
     gene            complement(<459068..>459856)
                     /locus_tag="HG536_0F02320"
                     /db_xref="GeneID:59327122"
     mRNA            complement(<459068..>459856)
                     /locus_tag="HG536_0F02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284685.1"
                     /db_xref="GeneID:59327122"
     CDS             complement(459068..459856)
                     /locus_tag="HG536_0F02320"
                     /inference="similar to AA sequence:RefSeq:NP_116683.1"
                     /note="ancestral locus Anc_1.350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140581.1"
                     /db_xref="GeneID:59327122"
                     /translation="MAAKSRSTIRSRSAGTKGGKLVQSRLHIGPQKTSLIKCCQCEMT
                     YSPSALNDASAHRVYHDMHLKGRKWSSSWGTDVTSHQETVMLTPPSSSKSDSRFGQNE
                     RIVMIRAASAPEVKATMEIMNIVNDELNAPHDENEFWSLPGGQGKAFLYVKDNRAVGV
                     VTVEVLGPSRGRWMVYESKSIIEHVRPTFLLGISRIWVCRTERHKNIATRLVEAAREN
                     TIYGRSIDKRQIAWSQPTDSGGKLAFRYNGTRHKSGKILIPCYI"
     gene            <460487..>461491
                     /locus_tag="HG536_0F02330"
                     /db_xref="GeneID:59327123"
     mRNA            <460487..>461491
                     /locus_tag="HG536_0F02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284686.1"
                     /db_xref="GeneID:59327123"
     CDS             460487..461491
                     /locus_tag="HG536_0F02330"
                     /inference="similar to AA sequence:RefSeq:NP_116681.1"
                     /note="ancestral locus Anc_1.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140582.1"
                     /db_xref="GeneID:59327123"
                     /translation="MHSHHSHSGDYIAHGVDPLEAVTAQAVKMKFHTYCLTEHMPRFE
                     AKYLYPEEWNSKRDESAAIAKLQQDFQNFLDHAQRIKNRPNPSNTKFLIGVEVESCDL
                     NHIEYARRLVEENRGVIQFSVGSVHHINEIAIDFNQIEWDRALAASGNNLKTFLLAYF
                     DLQYKMLRNLQPLVVGHFDLYKLFLPQDLRVDLETGACGTSGTPVSGISLINQWKEVQ
                     AAVVRNLQYIEKYGGAIEINTSALRKKLPEPYPGKDVGLLVKRHCGGRFVLSDDAHGV
                     AQVGVCYDQALNYIVHELNLEKIYYLTEAADRQSVRLEAVPIDQFESDAFWRLYRAPK
                     "
     gene            complement(<461598..>463628)
                     /locus_tag="HG536_0F02340"
                     /db_xref="GeneID:59327124"
     mRNA            complement(<461598..>463628)
                     /locus_tag="HG536_0F02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284687.1"
                     /db_xref="GeneID:59327124"
     CDS             complement(461598..463628)
                     /locus_tag="HG536_0F02340"
                     /inference="similar to AA sequence:RefSeq:NP_011884.1"
                     /note="ancestral locus Anc_1.352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140583.1"
                     /db_xref="GeneID:59327124"
                     /translation="MCVEEAFSKLCLSEKGSDDAIGVKSLVFKPKTAKSAVPVPIVVV
                     ALQSTTTPSPLVAQATSLKDPRLARDELFQSFFKCNSAKEFSVAYLANAESPFHLLVD
                     RQLEALDESAMLQLNEAAFIQKSELVAYLGKFESQKQCVDFGQEVAKPDAKKKQEAAA
                     GAASAALEDAKLIGITVDKALDFPGWYQQILTKGEMLDYYDVSGCYILRPASYAIWEQ
                     IQQWFDSKIKALGVQNAYFPMFVSSRVLEREKDHIEGFAPEVAWVTKAGSSDLEEPIA
                     IRPTSETVMYPYYAKWIRSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTA
                     HLTVEDAKQEVLDILDFYAGVYEELLAVPVVKGKKTEKEKFAGGDFTTTCEGYIPQTG
                     RGIQGATSHHLGQNFSKMFNVSVENPLGSDHPKLFVYQNSWGLSTRVIGVMVMIHSDN
                     KGLVIPPRVSQYQAVVIPVGITKKTTDAERSNIHASAKAIEDRLKKAGIRAFGDYNDN
                     YTPGWKFSQYELKGIPIRIELGPKDIEKSQVIVVRRNDSRKYTVQLNELETRIPEILE
                     ELQQDLFLKAKELFDTHRVIVEDWKDFVPNLNRKNVILSPWCGVMECEEDIKDSSAKK
                     DDGEELEQDEKSPSMGAKSLCIPFEQPELKQGQKCIKCSRPAIQYCMFGRSY"
     gene            <463919..>465586
                     /locus_tag="HG536_0F02350"
                     /db_xref="GeneID:59327125"
     mRNA            <463919..>465586
                     /locus_tag="HG536_0F02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284688.1"
                     /db_xref="GeneID:59327125"
     CDS             463919..465586
                     /locus_tag="HG536_0F02350"
                     /inference="similar to AA sequence:RefSeq:NP_011883.1"
                     /note="ancestral locus Anc_1.353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140584.1"
                     /db_xref="GeneID:59327125"
                     /translation="MSLYVKESVGVDEHGVPGSKEEPYKTAAFALFAFQQQNGEDAAE
                     PKLFVFKSEDNEYQEISASALKKARKGSSGLAKKAVKQKEEQARRQQQEADNAAKQIA
                     ALNIRIEEDKSLPEAQKFKIGQSYGHVGQRVKLYGWIHRLRANKKVVFVVLRDGTGFI
                     QCVMSGDLAAAQQTAELTLESSVALYGRVAKVPEGKSAPGGVELVVDYYEVIGVAPSG
                     DDSFTNRIAEGADPSLLLDQRHLALRGETISAVMKVRAALLRAVRRVYEEEQLVEVTP
                     PCMVQTQVEGGSTLFKLDYYGEEAYLTQSSQLYLETCLAALGDVYCVQESFRAEKSHT
                     RRHLSEYTHIEAELCFLSFDELLAHIEKLLVNAVQYVLEDPVAGPLVRQLNPGFQAPK
                     GPFMRLEYKDAIQWLNDHDIKNEQGEPFKFGDDIAEAAERKMTDTIGVPILLIRFPVE
                     IKSFYMKRCQDDPRVTESVDVLMPTVGEITGGSMRIEGTEELMQGFKREGIDPKAYYW
                     FIDQRKYGTCPHGGYGLGTERILAWLCNRFTVRDCSLYPRFSGRCKP"
     gene            <465813..>467210
                     /locus_tag="HG536_0F02360"
                     /db_xref="GeneID:59327126"
     mRNA            <465813..>467210
                     /locus_tag="HG536_0F02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284689.1"
                     /db_xref="GeneID:59327126"
     CDS             465813..467210
                     /locus_tag="HG536_0F02360"
                     /inference="similar to AA sequence:RefSeq:NP_011882.1"
                     /note="ancestral locus Anc_1.354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140585.1"
                     /db_xref="GeneID:59327126"
                     /translation="MSDNTQKLWGGRFTGETDPLMHLYNASLPYDYKMYKADLDGTKV
                     YTSGLQKLGLISEEELVKIHEGLDVIKKEWDEDKFVRHPNDEDIHTANERRLGEIIGR
                     GIAGKVHTGRSRNDQCVTDLRIYCRDYLNDKLFPGLKDLIDVMIRRGEREIDFLMPGY
                     THLQRAQPIRWSHWLSSYATYFTEDFKRLRQIQSRLNQSPLGAGALAGHPYGIDREYL
                     AQGLGFDGVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDLIIYSTAEFGFIKLS
                     DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLTGFLMSLKGIPSTYDKDMQEDKEAL
                     FDCLLTVEHSILIATGVISTLSVQKEKMQDALTMDMLATDLADYLVRKGVPFRETHHI
                     SGECVALAEKLNLSGIDKLTLEQYQKIDSRFDSDLFETFNFEQSVERRDATGGTAKSA
                     VLKQFASLKSQIDSI"
     gene            complement(<467203..>468345)
                     /locus_tag="HG536_0F02370"
                     /db_xref="GeneID:59327127"
     mRNA            complement(<467203..>468345)
                     /locus_tag="HG536_0F02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284690.1"
                     /db_xref="GeneID:59327127"
     CDS             complement(467203..468345)
                     /locus_tag="HG536_0F02370"
                     /inference="similar to AA sequence:RefSeq:NP_011881.1"
                     /note="ancestral locus Anc_1.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140586.1"
                     /db_xref="GeneID:59327127"
                     /translation="MSSRDQDFVDGLFSAGHSLFSKGSRVMYAVAERVASKVREVQDR
                     EGGDLSALKADSGAIGRWSYVKQVFLSARGQQKRAIFGLGVAAGALVLFWQARALWSV
                     PPRLAASQAKCVLVFGDMRDPIVRSQVMDLYRRGFMVFLCSTNAKAFRERQEDDDFLR
                     HIDPHSASDLASFIQFLEKTSDVQCQLASILFMPNLAYYPPGEVPLSRLECELRSNVL
                     VYYNALLEVVRRIQGPAIQVILFNPSLSFNLAVSQHPAELFVSALMTGVHQSLKRHHR
                     LNAYMIHVGALKLGAQPSNYKYLGFNGSNINEELLRPVYNLIMTHSGNIIQRSWLWLT
                     TLGSLRCDYYYGKYSRLSTIPFISRFINGRPWSSATGPRDSAAAFR"
     gene            <468876..>469916
                     /locus_tag="HG536_0F02380"
                     /db_xref="GeneID:59327128"
     mRNA            <468876..>469916
                     /locus_tag="HG536_0F02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284691.1"
                     /db_xref="GeneID:59327128"
     CDS             468876..469916
                     /locus_tag="HG536_0F02380"
                     /inference="similar to AA sequence:RefSeq:NP_011880.1"
                     /note="ancestral locus Anc_1.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140587.1"
                     /db_xref="GeneID:59327128"
                     /translation="MAGAGAGGMVGVELTDFVFILNSAAAVKSFSEFGTVTLGGNISV
                     SAGPLGRNAEAAASASAGGVSSVFAYSKSKGLFAGVSVEGSVIVERREANRKFYGDSC
                     TAKMILSGRIRPPPAADPLFRVLESRAFNYRSAMPADDYDDYYDDIPDSFDSSDVSST
                     RPTTKSTRQRRSGSRSYFDDDDFDDDHDSDGNGYSGRRGSRGRESYDDDFSDPSGANE
                     YYRSYRRQGARSPRHTNTRWEDDVFDRDNDVDDLSNRFSKSRISSSAAGNARVSRPVS
                     EKPDFGSLSSSNTPKAVALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGR
                     EGIFPANYVELV"
     gene            complement(<470153..>472003)
                     /locus_tag="HG536_0F02390"
                     /db_xref="GeneID:59327129"
     mRNA            complement(<470153..>472003)
                     /locus_tag="HG536_0F02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284692.1"
                     /db_xref="GeneID:59327129"
     CDS             complement(470153..472003)
                     /locus_tag="HG536_0F02390"
                     /inference="similar to AA sequence:RefSeq:NP_116678.1"
                     /note="ancestral locus Anc_1.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140588.1"
                     /db_xref="GeneID:59327129"
                     /translation="MINPFTSREVNILNNVPLNIDKKQEILQKSNGKVGAVLEAIEEN
                     QRNKEEQSTASSRSSQSELSDVVKLNCTNANIDAAPGTKVHNSATLESKSMVALFIGD
                     LDPTVTEDTLRHIFGKFKSLTSVKLCLDSVTKSSLGYGYLNFADKGDAEKATEEFNYR
                     PIKGKEVRIMPSLRNSFYRKNVGTNVFFSNLPLEDSKLTTRVFYDTFKKYGKILSCKL
                     DKRKDIGFIYFDNDQSARKVIRDYNGQNFFGNRILCGIHFDKDFRKYPEFERRISKLD
                     SITLRMEELTTESCEKIVEHNSGSQVPHPNAVFVKNLPIDCTNDEILEYFSKIGPVKS
                     VFSSKAPKFNSLWAFVTYKKGSDTQKAIQYFNDKTFRNKRLNVSKAVAREGRNHQTYN
                     YKGYKTTIQIDDVSPILNEEFLTQMCMQERIKVHKLQMTSFDGNALTYSGYIKCKTKT
                     DAARLFELLNNRLIGGSVVKCSWKRYDDNTTSSDVGFKAPSFPQAQVLPFPLCPPLYY
                     PMKEGPPTYLQQQMPVNPNAHIYNEQQRAQILDYLKRQVRKGIDFLQYPSATKGENLS
                     CITDYIFDVYWRGDIDSLTKFMLLMNTNTQHEGILQKQIKEAANFLGFGR"
     gene            complement(<472540..>474642)
                     /locus_tag="HG536_0F02400"
                     /db_xref="GeneID:59327130"
     mRNA            complement(<472540..>474642)
                     /locus_tag="HG536_0F02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284693.1"
                     /db_xref="GeneID:59327130"
     CDS             complement(472540..474642)
                     /locus_tag="HG536_0F02400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140589.1"
                     /db_xref="GeneID:59327130"
                     /translation="MFQMPLRFHNARILARMASQRPYSASSRLCLSTQVSRINHRRGF
                     SMSRSLLNVKEKALAAPENSSVSKSEIPTFFSHGFGKLLKWSIVSTGAIVTICGSALV
                     IFFIYDSTTYKECEVPETIEVPTLAINPEVGGPENLPILKESLDTYDSEIKQTISYKP
                     KLVILGSGWASVGLLKNLRKGDYDVTVISPQNYFLFTPLLPSAATGTLEVKSLMASIR
                     KIVGAVSGHYLEARADKIEFEHKLVKVSQVLPHSGEVRSFYVPYDKLVVAVGSTSNTH
                     GVEGLQYCDRLKSAEDALDIKRKIKNNLELACLPTTSDEERKKLLSFVVCGGGPTGVE
                     FAAEVFDLLNEDLPKLYPKILRQQVSVHIIQSRSNILNTYDEKISEYAMERFRKESID
                     LLTNARVDRILPDKVIFNQKNPQTGEIERKELPFGLCLWSTGVAQNPLAKQVVTAFSA
                     NQRNKRAIETDSHLRVLGNEAKDVYAIGDCSTLRTDLAAHAAEYVRKYIIQKNLRSAN
                     NTCDLFSNDEIKKLSLTYEEIADLARQLSKRHPQTREGFLTLDENLPKYDPENKGSLN
                     FEQITLLLKDIESGLTSLPATAQRAHQQGSYLGKKFTRLARITDDHFRKDQMIEADLD
                     ESSCKPFKYIHLGSLAYVGNSAVFDLPGYSFVGGLIAMYLWRGVYFAQTVSLRTRVLL
                     FMDWLKRGLFGRDIMTTV"
     gene            complement(474905..474976)
                     /locus_tag="HG536_0Ftrna5Q"
                     /db_xref="GeneID:59327383"
     tRNA            complement(474905..474976)
                     /locus_tag="HG536_0Ftrna5Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:59327383"
     gene            complement(475148..475220)
                     /locus_tag="HG536_0Ftrna9A"
                     /db_xref="GeneID:59327393"
     tRNA            complement(475148..475220)
                     /locus_tag="HG536_0Ftrna9A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:59327393"
     gene            <475349..>476008
                     /locus_tag="HG536_0F02410"
                     /db_xref="GeneID:59327131"
     mRNA            join(<475349..475368,475426..>476008)
                     /locus_tag="HG536_0F02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284694.1"
                     /db_xref="GeneID:59327131"
     CDS             join(475349..475368,475426..476008)
                     /locus_tag="HG536_0F02410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140590.1"
                     /db_xref="GeneID:59327131"
                     /translation="MSDEAALSAALSDLADCEEDVEKAEEDIELYRLKKLAPLYLHRD
                     EIIQKIPGFWRVVLSQHDEFADHIKASDFEYVDAIKSITVHWKTFQDYEIEFSFNAIE
                     GKLKDQTIRKHFLLKDEQLTSEPVDIGVPATAERKSFVDWFNWTGVSNAKEFPDGGEL
                     AALFSEDIYPYCVKYYTEAQRDVEDEESAGSSSEGELILD"
     gene            complement(<476115..>478373)
                     /locus_tag="HG536_0F02420"
                     /db_xref="GeneID:59327132"
     mRNA            complement(<476115..>478373)
                     /locus_tag="HG536_0F02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284695.1"
                     /db_xref="GeneID:59327132"
     CDS             complement(476115..478373)
                     /locus_tag="HG536_0F02420"
                     /inference="similar to AA sequence:RefSeq:NP_116677.3"
                     /note="ancestral locus Anc_1.358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140591.1"
                     /db_xref="GeneID:59327132"
                     /translation="MFPSSSKSKEPLLYDVRIKGTDHGVILLKGSTSEAPSVLLSGTI
                     VLSVQEPIQIKNLSLRLYGKIRLNIPTQYKTSKGMIQRYSKYERRIYEHVWDNFNVEN
                     YLQNLYDNYGRKTSIASKSSGNLSSLPRKARSSTASLISLAGQSSSHYHTLVKGNYEF
                     PFSAILPGSIPESVEGLPNASVVYKLEATIERNKFYTDLICRKHLRVVRTLAPDALEL
                     SETVAVDNTWPKKVEYSISIPEKAIAIGSATPIHILIIPLLKGLKLGPIKIQMVEHYQ
                     YCGTFGSVTSQERTVNKMRIKDPLNHMNEDENDTRGANDEDFEFQDRWEVDTTFHIPA
                     SLSKCTQDCTLLNSIKVRHKVKFVISLVNPDGHVSELRASLPVQLFISPFVALGVRSS
                     DGAFSSAGSSSTDISGLAHNQKGKSNEENDSDDEVIFARSASELEVPAMSNSASATAS
                     MSKLMSPPNYGNHIYDRLWNDVSIGDTPPMSGAQTPSEDFREGSVLDNDHNFSELQMN
                     LRRLRLEREYGGSTTSILVTAPVEESSSADANNGLLAQPIAANGFPNAGDPMRDSNSP
                     LLTPNSLQLATEDPSVQQGALSPLNKEWEIGTLSRVPSYDKAMKSDIIGEDLPPLYPA
                     SSKSGSGAHNLERPQIVHHKSSPYFSNTSNVQRSSVGLGRSNNSSSTSLNFLPDNENS
                     DNAPNPSTSSNSTKGQTANRYFSFGMTPAGSDNGSSTSLHIQRNSHKGALGGKSSSFS
                     NLVGLLSKKDKK"
     gene            complement(<478723..>480330)
                     /locus_tag="HG536_0F02430"
                     /db_xref="GeneID:59327133"
     mRNA            complement(<478723..>480330)
                     /locus_tag="HG536_0F02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284696.1"
                     /db_xref="GeneID:59327133"
     CDS             complement(478723..480330)
                     /locus_tag="HG536_0F02430"
                     /inference="similar to AA sequence:RefSeq:NP_444297.1"
                     /note="ancestral locus Anc_1.359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140592.1"
                     /db_xref="GeneID:59327133"
                     /translation="MPDSLPVVNLINFNQDGTCISIGTSVGFKIFNCEPFGKFYSEDS
                     GGYGMVEMLFSTSLLAIVGIGDQPAMSPRRLRIINTKKHSVICEVTFPTSILSVKMNR
                     SRLVVLLKEQIYIYDISNMRLLHTIDTNPNPQGIVAMSPSTENCYLVYPSPPKVINSE
                     IKQNVTTNNLNVTTGGNKLSDDVAQSVISQRAGGSSVDSNSIPVGNNILNSTKGGVMV
                     PDKAQTAKNEHNSIMKNGDVILFNLKTLQPTMVIEAHKGEIAALALSFDGSLLATASE
                     KGTIIRVFNVETGMKMYQFRRGTYPTRIHSMCFSSDNQFLAVTCSTKTIHIFKLRKDD
                     IITEGHETHESDNSLIEDNGSDAVSTATRNADVSNDNVEADPETEAALIEAESNNMIL
                     LEKSKEPYVDASRRTVARMIRKSSQKLSRQAAKTLEQLLPIKVSSLLEPSRHFASLKL
                     PIDNNAGVKSMTAIGELIDVDTSEYPELFELSDESSSVKSNKSASLVKMLPVRVITSD
                     GYLYNYVLDPERGGDCLLLSQYSLLLA"
     gene            480657..480756
                     /locus_tag="HG536_0Ftrna11S"
                     /db_xref="GeneID:59327372"
     tRNA            join(480657..480694,480711..480756)
                     /locus_tag="HG536_0Ftrna11S"
                     /product="tRNA-Ser"
                     /note="codon recognized: AGC"
                     /db_xref="GeneID:59327372"
     gene            complement(<480914..>487087)
                     /locus_tag="HG536_0F02440"
                     /db_xref="GeneID:59327134"
     mRNA            complement(<480914..>487087)
                     /locus_tag="HG536_0F02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284697.1"
                     /db_xref="GeneID:59327134"
     CDS             complement(480914..487087)
                     /locus_tag="HG536_0F02440"
                     /inference="similar to AA sequence:RefSeq:NP_116674.2"
                     /note="ancestral locus Anc_1.360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140593.1"
                     /db_xref="GeneID:59327134"
                     /translation="MKGAIDKPEFLATDALIPKTTTDLDTNPVMSDLSVPLQMNIGTE
                     QFSPNSNATIEQVRSESSTDIDELSQLEPVENKDTTAVSHEPNKTTLHRHSGPALAQG
                     RSLTFSLDSNARAKRSSIYESKSTVTAIPIRNPTNSMRQHYRDNEDALSMKSGSSSMT
                     ASLSRSFLFGFYHNRKKNQKNTKSVISKEYWMKDDSAKECFTCGKSFNTFRRRHHCRI
                     CGQIFCNSCTFSVSGERFGSDGTMRVCNHCYEHANNYEDSSDEESAVDQASHYRNSDD
                     RYIFAAHEKLPSQHLGDHECAAGDPVICSHNQDDIPFDDDADAQSVITTAEGDSRLLV
                     STPPPPPKMAIPATRQGESLEISFPVSNTLTDQWHHDSIMSSGHGLRDRYTIKDVDML
                     SSFDNNHAATRPSPSKSNGKPSKHSLRRSLFNYVGNNRPTLEKAATTGNANNIIGNVD
                     SKNYKFEFNYRKGAHRGSISSARRENPLQRQQSDSKESNSSPDDDTSEDEGSMSIYSA
                     LNDTMQSSNPIRSMRTSTKSFQRAEASLQRMRFRRKSKSKPNLTKSHSFHSGWDLFNN
                     STPNLISIVNEDKAFAPFSNEANTIQKPKGKIGLNGSWKRVSSPSIVTPEGKNELSEV
                     SSLHMEALLDQVLNDQNLDGKNEWKELLKEFFLKIQAIRLNARDSGTLDFRQNYVKIK
                     RIPGGNFESSEYINGIVFSKALPCKLMPRILDSPRILLIMFPLEYQRNENHFLSLKTV
                     MAQEKEYLDKLVARLTSLGPNVLLVGANVSGYAMELLTKEGVVVQFNLKPQVIERIAK
                     LTEADIAISVDKLAGNIKMGACERFEVKSFIYQNVSKTYTFIRGCNRELGGTVLLRGE
                     NEEILRKLKDVSEFMVYVVFSLKLESALFNDNFLKLSTNHYLEGRRAQQQEKLVGYFS
                     EFMEKFRGRILTTSPSVEFPIPFLLKRARELEQELIRKRKEFAKLGLDEETAKIFGAE
                     SQSLISTLTKKDCNYLVNFVHEKELSYLELQFQRKNRQWEVSYAQSRNMLGTGSHQCI
                     TLLYSMVSTKTATPCIGPQLVTIDYFWDSDISIGQFIENVVATAFYPCRQGCGGELID
                     HYRSYVHGSGKVDVLIEKFQARLPRLRDIIVTWSYCKKCGATTPILQVSEKTWNYSFG
                     KYLELMFWSKKESVAGIGKCIHDFATDHVKYFGFNGLVVRIDYSDLEVHELVTPPRKI
                     TWTPYKDIKMKVELYYQILDKINAFYDSVLSRLERVKLDSMSGDRLLAGQSAIEELKS
                     KVGEEKALIIQDLERLYRKEPGDQHIHLNFIIKTLHDRAVSWDSEFTDFGKRFLPSET
                     DITRITSRQLKKLFSDFKPEEDVGQQINTKKEIEKSDNSSCPNSNESPITGQDVEELR
                     AMLSAGDKPPLQDKPEDGAVSAAKVSDDEESAAVTNVSSDDHFNGNDAPLSVNKSFDK
                     GVVSNLINSRNVSTTSNSSSVGRRRSTSTKVGQLANFFDQMHFDALSKEFELQREKER
                     VQLNKNKYQALRLHTSTPIVEIYKNVKDAVNEPLHDLAKYKDSRIKDTTDKVTGNSNK
                     HKMQQKLESQLENSIHQWGEQVLQEDHEIPKHETPSIIVSTDGKEINTSEPLPPVTTS
                     TTANKDGSNNQPEKSLLMKALANFWADRSASLWKPLNYPTLPTEHIFVDNDVIIREDE
                     PSSLIAFCLNTSDYKQKMANLENMQQPTSAAPTEFSTDTSANGSESIGIEKELNISRD
                     SFSNSHAPSEVPVSMEPQTSKIPAQPTVSESGGKLESIMTKSTAVHLRYQFEDALTVM
                     SCKIFFAEHFDAFRRICGCHEKFIQSLSRCVKWDSSGGKSGSGFLKTLDDRFVIKELS
                     HSELDAFIKFTPSYFEYMAQAMFHDLPTALAKIFGFYQIQVKSSISGSKSYKMDVIIM
                     ENLFYERKISRIFDLKGSMRNRHVEQTGKENEVLLDENMVEYIYESPIYVREYDKKLL
                     RASLWNDTLFLAKMNVMDYSLVVGIDNEGHTLTVGIIDFIRTFTWDKKLENWVKEKGL
                     VGGSSSKKPTVVTPKQYKNRFREAMERYILMVPDPWYQGIF"
     gene            <487488..>488447
                     /locus_tag="HG536_0F02450"
                     /db_xref="GeneID:59327135"
     mRNA            <487488..>488447
                     /locus_tag="HG536_0F02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284698.1"
                     /db_xref="GeneID:59327135"
     CDS             487488..488447
                     /locus_tag="HG536_0F02450"
                     /inference="similar to AA sequence:RefSeq:NP_116673.1"
                     /note="ancestral locus Anc_1.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140594.1"
                     /db_xref="GeneID:59327135"
                     /translation="MLILLALVSAWIALAQELSFAEFHKNNLRNSLSVAEQSASNLLR
                     HFNGTRVPGSKESKEMQDFIKKYFRDVLNNDWSVETDSFEENGFNFTNLVFTPMHGES
                     YLVIAAHYDTKIDPPGFIGAMDSGASCAVLLYVAKFIDHILTVDKDLLEPLLLGSQVG
                     LKIVFFDGEEAINQWGPYDSIYGSKHLARKWEKLGILNSIDLFVLMDLLGSKEQQPVH
                     SYYRSSHRHYAALSQIEDWIGGTQTKWLDPAERKYVQLNDPIIDDDHRPFYEAGVSIL
                     HLIPFPFPATWHTLDDDFDNLDEGSIQKWALMMSQFVLDFLRY"
     gene            <488560..>490383
                     /locus_tag="HG536_0F02460"
                     /db_xref="GeneID:59327136"
     mRNA            <488560..>490383
                     /locus_tag="HG536_0F02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284699.1"
                     /db_xref="GeneID:59327136"
     CDS             488560..490383
                     /locus_tag="HG536_0F02460"
                     /inference="similar to AA sequence:RefSeq:NP_014617.1"
                     /note="ancestral locus Anc_1.362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140595.1"
                     /db_xref="GeneID:59327136"
                     /translation="MLVKALVEQYLNATDNDLRYMVLRQDLTICEPVQDADLLVKKIL
                     LPVLLEETDPEIVELVSSQVYPQMTLKCIEKMNEAGTVLESQWFDGLIIEPLFEQIES
                     KRTSFIVQTIRNVFKVVEGDGKKVASSTERYMRRLIAQMKGKKGERRNTVLYWDTLDL
                     MISAYYDSVTRMSFEVLSDIFDMYEDRSDNTTNAALINSIKAATSSAVTKLLEREISD
                     GLLETISSVWWQFHSVASRLFEHRLIPSLHAKASEPLMLALQTIWNFRPFYQVPSVEH
                     SRPTLSDKAMAELQSAVAGLLNRASASDSNKEAPSSMQQELIIEDTEIDDEQQAYLDQ
                     LQADDDLQFDELDDDPSTSADEYNYEQITEKCSAILKSLHSDPPEPCSHGNLLPSLDD
                     VKVSALSTEKDIQDVSRTAWAVLETETALPALLLSVDVLGQILQNNLAEIDCSRTCES
                     LLLHMKQNKSFLQTIKVGNMTQTIDEGSTFRTMVYSTMLQIVTTRSVDYPVCCKVLIE
                     ALSRGVRDSDCTINQLSIRIIEALLQANYEAIRGIDPEWYNLTLLPRVAEIATKVSKK
                     LQSRSEGRQDRAQHPAATAETVIDIVDRLHCLFDRQYPAIA"
     gene            <490619..>491152
                     /locus_tag="HG536_0F02470"
                     /db_xref="GeneID:59327137"
     mRNA            <490619..>491152
                     /locus_tag="HG536_0F02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284700.1"
                     /db_xref="GeneID:59327137"
     CDS             490619..491152
                     /locus_tag="HG536_0F02470"
                     /inference="similar to AA sequence:RefSeq:NP_116672.1"
                     /note="ancestral locus Anc_1.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140596.1"
                     /db_xref="GeneID:59327137"
                     /translation="MSATHLNTTKNHRSYAQSTDFLNLEEPPAAKESPSGSQFCLADF
                     NDANDKICAGDSSYTRNYEQDLRQARLLNEDDTVARPPIGEPVRRRSTNYVDALREKA
                     RSQARKQDRAPSQDQPPVFKPSYTTGKQEIPSEAQEEYNERTEGSIPQLEHRKSSFEY
                     EDFKKDVYDRLNMFDKE"
     gene            <491371..>493347
                     /locus_tag="HG536_0F02480"
                     /db_xref="GeneID:59327138"
     mRNA            <491371..>493347
                     /locus_tag="HG536_0F02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284701.1"
                     /db_xref="GeneID:59327138"
     CDS             491371..493347
                     /locus_tag="HG536_0F02480"
                     /inference="similar to AA sequence:RefSeq:NP_014619.1"
                     /note="ancestral locus Anc_1.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140597.1"
                     /db_xref="GeneID:59327138"
                     /translation="MWRSMLCCHRATIRVVPTIARVPVRCYAKKLKKVPQLKPVPFVI
                     PNYISVSKLANLLNCRMEALLQDLKKLGFSNLSQGYILSREYVELILQEYNYRLPDSS
                     KEVTPENIYDALKTPANPRFLQKRPPVVTIMGHVDHGKTTIIDYLRKSSVVAQEHGGI
                     TQHIGSFQVITPVSKKKITFLDTPGHPVFLKMRQRGANITDIIVLVVSIEDSIMPQTV
                     EAIKHAKNSGNELIVAITKIDRISQPKQRERAIEKVTNDLIANGITVEKVGGDVQVIP
                     ISAKTGENMDLLEEAIILLADVMDIKAENSLKTMAEGWILESRVSKSVGNVATVLVKK
                     GVLQKGKILVCGNTYGKIKNIRNEGGEQLSKAFPSDAVEVLGWKQLPVAGDQVIEAKN
                     EATAKKFVSKRLSLLEIEKEGLTVEKLNEQRAIEASKKAQESNAANEDLEEEKEPSGP
                     KDICFIVKADVSGSAEAIVESIAHLGNDEVKCKIISSSVGIPNENDLKLAQITNSTIL
                     CFNLSSLPNEVINNKLGVDIKQYNVVYKLIEGVTEILTDNLTPIFEKKQIATVDIREI
                     FEFQLKKKTIKIAGCRVTNGKLNRNSVVQIQRGPTKEIIYDGPLSSLKQGKEDVMEIT
                     KANECGITFDRNFEGYQIGDKIMVYEEVKVPRYL"
     gene            complement(<493458..>494687)
                     /locus_tag="HG536_0F02490"
                     /db_xref="GeneID:59327139"
     mRNA            complement(<493458..>494687)
                     /locus_tag="HG536_0F02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284702.1"
                     /db_xref="GeneID:59327139"
     CDS             complement(493458..494687)
                     /locus_tag="HG536_0F02490"
                     /inference="similar to AA sequence:RefSeq:NP_014620.1"
                     /note="ancestral locus Anc_1.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140598.1"
                     /db_xref="GeneID:59327139"
                     /translation="MPQSEDFSASASEFEEDYGTGNGSAVYIALVDAPLKENEDVSIE
                     DSFIGGKPVWLHPESLPSDNLLECGACKSKDNMKLLLQAFCPLDIDQVQKVQATYGVE
                     SMEHISADDDRVLYVFLCTRCQRKANSVRCIRGVKKNTKKSAPEKLSEKMEKLSFQKD
                     FKINPFDLSNDEGSNPFSSNPFQSGGSGSNPFSNSLNAAKASEEKSANELSLKATRKL
                     HDSKADKTFDEAEAFKSFLLYVEEESFKNKKPDHLKLPKNLKIDKEALDLTGEDESSL
                     DKDPIKLDPRTEKLSKFLDDDVFQKFQEVVGYNPHQVLRYDFGGKPLLYAQSKVDFEK
                     TVANPAYNPSSRRVFEMQLMPKMIMDLESDASLSDGMEWGTILVFSDVQNYTPEFDAN
                     GVGYVEEVVKVQWESRN"
     gene            494874..494944
                     /locus_tag="HG536_0Ftrna12G"
                     /db_xref="GeneID:59327373"
     tRNA            494874..494944
                     /locus_tag="HG536_0Ftrna12G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59327373"
     gene            <495078..>497339
                     /locus_tag="HG536_0F02500"
                     /db_xref="GeneID:59327140"
     mRNA            <495078..>497339
                     /locus_tag="HG536_0F02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284703.1"
                     /db_xref="GeneID:59327140"
     CDS             495078..497339
                     /locus_tag="HG536_0F02500"
                     /inference="similar to AA sequence:RefSeq:NP_116664.1"
                     /note="ancestral locus Anc_1.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140599.1"
                     /db_xref="GeneID:59327140"
                     /translation="MSTSIGSQVRRVATSVDPIVADYAVGYFNHLSSITFDAVQSKVI
                     DLPSEVSFVSSLLVDAGAPKEKVEELSNDLLEKLTIQLKENQAKLEVTGDTSKRLLDI
                     NVLQTHNSKANINTSLNMLGVNNDIEHTGRKMDTRVDLKKLAKAEQKIAKKVAKRNNK
                     FVKYEASKLIDQKKEEDYDSFFLKINPLDFGSAAGKSKDIHIDTFDLYVGDGQRILSD
                     AQLTLSFGRRYGLVGQNGIGKSTLLRALARRELNVPKHISILHVEQELRGDENTALQS
                     VLDADVWRKQLLGEEAKINERIQEIEKLRTEFEEESLEVKKLDNEREDLENHLNQISE
                     KLVDMESDKAEARAASILFGLGFSAEAQGKATNSFSGGWRMRLSLARALFCQPDLLLL
                     DEPSNMLDVPSIAYLSEYLKTYPATVLVVSHDRAFLNEVATDIIYQHNERLDYYRGQD
                     FDTFYATKEERRKNAQREYDNQMAYRKHMQEFIDKYRYNAAKSQEAQSRIKKLEKLPV
                     LEPPEQEKSINFKFPDCEKLSPPIIQLQDVSFGYNEHDLLLKDVNLDLQMDSRIALVG
                     ANGCGKTTLLKVMMEQLRPLKGYVSRNPRLRIAYFTQHHVDSMDLGTSAVDWMSKTFP
                     GKSDEEYRRHLGSFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHVLILDEPSNHL
                     DTNGIDALVDALKNFTGGVLMVSHDISVIDNVCNEIWVSENGTTRRFEGSIHDYKKYI
                     LESADNTGVVKRH"
     gene            complement(<497399..>500359)
                     /locus_tag="HG536_0F02510"
                     /db_xref="GeneID:59327141"
     mRNA            complement(<497399..>500359)
                     /locus_tag="HG536_0F02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284704.1"
                     /db_xref="GeneID:59327141"
     CDS             complement(497399..500359)
                     /locus_tag="HG536_0F02510"
                     /inference="similar to AA sequence:RefSeq:NP_014621.1"
                     /note="ancestral locus Anc_1.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140600.1"
                     /db_xref="GeneID:59327141"
                     /translation="MSVADLGHRKRLAEGLTVTQKVFVRSRNGGASKIVREHYLRNDI
                     PCLSRVCKVCPNVVVPDAKNELPQFVLSEEPLSLSNGPHYVVLDTNIVLQAIDLLENP
                     DCFYDVIVPQIVLDEVRNKSYPVYTRLRTLCRDSDDKKRFIVFHNEFSESTFVERLPS
                     ESINDRNDRAIRKTCQWYAEHLKEHNIHVILVSNDRLNREAASQDSFLTKSLYEYVEM
                     LPNAEDIKDSIPNFESSSDNTKDVEAKAEFTFPEYYSTARVMGGLKNGVLYQGNIQIS
                     EYNFLEGSVSLSTFSKPVLVVGQKNLNRAFNGDQVVVELLPKSEWKAPSSIALDSEHF
                     DVNDNADADEDVGAVISDKQRKLLAESAISAQKLNKVQPTARVVAIPRRSWRQFVGQI
                     APNSVDPHTGGTQNVFVILMDKCLPKVRIRTRRAKELLDKRIVISIDSWPAEHKYPLG
                     HFVRDLGEIESAEAETEALLLEHDVEYRPFSKKVLECLPPEGHDWKAPADLNDPAMIA
                     KDPLLPKRRDLRDKLICSIDPPGCVDIDDALHAKRLANGNWEVGVHIADVTHFVKPNT
                     ALDAEGASRGTSVYLVDKRIDMLPMLLGTDLCSLKPYVDRFAFSVIWELDADANIVNV
                     DFTKSVIKSREAFSYEQAQLRIDDPTQKDELTEGMRALLHLSIKLKQKRLDAGALNLA
                     SPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYEAFPQTAMLRRH
                     AAPPATNFEILNEMLQTRKGLSISIESSKALADSLDRCIDPNDPYFNTLVRIMSTRCM
                     MAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRFCDVVAHRQLAAAIGYEPLDLMH
                     RDKNKMEMICRNINKRHRNAQFAGRASIEYYVGQVMRNNETVETGYVIKVLNNGIVVL
                     VPRFGVEGLIRLENLTTDPNSAEFDEVNFKLSFKQNETEKQKEIYVFDKVEVQLRSVL
                     DPVTSKRKAELLLK"
     gene            complement(<501152..>502225)
                     /locus_tag="HG536_0F02520"
                     /db_xref="GeneID:59327142"
     mRNA            complement(<501152..>502225)
                     /locus_tag="HG536_0F02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284705.1"
                     /db_xref="GeneID:59327142"
     CDS             complement(501152..502225)
                     /locus_tag="HG536_0F02520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140601.1"
                     /db_xref="GeneID:59327142"
                     /translation="MGNAKNSDSLQKSLVYDYLNTIKPSGHQMFGKVRFIRCGNYVLN
                     LVFGRIVKSLREDRLFAEAFSKVTRLEKIMRRSTAVNASLKEHDLPLIPYESQTIWIY
                     TWRQVTVFFQNYPAYWEWFKALDTKSHTHIINRVQSVIGFDEKTIQMLTYFVECCDIF
                     TELDSAFQNDEFNNLPQAVPLYYILGHYYKLCLSAFAGNHIPNISGIDFSYFNGRECL
                     SLDDKRIVLQAIKDSYSCYQDHLCDLEVNPLFYVAVLLDPTAKQDKLREVMEADELTV
                     RISEVNSFMRNYLKVQRFSCATEQERRKIPKAPSNENLLSFNIRVAPDPSKHTRLAAE
                     AEYNDASSEEWERYQRACNRRKL"
     gene            complement(<504129..>504584)
                     /locus_tag="HG536_0F02530"
                     /db_xref="GeneID:59327143"
     mRNA            complement(<504129..>504584)
                     /locus_tag="HG536_0F02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284706.1"
                     /db_xref="GeneID:59327143"
     CDS             complement(504129..504584)
                     /locus_tag="HG536_0F02530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140602.1"
                     /db_xref="GeneID:59327143"
                     /translation="MLSIHRLAILYLHLVVLVQSRVLVAPADDSIDSGPNADELHAVD
                     MAMQDLLKKHNDFIEKHIGRVELTNFRAKSQSTKDHQFKGLRKPQSQSQSDLKNDLRF
                     HMTPITMKDVSYLKQRLRHKFRDFMMNAPDMEDKRGTNMKSLLLFYSNE"
     gene            <506357..>507910
                     /locus_tag="HG536_0F02540"
                     /db_xref="GeneID:59327144"
     mRNA            join(<506357..506372,506445..>507910)
                     /locus_tag="HG536_0F02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284707.1"
                     /db_xref="GeneID:59327144"
     CDS             join(506357..506372,506445..507910)
                     /locus_tag="HG536_0F02540"
                     /inference="similar to AA sequence:RefSeq:NP_116665.1"
                     /note="ancestral locus Anc_1.369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140603.1"
                     /db_xref="GeneID:59327144"
                     /translation="MSQLEFNIKHAGRVYPVKIAMDATAGALKGQVEQLIKVPISRQK
                     YMVKGGLSDDTATELSSIIKPGSTIMVLGTPDADLVSKPKQRSQFIEDLAPEQQLQHL
                     NELPIGFQNMGNTCYLNATLQALYRIEPLRDMILNYSQQSADNAADEGHKKIIIEMKR
                     CFENLKNKSYKAVMPMVLLTALRKCYPQFAERDPQSGFYKQQDAEELFTQLCQTMALI
                     FGNKFSEAFSIHFRTTIKDTANENDVTVKEDESDVKLQCHISGSTNFLKNGLMNSLHE
                     QIEKRSTITDVNSVYSVDKQITKLPKYLTVQFVRFFWKRSAGKKSKILRKVVFPFQLD
                     VAEMLTPEYAKEKIQVREDFRQIDKERLEKERDLKKRKIDDTANPTVMAPREKYETEM
                     ALAKSEQEHWIEEFKKKTPKDLQPGENPSCLYELIGVITHQGANSESGHYQSFIRDEM
                     DENKWYNFNDDKVSVVAKEKIESLAGGGESDSALILIYKGFGL"
     gene            complement(<507980..>508444)
                     /locus_tag="HG536_0F02550"
                     /db_xref="GeneID:59327145"
     mRNA            complement(<507980..>508444)
                     /locus_tag="HG536_0F02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284708.1"
                     /db_xref="GeneID:59327145"
     CDS             complement(507980..508444)
                     /locus_tag="HG536_0F02550"
                     /inference="similar to AA sequence:RefSeq:NP_116666.1"
                     /note="ancestral locus Anc_1.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140604.1"
                     /db_xref="GeneID:59327145"
                     /translation="MGSQPSKGGEVQVFQPQTQIDFSEALLAQLESSKESDYSRRQLA
                     ERYVEQRVSDRLSELEEDTLKKFENRLESSLLKGDSSDGEGSSLSSAALNEKIEQLNQ
                     KLGLFQERDDAQRAKYADGDARKALHKCLLENKGKPLNCYEEIEQFKKLVFS"
     gene            508740..508825
                     /locus_tag="HG536_0Ftrna3Y"
                     /db_xref="GeneID:59327381"
     tRNA            join(508740..508779,508789..508825)
                     /locus_tag="HG536_0Ftrna3Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:59327381"
     gene            <509211..>510638
                     /locus_tag="HG536_0F02560"
                     /db_xref="GeneID:59327146"
     mRNA            <509211..>510638
                     /locus_tag="HG536_0F02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284709.1"
                     /db_xref="GeneID:59327146"
     CDS             509211..510638
                     /locus_tag="HG536_0F02560"
                     /inference="similar to AA sequence:RefSeq:NP_116667.1"
                     /note="ancestral locus Anc_1.371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140605.1"
                     /db_xref="GeneID:59327146"
                     /translation="MLPRTRAVFTVICGFQFAAMAFLVIACITAPVFKQIGLSKYQGT
                     TYGVFGYCQSDKGCSKAAATYDPFEVGSGSNGDWTLGTTPRKRLGKILIVTPVAAGLN
                     FISLVSTLLAFAIGLLRDSTSGILFTLNLAMTALAFAASALVCVVTFLLFYPHVTWCS
                     WLLIPAAVLPLIAIPLVFVAHSSGRRAGHGESDDDLTGIVQHDAILDSEFDSPSRKNG
                     SYRELNNTSDSLLEKPLILPSYDNLHKQESVVRTDTDTTAHSTVEKDPYEIQAETKSQ
                     TAFSAINGPSGQVRPPVSLSMASSEYSNNYPQSQLQKEPRDVLEDIIKDSLSKDELAE
                     SHVRSVSDNGSDFTSISQRAARQQPAGPRPFPSQQQNMPPNVRSAGPDPTEMLLQNNP
                     NFLHPNTRRMQPPVHNQQPNHFPQHPHRPRHPNSYGGFQNSVPTPVAPSTSTHYKPAY
                     KRVGARNNMMPPASSMNGNNPYQFR"
     gene            complement(<510654..>511811)
                     /locus_tag="HG536_0F02570"
                     /db_xref="GeneID:59327147"
     mRNA            complement(<510654..>511811)
                     /locus_tag="HG536_0F02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284710.1"
                     /db_xref="GeneID:59327147"
     CDS             complement(510654..511811)
                     /locus_tag="HG536_0F02570"
                     /inference="similar to AA sequence:RefSeq:NP_014624.1"
                     /note="ancestral locus Anc_1.372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140606.1"
                     /db_xref="GeneID:59327147"
                     /translation="MNSAETNTFKRQRKSMMFRDRTNLFLSYRRTFPHNARFSIRSND
                     GKTNPFLDEVEDEEAFPMVDMSDANKGDVLPPRFVDLTQEVVDNLDQVERLMKQLNGL
                     YRKNSLPGFEDKSHDEKEIEQLSYQIIQLFQRCYNVIKKLQHIFDSQTMDGKRLQRGE
                     LIILDNMRKRYAQQIQSESNKFRVLQNNYLKFLNKDDLKPIFPKNDDPSQLLIEEEET
                     ATKGSQDIEAYSRQTLRRQMDNKQQTNQRFLQERDEEITQLAKGVLEVSTIFREMQNL
                     IIDQGTIVDRIDYNIENTVIHLKGANRELDKATHYQKRSQKCRLILLLSLCVIALFFI
                     VMLKPHSSGGNHSSSPATTSPGDSTTRPENMDPVGVTDDKLQKRFIDIVIK"
     gene            <512313..>514718
                     /locus_tag="HG536_0F02580"
                     /db_xref="GeneID:59327148"
     mRNA            <512313..>514718
                     /locus_tag="HG536_0F02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284711.1"
                     /db_xref="GeneID:59327148"
     CDS             512313..514718
                     /locus_tag="HG536_0F02580"
                     /inference="similar to AA sequence:RefSeq:NP_014772.1"
                     /note="ancestral locus Anc_5.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140607.1"
                     /db_xref="GeneID:59327148"
                     /translation="MNLIPGCELSGRSVFYLLSGEFDNKYGPTISCQYPRDIPGFGSV
                     SGDRDIDSASSLASLLIPTNAEHRTLSAPDSNVFTLFLNQHSRNYQLLPSFGMVTMET
                     DVKDPLRLNFVNVVKTLRDENNSRGAKIRSIALGTTLGNVEALKPFLTEALVHIMHAS
                     DVNEIKEVLMSCFQALNGLDLCTVETSLHKNPIQQTLCSVRRKSLLQRLLSDDTQLGR
                     DILKILDLGSGDKFGNKIELKKGKLLLHFKHSSVQSPFENLIQKPIEMSLFSYTASHI
                     KIGNLLVFRFLQKLIPALAKLSSSDYSFRIIVNSHKLPKEQICQFVVTLSQLMGCFSE
                     AEGTQYYDGANVLILPYAEVSMIKSIKEFFTTCDVANLFTIIGTANPIFRHHKYLWDY
                     YYDIDEDVLEASSDNVVNNQNSLWDSNLLKKLLPKSINDAASLHAVEFDRMGLLAAFV
                     SLINDLKPNEENILSTLRKINVLQIQSQLREFRVDETSLCSRYVTGFRDFVKFNHLFT
                     QESLTVIQQFSNLDHLISNLYDAAQSLRRRQELLSQLLDLLNEVISFIEKSQERLTIF
                     LSIALDYSPFQSLSEGNLIVRDFSTTNLRHEVAETLKKNKSWISVIDNSDTRGLFETF
                     AKERALDLLSMTLLLNSDIHKTRVTKSTNLDGASVDSLSISSSSSGNSNVETRRPRSM
                     SLKWIKSLHLHKSSDNFVEESTTPWLDTSSVSSSPGRFTSTKSSNAESMSSLSSISSS
                     SSRKVSYKSFRQKTENIKRLATEIILRIKSHPIGTFLINEEMSSFGQTLFQVSEVEFM
                     PSS"
     gene            complement(<514831..>516753)
                     /locus_tag="HG536_0F02590"
                     /db_xref="GeneID:59327149"
     mRNA            complement(<514831..>516753)
                     /locus_tag="HG536_0F02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284712.1"
                     /db_xref="GeneID:59327149"
     CDS             complement(514831..516753)
                     /locus_tag="HG536_0F02590"
                     /inference="similar to AA sequence:RefSeq:NP_010668.3"
                     /note="ancestral locus Anc_5.456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140608.1"
                     /db_xref="GeneID:59327149"
                     /translation="MTPVTHDLVHATQNAFGTGSLAAQIPFGLYVFKRLLSVGVKSIF
                     GVPGDYNLRLLEHMYDDSLRDSNGGTLEWVGCCNELNAAYAADGYSRYTNGIGSVITT
                     FGVGELGAISGLAGACSEDVKVLHIVGIVDYEISNQNPEMRLRNVHHLVPRLNDSNFV
                     GPDYRIYSEMVRDKIACSAEYLDDLSTACDKVDKVIEDIYKYSKPGYIFVPCTFVDQL
                     VSSRNLVERPTITLQDSVTKTSPDEARKLTNKILDLLYRSSTPAIVGDVFCDRYGLTK
                     ELNDFINRTGIVSFSSVMGKSVVDESSPLYMGLYSGKGHVGSVIEKFLSCDLVLHFGI
                     EKNEINYGNYSYTYKPDAKVVELHPAYVRFYDHLSKEEEIYRNVNFVDILRLLGEKIE
                     VPRLSLHYDSKFTPYNPDDLKLDEIDFGNDETSDITQVYLQKHLPGSLNPGDVLISDT
                     GSFQFSIRDFKLPSQVKYIAQSIYLSIGMALPAALGVAKGMKDYPNLHILDYGKIEPG
                     YQPRLILLEGDGAAQMTAQELSTIVRHQLPMEIFLWNNNGYTIERVIEGPTRAYNDIA
                     PWKWTKLLEVFGDFDGKLSRSSTLETRSQLLKKLSELKSRYSKNRKGIDFMEVRLATM
                     DVPSQLSGLVKDLMKR"
     gene            <517435..>519150
                     /locus_tag="HG536_0F02600"
                     /db_xref="GeneID:59327150"
     mRNA            <517435..>519150
                     /locus_tag="HG536_0F02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284713.1"
                     /db_xref="GeneID:59327150"
     CDS             517435..519150
                     /locus_tag="HG536_0F02600"
                     /inference="similar to AA sequence:RefSeq:NP_014771.3"
                     /note="ancestral locus Anc_5.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140609.1"
                     /db_xref="GeneID:59327150"
                     /translation="MDSRTIGILGGGQLGRMIVEAANRLNVKTVVLDAAGSPAKQINS
                     VGEHVDGSFTNPDDIEKIAAKCDVLTVEIEHVDVATLKGLQKKFPDLKIYPSPETIEL
                     IQDKYLQKEHLIKNKIAVTESVSVDTPSVNTLAGVGEKLGYPFMLKSKTLAYDGRGNF
                     IVKSEKTIPEALEFLKDRPLYAEKWAPFKKELAVMIVRSIDGRVFSYPTVETVHKDNI
                     CFVCYAPARVPDSIQLKAKLLAENAVRAFPGCGIFGVEMFYLENGELLINEIAPRPHN
                     SGHYTIDACVTSQFEAHVRAVLDLPMPKNFSSMATSTTNAIMLNILGDEKEKNRELQI
                     CKRALETPGASVYLYGKESRPKRKMGHVNVVTSSMEECERRMSYVVGKIKDLPKISAA
                     SKIDHEAEKIPLVGVIMGSDSDLPVMSAACDVLKQFEVPFEVTIVSAHRTPHRMSKYA
                     IEASQRGIKAIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSCLDGVDSLHSIVQMPRG
                     VPVATVAINNSTNAALLAIRLIGAFDASLHHKMQHFLLRQETDVLEKAAKLESEGYKK
                     YLDSK"
     gene            <519280..>519552
                     /locus_tag="HG536_0F02610"
                     /db_xref="GeneID:59327151"
     mRNA            <519280..>519552
                     /locus_tag="HG536_0F02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284714.1"
                     /db_xref="GeneID:59327151"
     CDS             519280..519552
                     /locus_tag="HG536_0F02610"
                     /inference="similar to AA sequence:RefSeq:NP_076888.3"
                     /note="ancestral locus Anc_5.454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140610.1"
                     /db_xref="GeneID:59327151"
                     /translation="MRDQIYMVTQNMVRRLSGLQKEVLHLYRACLRVAHTKPKANQAH
                     FVQYTRQEFGKYKDLPKKDFTTIEHLLRVGRKRMESYSRSELKDIH"
     gene            complement(<519660..>522788)
                     /locus_tag="HG536_0F02620"
                     /db_xref="GeneID:59327152"
     mRNA            complement(<519660..>522788)
                     /locus_tag="HG536_0F02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284715.1"
                     /db_xref="GeneID:59327152"
     CDS             complement(519660..522788)
                     /locus_tag="HG536_0F02620"
                     /inference="similar to AA sequence:RefSeq:NP_010667.1"
                     /note="ancestral locus Anc_5.453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140611.1"
                     /db_xref="GeneID:59327152"
                     /translation="MSSNAGMMVDADIGDAEGGNVCPTCVRCKKLITSGHAYELGDDR
                     WHTHCFSCYRCEKALSCHSDFLVLGTGTLICFDCSDCCKSCGKKIDNLAIILSSSNEA
                     YCSECFKCCKCGDNIKDLRYAKTKRGLFCIHCHEKLLAKRKYYEEKKRRLKKDLPEVP
                     AADHTIPLVIPEKSSRRPLSPTKGQGQFSQSPPKSMIKSNSGSVISQYLNENDAEKKN
                     EQEQETRQSKHSRNVSIDDILNSTLENDEHDLRVVQEPKLLLDKTPLRNHKATDSISR
                     SPMSHRQGMVLESDSPPADLAETVENSLTGLQGQIQLGGGSVKDNMQAAPILSRSDEA
                     FNEGHANTHGLAITLPSPELTVTAFKNEEDTLTLGLQENTPTTNSLPSPPSSPSPIKL
                     NEAASSVSKNTGPPDNTLIPPASGGNAAQETNTTHGRSGKKIGRSLSRKSKNLVHSLK
                     SKTTGILDPRSASPSNPSGDALSPPSSSGSVANTSPKTGSDTHSGWGVSAFEDNGISP
                     TSAVFSRHRTTPRGKSDSTLHSEQRPGNKIGKRSITEALDHRRAHSNASVSSVSTNVS
                     MFRTPPLENSSVFGRVSNSGSISHRRTISRQANNETVIEEPVGLDLANGGLMRTDAED
                     ESTFTKELAETELLLRKLKSEVNELESKRAHLVHEIDKLQSSKDKLCYEVERLVGEKS
                     KYASMESLNPTQRSNEMLRSQDGSSDAPAPAKLTETASVARPATKPRFWKIFSGARQQ
                     PWQAQPQQQQGTTTANGLAADTSVSSSSSFPSTGNAASSRLEISGPVLQNPNEFSDMK
                     LVPISNNSRSEVSMQSSPSRLEGSILYGSSLVARCNYEQSAIPIIIKTCVQHIENDDS
                     LLASEGIYRKSGSQLLIEEIERAFTDCERSPSNELLNLLNEDVHAVASVLKRYLRKLP
                     NPLLTFQIYEPLINVVRENRLMINVPLKAASDAGSNDPQYVAALNIITKILDNLPKEH
                     LDVLQYLAKHVDKVTSYNESNLMTLHNLSLVFAPGLIRDYSGDKDIPDMKERNYIVGF
                     IFGHYRDIFHVA"
     gene            <523251..>523499
                     /locus_tag="HG536_0F02630"
                     /db_xref="GeneID:59327153"
     mRNA            <523251..>523499
                     /locus_tag="HG536_0F02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284716.1"
                     /db_xref="GeneID:59327153"
     CDS             523251..523499
                     /locus_tag="HG536_0F02630"
                     /inference="similar to AA sequence:RefSeq:NP_010666.2"
                     /note="ancestral locus Anc_5.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140612.1"
                     /db_xref="GeneID:59327153"
                     /translation="MSSRGTSSVSSQFLSEIIGKPVNVKLHSGMLYNGRLESIDGFMN
                     VALSSATEHYESGHNGLLKTYNSDVFLRGTQVMYISEV"
     gene            complement(<523585..>523890)
                     /locus_tag="HG536_0F02640"
                     /db_xref="GeneID:59327154"
     mRNA            complement(<523585..>523890)
                     /locus_tag="HG536_0F02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284717.1"
                     /db_xref="GeneID:59327154"
     CDS             complement(523585..523890)
                     /locus_tag="HG536_0F02640"
                     /inference="similar to AA sequence:RefSeq:NP_010665.3"
                     /note="ancestral locus Anc_5.451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140613.1"
                     /db_xref="GeneID:59327154"
                     /translation="MIAKRALSTLIAPKVVSPKNLGAAPNAKRISNVVQFYKSLPQGQ
                     AAAVKPTGFIGRYKAKYFDGDNASGKPLWHLALSILVMGYSLEYYFHLRHHKGGAEH"
     gene            complement(<524105..>525589)
                     /locus_tag="HG536_0F02650"
                     /db_xref="GeneID:59327155"
     mRNA            complement(<524105..>525589)
                     /locus_tag="HG536_0F02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284718.1"
                     /db_xref="GeneID:59327155"
     CDS             complement(524105..525589)
                     /locus_tag="HG536_0F02650"
                     /inference="similar to AA sequence:RefSeq:NP_010664.3"
                     /note="ancestral locus Anc_5.450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140614.1"
                     /db_xref="GeneID:59327155"
                     /translation="MILRFLRYASTNCERRRISIVGSGPSGFYTAYRLLTKCEVPLHV
                     TMWEKLPVPFGLSRYGVAPDHPEVKNCEDTFTACAEEFSRPGQKHLFEFIGGVTVGEQ
                     VTLSELIDKQDAVVLSYGCTGDKKLGIPGENDTKGVFSSREFVNWYNGHPEYANDPRF
                     VNFDWSRVKNVGIIGNGNVALDLTRALISNQIGELWDGTDISPIALKCLRQAPVEHIR
                     LIARRDFDHSKFTNKELRELWELERYGIYGKIDPQYFREDAYDLRSIKDRAFRRRVEM
                     CSEYLKPFDQRTKKNYKKFAPQPSAQSPPKTWELDYLKTPVRINSDGSGYITSLTLCR
                     NSITEDNKICQLKDQQVTYNLDLLITSLGYAAKPLAEFQKLGIQFEKGRLANAAGRVL
                     DSHGATFPGLYASGWIRTGSAGVIASTMMGAFEVADSILQDLSSLPAKQTGRIDFSHL
                     RHTTWPDWRSINRKELQQGEQEGKTRVKFLSSEEMLSFHKQSPA"
     gene            <525902..>526615
                     /locus_tag="HG536_0F02660"
                     /db_xref="GeneID:59327156"
     mRNA            <525902..>526615
                     /locus_tag="HG536_0F02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284719.1"
                     /db_xref="GeneID:59327156"
     CDS             525902..526615
                     /locus_tag="HG536_0F02660"
                     /inference="similar to AA sequence:RefSeq:NP_014769.3"
                     /note="ancestral locus Anc_5.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140615.1"
                     /db_xref="GeneID:59327156"
                     /translation="MNYNKFLLFGDSLTEFAFNSWMEEGKPDQFVLGAALCNAYTRRM
                     DIVQRGFSGFNSRWGLKVLPGILESECGIVVSTIAFGSNDLCLGGHQKVPEEEFVSNI
                     KKMILLLKAKDIKPILVGPALIDQERFEASRQEEVQKGYVRTPERFKLYSELLHKVAD
                     EEDVPMVDLNVAFQREGGDKWQELLSDGLHYSGSGYKIFFDELMATIRKFYPEYAPEK
                     MQRKLPEWRNVLEDGSNVL"
     gene            <526741..>528102
                     /locus_tag="HG536_0F02670"
                     /db_xref="GeneID:59327157"
     mRNA            <526741..>528102
                     /locus_tag="HG536_0F02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284720.1"
                     /db_xref="GeneID:59327157"
     CDS             526741..528102
                     /locus_tag="HG536_0F02670"
                     /inference="similar to AA sequence:RefSeq:NP_010663.1"
                     /note="ancestral locus Anc_5.448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140616.1"
                     /db_xref="GeneID:59327157"
                     /translation="MDSAAPVDPSSTVNSAELSTIPNGGTEPDTLRGRFSSLIANAME
                     NNPYFAAGGGLMILGTGLAVARSGIIKASSLIYRQMIVDLEIQSKDKSYAWFLQWMSK
                     HPHRISKHLSVRTNYVQHDNGSVTTKFALVPGPGNHWIRYKGAFIRITRERSAKMIDL
                     TNGSPFEIVTLTTLYRDRFLFDEILNEAKNIALKSAEGKTVIYTSFGPEWRKFGQPKA
                     KRLLPSVILDKGIKEDILSDVHDFMRNGKWYSDRGIPYRRGYLLYGPPGSGKTSFIQA
                     LAGELDYNICILNLSEGNLTDDRLNHLMNNMPERSILLLEDIDAAFNHRTQSGETGFK
                     SSVTFSGLLNALDGVTSSEETITFMTTNHPEKLDPAIMRPGRIDYKVFVGNATPYQVE
                     KMFIKFYPGEEALCKKFVQATANLNVQISTAQLQGLFVMNKDRPKDALEMIDTLRHSS
                     HVI"
     gene            complement(<528099..>528326)
                     /locus_tag="HG536_0F02680"
                     /db_xref="GeneID:59327158"
     mRNA            complement(<528099..>528326)
                     /locus_tag="HG536_0F02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284721.1"
                     /db_xref="GeneID:59327158"
     CDS             complement(528099..528326)
                     /locus_tag="HG536_0F02680"
                     /inference="similar to AA sequence:RefSeq:NP_001032576.1"
                     /note="ancestral locus Anc_5.447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140617.1"
                     /db_xref="GeneID:59327158"
                     /translation="MVRHYIQDYVVRELRKSCAEEGEPNEAEELLLACLYQELLRKVL
                     KKAQREAQLDGLREINESHIENALESMLEEG"
     gene            <528535..>529368
                     /locus_tag="HG536_0F02690"
                     /db_xref="GeneID:59327159"
     mRNA            <528535..>529368
                     /locus_tag="HG536_0F02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284722.1"
                     /db_xref="GeneID:59327159"
     CDS             528535..529368
                     /locus_tag="HG536_0F02690"
                     /inference="similar to AA sequence:RefSeq:NP_010662.3"
                     /note="ancestral locus Anc_5.446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140618.1"
                     /db_xref="GeneID:59327159"
                     /translation="MQRTWRRSYDEMVPARTIEDSLKELEGFITSIHSGKTIPVDDLG
                     SPRELFPSSDSNYTTRTAIPRSSYFVNELPEFHSLVSSTGVTYHINRMSMAVKQKNGE
                     NGRKSCGKKSSAIIPPWIDVPEHSRFFVIKSSCLEHVKKSFYNGIWSSTHFGNKRLSE
                     AYASLAVGAKIFLFFSVNGSGRFCGVAEMTSDLESGLDTSIWGDTKRYGTAFKVRWII
                     VRDVQNRLLKRFLIPANEMKPVTNSRDTQEIPAAICKSILKLFKYDQSNVQSFLDHDY
                     S"
     gene            <529520..>530209
                     /locus_tag="HG536_0F02700"
                     /db_xref="GeneID:59327160"
     mRNA            <529520..>530209
                     /locus_tag="HG536_0F02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284723.1"
                     /db_xref="GeneID:59327160"
     CDS             529520..530209
                     /locus_tag="HG536_0F02700"
                     /inference="similar to AA sequence:RefSeq:NP_014768.2"
                     /note="ancestral locus Anc_5.445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140619.1"
                     /db_xref="GeneID:59327160"
                     /translation="MLRCSMEKLPSRRSFSVLSSLKTAGSVGKRSQEEAKYEPLSEAQ
                     EAYLDRAIRVDQAGELGANYIYAGQYFVLANKYPHLKPVLQHMWDQEIHHHETFNKLQ
                     SRNRVRPSLITPVWKVGAFFMGAGTAMISPQAAMACTEAVETVIGGHYNEQLRCLTNQ
                     FELNKSDKTSGTPKELKDLTNTIRQFRDDELEHLDTAIQHDSKKAVPYMLLTEGIKGI
                     CRVAIWTAERI"
     gene            complement(<530308..>530880)
                     /locus_tag="HG536_0F02710"
                     /db_xref="GeneID:59327161"
     mRNA            complement(<530308..>530880)
                     /locus_tag="HG536_0F02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284724.1"
                     /db_xref="GeneID:59327161"
     CDS             complement(530308..530880)
                     /locus_tag="HG536_0F02710"
                     /inference="similar to AA sequence:RefSeq:NP_010661.3"
                     /note="ancestral locus Anc_5.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140620.1"
                     /db_xref="GeneID:59327161"
                     /translation="MGAKASKLSKDDLTSLRQSTYFDRREIQQWHKGFLRDCPSGQLT
                     REDFVKIYKQFFPFGAPEEFANHVFSVFDKDNNGFVDFKEFITVLSTASRGTLEEKLV
                     WTFQLYDLNHDGYITFDEMLTIVTSIFKMMGSMVKLSDDEATPELRVKKIFSTMDKNE
                     DGYITLEDFREGSRVDPSIINSLNLYDGLI"
     gene            <531492..>535301
                     /locus_tag="HG536_0F02720"
                     /db_xref="GeneID:59327162"
     mRNA            <531492..>535301
                     /locus_tag="HG536_0F02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284725.1"
                     /db_xref="GeneID:59327162"
     CDS             531492..535301
                     /locus_tag="HG536_0F02720"
                     /inference="similar to AA sequence:RefSeq:NP_014767.3"
                     /note="ancestral locus Anc_5.443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140621.1"
                     /db_xref="GeneID:59327162"
                     /translation="MLQHDESDGKRYDELGSMDVMGLDMDKQDSVEPVAEPRSQEEEP
                     SDSLDRGSDLGNAMLYPNISTHFPFKTSERLVDDLVHDLAFINSQDHDILYSDLHNGI
                     LRAPVLLYSRRISQLHSYQLGTLVDQVTLQTKYEYASKSCPAHNKVNVFMGVLVNIPQ
                     DSKISSTAVTELPIYHLKVSVKTRSLLENTRKRAGITHYHLLDEAELHPFDRQDLLTF
                     DVSDPQLVDYAIYVTNDTNKLVLIEIFRPEFSAQEREECWSEDAIKRRYAESCSKYES
                     LDPSDIPTQIDCMNTFYKIFKGPLNRRNSDEPLKTINSDNVVLNSRINPDWLTSKYGF
                     KLHVDNDESTGESYPEFEPPDLTNYAEDEQVRRLRESFVRKCLELIFLGKMAIELYKK
                     DTQTSNSKVFRSFNMIQTAFGKTAWYQVLGEQKSAFSFEPASPLDSNYHFINLLTCFY
                     YVERDIIKNYETQCALDPENTGVYFDALSYVANRKGAYQLVAYCGKQDVVGQEALDQS
                     LRLFGIDPKEVVLSAINDALLLSIYKSEIARNTNENYHADLKNALRLLAKCKSSSKLK
                     FFADYEPYSNKLRGYEILEVDESVDDDIIETAYSIKVNDSPGLKIDCDRSLYTVATDK
                     RSLRLFNFLTQQCPEFEEYYGPTNLSYFEALNLLQLNENAKDETILEVFQRMWNQEPV
                     LESDHFLKLRSALAKIGLERNSRLILHFLSSGTIDASCLPADTWPAGLNNIGNTCYLN
                     SLLQYYFSIAPLRDYVLGYHGTMENYQQNSVNHLRRIGGREVSDSEVERSVQFLHQLR
                     ELFHSMIYSTERCVTPKKELAYLAFAPSSFEVEFELPSNSMDNQDSAENRVDEGLIYG
                     PHLPERAPDGLISLDSGGDKDLDLSMSQSLRKEDKDANEDISMTDTEKENIMTTSTRV
                     AKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLDEDNEQNDLIKQLFYGDI
                     KQTIIPLANETQTRTKIERFSSLLVNIGDHPKDIYDALDLYFSDERLTMAEYGEVKRT
                     VAATKFPRILQIHIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYSDSKDPNLLKIKKE
                     TEAMKSKLATLKRRQRELLSVNDLGLSRKAAFIETINYLKSDALQTPEASCSDEKKSA
                     IIRQLTQATTDIDNELTSLYHQISDLENKISKQFDEFQTIGYSLFAVFIHRGEASYGH
                     YWVYIKDRFKNGIWRKYNDETITEVPESEVLNFTEGNTATPYFLVYIQKGHEQDIEPL
                     KRIVDRT"
     gene            <535482..>536474
                     /locus_tag="HG536_0F02730"
                     /db_xref="GeneID:59327163"
     mRNA            <535482..>536474
                     /locus_tag="HG536_0F02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284726.1"
                     /db_xref="GeneID:59327163"
     CDS             535482..536474
                     /locus_tag="HG536_0F02730"
                     /inference="similar to AA sequence:RefSeq:NP_010660.1"
                     /note="ancestral locus Anc_5.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140622.1"
                     /db_xref="GeneID:59327163"
                     /translation="MSNLQRRRVNRADSEGDSSAQASEFIESTTSKKVAYDPEEAKIT
                     DNVKIPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCILIELALRGKIRIIDDSA
                     RKRFDVSERLIEVVDASKTGEVLLDEALQLMKYDDPLTIANWIDLLSGETWNLLKINY
                     QLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNM
                     ELNYNDYFPETTSFKFIRTIALICGAYRANVLENVLTSLDYEKRDRAIARADELLEQY
                     AQYPFALDKATESGLSINLSQEVKEEINENKNCALQLEVVAGVFEVFSRMDMLL"
     gene            complement(<536608..>538161)
                     /locus_tag="HG536_0F02740"
                     /db_xref="GeneID:59327164"
     mRNA            complement(<536608..>538161)
                     /locus_tag="HG536_0F02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284727.1"
                     /db_xref="GeneID:59327164"
     CDS             complement(536608..538161)
                     /locus_tag="HG536_0F02740"
                     /inference="similar to AA sequence:RefSeq:NP_010659.1"
                     /note="ancestral locus Anc_5.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140623.1"
                     /db_xref="GeneID:59327164"
                     /translation="MLWRPLIGNTLVVLLVLASVIIEMRLYKKVFRKAMERRVVEHVQ
                     SQEQRNQTSSVMSSSDDDSYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHVYYAFFLVD
                     GVSGAVKNGDVWSDTGMDLYKPLAVKMSKLDGDGDETRSLPKGCLGELFYLRHADLFP
                     DQRTRNFKLIMCVGGWSNRDEFPKMVRDPRRVEVFVSSCIDTMFKYGFDGMELDWEFP
                     EDDNCEPQAYLELTRRLREKMNELEAQIFGAAAGHPKFHLSVATPAFSGKLKILPIKE
                     MDQYVDIWNMMTYDYYGEWSEKTGYHSNLYDGSQSAQEAFERKHIYSSDDDEGLNGDS
                     AVQYMLKDAGIDSRKVCLGMAAYGRGFKHVDAKSSNGRFIDKKFRGVGGASEGEKGMW
                     LYNQLPIKGSQEVFDPEYGSAFCYDAKHKTFVGYDNVDSVRMKAQYVKDKNLAGGFWW
                     ESCGDDHNNPSRSLLNAFTDEIRSVRKSDTLMYRQNQVLRFYIDKFGPNGYLSPFVQR
                     ILQREESTA"
     gene            <538413..>539717
                     /locus_tag="HG536_0F02750"
                     /db_xref="GeneID:59327165"
     mRNA            <538413..>539717
                     /locus_tag="HG536_0F02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284728.1"
                     /db_xref="GeneID:59327165"
     CDS             538413..539717
                     /locus_tag="HG536_0F02750"
                     /inference="similar to AA sequence:RefSeq:NP_014766.1"
                     /note="ancestral locus Anc_5.440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140624.1"
                     /db_xref="GeneID:59327165"
                     /translation="MAEENEERVDGVEDGPVEAVEEPVKEGVDGKMDDLFGDEEQESG
                     PEESGDGEEKTEESESEGENDERPGRGGTETDDEEAEEQAMYTRKFYGEDADNASDEE
                     EAAHRFKEQDVELVRHIVPYKTVDDEKEGKSTIYYAKVPEYLTIDPVPFDPPSFKSKV
                     EQRLKSSSKEDQLGDRLIDENTIRWRYSRDENQQVYKESNAQIVQWSDGSFSLKLGAE
                     YTDILVNDTDNTFFAVSHDQQELMQCYQGGEITKSLMFIPTSTNSKMYQKLTKAVIRR
                     DQKQASGPGVYIVNRDPELEKSELEKKQQQVIRERRRRQLKETESRNSPDPSSGLGSY
                     RRNPVASENEQDAFYGSSRRNEYEQDDFLVDDDEEEEAPYSDENDVLDDNDEEIDAEE
                     ANAERLRQLKREGAEKYRDRESGSDFTTKRRKVAIIDDDDDE"
     gene            <539985..>540447
                     /locus_tag="HG536_0F02760"
                     /db_xref="GeneID:59327166"
     mRNA            join(<539985..539997,540080..>540447)
                     /locus_tag="HG536_0F02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284729.1"
                     /db_xref="GeneID:59327166"
     CDS             join(539985..539997,540080..540447)
                     /locus_tag="HG536_0F02760"
                     /inference="similar to AA sequence:RefSeq:NP_014765.3"
                     /note="ancestral locus Anc_5.439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140625.1"
                     /db_xref="GeneID:59327166"
                     /translation="MSWQAYTDNLLGTGKVDRAVIYSRAGDSVWASSGGLTLQAKEIQ
                     EIAQGFDNPSGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIGHYP
                     PSVQAGEATKIVEQLADYLISVQY"
     gene            complement(<540505..>540822)
                     /locus_tag="HG536_0F02770"
                     /db_xref="GeneID:59327167"
     mRNA            complement(<540505..>540822)
                     /locus_tag="HG536_0F02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284730.1"
                     /db_xref="GeneID:59327167"
     CDS             complement(540505..540822)
                     /locus_tag="HG536_0F02770"
                     /note="ancestral locus Anc_5.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140626.1"
                     /db_xref="GeneID:59327167"
                     /translation="MVEWCIIVYDKADRSKFRPAHLAGIPPLVEQGKLVCAGAIYNEP
                     KAPGEERTFAGSHLQVVADTKEEALEIVKGDIFAKEGVWDLDNIIIYQFGCGVRKEKK
                     LLI"
     gene            complement(<541127..>543610)
                     /locus_tag="HG536_0F02780"
                     /db_xref="GeneID:59327168"
     mRNA            complement(<541127..>543610)
                     /locus_tag="HG536_0F02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284731.1"
                     /db_xref="GeneID:59327168"
     CDS             complement(541127..543610)
                     /locus_tag="HG536_0F02780"
                     /inference="similar to AA sequence:RefSeq:NP_013456.1"
                     /note="ancestral locus Anc_4.185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140627.1"
                     /db_xref="GeneID:59327168"
                     /translation="MQRKAFVKDRTTGGKLKSMPDLAENASNSRVIPPEIVYQILTFQ
                     FRDLMSNDYPGNPEKFTENFRTFVRSNLTVNKTFYHVCRVLIYRYCNLTTARRFHNLL
                     EALRQNERVRNIVQVADFQELTSIGLGRSGEMNKMIKNLTNETLSEFLELTKSNLREF
                     LACEHIQDDLDANIVYQLLRPGTVLSVLDFCGCSGAKFTESCIAALERLYRYDELKQQ
                     YVTNEENYQVTCLGLNDCTDLPSPVLGRILQMLPELQKLDLGHTSIDDETLMNSLPHL
                     KNLTHLSLSMCLRLSPRGVLEFFSHHPALTDENNLKTLEWLNLYSMPHSSSWTSVHTM
                     FLLKKLCQFGHNKTLQYLNLGGMPFHESDDPSAFKSTYYYQCSDTLQFIKYNFPKLKC
                     LSIRGNNFPITKICDFLKPVSIQNFAGKNGQEIDEHDLPQVQQLKFLNISNNVHVNKW
                     TINDPGLFTSSQSLVALEVSFDAWQQVEKSNERHEIIALRYKNPDSIIKDTADAEIVK
                     WRCYIDSSYGRRYWLHRVDEYLNPADLEKKGNISKYDSNGNKIIEITKQPDFLKFAQS
                     KIMLGCGIVPLSAVRRKECYRDLNPPISHFFTRSGNATLGQAPTPILGPRLPPGGWRV
                     LHHNEEENGGTSDVIPEEDEEDDGDESTNDMRDSFASYENPELSPAYASDRIGSRNGL
                     YWDRSMQNLQLRSQEEPPAFSSPSRQSQLQLHQAPEGISEVEETDDEYLNDTSLQRRR
                     SQLSILGLAFSHPAVSQRCNDRASSGSLVIPLRKPKNYYQLHPQEFVFDTKSSETTKL
                     YRIHFELVSEYEVFGCIERGMYRYYGLKT"
     gene            complement(<543718..>544818)
                     /locus_tag="HG536_0F02790"
                     /db_xref="GeneID:59327169"
     mRNA            complement(<543718..>544818)
                     /locus_tag="HG536_0F02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284732.1"
                     /db_xref="GeneID:59327169"
     CDS             complement(543718..544818)
                     /locus_tag="HG536_0F02790"
                     /inference="similar to AA sequence:RefSeq:NP_011554.3"
                     /note="ancestral locus Anc_4.184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140628.1"
                     /db_xref="GeneID:59327169"
                     /translation="MPRTITFDIPSQYQLQALVGEGAYGTVCSAIHKPTGIRVAIKKI
                     QPFSKAMFVTRTLREIKLLRYFHDHENIISILDKIKPTTIDKMNAVYLVQELMETDLQ
                     RIINNRAASPLSDDHIQYFTYQILRALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDF
                     GLSRCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAIDIWSCGCILAELV
                     SGKPLFPGRDYHHQLWLILEVTGTPSYEDVECIKSTRAKEYIANLPTKHKMPWEIALG
                     RQHLDPQMVDLLDKMLTFNPNKRISAAEALSHPYLSTYHDPDDEPEYPPLDLEDEFWK
                     IDNEIKKPNDESETSMGELKQMLYDEIMKPLV"
     gene            <545392..>546510
                     /locus_tag="HG536_0F02800"
                     /db_xref="GeneID:59327170"
     mRNA            <545392..>546510
                     /locus_tag="HG536_0F02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284733.1"
                     /db_xref="GeneID:59327170"
     CDS             545392..546510
                     /locus_tag="HG536_0F02800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140629.1"
                     /db_xref="GeneID:59327170"
                     /translation="MSKSSRPQVTIVGAGIIGLYTAYVLTELQKIPGSEICVVAKYLP
                     GDQSASGYTSPWAGGNWSCISPNDEATLFYDKFTYENLARLQKALLTFFTGRDDEWLG
                     LSRRPSRELWDQVPNERKIDSLRSYLEDYRVLSEKELNEIRPTAPAFGITLKTWNFNC
                     PVFLFNFFQFLRDKHQVRFVKQELTHLAQAKCYVNPLCSGSDRHIIFNCTGLGARDLG
                     GVRDHKVYPTRGQVVVVRAPHINENCLRWGRDYATYIIPRPGKGKEVVLGGFLQVDNG
                     NAQDTSLSETEDILKRTLTLLPKIGRADELEIIRVAAGLRPSRYGGPRIEREVKGDDD
                     NLVFIHNYGASGYGYQGGLGMALKAVQLAFRQERSSRL"
     gene            <546663..>547523
                     /locus_tag="HG536_0F02810"
                     /db_xref="GeneID:59327171"
     mRNA            <546663..>547523
                     /locus_tag="HG536_0F02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284734.1"
                     /db_xref="GeneID:59327171"
     CDS             546663..547523
                     /locus_tag="HG536_0F02810"
                     /inference="similar to AA sequence:RefSeq:NP_013455.1"
                     /note="ancestral locus Anc_4.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140630.1"
                     /db_xref="GeneID:59327171"
                     /translation="MSKILSQKLKVALIQFIGSTADKSANLQKAAALVEKAVKDQPET
                     KLVVLPECFNSPYATDKFREYAEVIEEDSPSYKVLSNLASKLKIILVGGSIPELEPKT
                     NKIYNTSMVFDQNGALIATHRKAHLFDIDIPNGITFKESDSLTGGEKATTVETSYGKF
                     GLGICYDMRFPELAMISARQGSFAMIYPGAFNTVTGPLHWSLLARSRAIDNQVYTLLC
                     SPARNMNSDYHAYGHSMVVNPRGDVIAEAGEGEEIIYAELDPEEIETFRQGIPITKQR
                     RFDIYKDVSK"
     gene            548631..548712
                     /locus_tag="HG536_0Ftrna12S"
                     /db_xref="GeneID:59327374"
     tRNA            548631..548712
                     /locus_tag="HG536_0Ftrna12S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:59327374"
     gene            complement(<548831..>549481)
                     /locus_tag="HG536_0F02820"
                     /db_xref="GeneID:59327172"
     mRNA            complement(<548831..>549481)
                     /locus_tag="HG536_0F02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284735.1"
                     /db_xref="GeneID:59327172"
     CDS             complement(548831..549481)
                     /locus_tag="HG536_0F02820"
                     /inference="similar to AA sequence:RefSeq:NP_011552.1"
                     /note="ancestral locus Anc_4.182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140631.1"
                     /db_xref="GeneID:59327172"
                     /translation="MGSMGEPLSSQSSRDESLKPFPSNETSSNKPSIAEPHKDHRRRR
                     SSSIISHVEPETFEDENDQQLLPNMNATWVDQRGAWIIHIVVILLLKIFYDLLPGVST
                     EWSWTLTNMSYVIGSYVMFHLIKGTPFDFNGGAYDNLTMWEQINDETLYTPARKFLIM
                     VPIVLFLVSTHYSHYDLKLFSWNFLLTFVLAVVPKLPVTHRLRISIPGITGPAQIS"
     gene            <549924..>550187
                     /locus_tag="HG536_0F02830"
                     /db_xref="GeneID:59327173"
     mRNA            <549924..>550187
                     /locus_tag="HG536_0F02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284736.1"
                     /db_xref="GeneID:59327173"
     CDS             549924..550187
                     /locus_tag="HG536_0F02830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140632.1"
                     /db_xref="GeneID:59327173"
                     /translation="MVSQLFEEKAKAVNELPTKPDTDELLKLYALYKQATVGDNTKEK
                     PGIFNMKDRYKWDAWEALKGKSQEDAEKEYIELVDALIAKYSK"
     gene            <550494..>553082
                     /locus_tag="HG536_0F02840"
                     /db_xref="GeneID:59327174"
     mRNA            <550494..>553082
                     /locus_tag="HG536_0F02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284737.1"
                     /db_xref="GeneID:59327174"
     CDS             550494..553082
                     /locus_tag="HG536_0F02840"
                     /inference="similar to AA sequence:RefSeq:NP_013451.1"
                     /note="ancestral locus Anc_4.180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140633.1"
                     /db_xref="GeneID:59327174"
                     /translation="MSTTEVAQLLENTILSADQGVRIASETQLKKLSNENFLQYAGLL
                     SNVLIDSQARLEARILAALTLKNELISKDSVKNQQFVQRWLTAIDPASNEQIKLNALN
                     GLMTADEPRVANASAQLIAAIANIELPRGEWLDLMKTMVENTSPSQPENVKRASLLAL
                     GYICESADPQSQVLISSSNNILIAIVQGAQSSEPSTHVRLAALNALADSLVFIRNNME
                     REGERNYLMQVVCEATQAQDIDIQTAAFGCLCKIMSLYYPFMKPYMEQALYALTIATM
                     KSTNDKVASMAVEFWSTICEEEIDIAYELTQFPQSPLQSYNFALASLKEVVPELLNLL
                     ARQNEDLEDDDWNVSMSAGACLQLFAQNCGNHILEPVLQFVEQNITSENWRYREASVM
                     AFGSIMDGPDRTQRTYYIHQALPAILNLMNDSSVHVKETAAWCIGRIADLVVDSIDPQ
                     QHLPGVVQACLMGLQDHPKVATNCSWTLINLVEQLAEAKPSPIYTYYPPIVDSLIKAA
                     NRPNNEFNARASAFSALTTMVEYATDAVADISASISTFVMDKLGQTMSVDESQLGMED
                     RQSLQELQANILTVLAAVIRKSPSSVASVSDMLMDLFLKILDKKDSSYIEDDVFYAIS
                     ALASSLGKDFEKYLETFSPYLVRALNQVDSQVSITAVGFIADISNSLEEDFNKYATAF
                     MNVLGQMISTENTMKELKPAVLSVFGDIASNIGSNFTPYLNEVMALCVAAQNTKPENG
                     TLEALDYHIKILESVLDAYVGTVAGLHSNPEALFPYVGTIFQFISLISEDPQLYGEDS
                     TARSAVGLIGDIAAMYPDGSIKQFYAQEWIAEFIKKTRSNTSFSQSTKDTARWAREQQ
                     KHQMSL"
     gene            <553527..>554225
                     /locus_tag="HG536_0F02850"
                     /db_xref="GeneID:59327175"
     mRNA            <553527..>554225
                     /locus_tag="HG536_0F02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284738.1"
                     /db_xref="GeneID:59327175"
     CDS             553527..554225
                     /locus_tag="HG536_0F02850"
                     /inference="similar to AA sequence:RefSeq:NP_011550.3"
                     /note="ancestral locus Anc_4.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140634.1"
                     /db_xref="GeneID:59327175"
                     /translation="MASVASSFNPNLIPFDDTYILYDAKDPLSFLSAYFSLFPIAVLV
                     FQLSWFITTRELEACIIAAGQVANEIFNNILKILLKQPRPMSFGESFQNDTLRSNYGM
                     PSAHSQFMGFFCMYIGLRYCFRWKGLTRAKRLLGVIMVCFMASCVCFSRVYLRYHTLG
                     QVLVGFTVGLATGSTYFLLVGFLREWKIIDWVLSWNLAQILYVKDSCNLAPITLEEEY
                     HEYQRRLQKKSKRM"
     gene            <554682..>554993
                     /locus_tag="HG536_0F02860"
                     /db_xref="GeneID:59327176"
     mRNA            <554682..>554993
                     /locus_tag="HG536_0F02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284739.1"
                     /db_xref="GeneID:59327176"
     CDS             554682..554993
                     /locus_tag="HG536_0F02860"
                     /inference="similar to AA sequence:RefSeq:NP_011549.1"
                     /note="ancestral locus Anc_4.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140635.1"
                     /db_xref="GeneID:59327176"
                     /translation="MMREGTQTNITARSDEMTSRITTYIVSPIISVMYLGRGRQASTK
                     PNVITRNDLLRAAQEMPARRQASSHSFPAGGSGSSMGSGDRKLRSRKSHRKEHFESEA
                     A"
     gene            complement(<555117..>556748)
                     /locus_tag="HG536_0F02870"
                     /db_xref="GeneID:59327177"
     mRNA            complement(<555117..>556748)
                     /locus_tag="HG536_0F02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284740.1"
                     /db_xref="GeneID:59327177"
     CDS             complement(555117..556748)
                     /locus_tag="HG536_0F02870"
                     /inference="similar to AA sequence:RefSeq:NP_013449.1"
                     /note="ancestral locus Anc_4.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140636.1"
                     /db_xref="GeneID:59327177"
                     /translation="MAAILSDEEELVNGLGSELLIAPTGNHMARTGKRWSGSGGARLN
                     NLKKPTSDGVHDPVEEYISPGQLYSTESGRLFHAGRILIVLVGLPATAKTLLSVAITR
                     YTRWLGVRTKSFHVSEYRRKEGVEVPDDYFSALPSTKEGMETRRRIFSTVFDEMVKFF
                     MDSKGQLAIYDALNIRRSERKDLEGKFRALNIKVLFIESIMTDDDLVARGIVMASQSS
                     DYKGLSKEKARSAFMQRILVNRPLYEEIIPEEQLSYVKYINFGERLIVNNNRYGYLIN
                     KIVFFLMNLREKKGCVYFARCGTSDKDKYIDDELLNRDGLRYSKILTDLVLDRINSRR
                     LSRHGTPNSSAKGSTPIPEEIFSKMDSPTLIPTMATLQRTASRGNHRIKQVTSWDGAD
                     EDSFVVWTAPRKRTYDTAKFFMDKGISVRQRFQLQQLHPGVVADLTEEEIKERYPTEY
                     RESLKDRYHYRFPRAESYHDLAVRMEPLLLEMERMRGDILIIGHESTLKVLYGYLMAC
                     TCEELPDLNFPRDELIEISFSPFKNTAETIPIPTH"
     gene            complement(<557025..>557588)
                     /locus_tag="HG536_0F02880"
                     /db_xref="GeneID:59327178"
     mRNA            complement(join(<557025..557389,557570..>557588))
                     /locus_tag="HG536_0F02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284741.1"
                     /db_xref="GeneID:59327178"
     CDS             complement(join(557025..557389,557570..557588))
                     /locus_tag="HG536_0F02880"
                     /inference="similar to AA sequence:RefSeq:NP_011548.2"
                     /note="ancestral locus Anc_4.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140637.1"
                     /db_xref="GeneID:59327178"
                     /translation="MAKQSLDVSSDRRKARKAYFTAPSSERRVLLSAPLSKELRAQYG
                     IRSLPIRRDDEVLVTRGSNKGQEGKISSVYRLKFAIQVDKVTKEKSNGASVQLNLHPS
                     KVVITKLHLDKDRKALIERKGGKLE"
     gene            complement(558078..558149)
                     /locus_tag="HG536_0Ftrna9R"
                     /db_xref="GeneID:59327394"
     tRNA            complement(558078..558149)
                     /locus_tag="HG536_0Ftrna9R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGG"
                     /db_xref="GeneID:59327394"
     gene            <558361..>559110
                     /locus_tag="HG536_0F02890"
                     /db_xref="GeneID:59327179"
     mRNA            <558361..>559110
                     /locus_tag="HG536_0F02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284742.1"
                     /db_xref="GeneID:59327179"
     CDS             558361..559110
                     /locus_tag="HG536_0F02890"
                     /inference="similar to AA sequence:RefSeq:NP_011547.3"
                     /note="ancestral locus Anc_4.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140638.1"
                     /db_xref="GeneID:59327179"
                     /translation="MISAIVCLRESPMGIGKMARATIVPSRLMPAKPKVNCKPVVWSG
                     GPSRSYSTFNAHSATSSSTEERKSGKRLTIWPKVKAFTTFTASGTLVIGAAGLSVVVI
                     YLILSELFSPSGDTQIFNRSVSLIEKDEIARALLQCNDTEDSKERLKAYGEIFTSDKW
                     TRNRPIVSTKKIDKNGKAHYFMRFHVESRKKRGLVHIEAVESDKNYQPDFKSMYLDVA
                     GEQRYYLIKPQLGTVAKPKGFLGVNWGPKRN"
     gene            complement(<559285..>560931)
                     /locus_tag="HG536_0F02900"
                     /db_xref="GeneID:59327180"
     mRNA            complement(<559285..>560931)
                     /locus_tag="HG536_0F02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284743.1"
                     /db_xref="GeneID:59327180"
     CDS             complement(559285..560931)
                     /locus_tag="HG536_0F02900"
                     /inference="similar to AA sequence:RefSeq:NP_013447.1"
                     /note="ancestral locus Anc_4.174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140639.1"
                     /db_xref="GeneID:59327180"
                     /translation="MISLISTILLMVRTVVGVPTQINNVAEIEIIGNKFFESTTGEQF
                     FMKGIAYQPSRSLQELEAAEGTYETKYIDPLADPEICLRDIPLLQELGVNTIRVYSID
                     PTKSHDECMDALSEAGIYVLLDLAEPDVSIPRDKPVWDVNIWRRYKDVVDAMHKYSNI
                     LGFFAGNEVTNDKTNTHASPFVKAAIRDVKEYIKGQKYRKIPVGYSSNDDADTRENLA
                     QYFACDDDHADFYGVNMYEWCGYSSYGTSGYKERTEEFEDYPLPIFFSEFGCNLVRPR
                     PFTEVGALFGPKMSKTWSGGLAYMYFEEENEYGVVKINDNGDVEKLDDFEYLRNEYSK
                     AKPEGTQKKEYANSERNRSIKCPSAGSNKDWKASNKVPPKPDVEKCDCLGTYLPCLVV
                     PYEDSTKYQELFDTVCSKVNCSDIMADGSSGVYGKFADCSTEQKLALQISKLYAINNA
                     AHSANDNGGNICPFAGKNVYFNSQYKSLSNDAKCSKFGFDIMNFQSSTSPSETIVEND
                     GNRVATDVPTPKAGSGSTTQYKNSGYAILFVTVFIASLLL"
     gene            complement(<561352..>566997)
                     /locus_tag="HG536_0F02910"
                     /db_xref="GeneID:59327181"
     mRNA            complement(<561352..>566997)
                     /locus_tag="HG536_0F02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284744.1"
                     /db_xref="GeneID:59327181"
     CDS             complement(561352..566997)
                     /locus_tag="HG536_0F02910"
                     /inference="similar to AA sequence:RefSeq:NP_011546.3"
                     /note="ancestral locus Anc_4.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140640.1"
                     /db_xref="GeneID:59327181"
                     /translation="MSYNGHPNDNQPPYRDQNTAGYDGQDQAYDQYGQPVYPANDAYY
                     DPNMSGDAYGNQHMMGGDPYDADQADYAGADGFYNQPRGPGQNPENFSDFSSYGPPGT
                     PGYDSYAGNGQYTPSQMSYGEPGSSGASTPIYGGEGYDPAAIAMALPNDPYPAWTADN
                     QSPVTIEQIEDIFIDLTNRFGFQRDSMRNMFDHFMTLLDSRASRMAPEQALLSVHADY
                     IGGDTANYKKWYFAAQLDMDDAVGFRNMSLGKLSRKARKAKKKNKKAIEESNAEDTEA
                     TLNQLEGDTSLEAADFRWKAKMNQMSPLEKVRQIALYLLCWGEANQVRFTSECLCFIY
                     KCALDYLDSPMCQQRSEPMPEGDYLNRVISPLYRFLRDQVYEIADGRFVKRERDHNKV
                     IGYDDVNQLFWYPEGIAKIVFEDGTRLIDLNVEERYLRLGDVLWSDVFFKTFKETRSW
                     LHLVTNFNRIWVIHASIYWMYVAYNAPTLYTHDYQQLVNNQPVPAYRWASAALGGSLA
                     SLIQLFATICEWSFVPRKWAGAQHLSRRFWFLCAIFGINLGPIIFVFAYEKETVNSEA
                     AHVVAAVMFFVAVATVLFFAIMPLGGLFTSYMKKSTRRYVASQTFTASFAPLTGIDMW
                     LSYLVWTTVFAAKFSESYFFLILSLRDPIRILSTMTMRCTGEYWWGAKLCRQQPKIVL
                     GLMIATDFILFFLDTYLWYIIINTIFSVGKSFWLGISILTPWRNIFTRLPKRIYSKIL
                     ATTDMEIKYKPKVLISQVWNAIVISMYREHLLAIDHVQKLLYHQVPSEIEGKRTLRAP
                     TFFVSQDDNNFDTEFFPRDSEAERRISFFAQSLSTPIPEPLPVDNMPTFTVLTPHYAE
                     RILLSLREIIREDDQFSRVTLLEYLKQLHPVEWECFVKDTKILAEETAAYEGGEDPEG
                     KEDALKSQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTVSGFMNYSRAIKLL
                     YRVENPEIVQMFGGNAEGLERELEKMARRKFKFLVSMQRLAKFKPHELENAEFLLRAY
                     PDLQIAYLDEEPPLNEGEEPRIYSALIDGHCEILENGRRRPKFRVQLSGNPILGDGKS
                     DNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEELNVEQINPYAPGLRYEE
                     QATNHPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFV
                     NATFMTTRGGVSKAQKGLHLNEDIYAGMNAMLRGGRIKHCEYYQCGKGRDLGFGTILN
                     FTTKIGAGMGEQMLSREYYYLGTQLPIDRFLSFYYAHPGFHLNNLFIQLSLQLFMLTL
                     VNMNSLAHESIICIYNRYTPITDVMYPIGCYNLSPVIDWVRRYTLSIFIVFFIAFIPI
                     VVQELIERGLWKATQRFFRHILSLSPMFEVFAGQIYSAALLSDMSVGGARYISTGRGF
                     ATARIPFSILYSRFAGSAIYMGSRSMLMLLFSTIAHWQAPLLWFWASLSSLMFSPFLF
                     NPHQFSWQDFFLDYRDYVRWLSRGNNKYHRNSWIGYVRMSRSRVTGFKRKLVGDESEK
                     AAGDAARAHRTNLIFSEIFPCAVYAAGCFVAFTFMNAQTGVKTTDDDRVNSTLRIIIC
                     TLAPIVIDLGVLFFCMGMSCCSGPLFGMCCKRTGSVMAGIAHGVAVVVHIVFFIVMWV
                     LEGFHFARMLLGVITCIQCQRLIFQFITVFLLTREFKNDHSNTAFWTGKWYGAGLGYM
                     AWTQPSRELAAKVVELSEFAADFVLGHILLFCQFPLLCIPGIDKFHSIMLFWLKPSRQ
                     IRPPIYSLKQTRLRKRMVRKYSSLYFVILLIFAACIVGPAVASSKVPSNIGSSLTGTF
                     KNLVQPRNKSNNDTGFQMSTYVSHYYTHTPSMKTWSTIK"
     gene            complement(<567863..>568810)
                     /locus_tag="HG536_0F02920"
                     /db_xref="GeneID:59327182"
     mRNA            complement(<567863..>568810)
                     /locus_tag="HG536_0F02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284745.1"
                     /db_xref="GeneID:59327182"
     CDS             complement(567863..568810)
                     /locus_tag="HG536_0F02920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140641.1"
                     /db_xref="GeneID:59327182"
                     /translation="MATNQQFVTLNNGNKIPAVGIIGTGTAWFKKQGQEEVISPELIE
                     QIKYALSLPGVIHIDAAECYNTYVEVGKALEQSNRPRDQIFITDKFSPQANDGRTVSE
                     SFERGLARMGVDYVDLYLIHCPFISRQGYSLEDAWSELEALYESGKAKNIGVSNFRVS
                     DLQRILKSGKVKPQVNQIEFHAFLQNQTPGIFQFCQQQQIQLEAYSPLAPLQRKSDEL
                     KTAAGAPFYHYLEQLASKYNKSEALILLRWVTKRHVIPVTTSSKPARVKDAQENLFTF
                     DLTDQEVDQITSLGLLHKPLRLYWNEVYADYDSQAQQPL"
     gene            complement(<569011..>570153)
                     /locus_tag="HG536_0F02930"
                     /db_xref="GeneID:59327183"
     mRNA            complement(<569011..>570153)
                     /locus_tag="HG536_0F02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284746.1"
                     /db_xref="GeneID:59327183"
     CDS             complement(569011..570153)
                     /locus_tag="HG536_0F02930"
                     /inference="similar to AA sequence:RefSeq:NP_011545.1"
                     /note="ancestral locus Anc_4.172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140642.1"
                     /db_xref="GeneID:59327183"
                     /translation="MRRELTGARSRIEYLSSKLVVSKVGISRILSLRQYVRPVQVKLY
                     SSDAERTPAGPLFDHHNNTFQTTTSQGKYGSTEVLNKDLLSDAIPSVELAYDLVKDHT
                     CQFIPEKPSIIILHGLFGNRMNNRSIGRELNELLERDVYLPDLRNHGASPHIGRHDYT
                     SMALDVERFIAEKILNRPDAKKPIIVGHSMGAKVAMSVVLRKPELCSMLVSIDNAPVA
                     TPPMNAFPRYTKKLLQIINDPGIQTAKQAEEALKEVEEKSVVRQFLLTVLQRVKDEET
                     GQWKFKSRIPLGILNDAIVKGNISNWEFNPWVHRFTGPSLFIRGIRSHYVADEYLADI
                     GNFFPNFEVRDIDAGHWVNTEKPRECVQNIVEFVERHEDELKASRL"
     gene            complement(<570606..>572315)
                     /locus_tag="HG536_0F02940"
                     /db_xref="GeneID:59327184"
     mRNA            complement(<570606..>572315)
                     /locus_tag="HG536_0F02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284747.1"
                     /db_xref="GeneID:59327184"
     CDS             complement(570606..572315)
                     /locus_tag="HG536_0F02940"
                     /inference="similar to AA sequence:RefSeq:NP_013445.1"
                     /note="ancestral locus Anc_4.171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140643.1"
                     /db_xref="GeneID:59327184"
                     /translation="MTLSLKDINSAATGSFTYNHFSRISILQDTFTVEEQKRQKLFLK
                     QKINKVYDISRRCYHEHSGRDWDAAVVSEENNVVAHLLSTESDSVLDFSILSERADID
                     SDLQLFTPNVLGGNSSFDLAELNAQMALLLVEYFPGAHPSANFLTRLTLAIVPQMVRL
                     NQALDRYDHLGSAEQSVGNFLHTCDKLFPKIWIPHLSEAIENMKSGQQILQKFDGRYS
                     KVEAKDAFEPGVRRIIRKWSLLNYFPVVLIKSLNFQIESNSENRIAANDVYFIGCSEL
                     FKIAFITLAIEVSKGLEKVINILIELNASNGLTNKTLIILLELLLECTVDSRAAEIMI
                     GLDRVVKRWILFKEAADESTRSIFQHWAGQILESYNAQKELEHKLRTDEEEDEADLMF
                     DKWEVGKMFVNEIIQFIEPRNSTRARSDLFGWLTVFDECHHSSSSQNYSQDPQFDFDT
                     VSIRSIQLPPTSEVPKHAYGKREALRRWAMSKKNKMSEGYRRIKKRFQQAFHTHTTRA
                     LITSVRYYNAINGRKYEYHFPDETTEFTPDQCAQVQRITQKLYKREKRGKRKRDAIKV
                     IFM"
     gene            complement(<572497..>573435)
                     /locus_tag="HG536_0F02950"
                     /db_xref="GeneID:59327185"
     mRNA            complement(<572497..>573435)
                     /locus_tag="HG536_0F02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284748.1"
                     /db_xref="GeneID:59327185"
     CDS             complement(572497..573435)
                     /locus_tag="HG536_0F02950"
                     /inference="similar to AA sequence:RefSeq:NP_013444.1"
                     /note="ancestral locus Anc_4.170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140644.1"
                     /db_xref="GeneID:59327185"
                     /translation="MGGIREKKAEYFAKLREYLEEYKSIFVVGVDNVSSQQMHEVRKA
                     LRGKGVVLMGKNTMVRRAIRDFIAELPDYEKLLPFVKGNVGFVFTNESLKDIKEVIVA
                     NKVAAPARAGAVAPEDIWVTAVNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVE
                     AGNKVGPSEASLLNLLNISPFTYGLTIVQVYDNGQVFPSSILDITDDELVSHFVSAVS
                     TIASISLAIGYPTLPSVGHTLINNYKNLLAVAIASKYVYPEIEELVDRIENPEKYASA
                     APAAAAASGAGEAKEEAAAEEESEEEDEDMGFGLFD"
     gene            <573840..>574316
                     /locus_tag="HG536_0F02960"
                     /db_xref="GeneID:59327186"
     mRNA            <573840..>574316
                     /locus_tag="HG536_0F02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284749.1"
                     /db_xref="GeneID:59327186"
     CDS             573840..574316
                     /locus_tag="HG536_0F02960"
                     /inference="similar to AA sequence:RefSeq:NP_011544.1"
                     /note="ancestral locus Anc_4.169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140645.1"
                     /db_xref="GeneID:59327186"
                     /translation="MAGLPRVQYDGKDARIDPADQESTMKYIYDHIISSCIQGPEVIG
                     DGIISYRKVTKNDNIKQTIDKLENTDCQYICLYSYGQHIQKMLSVVEIFKRILLGKTS
                     SVKQWNRLTCFILTKEGRNELLEKQTRIPILITVVEIPSTSIRPSFELSLKGFTQQ"
     gene            <574616..>577186
                     /locus_tag="HG536_0F02970"
                     /db_xref="GeneID:59327187"
     mRNA            <574616..>577186
                     /locus_tag="HG536_0F02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284750.1"
                     /db_xref="GeneID:59327187"
     CDS             574616..577186
                     /locus_tag="HG536_0F02970"
                     /inference="similar to AA sequence:RefSeq:NP_013441.1"
                     /note="ancestral locus Anc_4.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140646.1"
                     /db_xref="GeneID:59327187"
                     /translation="MLLDCRLDRISLQQPTRRNKRHITIKYSAYIGLNLVVLYVCYRG
                     LTSRLRAYIKLELTTSNTEYRAHPAFIEMAGPPAPPPPPPPAPSGFGSSGATAPRPAA
                     SVMQGRDALLGDIRKGTRLKKAETNDRSAPLVGGGGVVGSGSKSSSANGPSLPSAVGS
                     APPAPGLGAPQLGDILAGGIPTLRKVSRGQESQTVNSSSAPPVPGMPPAIPTGKVPPL
                     PSNRMPSMPTAPSSVAPPVPSANVPNIPVTPAPSVPSARPKRRSHQKQSSISSLSSTV
                     QVSSPPIPATGAPPPPKLPSSAPPVPGVPSSQPPPAPPAFLAAPAAPVEASNLKGFET
                     GNLAAPPPGPPAGLPFLAEINARRSDLGSVDGTTASAGPSIPSAAPVPPKPTALAPQA
                     PPLPSQAPPLPSQAPPLPSQAPPLPSQAPPLPSQSQPKRATAAAPPAPPLPSQSPLKA
                     KSAPAPPAPPMSSQSTPEMRTTAPPPAPPAPPAPPASQIFSTSTTPSSTAARDSKQAA
                     PTLGGPLPFLSEIQKKRDDRYVVGDGTGYSTKQEQPDAMASAPAPSMHRVDDGRGKSG
                     GPMSLMGEIESKLKPRKASQSVSDSRVTSVPSPAPPLPTAAPPLPTAAPPLPTAAPPL
                     PAAIPPQRLSSDIDHSRSNIAQEGSFLDEIQSSFKQHHIQPSPGATNAGHPESEFSIP
                     SSPPMSPPISAPPLPSAVPKAPPPPSNDFTPPQLVTGPPNIAPPPRSVPATRQQESES
                     ISGASPAITKAPLRPPSKEQTGNIKQRLFSSGESSARGTINERTNVPNIEVSQLTING
                     SDSTSGVKLNSGKVVIDDSRFKWANASQIPRPRPYQNRTKLYPSGKGSSVPLDLSLFT
                     "
     gene            complement(<577262..>577858)
                     /locus_tag="HG536_0F02980"
                     /db_xref="GeneID:59327188"
     mRNA            complement(join(<577262..577736,577803..>577858))
                     /locus_tag="HG536_0F02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284751.1"
                     /db_xref="GeneID:59327188"
     CDS             complement(join(577262..577736,577803..577858))
                     /locus_tag="HG536_0F02980"
                     /inference="similar to AA sequence:RefSeq:NP_011543.4"
                     /note="ancestral locus Anc_4.167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140647.1"
                     /db_xref="GeneID:59327188"
                     /translation="MPTEGHTGRKIIYDEDGKPCRSCNTLLDFKFATGRITSRAALPE
                     RAGRESRTIPAQELIPGSKSYAKVEPPDVVELGNSSWNLLHSITATYPSKPSEQKKAE
                     MKQFLTIFSHIYPCSWCARDFEKFIEQNAPKVDSREDLGRWMCEAHNAVNEKLGKEKF
                     DCNFWAKRWKDGWDEN"
     gene            complement(<578018..>579106)
                     /locus_tag="HG536_0F02990"
                     /db_xref="GeneID:59327189"
     mRNA            complement(<578018..>579106)
                     /locus_tag="HG536_0F02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284752.1"
                     /db_xref="GeneID:59327189"
     CDS             complement(578018..579106)
                     /locus_tag="HG536_0F02990"
                     /inference="similar to AA sequence:RefSeq:NP_011542.3"
                     /note="ancestral locus Anc_4.166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140648.1"
                     /db_xref="GeneID:59327189"
                     /translation="MSRKFDLKTIADLSVLIGTGISLYYLVNRLLNDVEAGPMSGRSK
                     ESKSRQLSQWQKLIDKNPELAKVELSTYEKSVLSSVVTADELAVTFKDIGGLDSIIAD
                     LHESVVYPLMMPEVYENNPLLQAPSGVLLYGPPGCGKTMLAKALANESGANFISIRMS
                     SVMDKWYGESNKIIDAMFSLARKIQPCMIFIDEIDSFLRERASSDHEVTAMLKAEFMT
                     LWDGLLTSGRVMIVGATNRINDIDGAFLRRLPKRFLIPLPGRDERLKILKVLLKDTKT
                     DDGLFSIETIAAHTNGLSGSDLKEICREAALNAAKEYIKLKREYMSQNSEKNPQDFPV
                     QMRPLRTSDFNGLLKLDAQQPLQSMSLD"
     gene            <579296..>582127
                     /locus_tag="HG536_0F03000"
                     /db_xref="GeneID:59327190"
     mRNA            <579296..>582127
                     /locus_tag="HG536_0F03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284753.1"
                     /db_xref="GeneID:59327190"
     CDS             579296..582127
                     /locus_tag="HG536_0F03000"
                     /inference="similar to AA sequence:RefSeq:NP_013440.1"
                     /note="ancestral locus Anc_4.165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140649.1"
                     /db_xref="GeneID:59327190"
                     /translation="MSNKHGIRLPGSLLDELKAHDYENDERFRPTGKTKGKRRVGPQL
                     SRKERRKRQRLDKKHSKTDRRLEAGGKFASKILSAKRKVEAAPENRNDLPFSSDDELT
                     SGNFDDFDDEDLDGEQLREQENESHADSDEVGLDEKAEGRDQDTPDEEEDAHEMSVEE
                     TMAALKALKEKKGKQKETGKLTKSERKKKKEYEKEIDFPLAPSDRAAAEKDEMDMQYY
                     AKKLGLKGKNKRIRAKDEFDAVGGLLEGLDFFEKYGDEDEEYGDLAEDEGSSGDSQGE
                     ESDEQPMAGLPSSDDEISSGDFDEFDEDDLDEEEWQQLRELEGENASDGDEGGKPTGK
                     TKKKPNPLVAPIASGTETYVPPSLRKKQLENNQESSVQSEVRKNVKSSLNKLSDSNIT
                     IIVGSLNDLFDKYARQLVTEAIVEQVIDIVAQRHKLLDSLIMNYSAVLYSLWKLRGID
                     IGASFIQLSVESFLGYYESQNRTLEHEKSGNLEEAPLLLSKEPVNLLTLIAYCYNFGL
                     TSSKLIYDLIRLFVDRPNELTTELLLKLISVSGSLIRGDDPAALRDIIAVLLSNVKGI
                     ANQPPRMKFLLDTILDLKNNRLKPSMLATSHSSVKKKLQSVVKTNSSANDALLVSIDD
                     IKNVETKGKWWLVGASWKGNMANASEELPEANNGRSQSKSETILLDDDLLDDIPDWSE
                     IARQQRMNTDIRRAIFISIMSAQDFMDAFTKLEKLNLKKKQTLEISRVLLHCLSQDGD
                     SNGYNPYYALLAKRLCENQQTLVKSFGFLFWDIMKKFEDDGLEGDLDEEEDLDEDTKL
                     KRLANQGKFFGFLVAERCLKLDILKHVSLISGLNADGNRFMEMFIFQLLLTSAKKSEI
                     KSKDSRGSRTITFRQDFLLQLLDAIKVDNKALIIKGLRYFMKKSFKYLDYIVGSPGDK
                     SYERDLRRLKWAVPSFRKLIDEKLETIDI"
     gene            complement(<582185..>583993)
                     /locus_tag="HG536_0F03010"
                     /db_xref="GeneID:59327191"
     mRNA            complement(<582185..>583993)
                     /locus_tag="HG536_0F03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284754.1"
                     /db_xref="GeneID:59327191"
     CDS             complement(582185..583993)
                     /locus_tag="HG536_0F03010"
                     /inference="similar to AA sequence:RefSeq:NP_013439.1"
                     /note="ancestral locus Anc_4.164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140650.1"
                     /db_xref="GeneID:59327191"
                     /translation="MAKRFADSQITRETFKENDSGSDEDNSGHKLASAAVMSKRKIAM
                     PKKKMASFQKKQPEPLIKPIDAPASSFSFLKDTKIPDGDSEKYAKMKALNLQFREKVT
                     FFIDRDPFADLSPVCEKYKIFVQSLNTAGNIPAKNTASESQKPLTQQKLSEAQESSDE
                     EEMKEVKVEGPTFTIDTKPPTSDSVFSFRTKKKAENEADHSDSDSVEIKGPQFTFAGS
                     VKSDVFKFSTPSNKQKDLEVATATVEPKEPPAFSLKTNDSLDTPKEKPKFSLGGAGES
                     KENKTPPTSEQQKDAKEISKRNFDFSFSANKANTNGTSETKKPSFSFTFGAGKVGEDV
                     KSDKPAAPTFSFGEPSQGSGNSTETKPAFLFGKSSQDSGSKAESKPAFSFGTSNQESD
                     EKAEAKPVFSFGAPNSSTAPSFTFGKPETTDKQNKSPENLYGAKSGFKFALPFEKRPK
                     DPEVDKNNESIEPPAQETTENGPQEESKPIDLQNGEEDETPLFSQRSKLMIFNPDSKS
                     YDSKGVGEMKLLQSKEDKSKIRFLCRSDGMGNILLNTRVLKDFTYSPLTAENENLVKV
                     PTIEADNKLVTYIVKFKQKADGRQFVKAIEDVKKDL"
     gene            complement(584265..584336)
                     /locus_tag="HG536_0Ftrna6E"
                     /db_xref="GeneID:59327385"
     tRNA            complement(584265..584336)
                     /locus_tag="HG536_0Ftrna6E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:59327385"
     gene            complement(585484..585584)
                     /locus_tag="HG536_0Ftrna2W"
                     /db_xref="GeneID:59327378"
     tRNA            complement(join(585484..585520,585548..585584))
                     /locus_tag="HG536_0Ftrna2W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:59327378"
     gene            <586610..>588307
                     /locus_tag="HG536_0F03020"
                     /db_xref="GeneID:59327192"
     mRNA            <586610..>588307
                     /locus_tag="HG536_0F03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284755.1"
                     /db_xref="GeneID:59327192"
     CDS             586610..588307
                     /locus_tag="HG536_0F03020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140651.1"
                     /db_xref="GeneID:59327192"
                     /translation="MILNNQDPVMPKAYMQNHLDCTMSGSTGIQSGLHLKGQPEPQPG
                     LSENAKPNEIRKREQLKQRLTRLWAGGNKEISASGPTAEKSNRRRHRLRFWKNDREEP
                     HSFDQPEQMRSWAPETDLSSNAEPFTISDYLAFGAASENTISSVSEANTVIHRPYQLE
                     VDEGHEPMPYYSKLEDRNEKPKPVNSVPPALDIKKSWSRSSPCSTVASSSGAANTFSP
                     VCAGFTPVTPVLYTESDSSGEKADGRLKSAWKPRTIIPASEKEMVFIDDNKQREIRLH
                     FKPLPNTSQGLEELKISSYPPCSIEEFPQTEDPLFDIQRNDLTKDTVSPNSEVSLKTW
                     EHIEDEIWFAKLLKEYCPVRLRRNKRMNFDSEEFRSMQADLTLRTLAEQELRGQDRKL
                     IFRPSLSSGKSFFRSIFHFEEDEDVLDAMDHFILCNEGLIPLFRGSRPAVRKHFFRRW
                     HNYDRDRIIVCEQLMEKWLEDKTYLAKLKEDRKRRQERRLLMESCEGNNDRLPPFSFF
                     AKKLLVRLSGQRGRIGKPPRRGSKLLVFRKEPLFGIPYFEKKKQEAKTWLKELVLSI"
     gene            complement(588828..588899)
                     /locus_tag="HG536_0Ftrna10R"
                     /db_xref="GeneID:59327369"
     tRNA            complement(588828..588899)
                     /locus_tag="HG536_0Ftrna10R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:59327369"
     gene            <589044..>589340
                     /locus_tag="HG536_0F03030"
                     /db_xref="GeneID:59327193"
     mRNA            <589044..>589340
                     /locus_tag="HG536_0F03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284756.1"
                     /db_xref="GeneID:59327193"
     CDS             589044..589340
                     /locus_tag="HG536_0F03030"
                     /inference="similar to AA sequence:RefSeq:NP_012258.3"
                     /note="ancestral locus Anc_7.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140652.1"
                     /db_xref="GeneID:59327193"
                     /translation="MVSVTVEFLGGLDVIVNKQRIHQVQIDEEGVDMKRLISYIADQM
                     ITNKNDVEVFLEDGSVRPGILTLINDTDWELEGGEGYLLEDKDVISFTSTLHGG"
     gene            complement(<589337..>589969)
                     /locus_tag="HG536_0F03040"
                     /db_xref="GeneID:59327194"
     mRNA            complement(<589337..>589969)
                     /locus_tag="HG536_0F03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284757.1"
                     /db_xref="GeneID:59327194"
     CDS             complement(589337..589969)
                     /locus_tag="HG536_0F03040"
                     /inference="similar to AA sequence:RefSeq:NP_012259.3"
                     /note="ancestral locus Anc_7.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140653.1"
                     /db_xref="GeneID:59327194"
                     /translation="MKELYNELNESIIDSTIAERVQRLNELALSEVLQLKAAIEQELE
                     KHFGALKSQGVDLSSPLITEDGFPREDIDVLQVRLTRRYLNMLRNDLRDVIDRSQFLL
                     NDHFQASNPAERPIDSTSIVPFAQIYDILPNGPLDVAGVRESDKLIAIANVNATNHSN
                     LSLLQKTIRENENVPLPIRVLRNQEVLDLTMTPSRQWNGPGLLGARLKLI"
     gene            complement(<590092..>590778)
                     /locus_tag="HG536_0F03050"
                     /db_xref="GeneID:59327195"
     mRNA            complement(<590092..>590778)
                     /locus_tag="HG536_0F03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284758.1"
                     /db_xref="GeneID:59327195"
     CDS             complement(590092..590778)
                     /locus_tag="HG536_0F03050"
                     /inference="similar to AA sequence:RefSeq:NP_010907.3"
                     /note="ancestral locus Anc_7.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140654.1"
                     /db_xref="GeneID:59327195"
                     /translation="MSIFTNTTIASSFEEPRGAGGRQPIVGELIFDSFIKKEEGQEHE
                     TIDFFNQDDENLTPIFENATVSNANASPSEWGSLFDNEIPISSEDVFTFTPQQPVDEG
                     SQAEEPELEISTKSFLPTPIFEEAKLTSKTCVAGGRVSKKGSPKVDHLGVTSYNRKVR
                     TTPLSPVVADSDDPAALKRARNTEAARRSRARKTQRMNELELKVEQLLKRNHELEQEI
                     QRLNSIIRGK"
     gene            <592075..>593277
                     /locus_tag="HG536_0F03060"
                     /db_xref="GeneID:59327196"
     mRNA            <592075..>593277
                     /locus_tag="HG536_0F03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284759.1"
                     /db_xref="GeneID:59327196"
     CDS             592075..593277
                     /locus_tag="HG536_0F03060"
                     /inference="similar to AA sequence:RefSeq:NP_010909.1"
                     /note="ancestral locus Anc_7.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140655.1"
                     /db_xref="GeneID:59327196"
                     /translation="MEIEPTFRGFIEDENDALLLFQATVDGKLKHIPRRPYEIERRHL
                     IVSGSVFVFVEEISGIKRWTDGVSWSPSRIAGRFLIYKELDKGSSGHVSKNVGNKTVD
                     GDSGCSVKLPPLLRHSSSHSLLSSTASLSSLSSSSSSSRSSDAAAVKKYTGFTKKTMS
                     VKFKDPRRNRVETLHLVSYYNVDDVNNQRLTRPRDSIFLKNVEPCAELLAAMENTALG
                     NGSRSSFFLSSASSSRSSSTSSSPSLGKITAGSNYATFVKKQHASQTDANILPPQIIP
                     STNSFSIQQQQQQHYMPFVPLHTNYTSQPPPPVPLPQLNPQPSYLQVNSIYQLQPIGQ
                     MQPNCRPGLHSLVFAPQPTGYFQQAPNRDNHSFAGNNGPLSLSNPSGTSHGTRNFFFS
                     SANPPDLR"
     gene            <593523..>594623
                     /locus_tag="HG536_0F03070"
                     /db_xref="GeneID:59327197"
     mRNA            <593523..>594623
                     /locus_tag="HG536_0F03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284760.1"
                     /db_xref="GeneID:59327197"
     CDS             593523..594623
                     /locus_tag="HG536_0F03070"
                     /inference="similar to AA sequence:RefSeq:NP_010910.1"
                     /note="ancestral locus Anc_7.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140656.1"
                     /db_xref="GeneID:59327197"
                     /translation="MDEDDLVRRKDPHEGFLVPDGVSPLSSSDVIEPRRAARLIEGHE
                     ISINHDVIQVPSTKLLQLNDTQVIALSGAVSGFLSGIIVCPLDVIKTRLQAQGLQSLG
                     ENRYYHGFLGTASTIVRDEGVRGLYKGLVPIIMGYFPTWMIYFTCYEFCKDLYPKLFP
                     HWGFAAYSLSAISSGAISTVLTNPIWVIKTRLMLQTHVSQYPTHYHGTFDAFNKIRSQ
                     EGIRALYAGLVPSFLGLLHVAIHFPVYEKLKVTFNCYQGSTQDNKKEQGIHLPRLIMA
                     SCVSKMIASVITYPHEILRTRMQLKSNLPDSVQHKMLPLIRKTYLTEGLRGFYSGFVT
                     NLIRTVPASAITLVSFEWVRNRLSNITTGPGS"
     gene            <594820..>596928
                     /locus_tag="HG536_0F03080"
                     /db_xref="GeneID:59327198"
     mRNA            <594820..>596928
                     /locus_tag="HG536_0F03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284761.1"
                     /db_xref="GeneID:59327198"
     CDS             594820..596928
                     /locus_tag="HG536_0F03080"
                     /inference="similar to AA sequence:RefSeq:NP_012261.1"
                     /note="ancestral locus Anc_7.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140657.1"
                     /db_xref="GeneID:59327198"
                     /translation="MLFLWLASIAYLLHVGGFALAFGEDSTEKAAFPDPLNEEEFNSQ
                     MRSGLHIVEFFSPHCSHCKALAPTWKKAWETFYEEGQGLNITFSQVNCLLSGDLCNKE
                     KIAYFPNIRLYGPSGFIKNFPENAKRTVENLIDFARREAYDPVNAEVLDIKSLSIPIR
                     GDQFNELLAGKGEQPILVSFWPSKTMRSSDDNIDFENCDECIPFQRTWRILSSKLLAH
                     NISTGHINCESSSNLCEELGFSDLVKIKNHSLDRLPRVALILPNRVVNNFFVYKSPFS
                     TSTADYEDFATRIVSNSEPPFISAKEVREITEREFEIPSTNGLNVSPQKLHVVFSYDP
                     ETVVPEDLHVLGHLLEPLSAIPNAYLYRSTDNMNSASRSVFESMYQMINYNESEPVKT
                     VKESFLDLNVMEQNPSLYVFKDGEKIPHIFPAYSTTEMRNVGYITSWIESVSLPPINE
                     ISPSTFERLLSFNPEVYSGLVIQLIDTSTGSKFEKSSRLLRKLIVGAYDYEDLRMQNV
                     LNVADAKRLTKTKKMQALKKKGASAKKIVKASIEEIPRLDVHKIILGYIDISKSDNAL
                     SQLGLDYREEYNLGDVIVIDILNRYVYEHDIFGNALSSESPYNVRETLAAVFLPESSY
                     SAGNIPRRVWNPSFGDVFRFFDFTGQVSFWRFFCILSLILLAYKALRLLSRARINKRY
                     KAKRNIVGLLGKADKKNLRD"
     gene            complement(<597079..>597429)
                     /locus_tag="HG536_0F03090"
                     /db_xref="GeneID:59327199"
     mRNA            complement(<597079..>597429)
                     /locus_tag="HG536_0F03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284762.1"
                     /db_xref="GeneID:59327199"
     CDS             complement(597079..597429)
                     /locus_tag="HG536_0F03090"
                     /inference="similar to AA sequence:RefSeq:NP_012262.3"
                     /note="ancestral locus Anc_7.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140658.1"
                     /db_xref="GeneID:59327199"
                     /translation="MSGQGTGPSSPYESNTKIDYSESSLARLESQNEEEMGVMSQKIQ
                     ALKSLSLKMGDEIRGSNQTLDSLGDTFQRTSTKVKANLSNMLVMAKNSRISIKTWLII
                     FLIVGMLFFWVWIR"
     gene            <597795..>598637
                     /locus_tag="HG536_0F03100"
                     /db_xref="GeneID:59327200"
     mRNA            <597795..>598637
                     /locus_tag="HG536_0F03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284763.1"
                     /db_xref="GeneID:59327200"
     CDS             597795..598637
                     /locus_tag="HG536_0F03100"
                     /inference="similar to AA sequence:RefSeq:NP_012263.1"
                     /note="ancestral locus Anc_7.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140659.1"
                     /db_xref="GeneID:59327200"
                     /translation="MEDVVSPAQSLSKIKHIILVLSGKGGVGKSSVTTQTALTLCNMG
                     LKVGVLDVDLTGPSLPRMFGLENRSIMQSREGWLPVSVKVPVSCKGSLSVVSLGFLLD
                     DRGNSVVWRGPKKTAMIKQFITDVAWGELDYLIIDTPPGTSDEHISLAEQLRWCKPDG
                     AIIVTTPQNVAVADVKKEINFCRKVELNILGIVENMSGFICPHCAECTNIFSSGGGKR
                     LADQFSVPYLGNIPIDPRFVEMVENQGASKPSLAELYKDSSLFEIFQLILRKVLDQNH
                     PPRV"
     gene            complement(<598693..>599541)
                     /locus_tag="HG536_0F03110"
                     /db_xref="GeneID:59327201"
     mRNA            complement(<598693..>599541)
                     /locus_tag="HG536_0F03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284764.1"
                     /db_xref="GeneID:59327201"
     CDS             complement(598693..599541)
                     /locus_tag="HG536_0F03110"
                     /inference="similar to AA sequence:RefSeq:NP_010911.3"
                     /note="ancestral locus Anc_7.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140660.1"
                     /db_xref="GeneID:59327201"
                     /translation="MAASSLRTRRNKHSFSRIEGEEAFDELKRLSSIPNHKQLTLQSI
                     YEALEGEISQVKEDINCVYQAVRNDINLENEQMETVGHQLKKSAKKVNHMYDKVLASR
                     SQNNNSIGASMLQKLSDDVENVASALKGIDNTVDSILTIFSQIDSRIPQKNRLLNGHG
                     FNEQHYPLLFGLMHQKFGDRLVTQQEESGSDKPESIQLTENRTGAASPRSTSPTMSRA
                     QLEPTEIVSDLITKYRISQAAKRTSTKADDSYLPPSLRRITAPSTKTTLETITAELSR
                     NGDPNS"
     gene            <599689..>600702
                     /locus_tag="HG536_0F03120"
                     /db_xref="GeneID:59327202"
     mRNA            <599689..>600702
                     /locus_tag="HG536_0F03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284765.1"
                     /db_xref="GeneID:59327202"
     CDS             599689..600702
                     /locus_tag="HG536_0F03120"
                     /inference="similar to AA sequence:RefSeq:NP_010912.1"
                     /note="ancestral locus Anc_7.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140661.1"
                     /db_xref="GeneID:59327202"
                     /translation="MWNTVGAIVYIFGGCCSNVLTLESIIDQQTNRVGSLLTFCQFAV
                     ASIEGLYNFLDYSSRIPRLRTPKVPLKVYVLMVILYYTSSVTNNSVFQYGISVPLHIV
                     FRCSGTVITMIMGWLLAGKRYSVMQVFSASLMTIGAIITTLFKDREFSKETTIQKMLG
                     NVSSSADSKFLVGISMLFISSIASSTLSICNEWSYRKYGKHWKESLFYTHALALPLFF
                     LDYKELYQEFWSFVSQRPSAITLLGHTFRLSKLNLLAANIITQHICVRGVNLLACYTS
                     AVTLSTVLLARKVISLLLSVHLFGGTFSTTGYVGIIIVLLGTLIYVLNPNDNAVGSKR
                     RTT"
     gene            <600881..>601281
                     /locus_tag="HG536_0F03130"
                     /db_xref="GeneID:59327203"
     mRNA            join(<600881..600899,600965..>601281)
                     /locus_tag="HG536_0F03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284766.1"
                     /db_xref="GeneID:59327203"
     CDS             join(600881..600899,600965..601281)
                     /locus_tag="HG536_0F03130"
                     /inference="similar to AA sequence:RefSeq:NP_010913.2"
                     /note="ancestral locus Anc_7.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140662.1"
                     /db_xref="GeneID:59327203"
                     /translation="MEQGSNVFQLKYNEYKQTLEELQSKVIELSHDKDEHDIVLETLS
                     KTDPERICYRMVGGALVQSDVKTTLPILTTKRDKITETVSRFKAELISVAQEFEKWKK
                     DNKIHVVKQ"
     gene            complement(<601399..>602682)
                     /locus_tag="HG536_0F03140"
                     /db_xref="GeneID:59327204"
     mRNA            complement(<601399..>602682)
                     /locus_tag="HG536_0F03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284767.1"
                     /db_xref="GeneID:59327204"
     CDS             complement(601399..602682)
                     /locus_tag="HG536_0F03140"
                     /inference="similar to AA sequence:RefSeq:NP_010914.3"
                     /note="ancestral locus Anc_7.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140663.1"
                     /db_xref="GeneID:59327204"
                     /translation="MLRNLLIALSILLVTVSARCVEGSKTLVLYDERLTTINDYSIMF
                     NSMKERKYKLDFVSVANETATVSLFDGDHRLYDNVVVFPLKGKGLNKYLGVKSLLKFS
                     KNGGSMLTISSPDGLADSIRLFLNQLGIYPSPKDYKLTDNFQEKSDSFEVASSRVRNE
                     FIYNSEEDTFLFANSSVALLDNREQVLPVLPAPRTSLCYGKADNIWAAGSQTYMVAAF
                     QALNNGRVTWIGSTELLKDSNSHANGHFVEELVKWTFKEKAVIKITGHGHSHIDGTSY
                     ELAPYKIKDVIQYNIGLSQWNGEEWQPYEADDVQLELKMIDPYYRLNLVRGKKENITR
                     WYTTGDFRLPDHHGVFTFQVDYKRAGLTFVSVSDAKAIRHLAHDEYPRSWEITNAGVY
                     LSGIFAVIFAWIIFVIFFVSTSKVSKSINAEKKNN"
     gene            <602882..>603094
                     /locus_tag="HG536_0F03150"
                     /db_xref="GeneID:59327205"
     mRNA            <602882..>603094
                     /locus_tag="HG536_0F03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284768.1"
                     /db_xref="GeneID:59327205"
     CDS             602882..603094
                     /locus_tag="HG536_0F03150"
                     /inference="similar to AA sequence:RefSeq:NP_878098.1"
                     /note="ancestral locus Anc_7.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140664.1"
                     /db_xref="GeneID:59327205"
                     /translation="MTEDKPELAEFTAADLSRALKTLQEGEQTADEIERRLDMMEQRM
                     ALLLEQVEQMQSNTERIQTNQTKNDN"
     gene            complement(<603193..>606039)
                     /locus_tag="HG536_0F03160"
                     /db_xref="GeneID:59327206"
     mRNA            complement(<603193..>606039)
                     /locus_tag="HG536_0F03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284769.1"
                     /db_xref="GeneID:59327206"
     CDS             complement(603193..606039)
                     /locus_tag="HG536_0F03160"
                     /inference="similar to AA sequence:RefSeq:NP_012264.3"
                     /note="ancestral locus Anc_7.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140665.1"
                     /db_xref="GeneID:59327206"
                     /translation="MKLFIGRNPRSAVVSSNGYNLCFERLPSVSGNSQVGQQNLKAPV
                     VSIRSISDEELADTKHYFELKNRMFSGLVGLVSLNGNLFLAVVSGVQKVGFPRWTLEN
                     GHISSSENVFKVLDVEFHSLDAEIYDHLYLEPTEQNYEKLIHEHPCGSLKKLLGDGSF
                     YFSRGFDISNVLKHGGPAHNLDYTIDNQDLNNIWNASFISEIINWRSRIPAQEKDLVG
                     GEFFTFLMRGFYKTVIVEQANTISTITLVSRISAESNQNSFALDGVDEYGRVSNFVET
                     EIIVSTEDFFLSYTQVSGNVPLFWEVVDGQLLYGRRLKLTRGIEQTQAAFDRHFDNLA
                     SKYGVVSVLNLVKPKSESQELMADAYKDCAEMKGIKFTSVEYGSRLLTKTPHKLLYLL
                     KQDLYEFGAFAYDIKKKIYVGKQTGVLRISSFGSVSRINTVEKLVSREVLELTTSELS
                     GIEITSPFLKAHDRLWSENNYWLEAVYSKNSKNPSKYRKVYGKLFNSKVKIYDPLHST
                     ISQYLRQRKESYTYKKEITIFAGTFNVSGKIASEDVKDWICPDISNEDSCAPEMYVIG
                     LEEVVELTPGHILSTDPYVKSYWEKKILGAINGLNPERRYGCVWSSQLGGVLLMLFVN
                     ELEYQKVKHIEGDMKKTGFGGMTSNKGAVAVSFKYSATKFCLLVSHLAAGLDNVEQRH
                     NDYKTIVKNIRFSRGLRIKDHDVVIWMGDFNYRILMSNDEVRKMIAAEEFSKLFERDQ
                     LNQQMIAGEAFPYYHEMEIKFPPTYKFDPGTKTYDTSEKMRIPAWTDRILSRGASLRQ
                     LTYGCAENILFSDHRPVYATFRAVVTVLDEQEKAALAAEIYQKIASKLASLNDREKLA
                     LLNDGSLLVESLEKDGSKTPAISPSAASGHTTGVRLPPPSSDLKKWWIGNGKQVKVII
                     HVDPSKYALNPERSVNPFSYEDKDEPLFVPREIT"
     gene            <606548..>608104
                     /locus_tag="HG536_0F03170"
                     /db_xref="GeneID:59327207"
     mRNA            <606548..>608104
                     /locus_tag="HG536_0F03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284770.1"
                     /db_xref="GeneID:59327207"
     CDS             606548..608104
                     /locus_tag="HG536_0F03170"
                     /inference="similar to AA sequence:RefSeq:NP_012265.3"
                     /note="ancestral locus Anc_7.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140666.1"
                     /db_xref="GeneID:59327207"
                     /translation="MNKIFSELCYACRVGDKENVDRLASTGVNLNAVDEFDNSPLFLA
                     SLCGHEEVVKLLLERGAVCDRDRYEGARCIYGALTDSIRDILLQYDISKAVDLNQPFV
                     MHLSSLLKESAYQTHDICITSLGSKQNNRLRLHKFILNTRSPGFAGQVDFFNGGKHCI
                     EIPSSVSPTVLEIVTKFIYLVPVLHEIDARDMNCLIDLSALWGMSELKEFLERVRHVI
                     DPSEKSTMMVEYQHRITERAREQLCCFVNDNILRNAVDVGPNLSLRSQELISMFNSSA
                     FPDLIVVVENSMGLKRFYPCHLAILSRSNYFKIMFDLPLAECFAYKQFKAYRNIPSPT
                     EIPTVSFPPCEFEVAELLLRYLYYDASEIPWQYAMDVLLIADHLLEDRVKSMAAVVIT
                     QSKDILEEYSIFQILYLGWETRMERLEHYAAKIVANDIQRYAKDPELKKAIMLSSTRI
                     SIRQETDSIEFVDDMRYYLLQKYAFEADDVEFLGEEDDEDLLKASGFSDYMKDNSTIE
                     ALLGKLNLQA"
     gene            complement(<608162..>608818)
                     /locus_tag="HG536_0F03180"
                     /db_xref="GeneID:59327208"
     mRNA            complement(<608162..>608818)
                     /locus_tag="HG536_0F03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284771.1"
                     /db_xref="GeneID:59327208"
     CDS             complement(608162..608818)
                     /locus_tag="HG536_0F03180"
                     /inference="similar to AA sequence:RefSeq:NP_010915.1"
                     /note="ancestral locus Anc_7.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140667.1"
                     /db_xref="GeneID:59327208"
                     /translation="MRFLSLIFLFIVSRCVAAIDNETDGYADPAEQRDFVNLNVTYDI
                     LEKPKINFNVPTEFAADETATFNITFQNNEDSNVTVVGLSGSVIDAMVGYEIANISAQ
                     ELGPLNVAVNETVTFRAPIQLTLPEGSFFLAPILFIVKADKVMKVGIPPLSIFISPPP
                     LSFLNPSFLSVQVLLGLVVVGTTYLVINFKKQGGRSTKKRSTKARPVDENWLPSIHKK
                     "
     gene            complement(<609220..>610020)
                     /locus_tag="HG536_0F03190"
                     /db_xref="GeneID:59327209"
     mRNA            complement(<609220..>610020)
                     /locus_tag="HG536_0F03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284772.1"
                     /db_xref="GeneID:59327209"
     CDS             complement(609220..610020)
                     /locus_tag="HG536_0F03190"
                     /inference="similar to AA sequence:RefSeq:NP_012266.1"
                     /note="ancestral locus Anc_7.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140668.1"
                     /db_xref="GeneID:59327209"
                     /translation="MPVEGSIEERNATANHDTEVQDVLDKPEQSAQEAYLAEIKLSTS
                     MKAMSLDDKSNEFLKPSREERYAAQVEADSRSIFVGNITSEITPEIIEEHFKNCGNIK
                     RITLLYDKNTGAPKGYAYVEFNSIEEQRKALEYNGSNLKETVITVYKKRTNLPGYRRR
                     FQYRNSSICYQQQWGHSQDNYQAHGIVDIYRQFNFKADHSQSFDRYNGGYGQRHNRRG
                     NGRQDHRLNLTKSRTSKEPTATPQVSSIESDDKIADSLANDATNTTPN"
     gene            <610477..>611166
                     /locus_tag="HG536_0F03200"
                     /db_xref="GeneID:59327210"
     mRNA            <610477..>611166
                     /locus_tag="HG536_0F03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284773.1"
                     /db_xref="GeneID:59327210"
     CDS             610477..611166
                     /locus_tag="HG536_0F03200"
                     /inference="similar to AA sequence:RefSeq:NP_010917.3"
                     /note="ancestral locus Anc_7.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140669.1"
                     /db_xref="GeneID:59327210"
                     /translation="MVSVRKRKMARSSVGKATRRNKDKQRKINITSNPIIAAHWDYSL
                     TLSQNYKRLGLRAKLQTPAGGQEVDLSKENRKKPLIKLADEYDSEEESGSVADINLEE
                     VNSEGEYLEDRIPEGEARIQRDKNGEVIKVVYGKKKADSEALSDPSSAKSETTSEVVK
                     ELESFASRPLQKKDRTQSKREEEWLERLYNKHGNDYKKMFFDKKLNIYQQSEGDLKRR
                     IIKWKKRQGIA"
     gene            complement(<611242..>612384)
                     /locus_tag="HG536_0F03210"
                     /db_xref="GeneID:59327211"
     mRNA            complement(<611242..>612384)
                     /locus_tag="HG536_0F03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284774.1"
                     /db_xref="GeneID:59327211"
     CDS             complement(611242..612384)
                     /locus_tag="HG536_0F03210"
                     /inference="similar to AA sequence:RefSeq:NP_010918.1"
                     /note="ancestral locus Anc_7.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140670.1"
                     /db_xref="GeneID:59327211"
                     /translation="MGTHPNVPSYRHDDKVPLRELISNDPSSFLGEAVIEKFQTTSEL
                     PFLFKVLSIRKVLSIQAHPDKSLGKILRAQDPKNYPDDNHKPEMAIAVTDFEGLCGFK
                     PLEEIADELKRIPELRAIVGDETAEDFIQNIKPKAPKGSLDDEANKKLLQAIFGKVMN
                     ASDEVVAQNARSLVKRAEARPEDFNKPDLPALIINLNKQFPDDVGLFCGCLLLNHCKL
                     KAGQAIFLRAKDPHAYINGDIIECMAASDNVVRAGFTPKFKDVKNLVDMLTYTYDPVE
                     EQTMKPSGFARCSGAGKALCFNPPIEEFAIIQTTFQESTGSKHFEGLKGPSILIVTKG
                     TGMIGTGAKKLKAEPGFVFFIAPDTPVDLETDDNDFVSYRAFVETD"
     gene            <613009..>613692
                     /locus_tag="HG536_0F03220"
                     /db_xref="GeneID:59327212"
     mRNA            <613009..>613692
                     /locus_tag="HG536_0F03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284775.1"
                     /db_xref="GeneID:59327212"
     CDS             613009..613692
                     /locus_tag="HG536_0F03220"
                     /inference="similar to AA sequence:RefSeq:NP_010919.1"
                     /note="ancestral locus Anc_7.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140671.1"
                     /db_xref="GeneID:59327212"
                     /translation="MSTLILGATGLCGRAFLKYCEKSPEFGEICTITRRPLAFESFAT
                     QKVDEDTTKWAGYIPNEHLKYVFTGLATTRGAAGGFDKQYKIDHDLNVELAKVAKKNG
                     CSTFVLVSSAGAGENSLFPYLRMKKDIERDILALDFDHTIILRPSFLLGQRLGSKGWL
                     QGFSAKIASFFYRGKLQMLAGYPVYGDEVGKVGAFLALKESAPGHSGNKVRIVESQEI
                     LRLAESMLK"
     gene            <613828..>615753
                     /locus_tag="HG536_0F03230"
                     /db_xref="GeneID:59327213"
     mRNA            <613828..>615753
                     /locus_tag="HG536_0F03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284776.1"
                     /db_xref="GeneID:59327213"
     CDS             613828..615753
                     /locus_tag="HG536_0F03230"
                     /inference="similar to AA sequence:RefSeq:NP_010920.3"
                     /note="ancestral locus Anc_7.149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140672.1"
                     /db_xref="GeneID:59327213"
                     /translation="MTTYDGYHYGIVIDAGSSGSRIHVFRWQDNAALLAESANEELVH
                     SVPQIFQDKDWTQKVTPGLSRYGSKPHKAFSKHVKPLLDFAREIIPENKIKETPVFLQ
                     ATAGMRLLEPEKRDKVLKEVCKGIKHSTDFLLSSCESQVQVIDGETEGLYGWLSLNYL
                     LGHFNSYDPSKTDHFTFGFMDMGGASTQIAFSPSDRKEIERHRDNIARITLKSVNGDL
                     QEWDVFVSTWLGFGANEARRRYLVQMINGLPENTNYQDNDDYSTRTLTDPCLPKNCIS
                     KFEYKDKDFKFIGSGNFEQCSKSIYPLLLKNLPCSEEPCLFNGVHAPQIDYFKDKFVG
                     TSEYWYTANDVFDLGGTYNFEEFSNHVKDFCSTDWEVIKANSDKGSYNSISQDLLVDS
                     CFKANWVLNVLHEGFDLPRVGVDKIDKEDGEEEHPLFQSAINVNERELSWTLGRILLY
                     ASAGVGTSTSPFVGIKPSSQKVPLLDEPFIPGGLIESKNGQSIRPDLQKLVFFVTVII
                     LCLVFVQRTSTTGIKSFFSNLRLKTLKSRYLEVGDPQSQLEEGFYRNDSNPLDGNNDT
                     SSCKFRSKSMFNLNSGDEATGRSPSYPMRFVAASTSSSPTLSRIPSTPPLQQPKTLRP
                     AFSLADFSKFKDGKLND"
     gene            <615966..>617519
                     /locus_tag="HG536_0F03240"
                     /db_xref="GeneID:59327214"
     mRNA            <615966..>617519
                     /locus_tag="HG536_0F03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284777.1"
                     /db_xref="GeneID:59327214"
     CDS             615966..617519
                     /locus_tag="HG536_0F03240"
                     /inference="similar to AA sequence:RefSeq:NP_010921.1"
                     /note="ancestral locus Anc_7.150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140673.1"
                     /db_xref="GeneID:59327214"
                     /translation="MGLRKRTSKRGSTRMREGIKKKAAAHRRKERKNAKKDPTWKSRV
                     KKDPGIPANFPYKAKILEEIEMSKQRAKEEREMVKQQRLEAKRLAMEGAGDVMDEDMN
                     SDDDIDNGLAALVESAQNAAQEYEDQGDDDEAYHDVVEHDIDFYNGSDEEGSELEKSR
                     KAYDKIFKTVVDASDVILYVLDARDPEGTRSRKVEQAVLQSQGKRLILLLNKVDLVPP
                     YVLEQWLNVLKSSFPTIPLKSAPGATTCSSFNKKLTQTVTATALLEALKTYSNNSNLK
                     RSIVVGVIGYPNVGKSSVINSLLSRRGGHSKACPVGNQAGVTTSLREIKVDNKLKILD
                     SPGICFPSDSKKKSKTEQEAELALLNALPSKYIVDPYPAVLMLIKRLAKSDEMVNSFK
                     TLYEIPPIPANDPETFTKHFLIHIARKRGRLGKGGVPNLASAGISVLNDWRDGKIMGW
                     VLPNASKGTENGIDTQPNTLSTGVSQAPAKMEETSIVPEWSKEFDLDGLFASLDNAIK
                     SEKQQDETI"
     gene            <617700..>619160
                     /locus_tag="HG536_0F03250"
                     /db_xref="GeneID:59327215"
     mRNA            <617700..>619160
                     /locus_tag="HG536_0F03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284778.1"
                     /db_xref="GeneID:59327215"
     CDS             617700..619160
                     /locus_tag="HG536_0F03250"
                     /inference="similar to AA sequence:RefSeq:NP_010922.1"
                     /note="ancestral locus Anc_7.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140674.1"
                     /db_xref="GeneID:59327215"
                     /translation="MKYRVGDRLNIGGEICTVRYVGEICKWPETNAYGVEWDNPTRGK
                     NDGAVDGVRYFEVSKYRSGSFVKATKLENEAHTGFSFDRAFAQKYLTPPIELASSAPA
                     SKPEVAKGLRPTEKVFLDGCSINDERISESALNVIRANCAEVTQLDLSSNLLSTFSQT
                     CQLISEFKNLRYLDLSRNVFSKGWDSLGEFSFHRVKRLQLVGCGLKIDQLEKVFKCFP
                     CLETLDLSWNDLSSPTGETIYFPSTLTELSLSGNLMNSLPSGISSLRLRSLNLSHNLL
                     HALDILPFPKLIDLDISHNMIQKWDTLDLLNQALPELRFARINGNLFNAAGDEISNFY
                     ATIARLQSIEGLDGSMLSKATRQEAELFFVSKVISGQIEYDRRLPRWTALARKYSIHE
                     KQQVTRKSWLEYLIITVRVVNEENQNSAKCSILTNYSVRYLKTIIARKLQLGKGPFQL
                     FFYPAPDARQNMDSEFRQVNYYGICDNTTIYIKRVA"
     gene            complement(<619229..>619842)
                     /locus_tag="HG536_0F03260"
                     /db_xref="GeneID:59327216"
     mRNA            complement(join(<619229..619763,619832..>619842))
                     /locus_tag="HG536_0F03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284779.1"
                     /db_xref="GeneID:59327216"
     CDS             complement(join(619229..619763,619832..619842))
                     /locus_tag="HG536_0F03260"
                     /inference="similar to AA sequence:RefSeq:NP_010923.3"
                     /note="ancestral locus Anc_7.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140675.1"
                     /db_xref="GeneID:59327216"
                     /translation="MFRKFTKDDIHSRSKVKSSIQRTLKTKLVSQYPKLEDVIDELIP
                     KKSQIELIKCEDKIQLYAVDGEVLFFQKFDELIPTLKLVHKFPEAYPTVQVDRGAIKF
                     VLSGANIMCPGLTSPGASLPPAPGYQKDTIVVVKAENKDSALAIGKLLMSTEDIKSVN
                     KGHGVEMIHHLGDPLWTFSVE"
     gene            <620493..>621719
                     /locus_tag="HG536_0F03270"
                     /db_xref="GeneID:59327217"
     mRNA            <620493..>621719
                     /locus_tag="HG536_0F03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284780.1"
                     /db_xref="GeneID:59327217"
     CDS             620493..621719
                     /locus_tag="HG536_0F03270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140676.1"
                     /db_xref="GeneID:59327217"
                     /translation="MFKSTVNPSFGAPAHACTHEKEPKLGKRQRIKTVLMKMWTKNCA
                     KNPRSDVSISEGTNGKNYLDSTKGCVLEQTKSFAFPAEEEVPSTASSQVTNGSTLTLR
                     SFCGSSVLSEDLETQKVNSGTDLPRSSAIPAEQHAIPCSSAAEMNSSKALDKPCYSTT
                     KKAGLYQRPEAYKDVSETAVDETWIAKCLKDYCPVRFRRIKHLDYESPEFRSKQLSMA
                     LHAVADQERREGDYKVRFRPERGRSKPFLRGLLHFEMDEDIVDSLEDFIASNRGLPSL
                     FTGTGPAVRRHFFRRWKNVDRDKAIIYDHLKRMWSLDKRFVKQLKMARELRSDELEDR
                     RFLEELFNGPSDRFPPFSFFTNRLTTKLKSLRTPAEQEQRLDGVPPERSISSHPYFAL
                     QKRRAKIWIKNLLLSI"
     gene            <622271..>622939
                     /locus_tag="HG536_0F03280"
                     /db_xref="GeneID:59327218"
     mRNA            <622271..>622939
                     /locus_tag="HG536_0F03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284781.1"
                     /db_xref="GeneID:59327218"
     CDS             622271..622939
                     /locus_tag="HG536_0F03280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140677.1"
                     /db_xref="GeneID:59327218"
                     /translation="MPKGYRENPDFGFSAMPRSRQRRLNVNVWDAQPRKTKRPEDGPE
                     DGPEDGPEASPKRKGKTERLKLKMDVMASWFSKKARQIALVPDERQHKKGKRHHLRFW
                     KNRTQVAETTLVSATAHSTSEAPTSSHHSCFSINDCLSSPPTFALSQSELEDPSFEDT
                     CTVIYRPLISSLDMDSVERMQLRLNTETSEMLLRCADLTVSQGVYATGSRLDHRGSEE
                     AVPL"
     gene            <625071..>627071
                     /locus_tag="HG536_0F03290"
                     /db_xref="GeneID:59327219"
     mRNA            <625071..>627071
                     /locus_tag="HG536_0F03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284782.1"
                     /db_xref="GeneID:59327219"
     CDS             625071..627071
                     /locus_tag="HG536_0F03290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140678.1"
                     /db_xref="GeneID:59327219"
                     /translation="MSVYEVKYNTSASDPWAPFNEAIKRRQENPESFNGQEQVPWPWI
                     DESENENVQIVFEQQGSLADENQGNQTTQEEFSGQGNASDSEDCENRESESDSSRYDD
                     SDTDESEYEEYDGPDDYITDVFDITNVNPAVEDAIAYYNKTGANRRTLEHKKELAAII
                     NKQREDYYSPPSNDDTTASNDSDSSQELPVFPLPPYNPLFDDIRQKRSERRLQFGTTR
                     VIRFKRSDIVAKDGSTVPKDKLPGKSILKNEKDQFVTPNHDFELVGESKLFTAIGRLY
                     NLCDMPLEFLNKNAPVHSTENLAAGFANAFKTQQLCWKRMSEEAVRVRVEALKKRKTE
                     IEALKLEKDALNVEVAELRQMLREKEINLEDVVRKSRIDLSLAEEKKQDLKQAIVQME
                     AIKLDLLQVRSMADELQVENDALRKELKSCQNNLQEQKEVSKPLLIKIKELEARVLKE
                     QKYTVDSQQKLAFLERYRRESFVLQKKIEDLEESNRKLVSESGKLQEVNDDLLRQSNL
                     LKNSLTLTVENLKTSNKREAELAKANKNLVKQLDESNANVRRLVDTNTAYKAKFHLKY
                     QEFEKRYAQAWADCNNRRKEIEKTKLEMEKMGGTLRETRKEMARKRGHNTVSICSANM
                     VVHEPPIDVSTAQSSHVKRRHRIFQSLTNRFYSSPVINAGEV"
     gene            complement(<629577..>632585)
                     /locus_tag="HG536_0F03300"
                     /db_xref="GeneID:59327220"
     mRNA            complement(<629577..>632585)
                     /locus_tag="HG536_0F03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284783.1"
                     /db_xref="GeneID:59327220"
     CDS             complement(629577..632585)
                     /locus_tag="HG536_0F03300"
                     /inference="similar to AA sequence:RefSeq:NP_012267.1"
                     /note="ancestral locus Anc_7.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140679.1"
                     /db_xref="GeneID:59327220"
                     /translation="MAKVDENYDDLDDEELECLHAGGVNKVVRKAVIRKPKALQTDLN
                     GKVIEGQQAFYEEIRNDVTFGPTHHKLCHENLQQFIYPTNFEVREYQFDIVRKALFQN
                     VLCAIPTGMGKTFIASTVMLNFFRWTQSGKIIFTAPTRPLVAQQIKACLGITGIPQDK
                     TAILLDKSRKNREQIWNEKRVFFTTPQVVENDLKRGILHPKEIICIVLDEAHRATGSY
                     AYTNIIKFISRFNTSYRVLALTATPGSDLEGVQEVIKNLEISKVEARTEESIDIVRYM
                     RKKERLKIEVAVSSEIEDLIEQVGAAVLPVLRQAVELDIYEDCDPSQINAFKAMQQSQ
                     KIIANPSIPEGVKWRNFFILQLLNHVGQMLKRIKIYGVSTFYNYFMDKYREFTTKYSL
                     GKSTNKIAAEFYFNPILITMMKRCEALLANPQFLSHPKLRHVREELTDFFSEDSLDSR
                     VIIFTELRESALEIVKCVDLMNGPGSNYRIRPHIFIGQAKGKEGFDEVTFTRKNQPKG
                     RKKADRMKRQEEDKQLEEQKKQKKKEEQLERDARRTGSSEDAQIKGMTQKQQKEVIQK
                     FKTGEYNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGKIVLLF
                     SSNESLKFEQALKDYYGLQRLLCQNHLTYTKSDRIIPPNIKPVCRKEHINLDEEALEV
                     NKMEDTEEVIRYATQCMLGKKPKAKKRAKGKEPKREKRFFMPDNVDGGIVTAMDLVTK
                     TKLPENRLDDDIRCKESIDRNESTSVETPSSAKDKPKDFSFTELARPATRMKLPSLIG
                     RTSDKIKDEQDDEIPTGKVTSDASDGINLSRKIDDDGLSTPASKRQKSISIETKSAFS
                     NRKLPERNTLEDADERNHGGLLTSSEREYFLQHYSPDDAVSIATIPNFVRSTKCAEVD
                     HSILNQKILQLFEELRQNRTHRTIEMNRTKCIARGIQSGIVNQSHVQPSVMVKCDCYQ
                     TTEPRHSTMTDVPAKGADDLDSLLSSDSDF"
     gene            complement(<632780..>636574)
                     /locus_tag="HG536_0F03310"
                     /db_xref="GeneID:59327221"
     mRNA            complement(<632780..>636574)
                     /locus_tag="HG536_0F03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284784.1"
                     /db_xref="GeneID:59327221"
     CDS             complement(632780..636574)
                     /locus_tag="HG536_0F03310"
                     /inference="similar to AA sequence:RefSeq:NP_010924.1"
                     /note="ancestral locus Anc_7.154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140680.1"
                     /db_xref="GeneID:59327221"
                     /translation="MKSSRSPFKKFSHSREGSTDEKPSSVHKRIISGSGSAKHARNVS
                     GNSMGNAPPVSGIHVSHRRTTSNSSRSSQSSNFLAEQYERDRKAIISSCFTMYDRNSG
                     APNNYITHVRIIEDAKSPSSRPPPNAQLQNKKKRILILSSKPDSPNAIQLHKGRENTD
                     GSFQIGRTWDLKELKRVERDTEVDEGFALTMGKKYYWETNSAKERTVFIKSLINTYMQ
                     AFDGHVPQLINWDLSIFYLDERSYQRAVITRVSGTDAASVNKTSGHSMPQAGPASPLG
                     NINSMRDADASQQPTANLLHRAPYSNSPTIAEASKRYSSSQHENEGKPVAEGDGLNHM
                     VTTDEPSFIDKNLDAMSKASVERQALSSARSSPSKDGYSSQSQGGASGNRRDHLLEDL
                     NNVLASEIQYVSEAASNLEPGPLRPKEESFVHEDFSKESPPLVAKVESIVEDIRYEPM
                     AFGDQDLDLNETISNEGDTTNDLSFERGDEVRHSQVLEPGSSHTYHEVSTIQEEVQFG
                     TDRIAKDKMFPALEADRASDSKGPQMKKKAWDIEDEEILEILTDVNWGAEDDADNLIE
                     RLNSKIAEAEYNFNNSLLSLEKLALDLRPYEQNVARECDKLNPILSLFLMEMSNVSGD
                     IEYVESQHNGLQVESANKKQLWNTLSELLNTVSLDEDSLGELLNCPIAERYLAKMEGQ
                     LRALFKALKAINGEEDEEHYNLGQMRALKHRRETYEKVTKVFLERLVNEMVGKFVNIS
                     IDELSEDHLTSFLSRLLRFSSLILFCKDVSPDSYKYLIEKWNGTICEVYNKMCQSVLR
                     ELELLKATLPSREKRTINEEPGLADLLSEWKHIKSKEIPRTKVSTSSELVGSLRKAME
                     TFERWVIVYQNFIDNFFHICSKLDFEEFLTRFAAAESRTAQLLEIRGMQPDRTSAAVE
                     TQLVSKIFQPITARISSGLIEVLKCDRSIAPALMISLEREIKSLESSNAEFLVSALSR
                     LLSQVIQVWSDYVDDQVMYMQRIRINVSSRSLLPSVIELPLFIKNSQDFIRETELELQ
                     MDDEDAFETRKIFEAACSKMSNCLADLFTTKNNDTKDLLDAAEAAETVPSESGNIDRT
                     ITLLMNCHWLLEILALLNSRGIFDNSLREAKSVFDVEKDNYASYLLRDSMPKLTSFIH
                     GASNLIASTPTDRMVDPSKWAAYSKHNLEIILSSYTSHEIDTLVKRLHGYMLAHFANE
                     PDESIKKALFDKIWSCIQGQTVSLYLRLYTLIEKHYKGTYVKFTKNDIITAFESYKKQ
                     HV"
     gene            <636729..>637199
                     /locus_tag="HG536_0F03320"
                     /db_xref="GeneID:59327222"
     mRNA            <636729..>637199
                     /locus_tag="HG536_0F03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284785.1"
                     /db_xref="GeneID:59327222"
     CDS             636729..637199
                     /locus_tag="HG536_0F03320"
                     /inference="similar to AA sequence:RefSeq:NP_010925.1"
                     /note="ancestral locus Anc_7.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140681.1"
                     /db_xref="GeneID:59327222"
                     /translation="MKVTQIFQLDRGPFTAIGYHCLSTSSSYYLSMSLDFNALAQQFT
                     EFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQRVQHRITTLDA
                     QPASPSGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDGSSYYVFNDIFRLNYSA"
     gene            <637431..>639461
                     /locus_tag="HG536_0F03330"
                     /db_xref="GeneID:59327223"
     mRNA            <637431..>639461
                     /locus_tag="HG536_0F03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284786.1"
                     /db_xref="GeneID:59327223"
     CDS             637431..639461
                     /locus_tag="HG536_0F03330"
                     /inference="similar to AA sequence:RefSeq:NP_012268.3"
                     /note="ancestral locus Anc_7.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140682.1"
                     /db_xref="GeneID:59327223"
                     /translation="MSSDDVPRIPERPQRVRGHRLTEEISQEKFPLPSSAEADLAKAE
                     GSELPKIPGHRPQRLKNSSSSPVLPVSKPHESSDLKPSVPGTRPNREKKENMRENGGI
                     TKDEGSQSRQESSDHEPTPQLPAARPQRLKSTPATTAVPSTGPLATLKTVASTDEVER
                     SEEPLDQSLKRSTTENLDMLVQNTSEQLKEMEMLLSKREMAPVRGNSLIKPIEVADVS
                     SDRRLMPENPEQKSTGPNDGSKTETQAASKSESDEPQSSAAENDREEVNRELLRETEQ
                     SESTAEEHPEEVHVMEATNQGEMKGTQPEREVSPDEEPPTTYSTKAQANLSSLDEQEV
                     AEFTKDFTPAPELDHLSSDKVEETKGGDISSELAPSVFEETEVLSQKSDHSSIPSAKR
                     AAPPVPKKPSSRIAAFQQMLQNQQLEQLQGSIPFRPHESPLSMESGTGGAPNYHRKAL
                     NDERAQFGKNLGTLFANPDMVTGSSISTDRRTEGNKLEEPNENSTRTPSESQQRRARG
                     PRGRKLPSLVANVEKVKTENSNDIELFHMWTIVSNNRDDKNTKEVLKDDSGQKSAQLS
                     EGRGAFEILSDGTQERRPSVLEDPSQPMVGSQETVNESEDLAFDETPQKLMTQSAFNS
                     KEVHQVRSSAKQELEENLEETANMKPGHKEAQEQSIDDKNGADYSFDLEQEL"
     gene            <639694..>640938
                     /locus_tag="HG536_0F03340"
                     /db_xref="GeneID:59327224"
     mRNA            <639694..>640938
                     /locus_tag="HG536_0F03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284787.1"
                     /db_xref="GeneID:59327224"
     CDS             639694..640938
                     /locus_tag="HG536_0F03340"
                     /inference="similar to AA sequence:RefSeq:NP_012269.1"
                     /note="ancestral locus Anc_7.157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140683.1"
                     /db_xref="GeneID:59327224"
                     /translation="MVVDNEYYELLGIKSTATAVEIKKAYRKKSIEEHPDKNPNDPKA
                     TERFQAISEAYQVLSDNELRANYDKFGKEKAIPKGGFEDAAEQFSVIFGGDAFEPYIG
                     ELTLLKNLQRQEELQAQEDAEKEKEKKKEEQQQAESRKAAEAQPSEEALKARMDNLKL
                     YNKDENVKEASKKTKLEEFEEQLKIEKEKSVEILANKLIERLSILTESVYDDACKDSF
                     ARKFEEEANLLKMESFGLDILHTIGDVYCERARIFLASNTVFGFGGMFHSMKAKGGVF
                     MDTLRTVSAAIDAQSTMKELEKMKGASESEAPLLDKEGNVIAKPTAEELAHQEQLLMG
                     KVLSAAWYGSKYEIMSTLRTVCDRVTHDKTVDKETRFRRGESLLLLGKVFQRAYRTPA
                     EQEEAQVFEQLVAEATKKKRHI"
     gene            complement(<641232..>642329)
                     /locus_tag="HG536_0F03350"
                     /db_xref="GeneID:59327225"
     mRNA            complement(<641232..>642329)
                     /locus_tag="HG536_0F03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284788.1"
                     /db_xref="GeneID:59327225"
     CDS             complement(641232..642329)
                     /locus_tag="HG536_0F03350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140684.1"
                     /db_xref="GeneID:59327225"
                     /translation="MQPALHSIKVQKSGFESEDDLELSTGRTAFSMRLSTGVPRDSCS
                     SSESLRNSVSTQVRSKRRFRRGIKLYFQSFRKKSGTAPKSSSSDTEAYYLTSDDDRYS
                     VDSLEAHGILPKTDSQLSPSYSNDSSIRTRRFKFWSNSTEGDNRTFDEERKVESSRSA
                     VSDTIVFQRPPRHKVRFWLNEKRHGHSDSILEIRQSAITTRIARSRCLAGIAAVEAAR
                     LGEYRRKIRALKFAVAATTAAFARVNKAKQDINASHGSIANAAMYSSKAIAAASIISP
                     QANQDYKKIQRVFNEHFKHKDDPTYFRRLKYIPMQQLDRNSAAYKMHLKLRAIPTPSC
                     KDDIYKFHSTRLDRISTSQHSRASTLQLSIA"
     gene            complement(<643058..>643753)
                     /locus_tag="HG536_0F03360"
                     /db_xref="GeneID:59327226"
     mRNA            complement(<643058..>643753)
                     /locus_tag="HG536_0F03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284789.1"
                     /db_xref="GeneID:59327226"
     CDS             complement(643058..643753)
                     /locus_tag="HG536_0F03360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140685.1"
                     /db_xref="GeneID:59327226"
                     /translation="MPKGYRENPDFGFSAMPRSRQRRLNVNVWDAQPRKTKRPEDGPE
                     DGPEDGPEASPKRKGKTERLKLKMDVMASWFSKKARQIALVPDERQHKKGKRHHLRFW
                     KNRTQAAETTVVSATAHSASQAPTSSHHSCFSINDCLSSPPTFALSQSELEDPSFEDT
                     CTVIYRPLISSLDMDSVERMQLRLNTETSEMLLRCADLTVSQGVYATGSRLDHRGSEE
                     AAPLTSVSQPCWT"
     gene            <644917..>649122
                     /locus_tag="HG536_0F03370"
                     /db_xref="GeneID:59327227"
     mRNA            <644917..>649122
                     /locus_tag="HG536_0F03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284790.1"
                     /db_xref="GeneID:59327227"
     CDS             644917..649122
                     /locus_tag="HG536_0F03370"
                     /inference="similar to AA sequence:RefSeq:NP_012271.3"
                     /note="ancestral locus Anc_7.160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140686.1"
                     /db_xref="GeneID:59327227"
                     /translation="MFNPYEVQSNSGSQATGYYQQMPPQQRQPQQQQLAPFNQTEQQN
                     VGFSSVQQNLNSFPNQSQSVTQQMSGFNGTNALLNSATMGQAKGNYYEQNASIPAGAA
                     FNPKANPTSNPSAFESSNNFQAQAQPLQTQGTGFYNIPFQQPQIQLGGQPQQQQQQQY
                     GQTGMQPQVQQPYQQAGMQAQPLTQQPTGPLSHPQQLQHQATGPQVLQLQQQRTGPQS
                     QFLQPQSTGYGQMQALLPQQTGFYIQSQQQTPLEPLRPNATGFVNSFANNGINNDVKI
                     PARRLSFITANDQAKFERLFRSRVAKGSNTISGNDCKAILMKSGLQPSQLARIWALCD
                     TSKAGELLFPEFALAMHLVNNVLQGDSIPFELQSKIKNEVSSFIDAINLSIASGSQTD
                     LAQTRTPFDQYLPTNAPSLQPQPTASMPQTSFGFPLQSQLTGGAVLNPQMTGSLPQTT
                     FGMPAQTTGGVQLNQQMTGGRLQPLNTGFMPQTSFNAPIQPHATGNGMLQSQMTGGFA
                     PNGMNQNYNSIVPQTTGGFNNALTSQGNATYNQQINLAGGAVTSQQASIPLQQQRTGG
                     TIPNLTSQSTGSIPIQQPSLTGLAAPNAMPQVGNDIPPQVQLYGGLSSTLPSQSTGNL
                     ASLQNQPTGYLPPSGFNPTMPLTAQKTGFGNNEIYSQSNFGSEFTAQNADSITPEEKS
                     LFYKIFETYDTNNRGLLDSSSAVEIFRKSGLNRSDLEHIWNLCDVNNSGQLNKQEFAL
                     GMHLVYRKLNGFQLPNRLPLSLIPSSTKIIDNVKNQLKSVPNKENKQKSKIDALSYKN
                     NDDEVLPSFRNRRKVFNNTVTSSQKTTRPESDVKREKMVSLRKAIEEKRTILHSLRTH
                     ELTTSEQDELRRVEILKSELKNLPQFPNVENDAVPIELRNRFDDVISKLPRIFSRIAE
                     VDNEITNAKVRLFKLKNPSSLSGTGINGEITEEDRRKAKSKAILKARMDALTGRQTGP
                     TESLEEEERKYNLEIRRIQNESGKNQHIIDDIRNSISEISASLRSNMNGGVYGGNPAD
                     FGKWEFGAGLLPEVRSFIETLNSSKETTSRNAVPHSQYPSPGSQSGASVSDARSAEAQ
                     KPSTFASISDVEDDEEERRLREELAKLKLKKKTEKEKRLAELRRQVEEAKVDSDDDKS
                     DFVPVAKPVGNSAAPVVNQTLTPSDIHNSTKPVVQHSSKTPEDPVSSVPAGDRNPFFK
                     QKDPSGSSFDLKAAETQRRLQRGLDDDDDGWSDDEPQTIKAKDQTGGQHAYAKKEPNM
                     EIQTIDARNANSLSSPAMAPPLPSLGGTVDSNSGLSGANNEAVPLAPHLPQAGTAGAP
                     PVPIAPPLPQINSGAGFSMPPPPALPGQSIASAGQNQLSVKSHNLDHGQDSDDVLSIP
                     ESVSSVDEDGSQPSGIPPPPPLP"
     gene            complement(<649273..>649752)
                     /locus_tag="HG536_0F03380"
                     /db_xref="GeneID:59327228"
     mRNA            complement(<649273..>649752)
                     /locus_tag="HG536_0F03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284791.1"
                     /db_xref="GeneID:59327228"
     CDS             complement(649273..649752)
                     /locus_tag="HG536_0F03380"
                     /inference="similar to AA sequence:RefSeq:NP_012270.1"
                     /note="ancestral locus Anc_7.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140687.1"
                     /db_xref="GeneID:59327228"
                     /translation="MNQIRAIQKINEAELNNGILSSHLSWHDEYKRQAYIFIGGLNTE
                     LIEGDILTVFAQYGVPVDVCLVRDRETGDSKGFAYLKYEDQRSTVLAIDNLNGIKLAG
                     RVIKVDHAWYTPRDDLSQYREAVKKELDKDKVIVPEDRHVKATQEMTNELEDPMQNV"
     gene            <649897..>650601
                     /locus_tag="HG536_0F03390"
                     /db_xref="GeneID:59327229"
     mRNA            <649897..>650601
                     /locus_tag="HG536_0F03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284792.1"
                     /db_xref="GeneID:59327229"
     CDS             649897..650601
                     /locus_tag="HG536_0F03390"
                     /inference="similar to AA sequence:RefSeq:NP_010926.3"
                     /note="ancestral locus Anc_7.158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140688.1"
                     /db_xref="GeneID:59327229"
                     /translation="MQDSGEELAKFSTCDVADGLLNLHSIVDGGYFPNLTQYSQRSKV
                     SVVGRAYTVLFAPVDDPRPAVNYIDAISKGCFLVIALSKELQTPYAPYVKVTQACYGG
                     LMSTRAKYQGAVGSVIFGRVRDIEEHRALEYPVFSYGLGACAPKMAIKPVAINVPLEI
                     LCIDGADKIIKPADYIVGDEHGVVRIPGDMDMAALLEYMKTSVEADELVVQDINAGVP
                     AKQAQKERREVLQRFL"
     gene            complement(<650772..>651446)
                     /locus_tag="HG536_0F03400"
                     /db_xref="GeneID:59327230"
     mRNA            complement(<650772..>651446)
                     /locus_tag="HG536_0F03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284793.1"
                     /db_xref="GeneID:59327230"
     CDS             complement(650772..651446)
                     /locus_tag="HG536_0F03400"
                     /inference="similar to AA sequence:RefSeq:NP_010927.1"
                     /note="ancestral locus Anc_7.161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140689.1"
                     /db_xref="GeneID:59327230"
                     /translation="MSINNLILLIAASISAVRAIDPTQSAELNAILNDAKGNLPQYMS
                     VASQVSIPPEIFQLGLAIATAADDSYTTLYSQIDFNQVSTLMTALPWYSSRLEPAISS
                     ALATLTPTATGSTSSQPTSQTNSSPATSQASSSSASGVTSSSASGVTSSSASGATSSS
                     KASSASSTEAPSNTVTSSKSSEASSTTSTVSQTSSHQVSQTSNAAPKPAIGMGAGVLA
                     AAAMLL"
     gene            complement(<652016..>652684)
                     /locus_tag="HG536_0F03410"
                     /db_xref="GeneID:59327231"
     mRNA            complement(<652016..>652684)
                     /locus_tag="HG536_0F03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284794.1"
                     /db_xref="GeneID:59327231"
     CDS             complement(652016..652684)
                     /locus_tag="HG536_0F03410"
                     /note="TIR3-like"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140690.1"
                     /db_xref="GeneID:59327231"
                     /translation="MHFSTLTALALIIAPLVSADSNADAVEFQAILSDVNNHLSDYIS
                     LAVNDPSFTVPSGVLDVYTQMTTYTDDAYTTLFSQLDFSSINAVMTALPWYSSRLEPE
                     IQSAFKANSITDTSIGPKVTDSASSMHSSSNAVSTTTASSGKSNAVSTVTASSGSSAA
                     SETTSVSSTSSADSSTSSVSLSSTTSSAPSSTKTSSHSAAANLNELNTILGIFVIGSV
                     AMFF"
     gene            <653183..>657250
                     /locus_tag="HG536_0F03420"
                     /db_xref="GeneID:59327232"
     mRNA            <653183..>657250
                     /locus_tag="HG536_0F03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284795.1"
                     /db_xref="GeneID:59327232"
     CDS             653183..657250
                     /locus_tag="HG536_0F03420"
                     /inference="similar to AA sequence:RefSeq:NP_012252.1"
                     /note="similar to Saccharomyces cerevisiae PDR11
                     (YIL013C)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140691.1"
                     /db_xref="GeneID:59327232"
                     /translation="MPLSTYFAAVPGTSLTFDGANIILDENYKLPGNDDFEANLGNSR
                     VLRDLVFTAEGSEMVLVLGSSSSLLLEALSSNQRQRYFPEGSVRFKTGDYWRYLKESS
                     QVIYSNEGDVHFPHLTVQQTIDFALSCKYNAPKIQKNQLRDELLQEFGLYHVRNTRVG
                     NDYVRGISGGQRRRVSIIETFIANGSVYLWDNCTKGLDSSTALDFLTILRDMTKRSKS
                     VSLVRISQASDEIVSKFDKILMLSEDHQVFFGTMEECLHHFESTLQIARNPNDSIIEY
                     LTSILRHSSDISRAPKVTLSEEQLYRAWERSRNYQYWKSKVKYDSTDNEIISISACVA
                     QKDGVGMLGQLSTCTKRAFQRIAADKSSMIAEFISVTVQALVIGSLFYNIPLTTIGSF
                     SRGSLTFFSLLFYTFMALTNLPNDFQRQGIIKKQLQLNFYSRWIEALASIICDCTFKM
                     VLVITFTLILYFLAHFQYNASRFFIFLLFLAVYNFSMVSLFSFIAYIAPTVAIANTIA
                     GILLLAIAMYASYVIYLSAMHPWFVWIAYLNPAMYAMEAILSNELFNLKLDCSESIVP
                     RGSTYNNVSFKHKACAWQGATLGNDFVRGRDYLNSGLHYSYDHVWRNFGIILGFLFFY
                     LVISLVAAEYIKPLFTRRHAGVLRRLLNFRNIKKDNLEEKRPIRNADSMTMPSLESST
                     SSESTDSITYLGGVKKYQPTAHGNFSENAPAVHVVTWKDVRFSIGDKIIINNTSGYVS
                     SGLTALMGESGAGKTTLLNILSQRTKGGKLEGQILVDGKIISDIGAFRRSIGFVQQQD
                     VLLQGLTVRETLEVSSTLRGDSDMEYIHTVAAMLDLSFNKLVVDLSPTERKLLSIGVE
                     LVTKPSTLLLLDEPTSGLDPHAALTIVKFLKELSLRGHAILCTIHQPSKSVFEHFDSI
                     YLLQGEGKCAYFGPADRVCNYFTTKDRHLKYRPEQNPAEFIIDAVGNSRRQLDDLHDA
                     SGIMTANYDWSTVWMDSNENQRVLKIAQDLEVKANLSALDLSKTSHTNKPFLKQLLVI
                     TKRQYLCIRRDKSYVVSKFLLNGGAGLFIGFSFWKTKHNIDGLRNAIFLCFMSLCVSS
                     PLINQVQDKALESKEVYLEREASSNTYHWSILLLAQLLVEIPLAIASSTVFFLCCYFC
                     CGYDSSPQIAGVFYFNYILFSVYYLSFGLWLIYSAPNAQTAAVFVAFLYSFTASFCGV
                     MQPYDLFPGFWKFMYRVSPYTYFVDTFVSLLLHDRPVICDTDELVPTSPSDGQTCGEF
                     LKAFVEEYGGAIKNPSSRTVCAYCPYKVGDDFLRQQHMSFDNRWRNFGVQCAFISFNV
                     AAMFVGFYLVHVKIVWHAVSKLPRRILGRKVPGVL"
     gene            complement(<657284..>659242)
                     /locus_tag="HG536_0F03430"
                     /db_xref="GeneID:59327233"
     mRNA            complement(<657284..>659242)
                     /locus_tag="HG536_0F03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284796.1"
                     /db_xref="GeneID:59327233"
     CDS             complement(657284..659242)
                     /locus_tag="HG536_0F03430"
                     /inference="similar to AA sequence:RefSeq:NP_012251.3"
                     /note="ancestral locus Anc_7.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140692.1"
                     /db_xref="GeneID:59327233"
                     /translation="MAMRFRQVIGSLKHGRGSLIRRISLIGSCILLIYLVITSSTQAA
                     SIAVSSKGRSSQISTAGSVGRDAKDSSPFRWIENRRRKALRKAATAEGLLASFWRFFS
                     VNANGIEDSEQQLLVNWENAPLADKCRYMIDATYTMDKGWSNHMIVDFYANEEVDDLL
                     ASLLGERLRLFDYCFIAGGLSMRKVFEIESLIDPDNKSNSSPEDFVKRVFPFLRQAGD
                     QTSDPMWPEVIDLTSGEKEPVPELPDEFSRDFWLNWQTIAKDKGIVVTLNEASKNLFY
                     KQLKVLEHNGNRLPIQIITSGNEFSADFRKELQETVEISSQQVYLINCSPLLDASFAK
                     KNIVNVINKWLAVIFNTFEEAVLLDVDAVPFVPIERFLQDKSYKESGILMYKDRFMPE
                     ERTFQYCVDMLKDVEPSWQEKNLIKSKIKYRSDFTDFDESEEAAVFQRFSHDLLLHHV
                     DSGLVVINKVRNLNGLLFSFMLNLDAKMKRCVYGDKEMFWLGQLYAGQNYSIYPVDGA
                     IIGPVRESVEKDSAIYQICASQIAHSDESQDLLWTNGGLKTCKRNHGAELDFENDPKY
                     FKERYGDLATLQNIYNAPLNLEGMIIPKTQERWIQLEECSGYIYCATAMEEKPVSNSQ
                     QSVSGHISIFDEPTLKKYNSVLSIWNES"
     gene            complement(659389..659461)
                     /locus_tag="HG536_0Ftrna5T"
                     /db_xref="GeneID:59327384"
     tRNA            complement(659389..659461)
                     /locus_tag="HG536_0Ftrna5T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:59327384"
     gene            <660082..>660582
                     /locus_tag="HG536_0F03440"
                     /db_xref="GeneID:59327234"
     mRNA            <660082..>660582
                     /locus_tag="HG536_0F03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284797.1"
                     /db_xref="GeneID:59327234"
     CDS             660082..660582
                     /locus_tag="HG536_0F03440"
                     /inference="similar to AA sequence:RefSeq:NP_012282.3"
                     /note="ancestral locus Anc_7.122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140693.1"
                     /db_xref="GeneID:59327234"
                     /translation="MSEIGGDDVLKEESETIVNLSQELQSQISKNSELGTRLLSLLLV
                     SSSNGKEIIGAINRGDISRIKNLNFNAKVTKSDIKEDEIDVIKRKKSTEASARFRIRK
                     KQREQERQSELKELNIRIQNLNKRVDVLLDENRYWKRQLEKVNDRKSEELLESIRRRN
                     QCTQDG"
     gene            complement(<660664..>662775)
                     /locus_tag="HG536_0F03450"
                     /db_xref="GeneID:59327235"
     mRNA            complement(<660664..>662775)
                     /locus_tag="HG536_0F03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284798.1"
                     /db_xref="GeneID:59327235"
     CDS             complement(660664..662775)
                     /locus_tag="HG536_0F03450"
                     /inference="similar to AA sequence:RefSeq:NP_014606.1"
                     /note="ancestral locus Anc_7.121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140694.1"
                     /db_xref="GeneID:59327235"
                     /translation="MMLEARSAGAGDVAGVAVMQLQDIKEEEDVELTRLDSDGSSEPR
                     QSGSGTLVAEEKQQYVEKEVAVVESGGGSRDDLSLLPPLPNTIERVVEREDAEEQTNS
                     SVAAEPQATVVPDAASQFDLSKALEIPVSFSAANNETSTINNTGSHSDSSLSLTPLIT
                     SPKLSLKKKFSTVTPEGSPSDGCETRAHGSVRNRSNSNVAAFQHILPTLNMAIEAGAY
                     QQPQAADKKLIRKFSFGDSSSLCTSSNSLSETEMLYRAPPPMLGGQRSRSGSNPLNNA
                     PLEGMNTPNSSILEADSSPRKVPLLRRASSAILRKTSLRSSAGKEVSRSSSASATPIL
                     HNGPVFDCGMPVKTPCRNATSSRSLLEGGSSIMNNLESDDELLYVTPLNGTPEGPFRN
                     PSIRSRVRRGFSRIISSSGSVRRVASSASNLRDVPQGHEPEQIDSSRIAPLSTSANNT
                     THAKFELGRNSFGSSKNSSPIEARRSVSNPLVTPISTSTAMTPTTSKTQQQGEITDQW
                     SHGVARPGSMDYFDQSNGARGYENPESGSLAAAGAITETTEEKRINQKDKDQDVGEAI
                     ENDITVDLDKLTQSIPVITVTDKLNSNDYTAVQLQSNIILDEVYKGKNYKNDKRYIGG
                     TRDKHDESKKPEMMTLSEYTGILMRQQQIEDERLAVVEKNFRDSGWCSNDDLMNLKQK
                     RVMISKKWAERISFYQNKLDS"
     gene            <663482..>664141
                     /locus_tag="HG536_0F03460"
                     /db_xref="GeneID:59327236"
     mRNA            <663482..>664141
                     /locus_tag="HG536_0F03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284799.1"
                     /db_xref="GeneID:59327236"
     CDS             663482..664141
                     /locus_tag="HG536_0F03460"
                     /inference="similar to AA sequence:RefSeq:NP_014616.1"
                     /note="ancestral locus Anc_7.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140695.1"
                     /db_xref="GeneID:59327236"
                     /translation="MRVDLRDLRRRDPRVLQLERRSPLASQHHTPLAFDPHRAGTPLD
                     RLRGILHLEDVTVGRENTQCSVVAAHLAWLGRWPLLGSVAKRSGGPFISVGGAGAAHR
                     VRAAASAHLKLARHRYGVPQQQQHHTAPMDDPAVVDIGDDECAERQERAGLRSLVRFA
                     GSCAVNLVLPFVNGLMLGFGELLAHELAWRNNLFDRVRNRGYRVYPPRRVQAAREKTF
                     L"
     gene            complement(<664176..>664523)
                     /locus_tag="HG536_0F03470"
                     /db_xref="GeneID:59327237"
     mRNA            complement(<664176..>664523)
                     /locus_tag="HG536_0F03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284800.1"
                     /db_xref="GeneID:59327237"
     CDS             complement(664176..664523)
                     /locus_tag="HG536_0F03470"
                     /inference="similar to AA sequence:RefSeq:NP_012280.1"
                     /note="ancestral locus Anc_7.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140696.1"
                     /db_xref="GeneID:59327237"
                     /translation="MASNDHFRRLNYLYQLSAWHTLALARHDGEQALARAHARTLDLV
                     AKRTRAKLLPQLKRTLCKRCHRLLLPQRTVECRLDASDSLVLRCRCGSAKRFAVGLDR
                     DHKTFYEKPGNLR"
     gene            complement(<664516..>665136)
                     /locus_tag="HG536_0F03480"
                     /db_xref="GeneID:59327238"
     mRNA            complement(<664516..>665136)
                     /locus_tag="HG536_0F03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284801.1"
                     /db_xref="GeneID:59327238"
     CDS             complement(664516..665136)
                     /locus_tag="HG536_0F03480"
                     /inference="similar to AA sequence:RefSeq:NP_012279.4"
                     /note="ancestral locus Anc_7.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140697.1"
                     /db_xref="GeneID:59327238"
                     /translation="MNSAEQLTLVCYTCVYLRYMKDGSLLLAVLAAVVVSLADFLATL
                     TTTYLKHNSHPHHDSFTPTDSPVVRAIVLKALRYLQVLLLVQTAYLLPYHATLAQPHG
                     FVDLRIIDERDRQGSWQLWALDLAVTLLELALISEALRPEYAGRRLALPQLQTHRYGI
                     LALLRFDTWSPAVCRDGPELSVVAKPTTRYGSTATATEPPDARAHG"
     gene            <665344..>666909
                     /locus_tag="HG536_0F03490"
                     /db_xref="GeneID:59327239"
     mRNA            <665344..>666909
                     /locus_tag="HG536_0F03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284802.1"
                     /db_xref="GeneID:59327239"
     CDS             665344..666909
                     /locus_tag="HG536_0F03490"
                     /inference="similar to AA sequence:RefSeq:NP_014615.1"
                     /note="ancestral locus Anc_7.116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140698.1"
                     /db_xref="GeneID:59327239"
                     /translation="MLNCGRSAAIARGTVRRAHWAPVGYGRRFYAGGSEGSGEVPSSK
                     VKSKEPLMQRIRHEVKHYVNGTKLLGYEIRISTKLLVKFVQGYELSRRETNQLKRTMG
                     DIFRLVPFSAFLIIPFAELLLPVALKIFPNLLPSTYESGTDKQKKRNKLNEIRRKTSD
                     FLHETLEESSLLSYNAIDNTETKKKFYHFFKKLYSPKDGKTNVFTHDEILSVAQMFKN
                     DTVLDNLSRPQLVAMAKFISITPFGNDNMLRYQIRHKLKQIMEDDKVIDYEGVGVLST
                     EELYQACVSRGVKAYGVKRDELVDYLRVWLDLRLRHKVPSVLLVLSSTFTFGGLEKRR
                     EADRKVISPEAEGKEVKSRYDELLDLYYDAILQVLSSIPDPVYNVTKLDVSEAKAAPS
                     ETETKKEPAEQPAEAARETIARGVAEAEAGVEPFKKQVPHVSETTTAEQETKTEKKEE
                     EEEEPPKTDENEFKLNVLKEQEALIKKEQEEAKNRTSTAPISDDITLDEDDQPRPPVP
                     ADQAAETSVTKKD"
     gene            <667234..>668508
                     /locus_tag="HG536_0F03500"
                     /db_xref="GeneID:59327240"
     mRNA            <667234..>668508
                     /locus_tag="HG536_0F03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284803.1"
                     /db_xref="GeneID:59327240"
     CDS             667234..668508
                     /locus_tag="HG536_0F03500"
                     /inference="similar to AA sequence:RefSeq:NP_012283.1"
                     /note="ancestral locus Anc_7.115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140699.1"
                     /db_xref="GeneID:59327240"
                     /translation="MSIDREQDVAKYAELKPKSSADAQLAMSKVYTSRSWNLPPRSKP
                     GRRPTFRNGTVSQTSTDQQSRAEGSEEESYDLEERKKRQNRDAQRAYRERRANRLLEL
                     EGVVETLQNLVKTWQRKYKAVESELNESKRRVAVVEEENASLQKKLGEILASAQSTNL
                     VRHEEADTMLLDPLLQGMIHNFKPMKAVALKKRKLSENARINARDSSDVPGGLDLTPA
                     SASSVDCGFCSGDTACVCEELANGNSESNVSNRCTEDTATCTKCSNIEESCIKPQAFK
                     EAIVQTAVSRKRCISAPQSTGMPALFDKATVSLQTSVSLGSAESLAADGGHYPNSRRT
                     ACGCKEKSPAGTKYVPMIAKDSDLKLLGLDHGEQPNTMDPNFVPGSCTKCQRDPQRKA
                     FCQAIFGPPTEQNCDGKKSSCCGEGSCSKADQ"
     gene            complement(<668622..>670052)
                     /locus_tag="HG536_0F03510"
                     /db_xref="GeneID:59327241"
     mRNA            complement(<668622..>670052)
                     /locus_tag="HG536_0F03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284804.1"
                     /db_xref="GeneID:59327241"
     CDS             complement(668622..670052)
                     /locus_tag="HG536_0F03510"
                     /inference="similar to AA sequence:RefSeq:NP_014612.1"
                     /note="ancestral locus Anc_7.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140700.1"
                     /db_xref="GeneID:59327241"
                     /translation="MVSFAILFLSLLAALVYGQNGNSSEIATINITGNAFFNSKTGDR
                     FYIRGVDYQPGGSSNLTDPLADVETCKRDIPVFQDLGINTIRVYTVDNSLDHAECMQM
                     LQDAGIYLILDVNTPEASISRYDPACSYNADYLQSIFATVDVFAQYDNLLGFFAGNEV
                     INMANNTFTATYVKAVVRDLKKYIRARNYREIPVGYSAADIESNRLLAAEYFNCGNDS
                     DARIDMFGVNDYSWCGQSSFQTSGYSQKMKLYNGYSIPIFLSEFGCNQVSGSRPFQEI
                     GSIYSTQMSSVFSGGLVYEYSNETNNYGLVQIDSPTEVTKLDDFNNLKNQYSQHPDPT
                     GSGGYSTSNNHSTCPDYQAGVWEANNTLPEMPSAASAFFKSGAGAPMGTGFTTQQQCD
                     SDGIDSIDNSSSDSSTITSSSSADASSTDSTSSTLSSSTSSATSSATSSSSTSSSSSS
                     KSKGSGAVLEIPRGLQMIAQLFTMII"
     gene            complement(<670260..>670727)
                     /locus_tag="HG536_0F03520"
                     /db_xref="GeneID:59327242"
     mRNA            complement(<670260..>670727)
                     /locus_tag="HG536_0F03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284805.1"
                     /db_xref="GeneID:59327242"
     CDS             complement(670260..670727)
                     /locus_tag="HG536_0F03520"
                     /inference="similar to AA sequence:RefSeq:NP_010276.3"
                     /note="ancestral locus Anc_3.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140701.1"
                     /db_xref="GeneID:59327242"
                     /translation="MKVTVNKVHSVFAWTWHIPKDNQDDNIEPIADDDGDDDVCGICR
                     ASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYKWLDTTTSRGLCPMCRQLFQLKKG
                     LAINDSQTAKFRELRHRQWQNRQQELGDQQDNNESDLLGDQDDSMLDQGLVVR"
     gene            complement(670863..670935)
                     /locus_tag="HG536_0Ftrna6T"
                     /db_xref="GeneID:59327386"
     tRNA            complement(670863..670935)
                     /locus_tag="HG536_0Ftrna6T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:59327386"
     gene            complement(<671405..>672064)
                     /locus_tag="HG536_0F03530"
                     /db_xref="GeneID:59327243"
     mRNA            complement(<671405..>672064)
                     /locus_tag="HG536_0F03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284806.1"
                     /db_xref="GeneID:59327243"
     CDS             complement(671405..672064)
                     /locus_tag="HG536_0F03530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140702.1"
                     /db_xref="GeneID:59327243"
                     /translation="MSGCTSARSSLPNGPDASTRSSWPPSWRPSSWSSTTCGAVSASF
                     SSVRSPSIRSQNVEILDPRSRASCRTACGSLHRSSSALRIFARWAITDGVIADARLAD
                     SSGCNSCSASGAFCCDACSATTGRASKTSTHASSTSASPTFGSQYMNKGSQDSDRSGP
                     STYLAWALLGQFRRSYKRNVLFHQCNQVLGQGYLLLEIAEDQYPGLQRPFGSFRLYQM
                     L"
     gene            <672538..>673074
                     /locus_tag="HG536_0F03540"
                     /db_xref="GeneID:59327244"
     mRNA            <672538..>673074
                     /locus_tag="HG536_0F03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284807.1"
                     /db_xref="GeneID:59327244"
     CDS             672538..673074
                     /locus_tag="HG536_0F03540"
                     /inference="similar to AA sequence:RefSeq:NP_013722.1"
                     /note="ancestral locus Anc_7.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140703.1"
                     /db_xref="GeneID:59327244"
                     /translation="MVQAYIHDNNYETDFREAHDSGVPVTLEQLSKLGVFYKYLETQE
                     AVDALAEERNYKNRDIVNISRATFPDEQSLLNKLSIFFTEHLHEDEEIRYCLDGEGYF
                     DVRDPISNDWIRIKFEPNDLIIVPAGIYHRFTLTSKNYVKALRLFQDEPKWLAINKPE
                     GDSSTAYQNYVQWVASRQ"
     gene            <673232..>674383
                     /locus_tag="HG536_0F03550"
                     /db_xref="GeneID:59327245"
     mRNA            <673232..>674383
                     /locus_tag="HG536_0F03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284808.1"
                     /db_xref="GeneID:59327245"
     CDS             673232..674383
                     /locus_tag="HG536_0F03550"
                     /inference="similar to AA sequence:RefSeq:NP_013723.1"
                     /note="ancestral locus Anc_7.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140704.1"
                     /db_xref="GeneID:59327245"
                     /translation="MGDGTGIDPIENSPVGDTLSSYLPRVDQFYIPEWLTVQFIANNL
                     ISFTPLFSYGSTIISIERSKTALGFSIDICATMLIASILRVSYYLITPYEITLLRQSL
                     VMIFIQLILLKTTLTYRPEEYKYHNLHDVESLSQLLHDVWFEYFACARPPIFSDDWKL
                     MLKSLSLKNMVGFINKILLVFLYKFLKFFDPSYKRFGSFWQWDDNRKFWRFLIFFAAF
                     QLLLTFLISKVFNWATLTDWMGSAVGTLGLLVESLLPLPQIAILYKLKSVQGFKLILL
                     VSWLCGDTLKISYLIYGAKNISMIFLTFALFQMSLDFYIGGQYIYYRFYYHSLRNEGS
                     MPADNDTNSEFARESFELQDFNIKTLDQYNKNTPPPDQHTKGRAYTLTV"
     gene            complement(<674470..>676758)
                     /locus_tag="HG536_0F03560"
                     /db_xref="GeneID:59327246"
     mRNA            complement(<674470..>676758)
                     /locus_tag="HG536_0F03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284809.1"
                     /db_xref="GeneID:59327246"
     CDS             complement(674470..676758)
                     /locus_tag="HG536_0F03560"
                     /inference="similar to AA sequence:RefSeq:NP_014660.1"
                     /note="ancestral locus Anc_7.111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140705.1"
                     /db_xref="GeneID:59327246"
                     /translation="MYACYRGGAHHSLGRLKYVYRKCELSTTERPKSNLFKPTDADGL
                     RKGTADLQTELADALSYSSEIIEKAVSQSQVAIEAKRKKENALAEHLKIPPSIQGARL
                     SKKRKKYKETAFSLSSKRSRHVTINGDGSLVNDSNAKVAPEVKPARLVSGLNRVLYQP
                     VTLHSLRDSRTGVYNFDSSLEKITPDYLESKQDSNGFVTPYKDQRLLELARKFERKYV
                     SSTSSMTSALSHLHFLLSNFRPLNIVNSPISKHFPQKNCRFTQGAQFPATIILRKLNR
                     KVRSIDSDRSLDREIILSVLGHSLEEFLTEKTPQQEESYHYSKIDEFVLRSQLDAYDD
                     NLPGTGVFDLKTRAVAAVRHDLSYVEKNNNHTGYEIDKVYGEFESLEREFFELIRSTL
                     LKYSLQARIGKMDGIFVAYHNISRMFGFQYLPLDEIDYIIHSSHDSAFWRALERRNET
                     FRQIYGDESFITSYQRKERKIASQVADAEFKMSIILLKNILTYIEDKLKSHNVKDWKM
                     CKIMMKTKEVTKTRANGQQFNFPVMKVMALALPSNYADMPLVTKNKTQEEILEQIDAI
                     QKYNEELSTSQLDSMIGFEVRVDHFYKSHPDSVHLPAFARVENNVLDVKTCHMISSKL
                     YEDYYQDPRKYRNPSFFHAKDVQTWRTMCKFRDIEIKSDLKKLYNELLDEKLQSLRDQ
                     TIVKETATKPNEREAIMQRLKIVCTSNNRKSQDLKCDQSAADAPSQFQAKLRAYAKKG
                     MIRRKHMDALERQRIGQVSQAG"
     gene            <677515..>678888
                     /locus_tag="HG536_0F03570"
                     /db_xref="GeneID:59327247"
     mRNA            <677515..>678888
                     /locus_tag="HG536_0F03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284810.1"
                     /db_xref="GeneID:59327247"
     CDS             677515..678888
                     /locus_tag="HG536_0F03570"
                     /inference="similar to AA sequence:RefSeq:NP_011842.1"
                     /note="ancestral locus Anc_7.110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140706.1"
                     /db_xref="GeneID:59327247"
                     /translation="MSLQRTIAGRRLLPIGRFVRNYSDVRDAATAIQGGKILRTKFDN
                     DSTTVTFITKDSPKHEPFTVTFNNLFLRDSSKSPKSVDLKSGQKLFTTGYLASNPSST
                     VPTKVEVSPDSQSVLIDWKDGDSYKYSLEFIYKFKGSTFVTDALRNSISKHKPVLWDR
                     KTLKGNIADLNSVNYEGFMNEEQKLYKALTILQKYGLTFINDVPKGDHDAVRKICERI
                     GPIRNTIYGETFDVKSDVTTTSNIAYSNFSLPLHMDLLYLENVPGFQLLHSINNSPAE
                     SGGANIFVDAFSAARHVREQDAEGYEAMQHVPVNYQYVRDGNCFYQSRPMIEQYDSNE
                     SNTLMSNYEYLIKRVYYSPPFQAPFTLGIYEKTPDTNTSPAKLTERFLFRDFVHGLGV
                     FDQFINRPENQFKLKLPENTCVIFNNTRILHARTAFKSTDRWLKGCYLDRDSFSSKLK
                     YLEQKYI"
     gene            <678905..>680023
                     /locus_tag="HG536_0F03580"
                     /db_xref="GeneID:59327248"
     mRNA            <678905..>680023
                     /locus_tag="HG536_0F03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284811.1"
                     /db_xref="GeneID:59327248"
     CDS             678905..680023
                     /locus_tag="HG536_0F03580"
                     /inference="similar to AA sequence:RefSeq:NP_011841.1"
                     /note="ancestral locus Anc_7.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140707.1"
                     /db_xref="GeneID:59327248"
                     /translation="MKLSDSYDSTGQQRAMPRTLSEYMECCSTKSDLSDALKPNPRNI
                     RFTSANTSLADTLRTIISLTRHSIEQHQQPISIIQDFGTTLCFPDINDSSSTAGKIAI
                     LLSLARTIQSTLSTGQTRTIRDVYYSNVELYGSQRKVEYWLSSITRNLRLESRDCLHI
                     LPAQKGLCYTPCDIRIQTAGKETVIAAHTSSMVPYIARGSSVQILPPADQDLKLRLVV
                     LEKEAVYHTVVKTCPPPNTIFVTGKGYPDFLSRLFLQLLERNDCIADWRLYTDADPHG
                     IDIALKYMQNEDHKQYMCKSLVYKGALLTKLLKRRNVQFLQLNHRDISLAIGLIKRLS
                     QPSSHPSNIGCLRVQLQRQMFFLKKAEMNSMAIDEYVL"
     gene            <680173..>680817
                     /locus_tag="HG536_0F03590"
                     /db_xref="GeneID:59327249"
     mRNA            <680173..>680817
                     /locus_tag="HG536_0F03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284812.1"
                     /db_xref="GeneID:59327249"
     CDS             680173..680817
                     /locus_tag="HG536_0F03590"
                     /inference="similar to AA sequence:RefSeq:NP_014659.1"
                     /note="ancestral locus Anc_7.108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140708.1"
                     /db_xref="GeneID:59327249"
                     /translation="MYSIQTFCQLAIASFILLWSGQVSASTSNYAPIAINLPAFSKEC
                     FYYDLISHDDSLVVSYQVLTGGNFEIDFEITAPDGSQIVSEKQKKYSDFLLKSFGLGQ
                     YSFCFSNTYGTALKKVEIVLELEKGALGDEASSPKDAVANNAIEEIDRSLTKISKTMN
                     YLRAREWRNMSTVESTYSRLTWLSLLIMGIMVGISVVQAGIIQIFFKSRSRNYV"
     gene            complement(<680887..>681474)
                     /locus_tag="HG536_0F03600"
                     /db_xref="GeneID:59327250"
     mRNA            complement(<680887..>681474)
                     /locus_tag="HG536_0F03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284813.1"
                     /db_xref="GeneID:59327250"
     CDS             complement(680887..681474)
                     /locus_tag="HG536_0F03600"
                     /inference="similar to AA sequence:RefSeq:NP_009394.1"
                     /note="ancestral locus Anc_7.107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140709.1"
                     /db_xref="GeneID:59327250"
                     /translation="MRPFTAHRMLFNGIRNTVGKRLSSTASRSFFLSPKLTARATGLT
                     IATSVGIAAPWLYKFGSIIYNDAVVDANGNPTAAVASLTERATETPVKPRSRFGGKLD
                     YRQLCIGSIFGLVLGVVVGKISTLLVYVTAVGFLCIQWLQNRGMIDKDMTGSIFARYI
                     VKTGRETIDFNTLVWERPSFKISFLLTFLLAAANI"
     gene            complement(<681724..>683964)
                     /locus_tag="HG536_0F03610"
                     /db_xref="GeneID:59327251"
     mRNA            complement(<681724..>683964)
                     /locus_tag="HG536_0F03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284814.1"
                     /db_xref="GeneID:59327251"
     CDS             complement(681724..683964)
                     /locus_tag="HG536_0F03610"
                     /inference="similar to AA sequence:RefSeq:NP_014657.1"
                     /note="ancestral locus Anc_7.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140710.1"
                     /db_xref="GeneID:59327251"
                     /translation="MMRGFKQKLMKKASSSSSANGKRKEKEKEGAVDHKKSGTAAVAG
                     GSTIGSSSGNGGGSSRSSLEKGRNGSAPSGASKHHSGSSGKSGKISSSSKSRSSSGSH
                     GESAKSVRNATPTAGYVATDQNRSDSGSGMANNAAGTPAVMVTKDGSSLDSLQRVDDH
                     PHSRSQPTLIGAAAAVPPTSPNLGINVESAQDYSVATRSSTSVSANTQSDSSPHGSPI
                     SPSGIDIPRLSHSFEKLPTPTKLNADTELDMIKIPQRHSSSRFEPSRYAQLTKLASFD
                     DVSPEETIPLFIAKVDQCNTMFDFNDPSFDIQGKEIKRITLQELIEFIVTNRFTYTHE
                     MYSHVVAMFKINLFRPIPPPVNPIGDIYDPDEDEPVNELAWPHMQLVYEFFLRFVESP
                     DFNHQIAKQYIDQDFILKLLELFDSEDVRERDCLKTTLHRIYGKFLSLRSFIRRSINN
                     IFLQFVYETERFNGVAELLEILGSIINGFALPLKEEHKVFLVRVLIPLHKVRCLSLYH
                     PQLAYCIVQFLEKEPLLTEEVTMGLLRYWPKINSTKEIMFLNEIEDIFEVIEPLEFIK
                     VEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYFLNLCIENAEVILPIIFPALYELTSQ
                     LELDGVNGDDGTSDPYMLVEQAINSGSWNRAIHAMAFKALKIFLETNPVLYENCNSLY
                     LSSVKETHKRKVQREENWQKLEEYVRKLKIGESNNDSERVPRNSDFNLEGQSADHSLA
                     QLNPIQ"
     gene            complement(<684633..>685490)
                     /locus_tag="HG536_0F03620"
                     /db_xref="GeneID:59327252"
     mRNA            complement(<684633..>685490)
                     /locus_tag="HG536_0F03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284815.1"
                     /db_xref="GeneID:59327252"
     CDS             complement(684633..685490)
                     /locus_tag="HG536_0F03620"
                     /inference="similar to AA sequence:RefSeq:NP_009393.1"
                     /note="ancestral locus Anc_7.104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140711.1"
                     /db_xref="GeneID:59327252"
                     /translation="MISEITSDGTRQRVAAMTETEVPSMKLETGEALDGPRTSTSRSS
                     YANGGTGMVERKRSNSRTSSGRNVKSSNDISSASKIFRNLLILEDDLRNQAHKQKVLR
                     WQFTIFLSCLMGVAGFAFYELYFTGESVKGLHRYALQFVLLFIGVTVALFHLGGEYRR
                     TIVIPRKFFTSTNKGIRQFNLKLVKVHSTWNERFTDFVRFTSRNVARLNISVLTGVCR
                     LSDSNALVTFWTSVTVRSQPRIGAVDVKLVLNPRSFSAEVREGWEIYRDEFWAREGAR
                     RRVQVPSKT"
     gene            <686071..>687402
                     /locus_tag="HG536_0F03630"
                     /db_xref="GeneID:59327253"
     mRNA            <686071..>687402
                     /locus_tag="HG536_0F03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284816.1"
                     /db_xref="GeneID:59327253"
     CDS             686071..687402
                     /locus_tag="HG536_0F03630"
                     /inference="similar to AA sequence:RefSeq:NP_009392.2"
                     /note="ancestral locus Anc_7.103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140712.1"
                     /db_xref="GeneID:59327253"
                     /translation="MLDYMESVSRAFEQSTGWSRDNSYANITATSKALLDFKIPTAFE
                     FQVSNATTPYTFNTTRVSTRNIFNGSLTYLYSDADNLKDMVRGSGAVSLQQVTETYRY
                     FQPFYNHKSAPSNGDRLVRKSLYYGRMYYPTSNLEAMMIKRLTPYTQVKLKCLSTFNE
                     FNILTCHWQRDTGRNCQELIFSTNDLLCGYRFLHNFLGTPSKMKTSLYNNSSLSLGTE
                     LWLGLITLSPGCSTTLRYCTHAPNTGRPLTLTLSWNPFFGNLSSSYSAKTSTSTTFCA
                     KYDFNLYSIDSNLSFGVEVWRRGSTNQQHEPPTSQSINKTDNLMYHHLLPTLSQSSSH
                     GHGQTKMEHEQQLLQDLTTAFSTSLKRIDREKFEIENFQNDYSCANFTSVWKLSTSLR
                     DKNLKVLWEGKFKGFLVSAGGEFFKSSPLLDNRSRTPLYPARFGVQLQYST"
     gene            complement(<687414..>689234)
                     /locus_tag="HG536_0F03640"
                     /db_xref="GeneID:59327254"
     mRNA            complement(<687414..>689234)
                     /locus_tag="HG536_0F03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284817.1"
                     /db_xref="GeneID:59327254"
     CDS             complement(687414..689234)
                     /locus_tag="HG536_0F03640"
                     /inference="similar to AA sequence:RefSeq:NP_009391.2"
                     /note="ancestral locus Anc_7.102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140713.1"
                     /db_xref="GeneID:59327254"
                     /translation="MPAVLRSRIKAEDEGETEPKSSSPKAFGRRIKRRKRNSTDSENG
                     EISGSDGYLEHSHGPVGNSRPFEMVGGVPSSLGVPEYSSTLTHPLSVKDSAVLYYSLV
                     NSRKTWVRGEMFELYFTKAAKPVKDSAGATEAPAQAATIQMRDKMQKLCDCTMLGGPH
                     TFPVRLFILKDEEMEKKWHDEQDMRKKEREEARRKVKEEKQRLAEMKKEMQQKKKQER
                     EKLLQLRKENKAKGRVEQEVVKQRRKNDVKKQNEHQNLKRAGSIVSNSSTRRSPAPSS
                     QSVTNPKMIANLNLMAQKDRKLNTLMGIVANGDATLEQVEEFKKFIEIAKNMPPPPGW
                     TPPPQAVQQTERKDAHPSASNVEDRSSNKDEAATILSKDPEKERADEEDIKPTVKGEF
                     KHSEGTAIKKEANSRRKKGDNSIQQAGNNSDEKSMHLTAFQQKYVHGAQIILEYTEYT
                     TPRYLLPKNAIIEFVEDDGSFLLSWIIVHNDADIKRHRSKRIRELSKSLKSEEEKEEL
                     AKNYDVYSERGCPTPLYSPMTVKFTGIHPKFARILLNSVDPAEKVRKAMTTIMEIGTR
                     LSGYNLWYQLDAYDDKDLAEKLRVKLNEHEEESKGRKHRQ"
     gene            <689631..>692930
                     /locus_tag="HG536_0F03650"
                     /db_xref="GeneID:59327255"
     mRNA            <689631..>692930
                     /locus_tag="HG536_0F03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284818.1"
                     /db_xref="GeneID:59327255"
     CDS             689631..692930
                     /locus_tag="HG536_0F03650"
                     /inference="similar to AA sequence:RefSeq:NP_014608.1"
                     /note="ancestral locus Anc_7.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140714.1"
                     /db_xref="GeneID:59327255"
                     /translation="MTVASSSLGVAKRRDEDFDRYPVGKKLRFNSVRYEDFKPGALIK
                     MRLVNFVTYKLTEFDLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKTELLGRSKKVTDF
                     IKNGEDSGLIEITLKNSGKLQDIPHVNAEDQIIKITRRITRLKTRTEYFINDREVTEH
                     VVRALVAGLNIQLDNLCQFLSQERVASFAGLKSDKLLVETLRSIDLGLCEMLASLKTH
                     QSEENDFQKQLNSKQKRLDELLKKRNELQGSVEQLRHYQEKRKRIDIHRKLIPYVRIK
                     AVAAERRLRRAELNQAVRNLKEFLKEKSPLVELDSQIKEKVASAAEELKTTEELFEKL
                     KAACTERAEKLCDIRSRIGRKKLNAESCQKRRSRLRAEIAHKRQELDQERAALRTGQM
                     PDPALFSQLEARQNDLIRHESEIKRAIREAESNITNKNYEISDLKRRIITKEALLSKD
                     DRIGVLDNLASTDRAGGNIFRTVKDAVGYVRDRPEMRLSVLEPPVIAVSVSSPKYAAY
                     LAQCVDFNTRIAFTLVGSEAYDRFANELLDNFRVNTRELSAAEMKPPLPREQLKRLGF
                     DFYLSDIVTGDARVIKMLCQNCNIHSIPISLRELAPQQITKLMEPRSNGKLLFTKFIH
                     GYKVVDMGIGAYSRQVWTKDYECAKKTDFFQISVMSDEKKSSIRAEISQVQAKIDDIS
                     KSIEDLESAKKESRNNLSKSSKENERISRELQELNDIRKKWSLAGATIQRLTSEIEKL
                     TDEIERGLPSQIKQIDDEISTIKTSQTTVLRELAATIKRLKECQKELALSNVRNFEAK
                     NLDISMSDVIQSINRKEEELNNECNSRKKRLEEAKNVNVQELKKEIKSYTEETQQQLH
                     AYVEKYDNEGTFNLEHIEGIIDKLESEVATLNNDESAISILDGVEKEVRDLEKDLPQI
                     ASKLKEVQGLIREKRKEFEPKVDDLVKKISDKFSELFKQIGSKGYVGLSKPTSFAEWK
                     IEIKVAFRDSAELTRLDAQKQSGGERAVSTVLYMIALQPFTTAPFRVVDEINQGMDAR
                     NERIVHKFMVTNACVDNTSQYFLITPKLLTDLYYDERMMIHTVMAGPWVPNPSERPEM
                     ACLGKTSKYII"
     gene            <693102..>694721
                     /locus_tag="HG536_0F03660"
                     /db_xref="GeneID:59327256"
     mRNA            <693102..>694721
                     /locus_tag="HG536_0F03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284819.1"
                     /db_xref="GeneID:59327256"
     CDS             693102..694721
                     /locus_tag="HG536_0F03660"
                     /inference="similar to AA sequence:RefSeq:NP_014609.1"
                     /note="ancestral locus Anc_7.100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140715.1"
                     /db_xref="GeneID:59327256"
                     /translation="MRAIASRLYSGLRKKEPGDLFSSRSILSKKPVKDVHPKAPVRTR
                     FAPSPTGLLHIGSLRTALYNYLLARNTGGQFLLRLEDTDQKRLVPGAEQNIYDSLKWC
                     GIDYDEGPNVNDMKCGPFRQSERTSIYQKYVDGLLESGHAYRCFCSKERLDGLRESAK
                     RLKPPTTTSYDRACADLSQKEIDDNLAKRTPFTIRMRAPDRYPPFKDLLHGVVDIQPQ
                     VNINDRRYDDPILVKSDNLPTYHFANVIDDHLMKITHVIRGEEWLPSTQKHIALYQAF
                     GWEPPSFIHIPLLTSANDKKLSKRKGDASVLNMKENGILPEALVNFCVLFGWSPPRKL
                     ATANHECFTLKEFERIFNLNYLTKGNAKVDDKKLWFFNKHYLQSRLADPSQFEIIAQE
                     VCSNIRPVFGDAVTLDKIKVILKKCGTALTTLNEFKDTFSYFFQRPTYTNSKAASEFL
                     ETHNKEDTLRVLEHFQDAISQSNIEELIRELASQASISKKAIFESLRFALAESHPGTK
                     IPVLIELLGPEEANVRISRAIGRIQAPTSRL"
     gene            <694877..>695596
                     /locus_tag="HG536_0F03670"
                     /db_xref="GeneID:59327257"
     mRNA            <694877..>695596
                     /locus_tag="HG536_0F03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284820.1"
                     /db_xref="GeneID:59327257"
     CDS             694877..695596
                     /locus_tag="HG536_0F03670"
                     /inference="similar to AA sequence:RefSeq:NP_014610.1"
                     /note="ancestral locus Anc_7.99"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140716.1"
                     /db_xref="GeneID:59327257"
                     /translation="MFAAIASGNPLQLSTEVPNSNGLQHTIVLSSTKPKSYSHITLFI
                     LPNVTFPDNFIATVYFKLSPNEDFKIFGYLGNEKPSAIFKVKLPSAASLGQPPSGYGD
                     GLGEIDMDDNIGGMGDSSNHNISELIIGISIEPRDQGMMKINEWKAEQQASKSSSSSL
                     VLSRPGMQGNVLTVGQLATAYPKLTQELAAKIVQHAYNYLSGFLDAAGNVSIKRFDTW
                     WDKFKTRLANDGTFLDEVTSS"
     gene            complement(<695623..>696834)
                     /locus_tag="HG536_0F03680"
                     /db_xref="GeneID:59327258"
     mRNA            complement(<695623..>696834)
                     /locus_tag="HG536_0F03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284821.1"
                     /db_xref="GeneID:59327258"
     CDS             complement(695623..696834)
                     /locus_tag="HG536_0F03680"
                     /inference="similar to AA sequence:RefSeq:NP_014611.1"
                     /note="ancestral locus Anc_7.98"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140717.1"
                     /db_xref="GeneID:59327258"
                     /translation="MARLRSSLLIGLLAGLALSTTTLSKHQDDKESTQLHIGDSQICN
                     EFECYPKVFEASSLWQEIKPGQHLPGGLDVRMNLETGVREAKLCDDEHNAIPNIPVAI
                     PESDSIPETSMHEFTQDFDVIRKLIDSDPESNLESVSAKLEDLMEFAHDYKHGYDIVA
                     HEFDLLKRISCDEQMPLALRDISTIMITSCTRNNPRVVEYINKWYPDFIDQVYQRIGT
                     LITNENRSDPHIKLLKRYLSLLDELTTESYEFTQFELDALDKAWQIPDKQIRIEVLEL
                     ISKLFTVPGSDDSELRKRGLTDPVPFAQMWANNIQELIQDDEIDELHTRKFFDSLYAI
                     KQDFSDVKIEASFLSWLSRQVDERKKQLDSGIKERDLEQDSFDKKMIESRHLVFGNPM
                     AHKIKNWNDEL"
     gene            complement(<697001..>698176)
                     /locus_tag="HG536_0F03690"
                     /db_xref="GeneID:59327259"
     mRNA            complement(<697001..>698176)
                     /locus_tag="HG536_0F03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284822.1"
                     /db_xref="GeneID:59327259"
     CDS             complement(697001..698176)
                     /locus_tag="HG536_0F03690"
                     /inference="similar to AA sequence:RefSeq:NP_009390.1"
                     /note="ancestral locus Anc_7.97"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140718.1"
                     /db_xref="GeneID:59327259"
                     /translation="MGLKDTDKFATKAIHAGAHIDIHGSVIEPISLSTTFKQSSPAAP
                     LGEYEYSRSQNPNRKNLEDAIASLENGKYGLAFSSGSATTAVILQSLPQGSHAVSIGD
                     VYGGTHRYFTKVANAHGVETSFTNDLIKDLPNLVKDNTKLVWIESPTNPTLKVTDIAL
                     VVDIVKKINKEILVVVDNTFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATN
                     DKAIYERLQFLQNAIGAIPSPFDSWLTHRGLKTLHLRVRQAALSATKIAEFLAQDDRV
                     IAVNYPGLDSHPNRDVVKKQHRDGLGGGMISFRIKGGADAAAKFTTSTRLFTLAESLG
                     GIESLLEVPAVMTHGGIPKEQREASGVFDDLIRLSIGIEDSDDLLDDVKKALAASSQ"
     gene            complement(<698432..>698755)
                     /locus_tag="HG536_0F03700"
                     /db_xref="GeneID:59327260"
     mRNA            complement(<698432..>698755)
                     /locus_tag="HG536_0F03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284823.1"
                     /db_xref="GeneID:59327260"
     CDS             complement(698432..698755)
                     /locus_tag="HG536_0F03700"
                     /inference="similar to AA sequence:RefSeq:NP_014603.1"
                     /note="ancestral locus Anc_7.96"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140719.1"
                     /db_xref="GeneID:59327260"
                     /translation="MKYLAAYLLLNAAGSTPNSDNVKAVLESVGIEIEEDKISTLLSS
                     LEGKNVDELIAEGNEKLAAVPTAGPAAGAGAAASGSAAEGAAEEAAEEEKEESDDDMG
                     FGLFD"
     gene            complement(<698815..>699306)
                     /locus_tag="HG536_0F03710"
                     /db_xref="GeneID:59327261"
     mRNA            complement(<698815..>699306)
                     /locus_tag="HG536_0F03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284824.1"
                     /db_xref="GeneID:59327261"
     CDS             complement(698815..699306)
                     /locus_tag="HG536_0F03710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140720.1"
                     /db_xref="GeneID:59327261"
                     /translation="MQRNLPIYSLKTYYLYLALNGDSIVCRRCETLSSLATKRLSYCA
                     PPNDLFPSSHRLEPGPPAGKPPDRSPSGTSSARGSALLQRAGATDPSDAKKISKKWSF
                     SCLKKTHSSEDCLFLTHAPKPSFYGAFCGSAVIHDISSKLPARIHLDSHRYSSKSPTL
                     TAI"
     gene            <699351..>699776
                     /locus_tag="HG536_0F03720"
                     /db_xref="GeneID:59327262"
     mRNA            <699351..>699776
                     /locus_tag="HG536_0F03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284825.1"
                     /db_xref="GeneID:59327262"
     CDS             699351..699776
                     /locus_tag="HG536_0F03720"
                     /inference="similar to AA sequence:RefSeq:NP_014602.1"
                     /note="ancestral locus Anc_7.95"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140721.1"
                     /db_xref="GeneID:59327262"
                     /translation="MSTAPAKKRTFKTYSYRGVDLEQLLGMSNEEFVKLAPARIRRRF
                     ARGLGHKPAGFMKKLRAAKLAAPENEKPAVVRTHMRNMIIFPEMIGSVVGVYNGKAFN
                     QVEIRPEMVGHYLGEFSITYTPVRHGRAGATTSRFMPLK"
     gene            complement(<699864..>701192)
                     /locus_tag="HG536_0F03730"
                     /db_xref="GeneID:59327263"
     mRNA            complement(<699864..>701192)
                     /locus_tag="HG536_0F03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284826.1"
                     /db_xref="GeneID:59327263"
     CDS             complement(699864..701192)
                     /locus_tag="HG536_0F03730"
                     /inference="similar to AA sequence:RefSeq:NP_009389.3"
                     /note="ancestral locus Anc_7.94"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140722.1"
                     /db_xref="GeneID:59327263"
                     /translation="MDEVATRSKEADRRSKEEDEESSLSVVDSNQRESEARNLDLSQY
                     CVSSDAETEKMGEDSIQDLDGLRPHISDLVEGQETSSGTSKRGREKSDEESDHKRLKV
                     GEEEPPHHDDDENEAGDEGDGEENDELDPEADKETVKSAVEIPTQSVKMEDNVSAKVE
                     GDEEEEEEEEEEEVEEDQMAEEKDVEKPLADDSESAKGDGTLSSMPPPIEMEKKRMDA
                     LAEITEIEYKFAELRQQLYENKLLRLQTELQMCLEGSHPELQTYYQKIASIREYKLRR
                     AYQRQKYELNCIDKETRATRTFIHQDFYRQVSDIRNHLLTETTQKWYDINKERRDMDN
                     CVPEVSYHVPIKIAGKTLSCITGYAGAAQQRYPGESLSEDLECENITFRYRSNAVDKL
                     EVIVNRMRLNNELSDLEGLKKYFNAFPGAPNLNGLRDSEIFDDLQDLNLS"
     gene            <701648..>702919
                     /locus_tag="HG536_0F03740"
                     /db_xref="GeneID:59327264"
     mRNA            <701648..>702919
                     /locus_tag="HG536_0F03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284827.1"
                     /db_xref="GeneID:59327264"
     CDS             701648..702919
                     /locus_tag="HG536_0F03740"
                     /inference="similar to AA sequence:RefSeq:NP_014601.1"
                     /note="ancestral locus Anc_7.93"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140723.1"
                     /db_xref="GeneID:59327264"
                     /translation="MSSSIDSLFGAVAPQEVDSSVSKLFGSSSGPVDSILVKNKKRTV
                     VVQVEAAEEAEEQPDGGVGEVSAAEEPLKKKPRRKRDDNTELEDRYFAKLAEVPEETQ
                     ETPDSDKEEDAVEKAEVGQQAKTIDLKEDELEKAERTVFVGNLSNEAITSKKVFKEFK
                     KLFSSDLEENEQSSLFSIENVRFRSISFDEALPRKVAFVQQKLHKARGFVNAYIVYKK
                     KQAVNKVCSRLNGQLFRLRHLRVDSVAHPAPHENKRSVFVGNLDFEEDDESLWAHFRS
                     CGDIEYVRVVRDSRTNMGKGFAYIQFKDFQSVNKALLLDGKTMQSVKEHGSKRKLRVS
                     RCKNIKKNSPSSLENSKLNESHKTKFGRAKKVLGKADRATVGRELTVEGLRATKGQGH
                     AASHLKKRKQRSKTGRVTKRSLAFKKKQASS"
     gene            <703244..>704053
                     /locus_tag="HG536_0F03750"
                     /db_xref="GeneID:59327265"
     mRNA            <703244..>704053
                     /locus_tag="HG536_0F03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284828.1"
                     /db_xref="GeneID:59327265"
     CDS             703244..704053
                     /locus_tag="HG536_0F03750"
                     /inference="similar to AA sequence:RefSeq:NP_009388.2"
                     /note="ancestral locus Anc_7.92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140724.1"
                     /db_xref="GeneID:59327265"
                     /translation="MDNLKLLYELGRLEDLVEERVRLTSVLKIRPSSKDNLNLKRQLD
                     KALDLLHETANNNEENLEKYSKRYSEILLEIPDKVIDLALYEFELPVKGQSPDDDTSD
                     ALGSRDLPKKVRFKDENLVSYNESEQFEPYHDEPQPVPKIDAKVEDDRMKLLNRAEPS
                     QAAVTAPALSNQGLFIQQQQQLLEQDTYLDALGESVRKSHDFAMDINDEVTEQNNQVL
                     HDLESLVDNSGRNLDRAKRRLQVFESTARENGPCFIILLLILILLLLLIML"
     gene            complement(<704783..>705886)
                     /locus_tag="HG536_0F03760"
                     /db_xref="GeneID:59327266"
     mRNA            complement(<704783..>705886)
                     /locus_tag="HG536_0F03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284829.1"
                     /db_xref="GeneID:59327266"
     CDS             complement(704783..705886)
                     /locus_tag="HG536_0F03760"
                     /inference="similar to AA sequence:RefSeq:NP_014600.1"
                     /note="ancestral locus Anc_7.90"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140725.1"
                     /db_xref="GeneID:59327266"
                     /translation="MLFGRRLLPIKKIASNLRRNSSKTLIDDKFTLLTYNLLSPYYMW
                     PQVYTYVPDEYKDWKYRHRLLENELLSRYRADIMCLQELTATDYYQYWEPVIDRDFNY
                     GSKYIAKPPPQYWKREPSDMDGVGIFYNLNKFDYISSSSVYLNDLIGSFDLNELSYLK
                     SKMVKLTDGAGNPTGEQALLEVLRNRNQVGLFVSLKHKDTGTIFVVVNTHLYWKYDEV
                     KLTQCIIIMRRLAKIINTLLVGEHDTTYSKMKVLFAGDLNSPRDSSVVKFLRGEIVKY
                     DNLDIANPLRPYLNRCVFEDVSADLFEHTCYSGKLKGIFDYIWYHNKDFELTKILSGA
                     DVSKELRNSNEFGLPNKNHPSDHIPVLGEFKIL"
     gene            <707003..>708217
                     /locus_tag="HG536_0F03770"
                     /db_xref="GeneID:59327267"
     mRNA            <707003..>708217
                     /locus_tag="HG536_0F03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284830.1"
                     /db_xref="GeneID:59327267"
     CDS             707003..708217
                     /locus_tag="HG536_0F03770"
                     /inference="similar to AA sequence:RefSeq:NP_009387.1"
                     /note="ancestral locus Anc_7.89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140726.1"
                     /db_xref="GeneID:59327267"
                     /translation="MARLRARKRNHVDISIEDDGREVKSKYFKSETIVKESDDGTESV
                     SAEDTVDIEWIKSLNSEEYFEWVSKVTDDRPERWNKPLDPDIFLNRPEGAPPLPENFI
                     PIYTRVRLMRSKIRTPVDSVGCAAIPITVNSQFNISQNQIKPKNYRLQLLVALMLSAQ
                     TKDELNAEAMSNLIRYSIDELDIPEGLTLEALLRIDEKVLVDLVKMVGFHNRKAHYVK
                     QTAEILAKQFDSDIPADLVGILSLPGVGPKMGLLALQKAWGKMSGIGVDVHVHRLCKM
                     WGWVDAKKCKTADHTRRELESWLPKALWYEINPLLVGFGQVICMSRGKRCDICLANDV
                     CNAVDKKLLKTKDAKKGSHKMPLKSNRGDFSLWLEYLAEKDSSFKIIDEKEVVQPMDE
                     GFAFIKKDPDEV"
     gene            complement(<708351..>710180)
                     /locus_tag="HG536_0F03780"
                     /db_xref="GeneID:59327268"
     mRNA            complement(<708351..>710180)
                     /locus_tag="HG536_0F03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284831.1"
                     /db_xref="GeneID:59327268"
     CDS             complement(708351..710180)
                     /locus_tag="HG536_0F03780"
                     /inference="similar to AA sequence:RefSeq:NP_009386.1"
                     /note="ancestral locus Anc_7.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140727.1"
                     /db_xref="GeneID:59327268"
                     /translation="MANESVEGKDLYPLALLMDELKHDDISNRVEAMKKLDTIATALG
                     PQRSRDELIPFLMEVAQDDEDEVFAVLAEELGKFVPFIGGPEYATLLLPILEILASTE
                     ETLVRDKAVESLNEIAGELSQDQLFHDFIPLIEHLATADWFSSKVSSCGLFKSVIVRV
                     KDNTFRKDLLALYLQLVQDDTPMVRRTAARNLPTLIDLLTQNPDLSTNEDWDYISNMF
                     QKIINDNQDSVKFLTVNCLISILKFFNTKGDYSHRKDLLDSATKLIADEAWRVRYMAA
                     DKFEELAAQFAGDGGYIAELIQPFLNLCEDNESDVRKAIAKQISGFAKLLNDPSIVLT
                     KILPAVQSLSMDESEAVRASLALTITNLVTLTSKDEAIDHLLPILLNMLKDEFPDVRL
                     NIIANLKVVNDVIGVDLLSESLLPAITELAKDVNWRVRMAIIEYIPILAEQLGVQFFD
                     QQLSDLCLSWLWDTVFSIREAAVNNLKKLTEIFGSDWCRDGVIAKLLKFDSQLLENFV
                     YRFTLLSALTELVPVVELDVVANQILPFVSHLADDAVPNIRFNVAKSYAIIVENLIKD
                     RARYNDTIEGTILSSLKKLLQDDDFDVKYFAKQSLEQCNKLLK"
     gene            complement(<710466..>711530)
                     /locus_tag="HG536_0F03790"
                     /db_xref="GeneID:59327269"
     mRNA            complement(<710466..>711530)
                     /locus_tag="HG536_0F03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284832.1"
                     /db_xref="GeneID:59327269"
     CDS             complement(710466..711530)
                     /locus_tag="HG536_0F03790"
                     /inference="similar to AA sequence:RefSeq:NP_014598.1"
                     /note="ancestral locus Anc_7.87"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140728.1"
                     /db_xref="GeneID:59327269"
                     /translation="MSDIEVDGPSLPNGIQSADTTLEDLLNDESLGCPSNFNIVGNEE
                     QRHFQDCLAVFIRGDCEDTIQKMYEYGFLTQTSLHTTYKYFNLFLEACYSVSSFRSLG
                     FRLQEVVHQTFTGDPQTVQYHLKGAPKNSQASMWSKYYSCCVRAALMNQLRGQQASIN
                     LENGARRVISSLAKETSGPDEAAELEKLVDTYIFGIQIEVLQKTPSTALYKQLCYHVP
                     NLGSRLSSLRSIHKGKTVEEDILSRLETKPVKIKKQPRQHSKPVTDNKAVGPTSKPPL
                     KKTRETNTVQVIPKWRSLWPKFFSKVYLSRSNLLLILFLFLASFQSIKKLAKIPRFFT
                     SFLRNLAPHLKNLLRLLSTI"
     gene            complement(<711931..>715710)
                     /locus_tag="HG536_0F03800"
                     /db_xref="GeneID:59327270"
     mRNA            complement(<711931..>715710)
                     /locus_tag="HG536_0F03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284833.1"
                     /db_xref="GeneID:59327270"
     CDS             complement(711931..715710)
                     /locus_tag="HG536_0F03800"
                     /inference="similar to AA sequence:RefSeq:NP_009385.2"
                     /note="ancestral locus Anc_7.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140729.1"
                     /db_xref="GeneID:59327270"
                     /translation="MPYIGASNVSQSSFRSFKEKHSMNRSVLQVDSSAGSTVSSLIEV
                     SDTRACSSTADTTSHSSSLEDVPPCSRGKAKHLKNEVDGTDLSRLRSRRAQSVDSIAT
                     SATEPEAAELLTLPNESTHAYSYNPLSPNSLAVRLSILKRTLEILIGNPQMLMDSNHQ
                     RNWSGVMSGRREDKQVKRTAHSAALDAFVSSTNASLTSSGVQSPAPSRGKTSLALSSH
                     AIPSSRLERASSIAFLPEFPYRGDLQAGKDNIVYNSIGTASTSTELIDAQRTDLESLL
                     DLLNETLENNTSAKATDLHMISLLNINKLILGNSEHNHSTSQSQLRTLHLKKTLLNSL
                     AEPFFEHYTLPEDEINEEEIELRQEISNVLGADLKSDSQLPIESIRPQQDYGRILHTF
                     TSGKNRAPQAIFTCSQQHPWQFKAANDLACLTFGISKTVLKALTLLDLIHTDSRNFVL
                     NKILSTEGQELVFTGEIVAIIQPGSSDKSSDLIWASFWAKRKNDMLVCVFQKVPCDYV
                     DVILDLRDYSVSSVSNGGGLFWNRPSEDRSEMSTISNAPKFELGFDESGDEDDDDEDS
                     ADIKIIPASILNRENKNERKIKTRKSVKFADQIQNVDQLSHSLSRLIKDVIDGKIFSE
                     DDDLLPIPIRVANHINTTRYFTLNHLSYNIPCAVSSSMLEDKLKLKIHSLPYQAGLFV
                     VDSQSLRLISSNKSILKNIFGFHFAELVGRPLTEIIPSFGDLIDFINVKYSALKITLA
                     RNRGLVLTEHFFRKIKAEMNNDPEGFYTSVGIDARHRDGRLIKVDFQLRVMNPSVILL
                     WVTHSRDVVFKDYTSTPSQLHMLKDHEPAYYSSDNSSEASSKRSSSKISIDRLKDLSE
                     HGTSRSNDVSLLGSSLRSTSLTEVKPESPRVASLLVSGNEDSRLDIQDSEFQKKLELN
                     LTKIYAKDKAQFVKEGNFKLDEDLIKSITSTPHSTRSNLSLDNMQSDEEATAASTAGR
                     HEIEPIFLKTPEPNIGAQKHIKKFSDFTILQKMGEGAYGKVNLCLHKKERYIVVIKMI
                     FKERILVDTWVRDRKLGTIPSEIQIMAALNKQPHENILRLLDFFEDDEYYYIETPVHG
                     ETGCVDLFDLIELKTNMTEFEAKLIFKQVVSGIKHLHEQGIVHRDIKDENVIVDSKGF
                     VKLIDFGSAAYVKSGPFDVFVGTIDYAAPEVLGGEPYEGKPQDIWAIGILLYTIVFKE
                     NPFYNIDEIMEGTLKFSSGAEVSDACINLIKKILNKSAPKRPTIQEIYDDEWMHI"
     gene            <717057..>717950
                     /locus_tag="HG536_0F03810"
                     /db_xref="GeneID:59327271"
     mRNA            <717057..>717950
                     /locus_tag="HG536_0F03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284834.1"
                     /db_xref="GeneID:59327271"
     CDS             717057..717950
                     /locus_tag="HG536_0F03810"
                     /inference="similar to AA sequence:RefSeq:NP_009384.1"
                     /note="ancestral locus Anc_7.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140730.1"
                     /db_xref="GeneID:59327271"
                     /translation="MSFAGSLLLTGVGALVYRYDRSQILRKSPESQFGTKYYKKKYDS
                     SATRAYSVVGNFLNEFFNGSSFLYPLKGVRFFFNNTKELCVPILGVFSLYLLMYFVVS
                     VVYWSTITPVYTALFAIFGPPGLLLAWTHAILQTNLLTMMFMRLCHFNNELTFITLQA
                     SGFKKGFNKKPIKYYVPINSVYFWTFHLPWKSLKYFMGFVSLVLLLVVSSIPLIGPLI
                     FTFLISPFIAKIYFSKILRLNGLSNIQRNDEFFDHYGQYCAFGIVAGFLENFPILAGF
                     ALCTNTIGGALWGIDRDLYRE"
     gene            <718061..>718912
                     /locus_tag="HG536_0F03820"
                     /db_xref="GeneID:59327272"
     mRNA            <718061..>718912
                     /locus_tag="HG536_0F03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284835.1"
                     /db_xref="GeneID:59327272"
     CDS             718061..718912
                     /locus_tag="HG536_0F03820"
                     /inference="similar to AA sequence:RefSeq:NP_014595.2"
                     /note="ancestral locus Anc_7.84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140731.1"
                     /db_xref="GeneID:59327272"
                     /translation="MSGEISKYCREKLEELKCFISIASSNLFVEPSISLEIIASPFLG
                     IKECFSTTKYGYLMFNIFLNYMVSYITSCIFYFYCIFPLTCLIYSIIFGPAGFLFAIG
                     HGALFCNIVACHETRISSGHFMDLFFTMVVTTSKILEKPKVGRILPVKESKDPISWRI
                     IFIAQVVRWMVVMSKLLMWFVISLIPVLGIILLKLQSSASRGFTYFIPYLEGTKRMDK
                     RCMKEAYYKSFGKWLLFGLTTGFTESIPILAGISISTNTCGCALWEVDHAINVENPEL
                     KHLQGQT"
     gene            <719158..>720330
                     /locus_tag="HG536_0F03830"
                     /db_xref="GeneID:59327273"
     mRNA            <719158..>720330
                     /locus_tag="HG536_0F03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284836.1"
                     /db_xref="GeneID:59327273"
     CDS             719158..720330
                     /locus_tag="HG536_0F03830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140732.1"
                     /db_xref="GeneID:59327273"
                     /translation="MTEEKISTLIDLYEELIPKSTEVQSFLLEVLVACDGSLEDANKM
                     LNDTLGVVRHLPVGNNRKHAIDQDQEDRRRHKVQRSLNYFIADEDKKIKPVAVDTRAK
                     VSKNAIELHSKEDIEGNIKYITFHEKILPGDLSNDLLRQLLNDKEGFTQNEFHLFGNK
                     CASSHTSKKFTSASFILDGKASLQYNNRRGPVYEYNDILKVVQLLVEGVVNETIQKFE
                     PLPFQVRSPNWKGDVVLVNRYEKAEYLLWHSDRLTSLGPQAIVASLSLGCAREFRVRR
                     AYPSDSQVYIIRPPHNSLIIMHAGFQEEYKHCIYQQTNNQTTNLHPISKDVRFNLTYR
                     NYLRKYMEDPPRCPRCNAAMDLRRSFKDCRYRGQYLWQCAGHYTGRDCKGMRLAAR"
     gene            <721245..>721874
                     /locus_tag="HG536_0F03840"
                     /db_xref="GeneID:59327274"
     mRNA            <721245..>721874
                     /locus_tag="HG536_0F03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284837.1"
                     /db_xref="GeneID:59327274"
     CDS             721245..721874
                     /locus_tag="HG536_0F03840"
                     /inference="similar to AA sequence:RefSeq:NP_014594.2"
                     /note="ancestral locus Anc_7.83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140733.1"
                     /db_xref="GeneID:59327274"
                     /translation="MVAVIYYVTVIPLVVAWAMISLGPLGILLAHIQWVLQTNAITTM
                     ICRNIVLSHMDNQIFDITLYLNGQKEFLRKAKFIKVTEKPHPTHGFFSGSWQMTFPLL
                     VVHLIRKGLILIILALLSLIPIFGPPITNQVLSGRRGFSYMRRYFALKGQSAAEAKDF
                     QYEHLGLFFSFGMAAGILEFIPLFSIITITSNTIGAAKWSVDLIKKSQK"
     gene            complement(<721907..>723355)
                     /locus_tag="HG536_0F03850"
                     /db_xref="GeneID:59327275"
     mRNA            complement(<721907..>723355)
                     /locus_tag="HG536_0F03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284838.1"
                     /db_xref="GeneID:59327275"
     CDS             complement(721907..723355)
                     /locus_tag="HG536_0F03850"
                     /inference="similar to AA sequence:RefSeq:NP_014593.1"
                     /note="ancestral locus Anc_7.82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140734.1"
                     /db_xref="GeneID:59327275"
                     /translation="MDLSYPNLSETEIKEEILSEVHQWALANGLVMYPPAFSSEQATI
                     VPTTLYPTYLPRSSFEKVVSLQKTYNKLYADISRDSSGGWLTQESIKLAKYDNEFTGK
                     LWELYLKAKKQGIAQKLRLGIFRSDYLIDKRTNEAKQVEFNTISVSFGASSTKVGELH
                     DFLNKAGKYSANSGDRFYQSEIPVSDSTPLLAKGLAIAAESYQGLSERKVVAFIVQDN
                     ERNAFDQRTIEFQLLKAHCIKSVRITLGDLHNRTTLDPESKRLFVKKTGEEIAVVYFR
                     AGYSPSEYKSERDWENRLLLETSYAIKAPDILTHLSGTKKIQQLLTDEDILAKFIPDV
                     IVRKQMLSTFVKIYPLDDSALGQEGKKLAFKSPSKFVLKPQREGGGNNVYKQDIPLFL
                     EKLDEKDWSAYILMELIEPNETTENVVVRGNSFFREPIISELGIFGCILFDDTDVHLN
                     EYSGWLLRSKFSGSNEGGVAAGFGCVDSVMLY"
     gene            complement(<724130..>727156)
                     /locus_tag="HG536_0F03860"
                     /db_xref="GeneID:59327276"
     mRNA            complement(<724130..>727156)
                     /locus_tag="HG536_0F03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284839.1"
                     /db_xref="GeneID:59327276"
     CDS             complement(724130..727156)
                     /locus_tag="HG536_0F03860"
                     /inference="similar to AA sequence:RefSeq:NP_014591.1"
                     /note="ancestral locus Anc_7.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140735.1"
                     /db_xref="GeneID:59327276"
                     /translation="MNSGGKESLSLDERSKNVNDLLLVLMDINEINGGNSDTAEKMKL
                     HAKNFEAALYAKSSSKKEYMDSMREKVNAMRNTRDTRKKAAVSATNQGMAGGYSGHPN
                     QQQSQQQRQGNVMMNGSYVPNTLNMNSQTFLNQQAQVRQQAAQQMRNQRRPQLTPQQQ
                     QLINQMKVAIIPRELLQRIPNIPPGVNTWQQITELAQQKRLTAQDMQVAKEIYKLHQQ
                     LLYKTKIQQQQNANNRMVMQQQTPQPQSQPQPLQGQRVSSNGHLPQQQQQSQQAQQAQ
                     QQQPQQRQLKPGEIPNVLSQINQIFTPEEQRSLLQEAMEACKNFQMTQFGKNMTDSNR
                     QNFIRKYINQKALKKIQNMRLAQMAAQGGQQPQQPQQRQQVQPQTQPQTQLHSRNPSA
                     GLMANNGQTNGANGLQNSMPQSMQHQHLDRGSQQPQQTSVQQPRPSVLQAFAPTPQDV
                     ETVKRISAEAARTPLRLSDLTNTLSPQEKEEIKRKLQLNQQLFAQVSNYAPQVYVLTK
                     SENFLKEVLQLRIFAKEILEKCTKGIFVVRLDTVDKLILKYQKYWESMKIQLLRRQQL
                     IQQQQQQQQQQQQQQQQQQHPANNDQSGPNISQQQQRVQGSLQQIQQQMQQKQRQQQR
                     SMPSSTSGNTMNAPNPAALAAASAMSNGNNYMTSNFQQTMPDGNIGSVPNSSEFDPLN
                     GNIALGYMSADGAKPTSSQGVSPQTGNHNRVKSNIKKVSPLNPGQSNINSPTVVPQGA
                     MHSRSVTPAVMGMAGSPLGGAKNGGAYQKTPSPLTVPSASQPATVAENRPFKEEEENL
                     RNLNIRKAEIISRFKHRQEIFSSSAIDMFLSTLADCIGVKDDQVDIVMNISQSLVDQV
                     NGTGKKKLTKAAQRARDQDVVSLSIKNNRLIMESKASPTTRSYRIRPRALASVFKNVS
                     KMADVNEMNLNDSTPNSDACNEAPSKTKRKLQDLENSPANSNTSPSSSLMSESKRLKV
                     DSPEDLFVGKDDGKLQRSMQDGLSNIWNWNYWASLD"
     gene            complement(<727877..>730990)
                     /locus_tag="HG536_0F03870"
                     /db_xref="GeneID:59327277"
     mRNA            complement(<727877..>730990)
                     /locus_tag="HG536_0F03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284840.1"
                     /db_xref="GeneID:59327277"
     CDS             complement(727877..730990)
                     /locus_tag="HG536_0F03870"
                     /inference="similar to AA sequence:RefSeq:NP_009383.1"
                     /note="ancestral locus Anc_7.80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140736.1"
                     /db_xref="GeneID:59327277"
                     /translation="MADSPSDEVQVPESSSPLRQAQGDSAASLLRDKFSFTPGNLAHN
                     GPAMTGNGTEKQLDVQLVRLAEEFPDFSPTLVQAVFKSNSFDVNLARERLTRIKNQRQ
                     NWSVNSKGPKKAPAPPVSRSSSTNRLNSIKQGDPSSKIVLEKQRTSIFDRYSNVMNQR
                     ARPVMTESLVVDEESLAKLGGAGNKRRRLVRADNLDGDRKATHLEKAKENLLKEKLKK
                     RGMSDDDETAEEEMSGEEEMSGEEYEERTPEINIDDQVLQFLNTAEASDLADLGETSV
                     SKANTIISRRPFSSLYAFTQLDLSTEDESKKMQKKVRKGGNQKKESEKVLEKINQSIR
                     GYNAIDSLIKRCSSYGKLISGQMRRWGIDLEHSQNGGELDFTNIDSDDDDAAVVEEFD
                     ESEISATPTPAPGSISSNNVSKTRTKNSSDNEAEEEEEEVEEDAEFENSEDEDYGQTR
                     RTTIPGRRGRPQKRLVKFFKGRPKLLGPEVQLKDYQQTGINWLNLLYHNHMSCILADD
                     MGLGKTCQVISFLAYLKQINEPGPHLVVVPSSTLENWLREFQKFCPSLKIEPYYGSQQ
                     ERAGLREILERTAGQYDVIVTTYNLAAGNKYDISFLRNCRFNVVVYDEGHMLKNSLSE
                     RFTKLMRIQGNFRLLLTGTPLQNNLKELMSLLEFIMPSLFESKKEYLASIFKQRARTS
                     DDNKNFNPLLAQEAINRAKMMMRPFILRRRKDQVLKHLPAKHRVIEHCEMNAAQRKIY
                     NEEIKLVMEHKRMIQDGTLPSDPKERSKIQSSSSKNLIMALRKASMHPLLFRTLYNDK
                     IIAKMSDAILDEPDYAENGNRQYIMEDMSYMNDFELHRLCCSFPNTLEKFQLRNKEWL
                     QSGKIDKLTEILKHIIVDKKEKVLIFSLFTQMLDILELVLSSLNYKFLRLDGSTQVND
                     RQSLIDKFYEDDTIPVFILSTKAGGFGINLVAANNVIIFDQSFNPHDDRQAADRSHRV
                     GQTKEVTITTLITKDSIEEKIFQLAKNKLDLDTHISEDDKKSQETLENKVSDILEDII
                     YDENTTA"
     gene            <731320..>732234
                     /locus_tag="HG536_0F03880"
                     /db_xref="GeneID:59327278"
     mRNA            <731320..>732234
                     /locus_tag="HG536_0F03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284841.1"
                     /db_xref="GeneID:59327278"
     CDS             731320..732234
                     /locus_tag="HG536_0F03880"
                     /inference="similar to AA sequence:RefSeq:NP_009382.2"
                     /note="ancestral locus Anc_7.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140737.1"
                     /db_xref="GeneID:59327278"
                     /translation="MLLSDGSAYGCGDNSNGQICDSPEKGDCASWTRLDQRFQDVACG
                     WDFTVGINKDNEVISRGAGHKGELGIEGLSQAGHFTKVMKVNKGSRVFSSLQNCVVVE
                     PLGDTGGSRVYGWGSNTKCQLKQPKSRVVAAPVVIFESNNTMVKYAALGKDFTVLVDV
                     SGRIVHACGNLPSGFDIYQWGNKSGLQVHCMWTSLHILTSRGGIYSYGNGRHGQLFNR
                     EQWAHSDDLKQAAVGSEHGVLLSNLNTVACWGWGEHGNCGRLTDDRTINNDYSNVVSP
                     LNRLPIPNGVIITKVFAGCATTWLVAKR"
     gene            <734176..>736587
                     /locus_tag="HG536_0F03890"
                     /db_xref="GeneID:59327279"
     mRNA            <734176..>736587
                     /locus_tag="HG536_0F03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284842.1"
                     /db_xref="GeneID:59327279"
     CDS             734176..736587
                     /locus_tag="HG536_0F03890"
                     /inference="similar to AA sequence:RefSeq:NP_009381.1"
                     /note="ancestral locus Anc_7.78"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140738.1"
                     /db_xref="GeneID:59327279"
                     /translation="MNNPSILSYPSLGPQHQPNIIPGMQAGTPTGIHQQLQGNPLLGG
                     TSGGGGTMPPPGMMKPNIGGANDGAALQLLNHLGTGSGKVAGTNSGTVTGSVNGNEKN
                     PLYHLHLEEPGLLNNPIWKLQLQLAAVSAQSMGQPNVYARQNAMKKYLVNQQQQQQSL
                     DHQRQPGLLQQVSGSQTQLQTTEQQPQNPQMAVASVSLVDKTKQLLMEMAADIKDTAA
                     SSNNGISNPPGSANTSATANTSGSASSPSTPKTELHNLRDQNTGTPVLLLQHKKLSQF
                     NIDEDDELEHRMAGPKNTKFDDQLWHAIDFSNLQIFNISANLFKYTFLTRLYLNGNSL
                     TSIPPAIKSLVNLRVLDLSHNKLTSLPKEMGHCYQLKYLYVFDNMITTLPWEFGSLFN
                     LQFLGCEGNPLDKQLLKILTEKSVTGLIFYLRDNRPEVPMTKDRDFIEINADGDPVEK
                     YKSLQEADEHLSRDLAKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQ
                     ILSYMSDVICLQEVEAKTFEDYWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCV
                     FYKKSEFRVIFKDAVDFSGVWMKHKKFQRTEDYLNRAMNKDNVAIYLKLEHIESGEHV
                     WLVTTHLHWDPQFNDVKTFQVGVLMDHMEDLLREQSNAQSKQEIKKCSVILCGDLNSE
                     IDSAVYELLSTGRVQTHDDVKGRDFGYMTQKNFAHNLSMKSSYSHIGELPLTNFTPSF
                     TSVIDYIWFSTQSLRVRGLLGPIDSDYISEFIGFPNAKFPSDHIPILARFEFVKGGAG
                     SSRKI"
     gene            <736835..>738109
                     /locus_tag="HG536_0F03900"
                     /db_xref="GeneID:59327280"
     mRNA            <736835..>738109
                     /locus_tag="HG536_0F03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284843.1"
                     /db_xref="GeneID:59327280"
     CDS             736835..738109
                     /locus_tag="HG536_0F03900"
                     /inference="similar to AA sequence:RefSeq:NP_009380.1"
                     /note="ancestral locus Anc_7.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140739.1"
                     /db_xref="GeneID:59327280"
                     /translation="MDSNELILDSELDRTSEARGSSLEQESLWTKLHNHAYLTFMFIG
                     IGLLWPWNCILSASVYFKHDVFHDTTLWAKIFTSSMMTVSTLSSMLFNIWLSRRQHSY
                     SQRVTRGLFWEIVVFFALGVVTLMHTLVPLWLTFAFVLTLVAVSSVATAMTQNGAMAI
                     ANVYGSEYSQAVMVGQAIAGVLPSIVLLVISFFSDPSKQSVSGILMYFLTTAIVAIIA
                     VILYRVNKIDARLNSTKSTALVTHTIPFSTLFRKLKYLVLSIFTTFVVTLIFPVFAAN
                     IPVKGLPLSDSQFSPLIFSVWNLGDLHGRVLADWPMFRSRRFSPFKTFVYSLCRLLFV
                     PIFFYFSMNTSSAALLAILQDLGYALLQYGFGLTNGHVISISFMKVPEQLASDDEREA
                     AGGFTNIFVSTGLTLGSVVSYLFVFAIGSFKK"
     gene            <738249..>740579
                     /locus_tag="HG536_0F03910"
                     /db_xref="GeneID:59327281"
     mRNA            <738249..>740579
                     /locus_tag="HG536_0F03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284844.1"
                     /db_xref="GeneID:59327281"
     CDS             738249..740579
                     /locus_tag="HG536_0F03910"
                     /inference="similar to AA sequence:RefSeq:NP_009379.2"
                     /note="ancestral locus Anc_7.76"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140740.1"
                     /db_xref="GeneID:59327281"
                     /translation="MNVDSGSVNESTLKQAIEGPIEAQLQSRMSSATGFDGSLRDDSK
                     SVRRRKNEEVLEADSPMEQEDLSKLKNEKICAFTRLESIVMPIVFTALAFFLRMYKIG
                     INDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSYDFNSGELY
                     PEYVDYVKMRLFNAAFSALCVPLAYYTAKNIGFSLPTVWLFTILVLFENSFTTLGKFI
                     LLDSMLLFFTVASFFCFVTFYQQRSKPFSRKWWKWMLLTGISMGCAISVKMVGLFVIT
                     VVGIYTVGELWNFLSDKKMTWKTYTMHWVARVICLIIVPFVVFMLCFKIHFDLLYRSG
                     TGDANMPSLFQANLVGTEVGEGPRDVAIGSSLISIKNQALGGSLLHSHVQTYPEGSSQ
                     QQITGYGFKDGNNLWFFDRPRGSPHYSENETDVEYAQAGMTYRLVHQKTGRNLHTHHI
                     PAPISKSAWEVSGYGDHLIGDEKDHWIVEVVAQNGNEDKSRLHPLTTSFRLRSAALDC
                     YLAQTGHHLPEWGFRQSEMACLKNPFKRDKRTWWNIESHENEVLPARPDDFKYPKTNF
                     FKDFIHLNLAMMATNNALIPESDKLDSLASSAWQWPTLNLGLRLCGWGDDNIRYFLLG
                     TPLTTWSSSVAVVLFAIFVAVLILRWQRQYTDLSNSEDASVFLIGGLFPMLAWGLHFM
                     PFVIMSRVTYVHHYLPALYFALLVMSYLFEVGTKRWIKSKCGKVMRICIYAAYCTAVI
                     ACFFYFSPISFGMEGPVSDFEYLDWLPGWFISNKNK"
     gene            complement(<740768..>743035)
                     /locus_tag="HG536_0F03920"
                     /db_xref="GeneID:59327282"
     mRNA            complement(<740768..>743035)
                     /locus_tag="HG536_0F03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284845.1"
                     /db_xref="GeneID:59327282"
     CDS             complement(740768..743035)
                     /locus_tag="HG536_0F03920"
                     /inference="similar to AA sequence:RefSeq:NP_014967.3"
                     /note="ancestral locus Anc_7.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140741.1"
                     /db_xref="GeneID:59327282"
                     /translation="MGFSKLVPYHSSSGGKSHSKLRDLTHSHKERPLELSIDIESPPC
                     VLYGSATESSGALLSGLLTLDIKDPYDSEPHSELVSPVSSRDGKHKGALGSSLSSTLS
                     HLSLSSPNMSPVGSLANLKIMSGYTKVCITSVTLTLVQKVQIHKPFLPDGQSFHSCMN
                     CKTKTTNMKTWEIQTSAQDMPVGRHSFPFSYLIPGSVPAKSFLGLNSGTRIRYELIAV
                     VTYKDPKRGLNSQSKQQLLQLAMPISVTRSIPRGPDKNSLRVFPPTELTATAVLPSVV
                     YPKSTFPLEMKLNGISSSDRRWRMRKLAWRIEEISRVRCNACDIHKHELKQLEKCVIE
                     KESNKKPSSAIKKYDAGPQVRLTVGPTQDPASQALRRNSSLGGPQAGNEGPQDEDRDE
                     EGPNNDFIHPNDDALRQQVLQQQQRAREQQVQEELKNDIQIYTEETRTVARGEMKSGW
                     KTDFDNNGQVDVITDIDCTALTSGVTNPITHVSTAKPFVEPVKQDTNVSCDIQDPTLG
                     INVSHVLAVEIVVAEETLQYANGQPIRKSSTSVSSSKPNLNDPDQRLAELSPMFANRN
                     NVKARPVETDSLTPTKSGSSTKSTHSGKGNGGNSTGSRIISVPTGAARVLRMQFRLNV
                     TERSGLGISWDEEVPPIYQDVGLLSPPSYENTISKSSTSQSLPSMCDLPSPSETRGDP
                     LLAQSIAPPPIAHHHNSSSSLRALSSVQSPQLESVISIQGNNPFNDHLLTPHATRDIP
                     LQNISERLDSDRITQ"
     gene            <743747..>747760
                     /locus_tag="HG536_0F03930"
                     /db_xref="GeneID:59327283"
     mRNA            <743747..>747760
                     /locus_tag="HG536_0F03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284846.1"
                     /db_xref="GeneID:59327283"
     CDS             743747..747760
                     /locus_tag="HG536_0F03930"
                     /inference="similar to AA sequence:RefSeq:NP_009378.1"
                     /note="ancestral locus Anc_7.74"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140742.1"
                     /db_xref="GeneID:59327283"
                     /translation="MKQMDCFNKPEYYPVPSETVISYARGDGNSGGRKQVLKADLLAL
                     IVFLTSPEDAVDYTAISDFFLIYRNFISPMELSDLLILRLRWCMSESSSPNGERRKIG
                     KITLVRTFVLLRHWILNYYVQNFLPDVNLRLRVIKFLNEPCESYPSIVKSIIVNLKKA
                     WVRCSRRVWTNLALDEPASVGQDDRWALYEIKDYTQLEELRKRGSRLSTYAKNGSSSP
                     NFRNQSVLSLFKESDVFKIPDSVGATSRTASMVLFPCDNSNVKTGFCLEGEDKFGNEQ
                     NNAKATHSEHKRMVSNLSKMTNVSGMLRDVKESVSPNLDQLIPPTPAKKVELILKLPE
                     DIGSDSEGKEIKRNGGKVPAVENSSIEKHRGPMALLSKWKNNHSRTAKLRAGAASSVS
                     NSFAKPEMDNFVKYVISITSLETKAQELEDPQSLVSSKFDILSARTIEEVEFLVSLEN
                     DLISQVRGSVEPHADAPANDLVKIDDEESVETQGFSAVDNLNLYQTVSSIANSVVSLS
                     NNLNRPSKVPNGAVSPSSAALERRKVQSSMAAILRSNSKFSFVSRNNSMKESSNEPTD
                     GPQRLVFHDSESVDRGKGDNETSSEAAPQLTMLKKRYSQSPTRTSPLRNNLPSLAEDH
                     LTSSMHGGMTRGSSYSSITYDSDLSMSSRASPGDRHIENDNQSINALKRKGARNNLRE
                     FTFESQKRKSMQDIESASSFVTTRESIDGATPLSQKPPDKVARPASGRISIMRKPTIA
                     KSPLRSIQQSQKEDLDFLLRDKELMQNELEVALLQKKTASITASVDTGVLFVSQNNSP
                     KKLPQQEALCIRLSTTPSIQSITDKSPVLVRTTMDNTEGSSETQDPNEGLKNELHRLN
                     LQTSADSSLGYPEFEESVSLSDAAKSSGLKNKYLFSPDNDSVDIASPAKNVEELKDKF
                     LNKDEKEDTSESPSQTDATSTNGLADDAEKLIAEFKNKAMQEENILNIVSLPDDSVHD
                     DPVNVALMKLEGTYKKGSDDKSGSEQESRSSSVLAEEVDMLGIADLSVPQIDPSDRRR
                     SLLIEKRRQTIMNIPFTPDTEKDAERVNEKSLRMDAKQLLQGYQLKDPSLLIANNDLH
                     VSFILMYDSLSIAQQMTLIERELLSEIDWNELLNLKLAGSAPRATSWLQLLVQNESLS
                     GINLAIARFNLMVDWIVSEIVLTADVKLKRNTIQRFIHVAEHCRLFQNYNTMMEIVLA
                     LGSTTVQKFSEAWRLIEPGDLITWEELKVIPSLDRNYSTIRKLLNDVDPLKGCVPFIV
                     LYLSDISLNSEKKSWFVENQVVNYNKFDTNVQMVKNFIQRVQWSRYYDFPVNHELLSK
                     CVYLTALTQEEITQLTR"
     gene            <748011..>748931
                     /locus_tag="HG536_0F03940"
                     /db_xref="GeneID:59327284"
     mRNA            <748011..>748931
                     /locus_tag="HG536_0F03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284847.1"
                     /db_xref="GeneID:59327284"
     CDS             748011..748931
                     /locus_tag="HG536_0F03940"
                     /inference="similar to AA sequence:RefSeq:NP_009377.2"
                     /note="ancestral locus Anc_7.73"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140743.1"
                     /db_xref="GeneID:59327284"
                     /translation="MSDDIIWHLINNQFCSYKLTTDKGQAFCRNEYNVTGLCNRQSCP
                     LANSKYATVKSVNGRLYLYMKTAERAHTPAKLWERIKLSKNYSKAIQQIDNHLLYWNK
                     FLVHKCKQRLTRLTQVAITERRMALREEERHYVGIAPKVKRREENRERKALAAAKIEK
                     AIEKELLDRLKSGAYGDRPLNVDEKIWKKVMGHMEDEDELHEDEDELELEEEEESDEG
                     EVEYVEDEGDDEMVDLEDLENWLQGSDSDEPSSEEDSDEESDEDSDESDAEEKPSKKK
                     KKVAPARKRPKVEIEYEQETVLPTVQETTR"
     gene            <749318..>753328
                     /locus_tag="HG536_0F03950"
                     /db_xref="GeneID:59327285"
     mRNA            <749318..>753328
                     /locus_tag="HG536_0F03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284848.1"
                     /db_xref="GeneID:59327285"
     CDS             749318..753328
                     /locus_tag="HG536_0F03950"
                     /inference="similar to AA sequence:RefSeq:NP_009376.2"
                     /note="ancestral locus Anc_7.72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140744.1"
                     /db_xref="GeneID:59327285"
                     /translation="MPLSRSESQPGEDTLFDVDFLDLPPTGASEQRYRSQQSSLGDSN
                     HNYVLPEETIDLSRNVSIENDLDEEYGSFPHETSTKWAHDRLNSGDDAANAANIRPKG
                     TGTISKMLEAVRNTLSPSNGSSGYHSFEMRDFNTPREADNYEASRNQFNIRVLFNRYV
                     LRRPTVSADTNAHRVIHMNDRAANSSLGYGDNHVSTTKYNAATFLPKFLFQEFSKYAN
                     LFFLFTSCIQQVPHVSPTNRYTTIGTLIIVLIVSAIKECVEDIKRINSDNELNNAKTE
                     IYSELDGGFTRKRWIDIRVGDIVKVKSEEAIPADIILLSSSEPEGLCYIETANLDGET
                     NLKIKQANQETSRFIDARTLRNIQGKILSETPNSSLYTYEGTMELNGHKIPLSPEQMI
                     LRGATLRNTSWIFGIVVFTGHETKLMRNATATPIKRTAVERIINLQIAVLFGVLIILS
                     LISSIGNVIMSTAGAKNLWYLYLGGTNKVGLFFKDILTFWILFSNLVPISLFVTVELI
                     KYYQAFMIGSDLDLYYEETDTPTVVRTSSLVEELGQIEYVFTDKTGTLTRNIMEFKSC
                     SIAGRCYIEKIPEDKAATMEDGIEIGYRKFDDLKLKLNDPTDDESAILENFLTLLATC
                     HTVIPEFQSNGEIKYQAASPDEGALVQGGADLGYKFIIRKPSSVTILLEESGEEQVYE
                     LLNICEFNSTRKRMSAIFRCPDGSIKLFCKGADTVIMERLEKEYNPYVDATVKHLEEY
                     ASDGLRTLCLAMRDVGEDEYRKWNEIYAAAATTLDNRAEKLDEAAEMIEKDLFLLGAT
                     AIEDKLQEGVPETVRTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEEMNLLIINEES
                     KEETRANMLEKLRAFEEHQISQQDLNTLALVIDGKSLGYALEPDLQDYLLSIGKLCKA
                     VICCRVSPLQKALVVKMVKKKSSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAAR
                     SADVAIGQFRFLRKLLLVHGSWSYQRISVAILYSFYKNIALYMTQFWYVFANAFSGQS
                     IMESWTLTFYNVFFTVLPPFVMGVFDQFVSSRLLERYPQLYKLGQKGQFFSVTIFWGW
                     IINGFYHSAVTFIGSTLIYRYGFALNRHGETADHWSWGVAVYTTSILIVLSKAALVTN
                     QWTKFTLFAIPGSFIFWIIFFPIYASIFPYANISREYFGVVSHTYGSATFWLMLLVLP
                     IFALMRDFVWKYYKRMYVPEPYHVAQEMQKFNISDYRPHAQQFQKAIRKVRQVQRMKK
                     QRGFAFSQSEEGGQEKIIRMYDTTQKRGVYGELQDASADPFSDENYVNIPSDPFAEDI
                     RETPAEVSEESESFIL"
     gene            complement(<753393..>754763)
                     /locus_tag="HG536_0F03960"
                     /db_xref="GeneID:59327286"
     mRNA            complement(<753393..>754763)
                     /locus_tag="HG536_0F03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284849.1"
                     /db_xref="GeneID:59327286"
     CDS             complement(753393..754763)
                     /locus_tag="HG536_0F03960"
                     /inference="similar to AA sequence:RefSeq:NP_014968.1"
                     /note="ancestral locus Anc_7.71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140745.1"
                     /db_xref="GeneID:59327286"
                     /translation="MSSSEQIAKNARRAGNILKTISDENRSKVLYKIHDELKENASSI
                     EKANKLDLQAAAESGLAQSLMKRLDLFKGDKFDTMLQGIKDVAELEDPVGKLKLARQL
                     DEDLVLYQVTAPVGVLLVIFESRPEVIANITALAIKSGNAGILKGGKESVNTFREMAR
                     VINSTIAKYEKDTGVPVGSVQLIETREDVSGLLTQDEYIDLVVPRGSNALVRKIKAST
                     KIPVLGHADGICSIYLDADADLEKAKRITLDAKTNYPAGCNAMETLLVNPKLAKWWKV
                     LEHLSRKGDVTLHLASDVKEAYVEKLKEENAFDEEVRSKIVDVDESTDFDREFLSLDC
                     AVKFVESTKEAVEHINHHSSKHTDAIITENEAHAELFLKGIDSAGVYWNASTRFADGF
                     RYGFGTEVGISTSKIHARGPVGLDGLVTYQYQIRGTGQVASDYLGAGGKRAFVHKDLD
                     ISQMTI"
     gene            complement(<755082..>755648)
                     /locus_tag="HG536_0F03970"
                     /db_xref="GeneID:59327287"
     mRNA            complement(<755082..>755648)
                     /locus_tag="HG536_0F03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284850.1"
                     /db_xref="GeneID:59327287"
     CDS             complement(755082..755648)
                     /locus_tag="HG536_0F03970"
                     /inference="similar to AA sequence:RefSeq:NP_009375.1"
                     /note="ancestral locus Anc_7.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140746.1"
                     /db_xref="GeneID:59327287"
                     /translation="MRDLCSELKDELLLIAYELAPELAAGGAFGNLRMGQSSDFASNF
                     VSKLLGGDDAALITSRIETVTRVTKSRYKLHYKGEWELEIIISSVKRLSDIRSFLLSK
                     ELGLAYNAGSLHSRRKVVLAETVSLDTPAIVQEEEDQLDRSLDQSAVEVDEKPEIKFK
                     YKPVVNLGECIDIYILHRPKRHRHSQRS"
     gene            complement(<756230..>757747)
                     /locus_tag="HG536_0F03980"
                     /db_xref="GeneID:59327288"
     mRNA            complement(<756230..>757747)
                     /locus_tag="HG536_0F03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284851.1"
                     /db_xref="GeneID:59327288"
     CDS             complement(756230..757747)
                     /locus_tag="HG536_0F03980"
                     /inference="similar to AA sequence:RefSeq:NP_009374.1"
                     /note="ancestral locus Anc_7.69"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140747.1"
                     /db_xref="GeneID:59327288"
                     /translation="MNLLIDRMENPGQRKSAPLVPSVRATAVPMREMTSGREKERQQR
                     QRQVNIDLPTISVNDKPIASGKTAQRRTSFGRKDSLNRNEDKEPHYDRAAFSYHHGRR
                     SSAGADVTSASAGMFSECMFKSESQRPMRHSSTSTTACSPASSVSLGKKGHVETSLEP
                     LKRHHRHHEHPSSGAYRRHRSSFVSVGLNDNKRLVNEFLRSTRPAGAESHMFQEASRS
                     LQTSAEGITPERAVKQRPEFEGYASGSHRSLQSLLYHDLTSNNLAEGTAPMVPPQPFL
                     LSSTSSSSNSSSLSVVHADQRSSPSLSAYDSEDSFNFEKWDMNGSGLTINGGISLNYN
                     EADFYRRHIEAELHKFEDTLKHNLKETIVKNEIDMQQNWKAFDVLIAQLDKLKNDAQS
                     LHDSVKDSKLVTLQKDFDQNDEKSFISNVTASIRVNATQLKSLEARMDCCKRKLLQQR
                     DTLRKLEGLLSLEDSLLNAKATSKLAYKYRYMVFDAGVFIGVVLVFFFVKWFIWC"
     gene            <758080..>762819
                     /locus_tag="HG536_0F03990"
                     /db_xref="GeneID:59327289"
     mRNA            <758080..>762819
                     /locus_tag="HG536_0F03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284852.1"
                     /db_xref="GeneID:59327289"
     CDS             758080..762819
                     /locus_tag="HG536_0F03990"
                     /inference="similar to AA sequence:RefSeq:NP_009373.1"
                     /note="ancestral locus Anc_7.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140748.1"
                     /db_xref="GeneID:59327289"
                     /translation="MSFEVGTRCWYPNEEQGWIGGEVTKHETKDGIHHLELTLEDGNV
                     VSIETDTLVANADDSDGKLPQLRNPPVLEATEDLTSLSYLNEPAVLHAIKQRYSQLNI
                     YTYSGIVLIATNPFDRVDQLYSQDMIQAYAGKRRGELEPHLFAIAGEAYRMMKHDKQN
                     QTIVVSGESGAGKTVSAKYIMRYFASVEEENSYAMDNVQHQVEMSETEQRILATNPIM
                     EAFGNAKTTRNDNSSRFGKYLEILFDKETSIIGAKIRTYLLERSRLVYQPKSERNYHI
                     FYQLLAGLPPDQKKELHLMEPSDYLYMNQGGVTEIEGVNDEDEYKTTVEALTLVGVTQ
                     ETQHQIFKILAALLHIGNIEIKKTRNDASLSSDEPSLQIACELLGIDSFNFAKWITKK
                     QITTRSEKIVSNLNYNQAVVARDSVAKFIYSALFDWLVENINTVLCAPEVADQVNSFI
                     GVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFND
                     NQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQTLDKPPTNQVFSKPRFGQTK
                     FVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLQNILLTLENAALKVDEA
                     KKAEQEQSKKPVPLARTVQRKPTLGSMFKQSLIELMDTINSTNVHYIRCIKPNSEKEP
                     WKFDSLMVLSQLRACGVLETIRISCAGFPSRWTFSEFVLRYYILIPSSEWSKIFNGEE
                     MTEDSIVDICQKILDGTDKSKYQIGNTKIFFKAGMLAHFEKLRSNKIRQSSVLIQKKI
                     RAKYYREQYLNTIRALKNTQTFAKGYVIRQKIDRELKLNLALAVQRLYRGLLVRAETF
                     AVLRSITMIQSRLRQQLAQRELEARNAHNAAVTIQSRVRSFQPRKSFQRFRKDTITVQ
                     SLVRRRAAQTQLKQLKEEAKSVNHLKEVSYQLENKVIELTQNLALKVRENKDMTSRLL
                     ELQEKLQFSGNLKEELELQKEEHARALKDQSMEHDARYHEIEEQLKISQQEVEAAREE
                     IKSLTAKHQEIKEASRQQLEELNSTKELLNESRTQNSDLRDEVKSLKDEISRLQNSMK
                     TELAAQTPRSVKTYAMNGGLMDDTMSPSQMNIVSVNGQGSSVPVTGLGIESDNRSTLS
                     TLSQINDELYRLLEETKVLNGEITEGLIKGFKVPETGVAIQLSEREVLYPARILIIIL
                     SDMWRLGLTKQSERFLAEVLTTIQRVVQSLKGADVIPGGAFWLTNVRELYSFVIFAQE
                     SILHDESYNKGLSEDEYKEYVVLVTELREDFESLSYNIYNIWLKKLQKDLQKKAVPAV
                     IVSESLPGFKNEAGKFLSNLFGSGPEYNMDDILTFFNTIYWCMKSFHVENEIFRDTVL
                     TLLNYVDSICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKTHYIPEGADCLQHLVQT
                     SKLLQLRKKDLDDVKILCDICTALKPVQLQKLMSQYAVADYEAPISDEILNYVAEKVK
                     KGSSLSSDGKSKVHSEDIFLKVETGPFEDPFVGIETRQFRKIEAYIPAWLNLPTTRRV
                     VELVTEQVTVQESQALLDTSVVDESTA"
     gene            complement(<763057..>763461)
                     /locus_tag="HG536_0F04000"
                     /db_xref="GeneID:59327290"
     mRNA            complement(join(<763057..763305,763381..>763461))
                     /locus_tag="HG536_0F04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284853.1"
                     /db_xref="GeneID:59327290"
     CDS             complement(join(763057..763305,763381..763461))
                     /locus_tag="HG536_0F04000"
                     /inference="similar to AA sequence:RefSeq:NP_009372.1"
                     /note="ancestral locus Anc_7.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140749.1"
                     /db_xref="GeneID:59327290"
                     /translation="MSSAVPYDPYIPPEEPAEQSKAAALKAEIDDTVGIMRDNINKVA
                     ERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLCLVLVVIILLVVIIV
                     PIVVHFS"
     gene            complement(<763818..>765995)
                     /locus_tag="HG536_0F04010"
                     /db_xref="GeneID:59327291"
     mRNA            complement(<763818..>765995)
                     /locus_tag="HG536_0F04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284854.1"
                     /db_xref="GeneID:59327291"
     CDS             complement(763818..765995)
                     /locus_tag="HG536_0F04010"
                     /inference="similar to AA sequence:RefSeq:NP_014974.3"
                     /note="ancestral locus Anc_7.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140750.1"
                     /db_xref="GeneID:59327291"
                     /translation="MSFDWLNVPGLSSDEGNVTVEEAGQMPPPSVSFNFGPGSAISFN
                     AEQPANNSNQQPKQSLSGNVKTANGNWSGHPQASPNEQPKAHQNELVYSQHSNIHKSH
                     KIEAEADIEYKETPDELRVPLSLSRSELTFEEVRTYLRWYNCITLRTHSKLVRLADVF
                     RFLSNFNISEQLKERITLIFRTCKNALNIGQFFAVLRLVSKALIENKMPNRKMILEKA
                     PIPKPRPILSSGAGQEVYEEVDEEPDDINGGKVDFDSFASLLLTGKSARKRIRRRITI
                     VADKNKRVRFSEHLTFQEAPSSDGVDQKHEDIEENEESDKLDLSLPMDQLLKRMAKRK
                     EKNSALVSAMPNDQQETEEEREVLEEMKDSLSHFKQIQTVDFASMAPGSVPSIVLDSS
                     KANSDGNLSQAPAQALIPLKPTSTGSANHLFRQHYNPPQESQMDSQASLLPLKPTATG
                     SANYLMRNQIPSQQHGASGYSPSATGSSPVSGLQPLKPTATGSGNYLMKQHFNQQFTQ
                     STNSSNAANDVHGRSSPLYSGQLPPDPHLQAPQPSVSLQQQLSPQITPQSQNLQPQRQ
                     QQQQQQQHGVFSASNPAGSYFQSLLSHSPSPSSSTSNLPVMASGSPYRDMLPSNGPTS
                     QSRATYNSGYQYSSPVPDRQQPMFTGSNQPQVQSQQLPQQLPQHQQNPQQFIPQQGFT
                     NGFSAPRPYAMPTSASPRSGDILSDLQSLQQQVDALQSSYSQR"
     gene            <766187..>766948
                     /locus_tag="HG536_0F04020"
                     /db_xref="GeneID:59327292"
     mRNA            <766187..>766948
                     /locus_tag="HG536_0F04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284855.1"
                     /db_xref="GeneID:59327292"
     CDS             766187..766948
                     /locus_tag="HG536_0F04020"
                     /note="ancestral locus Anc_7.65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140751.1"
                     /db_xref="GeneID:59327292"
                     /translation="MPRKNKRPVFGEDDSESESTGDGFKAYLSKKSLQSSKRAKSPQA
                     LAVAKSSLDEDESKGLKRPQETEQRSSFMEGLLKAKRQREMDRLHSQAIRNTFENELQ
                     KKNDSPDQSFITEGYKVKRTEYDQAELRAAEEDEYHNDDKLHGGSSRALALQMLMRDA
                     PPAEDSEAAPEEACSEKNVAKVPPIFENDIYHSEPSKMRRSVVEANHSVESLIKLRPE
                     EKQSCIREFLRSTKSMQEIKLHIEKYYERQSVRKR"
     gene            complement(<766963..>770904)
                     /locus_tag="HG536_0F04030"
                     /db_xref="GeneID:59327293"
     mRNA            complement(<766963..>770904)
                     /locus_tag="HG536_0F04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284856.1"
                     /db_xref="GeneID:59327293"
     CDS             complement(766963..770904)
                     /locus_tag="HG536_0F04030"
                     /inference="similar to AA sequence:RefSeq:NP_014975.2"
                     /note="ancestral locus Anc_7.64"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140752.1"
                     /db_xref="GeneID:59327293"
                     /translation="MVACFAPRSGPRSSPERVLTRLATCRTIYRYRQYSSSVEKFKEE
                     PRINPVGIQYLSRSLYQQLFGGRKHSKKEDFLDATKREALVNLSRQFLKSFDLLGKKT
                     SISEPISFQLPKLQGNSLDEHFQKLGHFASEPYRTMCSDKFNEIVPRPREWIRTEGWM
                     RYEPGKEPQRVSSPLEDTLVFDVETLYRISSYPTLAVALSDKAWYLWCSPFICGSSKV
                     EHLIPMNSMDQNRLIIGHNVGYDRARVLDEYNFRPSKAFYLDTQSLHVASSGLCSRQR
                     PQFVKSQKLKSIRDTSDGDEELESTHLENLEEDPWLSVSAMNSLSDVASLHCGIKMQK
                     EPRQFFETTDKNDVIDNFQLLANYCATDVETTSRVFDKVFPLFLEKCPHPVSFGALRS
                     LSSCILPTRHKQWNEYLRSSESVYQESKLDIESKIIQIIEDTVKLYQPGSSLEAINKD
                     PWMRQLDWSIKPLRLTKKGVPTKNQKLPGYPEWYRSLFPNKNAIKPHITIKSRIIPIF
                     FKLSWEGYPAVWTDDNGWCFPVPNSMIDKFKSKNYVLADEGVNERYRKELQAKGVESE
                     NPGVFFKIPHPNGPDNNCKTLLSKPYIHFFEKGILTSASEFAHDALKINSCGSYWMSA
                     RERILSQFVVPQPDFPEAFKPLKSSDDKHKGNQDLGIILPTVIPMGTVTRRAVENTWL
                     TASNAKSNRIGSELKAQIRAPEGYCFVGADVDSEELWIASLVSDSVFNIHGGTAIGWM
                     CLEGSKNEGTDLHTKTAHILGCSRGEAKIFNYGRIYGAGVKFAAHLLKKFNPSLSDQE
                     AKATASKLYESTKGKTKTSKIFKRFWYGGSESILFNKLESIAEQDVPRTPVLGCGITV
                     SLMKRNLGANSFLPSRINWAIQSSGVDYLHLLACSMHYLIAKYNINARLSISIHDEIR
                     FLVAEEDKYKAAMALQVSNIWTRAIFCEQLGIDDLPQNCAFFSAVDIDHVMRKEVDMD
                     CVTPSNPNPIPVGETIDMRKLLEIPGSALEDPKECIEVSHFPYKYREPVFAEYNKAYS
                     EEFWKYFLRMQLQNAKWKVDALESAYIQETTDKEFRTENPEEMYGLLDYLKDLKRGKK
                     KRITIMDNAPFEHADQWVAYTMSMKEERLKGKNHQRHAANPSVKKNWIPTNVTVGPVQ
                     SPTAKSTPAGFFEQAASAAGRCEAIKAHAQASFESGVEASDQLSNPIARSDLESADEK
                     TRVSNKKVSQRGRRKTVGNKKAYDIFYECIDESRKHAASREEILNKTDVEEVVNDVLN
                     DASHKSSIRRKARRPKTKKTATQSVKKDGIRSSTLFKEMNNTSKDELQANS"
     gene            <771532..>772224
                     /locus_tag="HG536_0F04040"
                     /db_xref="GeneID:59327294"
     mRNA            <771532..>772224
                     /locus_tag="HG536_0F04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284857.1"
                     /db_xref="GeneID:59327294"
     CDS             771532..772224
                     /locus_tag="HG536_0F04040"
                     /inference="similar to AA sequence:RefSeq:NP_014977.3"
                     /note="ancestral locus Anc_7.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140753.1"
                     /db_xref="GeneID:59327294"
                     /translation="MSSVITALTPNQVNDELNKMQAFIRKEAEEKAKEIQLKADQEYE
                     IEKTGIVRNETNNIDANFEDKLKKASLKQQITRSTIANKMRLKVLSAREESLEKIFES
                     TKEELGNLAKKEKQYRPVLRSLILEASLKLLEDTVVVKVAKRDQKLAESLIDDVVKEY
                     KEVANKDLTIKISDMFLSDDTVGGVVVTSENGKIEVNNTLEERLKLLSEEALPAIRLE
                     LFGPSKTRKFLD"
     gene            <776518..>776985
                     /locus_tag="HG536_0F04050"
                     /db_xref="GeneID:59327295"
     mRNA            <776518..>776985
                     /locus_tag="HG536_0F04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284858.1"
                     /db_xref="GeneID:59327295"
     CDS             776518..776985
                     /locus_tag="HG536_0F04050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140754.1"
                     /db_xref="GeneID:59327295"
                     /translation="MPRIPPYRRSPKEEGEIVKILDELLEKGFIEPSKSPFSSPVVLV
                     RKKDGSFRLCVDYRVLNNATIKDPFPLPRIEVLLAKIGNSAVFSTLDLHSGYHQIPVK
                     EEDIPKTAFTIHDGKYQYRVMPFGLVNAPSTFSRYMTDIFATFHSFLFTWMTY"
     gene            <778393..>779322
                     /locus_tag="HG536_0F04070"
                     /db_xref="GeneID:59327296"
     mRNA            <778393..>779322
                     /locus_tag="HG536_0F04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284859.1"
                     /db_xref="GeneID:59327296"
     CDS             778393..779322
                     /locus_tag="HG536_0F04070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140755.1"
                     /db_xref="GeneID:59327296"
                     /translation="MTMNYPFPSAMNGADSNSLLSGYNNAGLLQNRPDNATAGAAGLY
                     GPNSMAMPRVVDCSDAYVRNQGTGTLGGTGADDNSSFSGPITASSGFTSSKNYANNTL
                     DSSFDCCLDSSASKSNSNANYADGLQVGDVGTNNELLKSLTLKLRIKETQNESLENEI
                     QKLRGSFNEALNFKQSEYKQERQILHKEKTSLEAPKDVEQVFRRLSSTLRSKDDELVE
                     TKNAFESIPTALALDPSNSVTKYGRYDAEALAHKMVTRIEILTKENQEMAKMLAYGRA
                     KEMQIERQLAQMKNKELNATISKLKEPEGAQKE"
     gene            <782005..>783339
                     /locus_tag="HG536_0F04080"
                     /db_xref="GeneID:59327297"
     mRNA            <782005..>783339
                     /locus_tag="HG536_0F04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284860.1"
                     /db_xref="GeneID:59327297"
     CDS             782005..783339
                     /locus_tag="HG536_0F04080"
                     /inference="similar to AA sequence:RefSeq:NP_014979.1"
                     /note="ancestral locus Anc_7.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140756.1"
                     /db_xref="GeneID:59327297"
                     /translation="MFLSRRNGLLRCACRLRPLPVAVAKRFVTTEKSSLSLPPLNHQL
                     LSLKPTTPSDAHVSCTVFNEKGDVTAVSEKFPKMGFLRDHSLYPRDLRKIDTTAIDII
                     PGIIVKNSCIVFNMLHIKALIEKDRVYVFDTANPLAVAKLGVLMYDLEAKLSCKNAGY
                     MSTLTQYYEHRALESMLINVMSSLETDFKRHSKLCGQILTDLEDEVNRDKLRDLLIRS
                     KDLTLFYQKSLLIREVLDELLENDDDLAGMYLTVKKKEQDDDFADLEMLLETYYTQCD
                     EYVQQAESLIQDIKSTEEIVNIILDANRNSLMLLELKVTIYTLGFTVATLLPAFYGMN
                     LKNFIEESNYGFGGAVLFSIVAALMVTGANFRALRSVTKLTMLNNHAGAESVRHKQLA
                     SKYAEEHIPSFWTRWAQWTSLVWNGRAGAIQRQQGKKDRDIAWKWLIDDEKK"
     gene            <783786..>786074
                     /locus_tag="HG536_0F04090"
                     /db_xref="GeneID:59327298"
     mRNA            <783786..>786074
                     /locus_tag="HG536_0F04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284861.1"
                     /db_xref="GeneID:59327298"
     CDS             783786..786074
                     /locus_tag="HG536_0F04090"
                     /inference="similar to AA sequence:RefSeq:NP_009371.1"
                     /note="ancestral locus Anc_7.61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140757.1"
                     /db_xref="GeneID:59327298"
                     /translation="MLAKAAAGASAPTLRGSVYLDSHDVKIIQYKAAIYKLGEMTRLL
                     NILEKNLERTGSSKIIPLVNYMLSLCEGPLFNVHPILRKRYQLLCEFKACKVTPILPA
                     LSTSQIDLKLEFPPFIRDRESLRSKIYDDELQWKLLGCLQKVLANCTTIYERRLRQIQ
                     LERNAMRPADTSGRSIPLDLNAVEDLLRPQELSLSLDLAVLINDAEQDTTTRSLLKLQ
                     TQVLAKFALCLQSKVLPVIRGYYNQLHTFCASRGISAAAVKELQYWQYSLHRIYALML
                     RALYIFDVMMSLTTQIYFPNRSYLNDIKTRLLSQNVFSYQEALQRVEELCDSSEHAAI
                     AKLVTALLDLSKQNVAYHVQPGKILELYQNSLSQVVPFLRTSTQTLSEFAEMWTYIEG
                     NLEAQNLINGYEASQLRRMLDERLEADRLTHIERRKVKSSIKEPGSPLKGSSTPNSRH
                     TLRRNLVGKSNGSSNSSVSSTGPSSPGTMSPLRMSRTNSVDVQSSNPLGFASPQVSRR
                     GSIAESRLPTSINASKATMDQKSTPRSPLANRRIMGRPRSSSLQSALESNRKTRQGPA
                     SPSRSNSLQADATVNQKIIQEAVSKSFNGAGKVGSPLSKVQTRTTLNHSPSPDDIRCE
                     SPASELEKLTLNPEDNQNKEDDFVQITVSSDYPSIASKSNLCIKKVRFIGVPPLDEKE
                     DKSPKRRGWYKKPAVLHYPPPPPQFAVQKYKMRQEGMAFRTSLREEDTTKKSNLLLNL
                     DISQPRDSATQKIASKLRDKLR"
     gene            <786220..>787548
                     /locus_tag="HG536_0F04100"
                     /db_xref="GeneID:59327299"
     mRNA            <786220..>787548
                     /locus_tag="HG536_0F04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284862.1"
                     /db_xref="GeneID:59327299"
     CDS             786220..787548
                     /locus_tag="HG536_0F04100"
                     /inference="similar to AA sequence:RefSeq:NP_009370.1"
                     /note="ancestral locus Anc_7.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140758.1"
                     /db_xref="GeneID:59327299"
                     /translation="MSFSSLLPPPRNCKAASKEASSSNRELVVRALTEIDGDQEEVVQ
                     HSNVINSVVASKLNFQDFVPIRQRNFNMELPKPSKLEIEETYKRTKKAFDKILASLSK
                     PDGTGVKSSTQVNADAYELKYDTLQPSGAVRSRSLKIVEHAQDPLQPSQVKAGKVVAP
                     PVEEPLAPILHKTDSTETSNKLSKEERERWNIPAAISSWKNPKGYTISLERRLDMDAR
                     YNKQHTGAQEVNMGFAKLSNALDVAEREARQEIKLRAEAKRQLADEELRQKELKLKLL
                     AQKAREEREYQRMHPPSRKRLLEQGNDFANEREIARNSRRMELDKDLRRSKMSTADRL
                     RELAYSQGRDVSEKVILGAAKATDAAGDQYDSRLLAKGASSGARVNEGQLYDRPLFDQ
                     QLRDSSNRANLEQIESFIRQDKRDTNGPIEFTPASENNEEQSKEYGLQKK"
     gene            complement(<787762..>788256)
                     /locus_tag="HG536_0F04110"
                     /db_xref="GeneID:59327300"
     mRNA            complement(<787762..>788256)
                     /locus_tag="HG536_0F04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284863.1"
                     /db_xref="GeneID:59327300"
     CDS             complement(787762..788256)
                     /locus_tag="HG536_0F04110"
                     /inference="similar to AA sequence:RefSeq:NP_009369.1"
                     /note="ancestral locus Anc_7.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140759.1"
                     /db_xref="GeneID:59327300"
                     /translation="MVRLKSRYILFEILYPDEGGIEGTAHITKRDILLRLHRVSPPDI
                     SIKSLLQEIRRSLQVNFGDYGSGKANSLLQVKYFSNMTSTGILRCHREDCDLLVAALA
                     LITKVGDVDGLMVNPIKMSGTIKKIEEYAGRRSEKLLSVLKQNDEIALDNFHDVSEDE
                     DQEE"
     gene            complement(<788423..>791563)
                     /locus_tag="HG536_0F04120"
                     /db_xref="GeneID:59327301"
     mRNA            complement(<788423..>791563)
                     /locus_tag="HG536_0F04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284864.1"
                     /db_xref="GeneID:59327301"
     CDS             complement(788423..791563)
                     /locus_tag="HG536_0F04120"
                     /inference="similar to AA sequence:RefSeq:NP_014980.3"
                     /note="ancestral locus Anc_7.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140760.1"
                     /db_xref="GeneID:59327301"
                     /translation="MCPDPALSKICFVRELGLFQGFLFPSVGSEILCKIWWKYDYLLN
                     VPLELRGLQEVLSGLRNTFGFKTLSFQLKRLGCCNFARKFGTKPYRMTIGDKEKWTAK
                     KVRETFMNYFKDQQHRFVPSSPVIPYDDPTLLFANAGMNQYKPIFLGTVDPASDFYSL
                     KRAHNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIHYAWELLTD
                     VYGIPADRLYVTYFEGDSKQNLEADLEALELWKAVGVPEDHILPGNAKDNFWEMGDQG
                     PCGPCSEIHYDRIGGRNASALVNQDDPDVLEVWNLVFMQFNREKDGSLKPLPAKHIDT
                     GMGFERLVSVLQDCRSNYDTDVFLPLFSGIQAITGARSYTGKFGAEDADGVDTAYRVL
                     ADHVRTLTFALADGGVPNNEGRGYVLRRILRRGARYARKYMNYPIGDFFSRLAPTLID
                     QVKDMFPEVAKDPSFLFEILNEEEASFAKTLDRGERLFEKYAEAAAKSGTKTLDGKQV
                     WRLYDTYGFPVDLTELMAEEKGLSIDGPGFEKAKQESYEASKRGGKKDNGDLLKLNVH
                     EISQLNDEKVAKTDDSAKYGTENIDATILKLFDGSRFVDEISEPGKKYGVILDKTCFY
                     AEQGGQEYDQGKIVIDDVAEFNVDNVQLYNGFVFHTGTLLEGKLSVNDKIIASYDELR
                     RFPIRNNHTGTHILNYGLLQTLGTEVDQKGSLVAPEKLRFDFSHKKALTIDELRKAED
                     ICNDQIRQNLKVFYKDVPLDLAKSIYNVRAVFGETYPDPVRVLSVGKSVDELLENPAN
                     EEWGKYSIEFCGGTHVAKTGDIKEFVILEESGIAKGIRRIVAVTGSEAHEAQRVANDF
                     DLELVAADKLPFSPLKEKKLKELGVRLGQLPISVIKKQELRDRFSKIEKAVKDEVKTR
                     AKKETKQTLDTVKEYFAENESSPFFIKFIDIPTNAKAITEAINHVKSSLKDKSIYLFT
                     GNDPEGRVAHGCFLSDDALSSGIDGPSLSKIVTSAIGGKAGGKGNVFQGVGDKQEGVD
                     KAISELQALFKEKLIV"
     gene            <791651..>795520
                     /locus_tag="HG536_0F04130"
                     /db_xref="GeneID:59327302"
     mRNA            <791651..>795520
                     /locus_tag="HG536_0F04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284865.1"
                     /db_xref="GeneID:59327302"
     CDS             791651..795520
                     /locus_tag="HG536_0F04130"
                     /inference="similar to AA sequence:RefSeq:NP_014981.1"
                     /note="ancestral locus Anc_7.57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140761.1"
                     /db_xref="GeneID:59327302"
                     /translation="MLFWRLAVAVLVCVRYAASVNISGSAIGVPESVRIWSILQFLLR
                     GDDRKILPELYPFVTQLEEFETENEQSDCDLVLRVSEMLATKYGLDDVGSLLPIYAEL
                     YPMGYPVRFSEASNENYFILNGKRYSKSDDVFYLQSKELQQQARVSDCEAAYDDEVIV
                     GVNSQAPVVLLYGCPDDDGEFEEFNRNLYSEASNTGKLRYVWRSTCSLNEYSLKGVPL
                     GLTKRSHSDPSVLPAELLGIPAEFAQAGLALGDLEVKKLADVDLKLASLIAAHQSGYK
                     DFHRTLRYAKGIINNFPLLAEQLANLQMSTSKILESNEQLNRDGIDYNMLGLYINGQN
                     WRLSEVDRYTLINAVSYEYYAMKHLGSILQKYEDVAGSLTAKRLLQVFAEISLPKLEQ
                     TQPIKVDLHRIPGFSEAVIYFNDIELDGQYEDMATNVRNFFEESKFGELPDVRQNWNE
                     VIFAIDFGNLNDDNSKIALEGLNRAVKVIAQGYPQRIGLLPLNTAAGEGIIHKIYQLK
                     HKDLSALAEFLENIPQNFITSRYEETPDYSSVVEELQIRETSIIINGNIYPFRKNTWH
                     YLIAKTIKKDKAYLKGELAKIMSSEQGPTENIDVRSILHSRSANTRHQKYTPDYFADA
                     SYTSLDNTILRTIDESVVEIVKGEKYVTLHTVTLVDDFSTVIALRRLKNLLNTTFFGV
                     RIRIINSGLPGKGRWNDIKKAVKSLDMAKLNSLILASQNRRALFASNHEALGKWLVDL
                     PLEPITKGAFVVVNGRFIHLESDEVPTKHHFEAIIKREAQRTLDTMQALEQVLPDITK
                     RSIDPDFIEMVSSILSKLFFHGTDIYNNGIDRTAEGTLSRVNLQLKLNDLTVFQSRDA
                     PKPVDVTLFMDPTEERSQKLASLLLLLENVPFVNLQIVLLPTEELKISPIHRVYLDGT
                     EDIELGRDLEHNFQVELDPPSHFFISNTSELDGIIVEAHVFKAGDTRSKANVDGLGGV
                     CLELVGSDQRIEASCITMSTFGYCQFIVRSLQADYAVRSCDPRFRVASFAVNSRPDYV
                     NSSSVALLHLDKVKLHVEVEETGVPAEPPQQQELNIYTVLKDNGHDEGKAQKMIETIL
                     AKAPKGETVNFWILDQPFLSRSFKQFCRQTTDDPSSPGSIQFIRYAWPAWLRPQRLCD
                     KRLDLFKILFVDVMFSPAISRILYMDPEPTPLNPFELYSQSSGGSPLAMFEATGRGYW
                     QEGYWAKKLAQTKKRFHTARLPFLVDLAQLRKTSGGDKLRIHYQRLSADIHSLAHAHE
                     DLINDLQLEIPIETLTALPDVVIHDEL"
     gene            <795629..>797497
                     /locus_tag="HG536_0F04140"
                     /db_xref="GeneID:59327303"
     mRNA            <795629..>797497
                     /locus_tag="HG536_0F04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284866.1"
                     /db_xref="GeneID:59327303"
     CDS             795629..797497
                     /locus_tag="HG536_0F04140"
                     /inference="similar to AA sequence:RefSeq:NP_014982.3"
                     /note="ancestral locus Anc_7.56"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140762.1"
                     /db_xref="GeneID:59327303"
                     /translation="MEVADEALRHGGAARKRLACSNCRRRRKKCDLTFPCGNCQRLNL
                     ECNVNEEDLRKKRYAASYVKSLENHIAHLETSLKNLVDKVYPNDELHAPIISNDSHHH
                     RHSTARKNDKRRTFGKGSFYPGSSDTGPGAGAAAQQTHAERIADLHTAVIVRPQPRSG
                     AVGGNALNSDAKILQSLSNFYTWLYPGHFIFVHRESFLYGFFNHAENEYADSHYCSPE
                     LVYAMCAVGSRLSPELAAMSEVYYERSKARLLQLVFDERSAARITTVQALFCLAFYEL
                     GKGDNEIAWYLSGLAIRVGYEMGFQLDPQVWITAEDPVPLTKSELEIRSRIYWGCYVA
                     DHLICVLLGRTPTLSLSNSTISQSDELPEIEGTEEFKYQGQHVLRVALPLKNLIVLSR
                     IVQIFTARIFIETGPTADKLVLLTRCNSQVYNWRVSLPPRLRWTHASLRDAQLATDPT
                     IAYFWYYYYTVRLVFNKPFIGDCREARAVVRETVDDLRAVFTQFKTRFGDFRHATLQQ
                     LYACLLAIQCLRELVKEDNAEHDDADGADADNLQFFSHVFNKYLGATYGLPGRLRRLE
                     EQGNVAAASVAAGAASGNHGVQQPIEVSNINLVHDFSLSKEIDDLIKELFGHADVA"
     gene            <797702..>798622
                     /locus_tag="HG536_0F04150"
                     /db_xref="GeneID:59327304"
     mRNA            <797702..>798622
                     /locus_tag="HG536_0F04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284867.1"
                     /db_xref="GeneID:59327304"
     CDS             797702..798622
                     /locus_tag="HG536_0F04150"
                     /inference="similar to AA sequence:RefSeq:NP_009368.2"
                     /note="ancestral locus Anc_7.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140763.1"
                     /db_xref="GeneID:59327304"
                     /translation="MEFYSPQPEHAQLHGGAAGSKHASQLLAMLHREVDDSLDAVLEE
                     KSILSPPPSPETSDDEAEDEGHSKIVVGPAWSPGLDAHKARVVLRNFLAEYRGLGPSG
                     AAVRRRAGLGKSLREPERFYRTRRRRVQGLEKPGSDEEEEEEDESDVVRPSTPARRHR
                     RVTAPPCVSPLASAAVLSHGASHYVPSMSWQSLPDYCPPVDTLPNDRCLKVEWKGSPM
                     DLSGDPLRHLLHPAELALAQVLRLPCDLYLDSKRRLFLEKTHRLKQGLPFRRTDAQKA
                     CKIDVNKASRLYAAFEKVGWLKDSNFTSFL"
     gene            complement(<798657..>799136)
                     /locus_tag="HG536_0F04160"
                     /db_xref="GeneID:59327305"
     mRNA            complement(<798657..>799136)
                     /locus_tag="HG536_0F04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284868.1"
                     /db_xref="GeneID:59327305"
     CDS             complement(798657..799136)
                     /locus_tag="HG536_0F04160"
                     /inference="similar to AA sequence:RefSeq:NP_014984.3"
                     /note="ancestral locus Anc_7.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140764.1"
                     /db_xref="GeneID:59327305"
                     /translation="MSKPEGIPEGHSVVKRLRNELVQLMMSPTPGLSAFPTSEEDLTR
                     WSGVIVGHEGTPYEGLKFRISLHFSERYPYEPPRVTFVSPMWHPNVDMSGNICLDILK
                     DQWSAVYNVQTILLSLQALLEEPNNGSPLNAVAAELWERDMDEYKKRLMARYEEIEE"
     gene            complement(<799224..>800066)
                     /locus_tag="HG536_0F04170"
                     /db_xref="GeneID:59327306"
     mRNA            complement(<799224..>800066)
                     /locus_tag="HG536_0F04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284869.1"
                     /db_xref="GeneID:59327306"
     CDS             complement(799224..800066)
                     /locus_tag="HG536_0F04170"
                     /inference="similar to AA sequence:RefSeq:NP_009367.1"
                     /note="ancestral locus Anc_7.53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140765.1"
                     /db_xref="GeneID:59327306"
                     /translation="MSAPTMQSTSVLTEHLQYPAVSLVDDIINAVNELMYKCTAAMER
                     YLLDRCVIGGVDHTDEIKVGVAKLETLLENSVDKNFDKLELYVLRNVLSIPQDLLDAN
                     VFRLAYQRDLRIVDETEQEHSVRDIHDKVHQIELAMGLHRQLTAQVKSAKLLQSKVRN
                     FKKLLVQLLECREPEMQEVFRSLKPLDDSIRLITSQLKQLYVESEEYGSADQIESLSR
                     RAQASRASLKSRATYIDSKTKIILDAVNKPENTSRTPREAPMAPSSCVIEDPDLELLD
                     AALT"
     gene            complement(<800207..>801130)
                     /locus_tag="HG536_0F04180"
                     /db_xref="GeneID:59327307"
     mRNA            complement(<800207..>801130)
                     /locus_tag="HG536_0F04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284870.1"
                     /db_xref="GeneID:59327307"
     CDS             complement(800207..801130)
                     /locus_tag="HG536_0F04180"
                     /inference="similar to AA sequence:RefSeq:NP_014985.1"
                     /note="ancestral locus Anc_7.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140766.1"
                     /db_xref="GeneID:59327307"
                     /translation="MAELRKRSLADMQAAKFIKKHKKTNKNPVIDGISNCVVRVPVSL
                     YVSLAPVYAESPLQGIMKQHLNPMVMKYNSKVNGVVLGYKDLTILDACPLEDKSEADG
                     KLIKLTADTPFGFTWCQVVLYVWQPQIGDVLEGWVFIQSASHIGLLIHDTFNASIKKN
                     HIPADWTFVHEEEEVHEGSDSQSRDEADEKNGEASQFTRRSMDHWVDSDGEKVDGKLK
                     FVVRNVYTTGRVISVEGSLVLDGNHDKERSQAESLPVVSNRKIVFDDEVSAENRESHK
                     ELELPEMKEDNGEEIIYEENSDSDEDSSSSE"
     gene            <801934..>806943
                     /locus_tag="HG536_0F04190"
                     /db_xref="GeneID:59327308"
     mRNA            <801934..>806943
                     /locus_tag="HG536_0F04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284871.1"
                     /db_xref="GeneID:59327308"
     CDS             801934..806943
                     /locus_tag="HG536_0F04190"
                     /inference="similar to AA sequence:RefSeq:NP_014986.3"
                     /note="ancestral locus Anc_7.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140767.1"
                     /db_xref="GeneID:59327308"
                     /translation="MDISKPVGSEITSIDFNVLTTRDIRDLSVKQITNPTVLDNLGHP
                     ISGGLYDLALGAFLRNLCSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCC
                     LFCHHFRLKSVEVHRYACKLKLLQYGLIDESYRLDQISIAGMQYLLDDDEQEDQEAVE
                     DNAMDAGTNSSKTKGTKDISAALKAEIMTKRNQFVDEKIGLALSEGRTSERGTFTATT
                     NDERKRLIHDFHKRVLSRAKCDNCGMFSPKFRKDGFTKIFETALTDKQLTNNRVKGMI
                     RQDMIKKQQQSKRLGGSEEENNSVEEDFSVERNPSARPKTGSTYILSTEVRNILRALF
                     KKEQQVLQYIFHSRPNLSRKVIKADNFFMEVVLVPPTRFRLPSKLGEEVHENTQNQLL
                     SKILTTSLLIRDLNDEMSEIQKDKVSADDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ
                     GNSSSKVAIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFA
                     TKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGTLVSLVGMTLEQRKALANQ
                     LLTPSSNILTHPLNKKVYRHIKDRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHY
                     ANTGAYNADFDGDEMNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISA
                     GVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRPRVVTLPPAIMKPVPLWTGKQIIST
                     VLLNVTPPDMPGINLRSKNKIKNEYWGKDSTENDVIFKNGNLVCGILDKSQYGASKYG
                     IVHSLHEVYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKARTEILKTS
                     IDVGRQAAAEVTNLDKDTAPDDTELLKRLEEILRDENKSGILDAVTSSKVNAVTSKVV
                     STCVPDGTMKKFPYNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTL
                     PSFKPFETDAMAGGYIKGRFFSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLT
                     KQLEGVHISYDNSVRDGDGTLIQMLYGGDAIDVTKESHMTQFDFCLDNYDALLKKYNP
                     SALVEHLDVDNALKYSKKAVKHRKKHAKEPHYKQKVKYDPVLAKYNPAKYLGSVSEKF
                     QDKLEAYLDSNAKALKSHGNVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPST
                     QMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDEQADTFCK
                     SISKVLLSEVVDKVTVVETTGSTNGSVASRSYAIKMMFFNQEEYNEQYDISSEELQNV
                     ISNKFLSLLEAAILKEIKKQKKTTLPEVGIAVAKESAMAALDGSMEKPTQDNDEEDAR
                     KKGKQAVSYEEPDEEELETMRQAEKSSDEEDLDSDKESKDSDSEDESDVDMERAIESA
                     EEAAEDMSKTQRDRQHAIISKQRFVTKYNFDDKNGKWCEFRLELAADTEKLLMVNIVE
                     DICRRSVIREVPCIDRCVHSESVKGRRTLVTEGVNFQAMWDQEAFIDVDAITSNDVAA
                     VLRTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETS
                     TSSLMKMSYETTCQFLTKAVLDNEREQLESPSARIVLGKLSNVGTGSFDVLTRVPNNG
                     R"
     gene            complement(<807168..>810137)
                     /locus_tag="HG536_0F04200"
                     /db_xref="GeneID:59327309"
     mRNA            complement(<807168..>810137)
                     /locus_tag="HG536_0F04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284872.1"
                     /db_xref="GeneID:59327309"
     CDS             complement(807168..810137)
                     /locus_tag="HG536_0F04200"
                     /inference="similar to AA sequence:RefSeq:NP_009365.1"
                     /note="ancestral locus Anc_7.50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140768.1"
                     /db_xref="GeneID:59327309"
                     /translation="MAKKGKKNQQNYWDEDFEEDSPQAEQFGESPAETPSVEGTPAAE
                     EAGAGAIEADFMSTLKKSKKKSDKKAVEEKAENGNGKPVLKSKKEKEKEKKELEKKKK
                     KEEAAKKKAQQQAQKEKNKELNKQNAEKVAAEKEAKARASEEPAEIKKPAKKPGKKVP
                     AGLAALKRQLELKKQMEEEERLAREEEERLEREEEERLRKAEEEQEEARKLKREKEKA
                     KRDKLKAEGKLLSKKQKEEKKLLERRRQALLASGNIKVAALSKKGDSEEPEAPKPKKV
                     VYGKKKKKSVKEDETSESSSTVEKEQKQDKIKQATEEVLIDDWENLALNDDEGEDLAA
                     EMDEAHLSEQEIEDEQTDSETEEESTSPEASQAREAVKVQQAMPVATSSSVNKKDLRS
                     PICCILGHVDTGKTKLLDKIRQTNVQGGEAGGITQQIGATYFPIEAIKNKTKVMTKYE
                     KQTFDVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVIDIMHGLEQQTLESIRLLRDR
                     KAPFVVALNKIDRLYDWNSTPNNSFRDSFEQQSRAVKDEFETRLENIKVALAEQGLNS
                     ELYFQNKNMSKYVSIIPTSAVTGEGVPDLLWLLLELTQKRMSKQLMYLSHVEATILEV
                     KVVEGFGTTIDVILSNGYLREGDRIVLCGMNGPIVTNIRALLTPQPLRELRLKSEYIH
                     HKEVKAALGVKIAANDLEKAVSGSRLLVVGPEDDEEELMDDVMDDLTGLLDSVDTSGR
                     GVVVQASTLGSLEALLDFLKDMKIPVMSIGLGPVYKRDVMKAGAMLEKAPEYAVMLCF
                     DVKVDKEAEQYAEQEHIKIFNADIIYHLFDSFTAYQEKLLEERRKNFLEYAIFPCALQ
                     TLQIINKRSPMIIGVDVIDGVLRIGTPICAVRSDPTTKEKQILLLGKVTSLEINHQPV
                     TEVKKGQTAAGVAMRLDDPSGQQPIWGRHVDETDTLYSMISRRSIDTLKDKAFRDQVS
                     RSDWLLIKKMKPVFGIE"
     gene            <810530..>811639
                     /locus_tag="HG536_0F04210"
                     /db_xref="GeneID:59327310"
     mRNA            <810530..>811639
                     /locus_tag="HG536_0F04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284873.1"
                     /db_xref="GeneID:59327310"
     CDS             810530..811639
                     /locus_tag="HG536_0F04210"
                     /inference="similar to AA sequence:RefSeq:NP_009364.1"
                     /note="ancestral locus Anc_7.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140769.1"
                     /db_xref="GeneID:59327310"
                     /translation="MSTTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRRELLT
                     SSQSSGGGGGGVGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVT
                     VPGVIRYKGAKIQMLDLPGIIDGAKDGRGRGKQVIAVARTCNLLFIVLDVNKPLHHKQ
                     IIEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLDNDGIRAVMSEYRINSA
                     EIAFRCDATVDDLIDVLEAPTRRYMPAIYVLNKIDSLSIEELELLYRIPNAVPISSGR
                     EWNLDDLLQVMWDRLNLVRVYTKPKGQMPDFTDPVVLRSDRCSVKDFCNQIHKSLVDD
                     FRNALVYGSSVKHQPQYVGLNHILEDEDVVTILKK"
     gene            complement(<811711..>812613)
                     /locus_tag="HG536_0F04220"
                     /db_xref="GeneID:59327311"
     mRNA            complement(<811711..>812613)
                     /locus_tag="HG536_0F04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284874.1"
                     /db_xref="GeneID:59327311"
     CDS             complement(811711..812613)
                     /locus_tag="HG536_0F04220"
                     /inference="similar to AA sequence:RefSeq:NP_009363.1"
                     /note="ancestral locus Anc_7.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140770.1"
                     /db_xref="GeneID:59327311"
                     /translation="MMIDNSYYLAHSLEQLKPQRLSGNIFFGPLNTLTQRQFIESENI
                     KLFIGVGLSTRRLAPILNEIPSFAGKLNDYLVLNFDSEFDAASIISGSAGSAVEEYHS
                     HNSTFLKLIIENFLKGNEEFSVQEGYRCLTPTPETLDFAQIIDGDVEAYYNGGNVYSD
                     PSSSKFVAFNDFIAIFKRVNPTAKVLVFSQNGNDLELVTFLVSAVLKEKPSVKVREAY
                     QFIKSIRPTINDSLGKVSHGCSALSEFHQLLLAKEQLAAQQGYTGCNQTPQVLRKRNN
                     SILQGGTPEPADEQVIGSKRIRFD"
     gene            813194..813266
                     /locus_tag="HG536_0Ftrna5M"
                     /db_xref="GeneID:59327382"
     tRNA            813194..813266
                     /locus_tag="HG536_0Ftrna5M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:59327382"
     gene            complement(<813424..>814197)
                     /locus_tag="HG536_0F04230"
                     /db_xref="GeneID:59327312"
     mRNA            complement(<813424..>814197)
                     /locus_tag="HG536_0F04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284875.1"
                     /db_xref="GeneID:59327312"
     CDS             complement(813424..814197)
                     /locus_tag="HG536_0F04230"
                     /inference="similar to AA sequence:RefSeq:NP_014989.3"
                     /note="ancestral locus Anc_7.47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140771.1"
                     /db_xref="GeneID:59327312"
                     /translation="MNSTMLAAVAPHSLMSGGNAVAGENGQLDDWIFSKQGAQNGEYS
                     DSSSWSWFEPLENIISSTSTSSVGSPIGGAAAGGVFGECEPLFADPSSYANSPDLLPA
                     VKKEEADDEELRIGGVSGAERFEEVADLKNPALADGKKKRAPRKRLTSHQKQAHNRIE
                     KRYRININTKIAKLQQIIPWVASEQTAFAVGDSLKKEDGSAKEVAKQLCAASATKLNK
                     SMILEKAVDYILYLQNSERLYEMEVQRLKDELDALKKGR"
     gene            <814941..>817502
                     /locus_tag="HG536_0F04240"
                     /db_xref="GeneID:59327313"
     mRNA            <814941..>817502
                     /locus_tag="HG536_0F04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284876.1"
                     /db_xref="GeneID:59327313"
     CDS             814941..817502
                     /locus_tag="HG536_0F04240"
                     /inference="similar to AA sequence:RefSeq:NP_014991.1"
                     /note="ancestral locus Anc_7.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140772.1"
                     /db_xref="GeneID:59327313"
                     /translation="MDDDKLLAILESSQEGEERGLGPEERDPAETLGRLSDDALIEYM
                     TNLSQGARKDFTREEYFRDKEIKQRERDEATRAGLGRANAPIFAGCTIYINGYTKPGR
                     LQLHEMIVSYGGKFQHYLLAKKKVTHIVATNLPLKKRLEFRNYRVVRPEWITESIEQQ
                     KLLPWQDYALSWDQEQRSLQLKVASAPVSSAVDCKDPNFLKTFFENSRLHHLSNWKAD
                     LRSRFLSEGFNKPSPGDALSIFHIDFDCFFATVAALGCESCDINRDPIVVCHGSKSSD
                     IASCNYVARKYGIRNGMWVSRAKSLLPPGVELVSLPYNFKEIEEKSKIFYTVLKEYKI
                     KFDLILPISIDEAVCVVIDHHTPHPIDRDEICRELRSEIWKRTGGCTVSIGCSNTLVL
                     ARLNLKIAKPNGYHILTQQQLVENEADWHSYLGKFQIDDLPGIGYSIVSKLRSLRQHL
                     NNLLQLKQYFHNSLPLLQKCVGKKTGSKILMYLHGKDDEESSRMIFEPESFFARKSLS
                     IEINWGIRFDTVQEIDNFIDTCADYLVQKLQEMNKRTSQITLKVLRRCADAPIEPPKY
                     LGCGECDALSHNCRLGIPTSELGVIATELKSTFRLLGCPPKDLRGVSIQFNKLIEVSY
                     DQNENQQRLKLPFQKTLNFDVFDNLPSDVKNDFSKELKRRNIVLTSSPRPKTSYAATY
                     EEKFMEELPTQIRNEVKNDLRINRKITRTKLSELREQNRKKKESIRNVRAHLLGHESL
                     FEPIKFQKESRFKDICRIVMEWFDATLIEGPHEKDLLLFENYLDKLSDSNRVPLILRF
                     SKLISVRLNLKSNQYGQEAGFQEWEQFLLKNVIPKLNKNKHTFQTVRKLDIDFDI"
     gene            complement(<817639..>819144)
                     /locus_tag="HG536_0F04250"
                     /db_xref="GeneID:59327314"
     mRNA            complement(<817639..>819144)
                     /locus_tag="HG536_0F04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284877.1"
                     /db_xref="GeneID:59327314"
     CDS             complement(817639..819144)
                     /locus_tag="HG536_0F04250"
                     /inference="similar to AA sequence:RefSeq:NP_009362.1"
                     /note="ancestral locus Anc_7.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140773.1"
                     /db_xref="GeneID:59327314"
                     /translation="MSSRIGWLTQLQTSPGSSARRTSIIGTIGPKTNNPETLVALRKA
                     GLNIVRMNFSHGSYEYHQSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNEVDY
                     PIPPNHEMIFSTDDKYAKACDDKVMYIDYKNITKVISTGKIIYVDDGVLSFEVLEVVD
                     DKTLKVKSMNAGKICSHKGVNLPGTDVDLPALSEKDKADLRFGVKNGVHMVFASFIRT
                     AQDVLTIREVLGEDGADIKIVVKIENQQGVNNFDEILKVTDAVMVARGDLGIEIPAPE
                     VLAVQKKLIAKSNLAGKPVICATQMLESMTFNPRPTRAEVSDVGNAILDGADCVMLSG
                     ETAKGNYPINAVTTMADTAIIAEQAISYLPNYDDLRNSTPKPTSTSETIAAASVAAVF
                     EQNAKAIIVLSTSGNTPRLVSKYRPNCPIVLVTRNPRTARSSHLYRGVFPFVYTQDAK
                     ADWSDDVEARLNFGIEQAKSFGFLKEGDTIVTIQGLKPGVGHSNTLRVSVV"
     gene            complement(<819888..>821633)
                     /locus_tag="HG536_0F04260"
                     /db_xref="GeneID:59327315"
     mRNA            complement(<819888..>821633)
                     /locus_tag="HG536_0F04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284878.1"
                     /db_xref="GeneID:59327315"
     CDS             complement(819888..821633)
                     /locus_tag="HG536_0F04260"
                     /inference="similar to AA sequence:RefSeq:NP_014993.1"
                     /note="ancestral locus Anc_7.44"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140774.1"
                     /db_xref="GeneID:59327315"
                     /translation="MFAKRDKEKEAVESGSGNGLFDKKAGQVVEIDLESLSAQGSSGK
                     ETSVGSQGRDDKQHRLKQGLSARHIQLIALGGAIGTGLFVGTSSTLHECGPAGLFISY
                     VIISTVLYPIMNSFGEMVCYLPGDGSDSAGSVAHLVGRYVDPSLSFATGWNYFYCYVI
                     LVAAECTAASGVVTYWTDAVPTGAWITIFLVVCIGLNLSAVKYFGETEFWFASIKVLC
                     IIGLIILSFILFWGGGPNHDRLGFRYWKNPGGFAHHITGGNLGNFLDIYTGIIKGAFA
                     FILGPELVALASTECRDQRRNIARASRRFVWRLIFFYILGALSISVIVAYNDPVLASA
                     LEAGKPGAGSSPFVIGIQNAGIKVLPHIINACILTSAWSAGNAFTFASSRTLATMAAN
                     GQAPKILGKINRFGVPWVAVSLTGLISCLAYLNVSSSTASVFNWFTNISTISGFIGWD
                     CGMVAYLRFRKAIKYNGLEDRLPYAPWGQKYLVWWSLFVVTLVIFTNGYAIFIPKFWN
                     AADFVAAYITLPLFLLLWIGHKIYTRNLKKWWYSVEEIDVVTGLAEIEEKTRILDEQR
                     QLPKGRFAKFMDVLL"
     gene            <822451..>825564
                     /locus_tag="HG536_0F04270"
                     /db_xref="GeneID:59327316"
     mRNA            <822451..>825564
                     /locus_tag="HG536_0F04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284879.1"
                     /db_xref="GeneID:59327316"
     CDS             822451..825564
                     /locus_tag="HG536_0F04270"
                     /inference="similar to AA sequence:RefSeq:NP_014994.3"
                     /note="ancestral locus Anc_7.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140775.1"
                     /db_xref="GeneID:59327316"
                     /translation="MYDEPVDVLLRQIDYGIESISAVSVESLLKRIDAFQQDPSKLES
                     DGRLSRYVKTVVRDFFVLDREAQLRRCRIFYNLCKVVKWKKVVVNLPTNVFLLSGLLA
                     ELKKKDGGWFRPYLLLSWVYILTLSPFKFNEFYDEIHAAMDSYRGLQILKTIIAHIHS
                     QLLLKNVELLDKEIQELDPLTLNYLLKTLKPNDPVINESVLIQLNSIDLKDDELTTLK
                     VLPKLFRINIAHENWEAAEDIISFYFSHLNSRFTDYRFALAHSFFKVLSALIEDTEDT
                     DTALELIETCINQIRVSFRETAAALVDHDLLHTNLLIIAEMSRVISVSWPHLLEVIAE
                     EIIPFASKFEQVKMNEIKGSQVKDASNYICWSLARSTRLPRVKLSRDVMRTIFLNLLM
                     CSVFDRDLVVRRSANAALQEVLGRCLASSKMLDNETVIKLIELPILNLVESYTENTSR
                     IYQIFTRKQIYEPYVHFLLDWLIEACLVETNDLHIVKLMVQALSLLLKNNPSATPIIK
                     PKLEKLIASTPSNEPYIASRVLLLLVTLETEKILTTHNMNVIPEMKNYYQNSLESVKI
                     EQKIHESDHEEHFKFMVILRYWNFALKRKPELILDRTGISVCFHIVRMIPERSSELKL
                     LFGDLIASLSKSSKNFAQPEDEALFWASFEKFIRFNNSVVCSAVPRLPPHRFQVIFNN
                     LLSVMDCQRKADLLRTLNDNLPQLIDVTEAKILQTVVQLLNDYTVTQQGDVGRLVRIG
                     AAKIIARHRDLFMNSKASNVASDAIANLLRLSGEQVTDLRLICFSTLCKAFDYETKLS
                     DKDLNYRLLEFNHRFFRSECIDFWKGFMITGGAIHFTDSQVVDAIDAFLHYYNQLPTN
                     QERLALCNSLVRIIPSAKQINEVRNSPSRKLWGMMEQDIVKLTVNYLNFWKRLFESGL
                     VLDREFNFFGFYAKIHNLNLINGNSLLKSLTTQLLPYLISSQTAATGQIDKIFTNNII
                     SRLLSLAQREIPFKKRELSGIQKDSLQALAQIYLESESFERLEVLMQASLTNDSILGL
                     SEAQLTL"
     gene            complement(<825567..>827453)
                     /locus_tag="HG536_0F04280"
                     /db_xref="GeneID:59327317"
     mRNA            complement(<825567..>827453)
                     /locus_tag="HG536_0F04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284880.1"
                     /db_xref="GeneID:59327317"
     CDS             complement(825567..827453)
                     /locus_tag="HG536_0F04280"
                     /inference="similar to AA sequence:RefSeq:NP_014995.1"
                     /note="ancestral locus Anc_7.42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140776.1"
                     /db_xref="GeneID:59327317"
                     /translation="MNKVPQRVSSFGIGKLTSDILLSRAPVDSNGTGKHKAEKLILRS
                     AGSQTLIDNWLKNAKVVNGPSKNGKAVTLHLPVVLKTLQRLRSTDNRASYFALISKIQ
                     SSRISWLDIANKPIDCNGALPVEFFNEVSSMLYRISLTCDAQELRLLSKFTLNLLHSC
                     KKSMNHRASFDLKVRTKLFRNCLMPIARTESVALINEALDAIPTEQGNLKYLTELAFY
                     YHSSQFTKVLSQLNKINLGKITLSPNEIDAFFPLFFGIIQSFVIYGDEQTCVWLITKL
                     SKDWGYQMDPHYRGMLAELCEKYAAYQVLGTLAVSSPLLQWKALQSQLTWEEFMKHLR
                     HLNIDLFKESQDLDFLQEKLATVGPNLKAWELFLRDKIPDDANPSLKSFAVNTILMHL
                     AANKRLPFVLSILEHLINEVGYAQQLLDSGKLLSTSKYSGFHCLFKACSVRNPAIFSS
                     YTLFKFLEQNQQIPFKFTSLDFYYMMQACLAGADHHSLYFFLFQFIRMMGPSFYADNQ
                     GKSSWALPVSIEQLLRHKVAKERGDDKVMQIVNEVRNWFLEHRSNAFDTTIDLAFLRE
                     AFGDKYLPSLTVGSMIALEQKHIDKYMSSGDEQYCPAADLHASRRLKRMLASLMENIN
                     VKQF"
     gene            complement(<828544..>829404)
                     /locus_tag="HG536_0F04290"
                     /db_xref="GeneID:59327318"
     mRNA            complement(<828544..>829404)
                     /locus_tag="HG536_0F04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284881.1"
                     /db_xref="GeneID:59327318"
     CDS             complement(828544..829404)
                     /locus_tag="HG536_0F04290"
                     /inference="similar to AA sequence:RefSeq:NP_014996.3"
                     /note="ancestral locus Anc_7.41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140777.1"
                     /db_xref="GeneID:59327318"
                     /translation="MSETMLGYLEMIGGSDDDSDETMTSMTLGGYPRRLAICKHRMLK
                     LGRNEKECDLVLQDPAISSIHCVFWAILFDEESSPMCYVKDCSLNGTYMNGSLLKRNS
                     AYLLQDGDLISLHDRVGKVFRFSGLGQAANPQLIEQMGFQRRVNDWEVTSRVIGNGTF
                     GHVLVAYRNSKNVQERTSLIPQHSPENYAVKIIKLKPNKLDKEAKILLKLNHVCSDTF
                     SRMNTDREVGIDTNIFVNGSLTSSKCITHIVTKRITYIFSKICYQEETCSRIWPKGIA
                     WHRSQKPNLS"
     gene            <829951..>830886
                     /locus_tag="HG536_0F04300"
                     /db_xref="GeneID:59327319"
     mRNA            <829951..>830886
                     /locus_tag="HG536_0F04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284882.1"
                     /db_xref="GeneID:59327319"
     CDS             829951..830886
                     /locus_tag="HG536_0F04300"
                     /inference="similar to AA sequence:RefSeq:NP_014997.1"
                     /note="ancestral locus Anc_7.40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140778.1"
                     /db_xref="GeneID:59327319"
                     /translation="MSGPATPLHAKPNEQIDLDNVRKLDKHDIDDLDLNPELEGSASI
                     SNFEDDSLGHENKARSKRRMFDPADNDTQMYDEIDDFQPRVSVDSPFSSGTVLNKLSK
                     SSDAPVNSGRRLSLSQQSKFILYCDDRLMEIQRKYVQSRGLNTQSGYSGLSPLLQDLK
                     SLVDFIWYSIEGVPNTDYLLRGDSSVAEESESQAIDNSTYFGQSAYLIRIADDLLDYV
                     DKFDVRSLPTEQQTSTLSKLFKLLLILDRVFARLLTGRTPGGSKMTGTDAVRLTGIAE
                     RTRTKMPRFLEHNDIHGYHYEVSKIYEETLESCGN"
     gene            complement(<830984..>833479)
                     /locus_tag="HG536_0F04310"
                     /db_xref="GeneID:59327320"
     mRNA            complement(<830984..>833479)
                     /locus_tag="HG536_0F04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284883.1"
                     /db_xref="GeneID:59327320"
     CDS             complement(830984..833479)
                     /locus_tag="HG536_0F04310"
                     /inference="similar to AA sequence:RefSeq:NP_014998.3"
                     /note="ancestral locus Anc_7.39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140779.1"
                     /db_xref="GeneID:59327320"
                     /translation="MSLNGAAASALMSSMNPIVAENQNQGVVPAKSALVPLDGVATTS
                     SKPPKERALRDVISKRLSQQDPSGSTVKLIGLNITSIPEPDVELLRNVERLSLRKNLL
                     LHLPSNFCTLKSLRYLDLDNNILQEIPPVLMQCPKLEILDLSYNNIECLPQEISTLWS
                     QQLKVLSLKNNNVSSIWGLKSIVKFENLRVLEILGNPINQEELEAVRSYTPMTSSMVK
                     EEYWLIALRRYLEDHSLPASESHHDSKMSKAAKRMGYINTPSPGSVDSVGSAASSPVP
                     IQMPNSEADSSYSTAETTNNDLYNHSKFNDYFKRLSILPEEASNNEQHKVSHDELVVA
                     CRKLLFSFTECQQNVRKIASFCKEKAVAVNVVSLLYSVRSHIDNLVGVLEQAENEKNS
                     HDGALIKLCMTIIAIFKLIIGQLRKNFKAFFGADDLCFIRMFYMTLVCSYTEIYNAWC
                     FIDAGEARKARNRHLARAHSAINLSSSNTSAGASALYLPRTRSNTLQSRAAPVALGLN
                     AVQPSMENSLHNAGGHSGNAMLSPPPNGHSPIQAKPVQSAAVITPPSNNTLMHNVPYH
                     SNESRQSDSSPRQHHTNSPRSRKVTEPQVPSGRDGVDGDAGPLLTSSGGSSVDPQLYQ
                     TLNTVIGMVNVVYERLTSEISKAAMASTTGQQELTDVLLTKIRDLTDTCCQAMELSKI
                     LNERLQLLTSEADISEKLLTTSEKVKTWENINAFLKSIISILANTKVVMTDMPGLNEI
                     RPNLATLAKITKDVTVILELSSYKGVSVLTAQNQIQNSSQNPSHGYSHAVSNHQTSST
                     GEENDEKFYTSITTPQITPAHSQVANPLDNFAG"
     gene            <833669..>834481
                     /locus_tag="HG536_0F04320"
                     /db_xref="GeneID:59327321"
     mRNA            <833669..>834481
                     /locus_tag="HG536_0F04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284884.1"
                     /db_xref="GeneID:59327321"
     CDS             833669..834481
                     /locus_tag="HG536_0F04320"
                     /inference="similar to AA sequence:RefSeq:NP_009361.1"
                     /note="ancestral locus Anc_7.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140780.1"
                     /db_xref="GeneID:59327321"
                     /translation="MGWFWASTAANRPQAGAAEDRESLSTCPVQYKKSSDRSECPVMH
                     GSESGRELNPLNNMPAFISAKKQPGQKLNLPTDRTVSSIPKGEEGDANWEYPSPQQMY
                     NAMVRKGKIDPNTGEEIPEDAVESMVFVHNFLNEGCWQEVLQWEQPYTEQTQVPPKLL
                     KFMGKPDELSPRARFYQALGQIFPKHFSREAPFDRHDWTVLRADPMSADPEFPGFRKV
                     RYVIDFYGGPDDEDGLPTFNLDVRPALDNFSNARDRFVHYTKPIFEEYFGRK"
     gene            complement(<834619..>836598)
                     /locus_tag="HG536_0F04330"
                     /db_xref="GeneID:59327322"
     mRNA            complement(<834619..>836598)
                     /locus_tag="HG536_0F04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284885.1"
                     /db_xref="GeneID:59327322"
     CDS             complement(834619..836598)
                     /locus_tag="HG536_0F04330"
                     /inference="similar to AA sequence:RefSeq:NP_014999.1"
                     /note="ancestral locus Anc_7.37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140781.1"
                     /db_xref="GeneID:59327322"
                     /translation="MLSRRSICRLRLPLLPRYQSTYVHPVSKLGQELSEQLASGDTNE
                     LYSSLKDHLEKFSNEMTDPTTLQRSFGLNAPLVQFLKKSATDKESHVDPYQILNTLCD
                     YKVARSPHFEVVLRHLLLHGSPQDVIALWVKYLETIAENPNAVSRSFNNRNGNNDSHQ
                     TNVALTSIAYLMLPEVKPDFQMLCQILQVDQSSGQRIPFNKIKFLINSLFKGERKEQL
                     TENSKSLFHQYVNSDKESFLRQLDGTLQFHHLQDLYNQYRGGSVDPEIIAKFMEKFLL
                     CNNPAGAVKIFNENKALDSSSLKNMLLIAVATLPANTRNVRLDRILAIWNSLIKPAGP
                     SASSYASLVQALGVSKNFGALQNIWDEEISEDLKKDPVVLEPYLTAILKDNDKAKFDE
                     IAGKLPADITSIDLINAVLSKMVKDNVSNEKFNSFFTAQFAKREDSGLQKRPNIETLA
                     VRMWANYHYAADKESFDFLKSVFQSKKNVLKVNAIIENFIRLAPSIDPVHKLFPQVKE
                     PLDTRKYGAFINAEFTKPGGSYERAEQIFKNFLEDSTPHSKKIDRFVLEPLICGFSEL
                     AITERDPSFLLKVSTYYTFASKVNLELTYQTVARILHSLALVAKENSGKFNTLQQQFV
                     DLFLKDMGSMKNFSPNTRDVETLRKANVKIGEEIS"
     gene            <837587..>839110
                     /locus_tag="HG536_0F04340"
                     /db_xref="GeneID:59327323"
     mRNA            <837587..>839110
                     /locus_tag="HG536_0F04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284886.1"
                     /db_xref="GeneID:59327323"
     CDS             837587..839110
                     /locus_tag="HG536_0F04340"
                     /inference="similar to AA sequence:RefSeq:NP_009360.1"
                     /note="ancestral locus Anc_7.36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140782.1"
                     /db_xref="GeneID:59327323"
                     /translation="MNHVKDVAGAVDLGYMSHVRRNVAHRKSQEANLVAREAACHEFC
                     VMEYSNQLLNHLILLERDNAVHVTARPSLSTFQSQPQINHKMRFLIFDFLMCCHTRLG
                     LSNSTLFLCYNILDRYTSKYIVKSCNYQLLALTALWISSKFWDSKNRIAPLKLLVKLC
                     CKQYSAQQFKEMELHLSKSLNWTLCQFATHDSFIDLLLFLKNDTKVPSTALLDNKLSP
                     DRVKFGATMLCELACFDIQLSFKCSASQIVLAAITLTTLALKFEEFNQWEDFNSKSND
                     AGLIKVCHSLLALAVREDSLPSSFKLKYINENKTASDKILKALQNYFIQLQVEQFYQS
                     QEFKNLAPGSYEKRNDYNEKRIHDDTDGRIHATGQSTNHSFASNPSIASSHSAVTPPS
                     RTSSSASPFASPFMAHDFISSPDSLPTPFYDKTCFTRTQASNTALLPLTPTTPTLLKN
                     KMAAIKRRSMTLPIRNPSHQLARSNTDDPQSFMKGHRKRASSSMDIDFFEDEVAIKR"
     gene            <839567..>841090
                     /locus_tag="HG536_0F04350"
                     /db_xref="GeneID:59327324"
     mRNA            <839567..>841090
                     /locus_tag="HG536_0F04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284887.1"
                     /db_xref="GeneID:59327324"
     CDS             839567..841090
                     /locus_tag="HG536_0F04350"
                     /note="ancestral locus Anc_7.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140783.1"
                     /db_xref="GeneID:59327324"
                     /translation="MKRSKNSEPQSRPKIAAGLDEKLCSSYDGYRPAEPRTEIDVVKV
                     PENEEEVKRFFELHVVKRKPCKIVGIPEDISVLRKLKPSNIQNVLPREEILTIEKKNE
                     GGFGSGATRLKMSFGQFLSKILNAGEEDLYLTTQYLEDDPNNGDYSTDEEEKDQVLDD
                     DFDTGSITFDNLHDDFDDLQEEEPCGPGSDQSDSLEEQELRIKELYQPPMTNLLDDLP
                     ETPKFLDYLIPQQINLWIGAAKAQDDEAEDDKWLSNFDPGDPNGQLGLGRNVPGGGSS
                     SGLHHDHADNLYVPIAGHKRFTLFAPCDAAKMYTVGTIRHLFASGVIDYVADRHAPLW
                     RQLRDDGAITAEVYKTLLDSDTLDPQTKKHYEDFLRLDVQQQLKAAHHKQDHLDPPSF
                     STIPPCVVHLEDIKNKRVRDSIAESSKKRWPRFFNAHRITVDLKPGEMLYLPTGWFHE
                     VTSYGDDGKEDKNVHVAANYWFIPPTGRDISNVYLDSYWPNDFAITQRALKRMRRHV"
     gene            <841729..>842985
                     /locus_tag="HG536_0F04360"
                     /db_xref="GeneID:59327325"
     mRNA            <841729..>842985
                     /locus_tag="HG536_0F04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284888.1"
                     /db_xref="GeneID:59327325"
     CDS             841729..842985
                     /locus_tag="HG536_0F04360"
                     /inference="similar to AA sequence:RefSeq:NP_015000.3"
                     /note="ancestral locus Anc_7.34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140784.1"
                     /db_xref="GeneID:59327325"
                     /translation="MALTNPRPLQIPALQNEILHNTASPVFQASSLVFNPKNDVSGFP
                     NTPTSEGSPSDTGKARKEGSVTPKKDSLTLEISKIIPVTGERPMPEERTAPLDDDVLY
                     AVFVILWEKDPELQGMTVKQLSDHLLEKHPEMSNLSTKLSNLISAKLNAYVKKLEKGE
                     KTLTYALSREWSNSSPRRMVYVYRGILSPDYKKHAHAAAVHMKQQQGSKDGKNASDND
                     LKRNSTGFSDVGPDGNKQGSGAANLGFSLSPEFKIPYATSPVSAILTPSSTGDGSAGD
                     HLTDKKRSRMDGDDTGSFTVNSKKTKIDSNDQHTESSKTDPNPVGTYVTAAAAAPRLS
                     KFSSKNFKGNSQNSASLVAAIHKVFLTQTPIDPRPVAAASHPKEQSYDHHFGSWIKTV
                     REGFLSHDIESPENLSMEELECILDS"
     gene            <843384..>845327
                     /locus_tag="HG536_0F04370"
                     /db_xref="GeneID:59327326"
     mRNA            <843384..>845327
                     /locus_tag="HG536_0F04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284889.1"
                     /db_xref="GeneID:59327326"
     CDS             843384..845327
                     /locus_tag="HG536_0F04370"
                     /inference="similar to AA sequence:RefSeq:NP_015001.1"
                     /note="ancestral locus Anc_7.33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140785.1"
                     /db_xref="GeneID:59327326"
                     /translation="MIRNVGKKAARVNLRQALGSFSKNRGLSTFLLRSREGQAHCRTT
                     SWLIKRFQSTEVSFDKLTPEEQNILTEERAVDKVDVCIVGGGPAGLATAIKLKQLDNK
                     EGDGQLRVVVLEKAADIGSHIVSGVIMDPRALRELFPESEYYDDKGEGIPLPPEIVTK
                     VIDEEFKFLIGQQGLPVPTPSHMKNEGKNYIGSLSEITAFLGAQAENLGVEVYSGIAV
                     SDVLFSDDGKSVVGVATKDMGISKSGRPKDNFERGMAFKARQVVLAEGCHGSLTKQII
                     KKFNLRKNAQNQSYGLGIKEVWEVSPEKFRRGFVTHTMGYPLSNSVYGGGFQYHFGEN
                     LVTVGLVVGLDYKNPYVSPYQEFQKMKLHPYYKNVLEGGKCISYAARALNEGGLQAVP
                     KLNFPGGVLVGASAGFMNVPKIKGSHTAMKSGMLAAEEMFKVISKMPTLEELEEQGVE
                     ELTKEPIDLDAYGEAFKSSWIYKELYAVRNVRPSFNSFLGGYGGMVYSGLDTFILKGR
                     VPWTFKFHESDASVTETASKHKPISYPKPDGIISFDIMTSVSRTGTNHDEDEQCHLRV
                     PNQDLDKHAEAAFPKWKGIENRFCPAGVYEYIKDDSSPLGVKFRINSQNCIHCKTCDI
                     KDPTQDINWTVPEGGDGPKYTLT"
     gene            complement(<845476..>847947)
                     /locus_tag="HG536_0F04380"
                     /db_xref="GeneID:59327327"
     mRNA            complement(<845476..>847947)
                     /locus_tag="HG536_0F04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284890.1"
                     /db_xref="GeneID:59327327"
     CDS             complement(845476..847947)
                     /locus_tag="HG536_0F04380"
                     /inference="similar to AA sequence:RefSeq:NP_009359.1"
                     /note="ancestral locus Anc_7.32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140786.1"
                     /db_xref="GeneID:59327327"
                     /translation="MDVVSSRCVANQAFLSFVYISQFGRITFVCQGIEVSRRCPSFLT
                     VLILSGYIETQPRMSSASLPLRNSQSNSTSMLNVMNASVTELDSLYYICTNVKTRLER
                     LPQLHPYLNLAYASAEVLSERQSLFLSQKQQQQKVNGHQSISSSFSGRDSHPGTNNIA
                     RTSSISNFSLKEDMSLDSITYSSSQTNSTSNPHMEDTLLTFSMGILPISMDCDPVTQL
                     SQLFQQGSPLCIIFNALKPQFKLPVVSSDDIKICKKSIYDFILGCKQHFAFNDEELFK
                     ISDVFSNSTTDLMKVLDVIVTLMNSSPDIFSTAEETQEQIQLELQQVPCYSEYSKIMK
                     EFVATERKYVHDLEILEKYREQLLESNLITSEELYMLFPNLSGAIDFQRRFLVSLEIN
                     ALIDAPKQRIGALFMHSKYFFKLYEPWSIGQNAAIDFLSNQLEKMLRTDFVIRNKMEL
                     QSFLYKPVQRLCRYPLLLKELLQASQDAGSSKELEVALEISKGIARSINENQRRTENH
                     EVVKKLYDRVVNWKGYRIAKFGELLYFDKVFISTNGTSEPEREFEVYLFEKIIILFSE
                     VVQKKSASLSLKKKPTNSGSSLTLSLGGSHGGFNAPPSGVSEPKLDLRGRIMIVNLNQ
                     IIPLENHSLTITWESVKEQGNFVLKFKNEETRENWSSCLQSLVRNARSESFRSVGSGD
                     QSSFASPVQFRNAHNSITSLNSSQGKHISEMLPKRNTSYANDNEYRSISENYKNSIPK
                     SSLLIRISYNSDFYTVLAELDSSVEDVLHIIQRKLSHSGIVSKVKYQDEDGDFVMLAS
                     EDDWNVAKDMLKESEDRILNVWAYS"
     gene            complement(<848008..>849228)
                     /locus_tag="HG536_0F04390"
                     /db_xref="GeneID:59327328"
     mRNA            complement(<848008..>849228)
                     /locus_tag="HG536_0F04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284891.1"
                     /db_xref="GeneID:59327328"
     CDS             complement(848008..849228)
                     /locus_tag="HG536_0F04390"
                     /inference="similar to AA sequence:RefSeq:NP_009358.1"
                     /note="ancestral locus Anc_7.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140787.1"
                     /db_xref="GeneID:59327328"
                     /translation="MVKKSTLLSLDAFSKTEEDVRIRTRTGGLISLSCVILTLFLLIS
                     EWYDFSRVVTRPQLVVDRDRQLKLDFVVDVTFPSMPCDMLSLDIMDSSGDLQLDIMDV
                     GFSKTRLDSSGKEISTASFHPGDSSPDYIPDDENYCGSCYGAKDQSKNDELPVNERVC
                     CQTCDDVKRAYLEAEWAFYDGKNIEQCEREGYVERVNQQLAEGCRVQGKAQLSRIQGT
                     IHFAAGRGFQNARGHFHDSSLYQKTPHLNFNHIINHLSFGVPITPRAEGRGAAASTQP
                     LDGRQVFPDRDTHFHQFSYFAKIVPTRYEYLDNEIVETAQFSATFHDRPLGGGADEDH
                     PNTLHTRGGSPGLFIYFEMSPLKVINKEQHAQTWSGFLLNCITSIGGVLAVGTVLDKI
                     TYRAQRSIWGKKSQ"
     gene            complement(<849411..>849899)
                     /locus_tag="HG536_0F04400"
                     /db_xref="GeneID:59327329"
     mRNA            complement(<849411..>849899)
                     /locus_tag="HG536_0F04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284892.1"
                     /db_xref="GeneID:59327329"
     CDS             complement(849411..849899)
                     /locus_tag="HG536_0F04400"
                     /inference="similar to AA sequence:RefSeq:NP_015002.3"
                     /note="ancestral locus Anc_7.30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140788.1"
                     /db_xref="GeneID:59327329"
                     /translation="MREFKSFSSTEQSTLPQAHKSPTYSEIYAEPENFLEVEVRNPKT
                     HIPNGTDTRGMFTDYEIICRTNLPSFHSRVSRVRRRYSDFEFFRKCLIKELSMYNNHP
                     KVAIPHLPGKILLSNRFNDDVIEERRQGLNKWVQAVVGHPLLQSGSKTLVRFIEDKKF
                     VG"
     gene            <850038..>850523
                     /locus_tag="HG536_0F04410"
                     /db_xref="GeneID:59327330"
     mRNA            <850038..>850523
                     /locus_tag="HG536_0F04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284893.1"
                     /db_xref="GeneID:59327330"
     CDS             850038..850523
                     /locus_tag="HG536_0F04410"
                     /inference="similar to AA sequence:RefSeq:NP_015003.1"
                     /note="ancestral locus Anc_7.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140789.1"
                     /db_xref="GeneID:59327330"
                     /translation="MADTEGADLTGNEEDGRAEVVNTMEGNDEEDMDVFRNVGQGLIG
                     HYREIMIQYWQELINEIESTNEPESQHQDDFKSHSLPLARIKKVMKTDEDVRMISAEA
                     PILFAKACEIFITELTMRAWCVAEENKRRTLQKADIGEALQKSDMFDFLIDIVPRHLQ
                     Q"
     gene            <850844..>853204
                     /locus_tag="HG536_0F04420"
                     /db_xref="GeneID:59327331"
     mRNA            <850844..>853204
                     /locus_tag="HG536_0F04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284894.1"
                     /db_xref="GeneID:59327331"
     CDS             850844..853204
                     /locus_tag="HG536_0F04420"
                     /inference="similar to AA sequence:RefSeq:NP_009356.1"
                     /note="ancestral locus Anc_7.28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140790.1"
                     /db_xref="GeneID:59327331"
                     /translation="MSLSEMDQLYQAQKLAMENSPEQMLPKVLETAASLYISEGTAPP
                     LKRELARFTARLLLDVITHDSVASAQKPFIASQHLDCLWSISRNVKDLIAYKYSVLAF
                     SACYPLLFDLVAKTSNQEMWNVMQEMRGFIASNWNTTYPLELSTSDSDPFLSARKNIG
                     CRLATAKFLSQIIIVHTSRNGNNLKAGSVSISSVPDSHPVISNKPQLESEAKKFLDLL
                     LNYLIEEPMMVSSVFNGVLNCLAFIMKQRPQATMRILSGLLKFNVDAKYQADDVSVLN
                     YRLSKRFVERCYKNFVQFGLKSQLIKSSGQMASQQMKLSKISQTLHIIGEETKSKGIL
                     NFDAEQVENKITNKEKQKYLVLKRKQTTAKVNRSTATPMMSPPAGAASSTPQPGNSAS
                     PPVEELPVDTTGSMLLDLQKYTMSKNNIAGFFNNSPIAIDTSYCAIYSLMNSKNSEQD
                     VSKLPQDVMIKLCSEAFYSTDTTKMISGLSIVASRYTDLMNKVSQLQQQQQQQQETGI
                     SKRKVEEEDEASDSKRIKKEDEVALSSNVADNEGKLEDEYDYDAAKDQKHTEVDLIKP
                     QAMTEEEKMKHLERIVQHIMDVSNNDESSEVNTALVKDQGPLEKIKLLQWSNKESWLH
                     ILTRLCTRGVSHRDNMSNFIRQTLYDYFMNDFNGRIGMALEWLGEEWYYESISNEPSN
                     NYPNYDHWSSKFLDGLIPFLENQHRRIFIRLMSELPRIEQLHIDKVRPICLDPARSSL
                     GFQTLKFLVMFRPPVKPMVKTLLEQIMQEDLTVKEQCNAILVKFYQ"
     gene            <853415..>854941
                     /locus_tag="HG536_0F04430"
                     /db_xref="GeneID:59327332"
     mRNA            <853415..>854941
                     /locus_tag="HG536_0F04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284895.1"
                     /db_xref="GeneID:59327332"
     CDS             853415..854941
                     /locus_tag="HG536_0F04430"
                     /inference="similar to AA sequence:RefSeq:NP_015004.3"
                     /note="ancestral locus Anc_7.27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140791.1"
                     /db_xref="GeneID:59327332"
                     /translation="MITMNNAFEEFASGSQSPYNLGRSAHPGAVLLSPQSSAMNLSNS
                     AASTGILSPQLTSQSHGLSFDEILDQQSALLDPSAQHSQQQPSMQQPGPLPTSSSAAG
                     SAVMSPMIQSPSRTPANIPTSSMFLESFTRPSSSSLLGMHNRSKSCNKEQAQGKQQPQ
                     SASSKQLQPRPAEANPVVNFTQDINQLCSWMSMLSSSQQNVVMDNLLSTLNEDVLHYT
                     KLKLDSLINSGYLSPQIPAIASPVPNREAYSIANLDSVFSDGKLADNDTKPGERIDPM
                     IENSAIYQKWSPQPASVTQPIYDYIKDMNQRPKSADPHVSRMNVNLIGKKGTNGIHGY
                     TANNGYYFMPGKSRAATSDFENNNSQNFYGGNRSQNGASSHATTSSHNSHSQSPDRSA
                     GGTASITPTASAATNPSTNSVPGVSSGTGHGSSMNPRTLTDPRLLTNIPMWLKALRLH
                     KYSDALSSKKWDELIYLDDETLEKMGISALGARRKLLKAFAIVKDHKEQGLIDQTAYV
                     "
     gene            complement(<855156..>856634)
                     /locus_tag="HG536_0F04440"
                     /db_xref="GeneID:59327333"
     mRNA            complement(<855156..>856634)
                     /locus_tag="HG536_0F04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284896.1"
                     /db_xref="GeneID:59327333"
     CDS             complement(855156..856634)
                     /locus_tag="HG536_0F04440"
                     /inference="similar to AA sequence:RefSeq:NP_015005.1"
                     /note="ancestral locus Anc_7.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140792.1"
                     /db_xref="GeneID:59327333"
                     /translation="MSTLFVVGEVERAEVTRALDALAGVCDRRVQVADLPGLFVRLYS
                     DRLAGSRWNYEEGVSVVVHAGGSAESRELDATFRAFLPVFNLVALEQRAAAARLPELL
                     RELPAQNAACRDRIRRMAHWMYYGGSGSCSSRVYSIVRQLRATGEPRSAARAIPSAVE
                     AVDFVSLLAGATRGGEPRYWRLLSTWGFQPHSLGAAELVYCAFVLLRKLSADAGVGLS
                     DNRLLLFLFTLEASYHQVNKFHNFRHAVDVMQATWRLCENIIDDRLQVLLLSMAAIGH
                     DIGHPGSNNMLLTKFGAPVATAYGESVLENMHKDFFQQLLKSQWPQLLGLSQSLCKGE
                     SQYNLIAETILATDMALHAEYVDKLKENHRIDNLKMLTSLIIKAADISNVTRPLAISA
                     QWAYLITLEFRDCSLLEEYQAKGDGGQSAPQDEESGHTNSGRLLSPDELVDKYPCIPG
                     GQIFFIDTFAEQFFKEFCQKFPELNFLIDNVQSNKKFWLEKL"
     gene            <857085..>857606
                     /locus_tag="HG536_0F04450"
                     /db_xref="GeneID:59327334"
     mRNA            <857085..>857606
                     /locus_tag="HG536_0F04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284897.1"
                     /db_xref="GeneID:59327334"
     CDS             857085..857606
                     /locus_tag="HG536_0F04450"
                     /inference="similar to AA sequence:RefSeq:NP_009355.3"
                     /note="ancestral locus Anc_7.25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140793.1"
                     /db_xref="GeneID:59327334"
                     /translation="MFGVARAVVGRSSAAGVLRVFARAQSSNALTKTGLPFTYSGAGP
                     STVLYTSQHEWIAAHQDGTAFVGITRYAADALGDATYVELPETGSSLEKGESLGSVES
                     VKSASEIYQPVAGEVVEANAALEEAPQLINKDPMGDGWIAKIRIGDASELQSAELLTL
                     EAYERSLKEDQHE"
     gene            <858043..>859095
                     /locus_tag="HG536_0F04460"
                     /db_xref="GeneID:59327335"
     mRNA            <858043..>859095
                     /locus_tag="HG536_0F04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284898.1"
                     /db_xref="GeneID:59327335"
     CDS             858043..859095
                     /locus_tag="HG536_0F04460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140794.1"
                     /db_xref="GeneID:59327335"
                     /translation="MCRTTGPSSSTTSAKRPGTLIITEAAYPSARSGGYDNVPGIWSE
                     EQIEKWKKIIAKIHNNKSFVWVRLWSLNGKALLGALARDGLPFVSASDELYMDEARRE
                     EAVESNNRQLGLTKDEIKQYINDYVNGAKNSIEAGADGVEIQCAGGNLLNQFLDPISN
                     KRTDEYGGSIENRARFTLEVVDALTEAIGCNKLGIRFMPYGTFSVMSCGQEPLIIAHY
                     AYVLGELEKRARAGKRLAFVHLVEPRVTNPFDTEGQGEYNEGTNDFAYSIWKGPIIRA
                     GGLASHPEEVRKMVADGRTLIGYGRFFIANPDMVDRIEKGLPLNKYIRETFYAKTKEG
                     YTDYPTYDEALKLGYK"
     gene            <861917..>864349
                     /locus_tag="HG536_0F04470"
                     /db_xref="GeneID:59327336"
     mRNA            <861917..>864349
                     /locus_tag="HG536_0F04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284899.1"
                     /db_xref="GeneID:59327336"
     CDS             861917..864349
                     /locus_tag="HG536_0F04470"
                     /note="Rover element"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140795.1"
                     /db_xref="GeneID:59327336"
                     /translation="MSGANTHATPIVIQQDMPFTKTSSLSAPISSRSCPATPAEMIRS
                     TPNTTLKVKKSPKKSPSRWMERSSFKIHFTLLNLNNKKRAKCIYCGKTFREGESTGNL
                     SKHITAVHPSALKSKKPKGSNLKTLDMLPRRSKSLRLSESLVQECQKNPQALQTLLLI
                     SEGFLPFNFVRLLSWRLINQTNPANAFIQSRTTLSTKINLFKRYLNETLHCNLKDTTM
                     VNIQLDIWTSPSNISFLAVMVSFAPNILNMESLELANDAKILLNNRGESRNCHLLEFI
                     SLGHKRHTGLNIYKVFKEILDRHNLVDKLGTITMDNATNNESFHKSLVYDYLNKIKPS
                     GHQMLGKVRFIRCANHVLNLIFGRIIKSLSEDLLFADAFSKVTKLAKIMRRSTAVNAS
                     LKEHGIPLIPYESQTRWIYSWRQVTVFLQNYDAYSEWFKALDTKSHTHIINRVQSDIR
                     FEEKTIQMLTYFVKCCDIFGKLNFHFQNDEFNNLPQGVPLYYLLGHYYKLCLRAFAGN
                     HIPKTPGMDFSYFNGPESLSLDDKRIVLQAIKDSCRCYEDYLSDIQVNPLFYVAVILD
                     PTAKQDKLYEIMEDEEFTVRISEVNSFMRNYLKVQRFSCATEQERRKIPEACSDENLL
                     SFNIRVAPDPSRHTGSAAMEAECNDGSLEEWVRYQREPVIAGNSRQEAIKWWYDHRHT
                     YPMLFKLAMSLFYTKFTSCDVERCFSLAGRVVRKDRARLSHNNIGTLMILRDRFSNFG
                     FYNGGLVSDAILDDDDFDINLDDSDHEREDSDDAIFEEWPQESWSPETPTAPRTPEDS
                     LRQATDSPTPVG"
     gene            complement(<865941..>866903)
                     /locus_tag="HG536_0F04480"
                     /db_xref="GeneID:59327337"
     mRNA            complement(<865941..>866903)
                     /locus_tag="HG536_0F04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284900.1"
                     /db_xref="GeneID:59327337"
     CDS             complement(865941..866903)
                     /locus_tag="HG536_0F04480"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140796.1"
                     /db_xref="GeneID:59327337"
                     /translation="MPFGLLNEPSTFSRYIADIFRDLPFVLVYLDDILVMSASKKEHI
                     KHLDTVLQRLKDHQLIVKDKKCKFLQPKIEFLGYHISERCIRPMKDNSKAINAIPECE
                     TVRDAQRFLGMINYYRRFIPRCSMVARPLIDFTSKKTPWTQAQTKAFEELKRLLSSAP
                     LLVPFHLDKEYRLTTDASKLGLGAVLEETENKKVTGVVGYFSKLLQGAQNNYPAGELE
                     LLGIIESLRPFKYLLHGKRFTLRTDDISLLTLKNRNEPSMGLARWLDELAEYDIELEY
                     LKGPDNVVADTLPRNVAINAVDRLPTSEPSQRTPDVQKKRIGPR"
     gene            complement(<867670..>868035)
                     /locus_tag="HG536_0F04490"
                     /db_xref="GeneID:59327338"
     mRNA            complement(<867670..>868035)
                     /locus_tag="HG536_0F04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284901.1"
                     /db_xref="GeneID:59327338"
     CDS             complement(867670..868035)
                     /locus_tag="HG536_0F04490"
                     /inference="similar to AA sequence:RefSeq:NP_075206.1"
                     /note="ancestral locus Anc_7.24"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140797.1"
                     /db_xref="GeneID:59327338"
                     /translation="MLRRLATRTMSTPPNRSIQGPIAQSITKKIHDNFPDLSHFELFN
                     DSYKHAGHHGIADSANRIESHFRLELASDKFCGMSLPSRHRLVYGVLAGELGADRVHA
                     LQLTTRTLDEHKRRLDSST"
     gene            <868148..>868462
                     /locus_tag="HG536_0F04500"
                     /db_xref="GeneID:59327339"
     mRNA            <868148..>868462
                     /locus_tag="HG536_0F04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284902.1"
                     /db_xref="GeneID:59327339"
     CDS             868148..868462
                     /locus_tag="HG536_0F04500"
                     /inference="similar to AA sequence:RefSeq:NP_009353.1"
                     /note="ancestral locus Anc_7.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140798.1"
                     /db_xref="GeneID:59327339"
                     /translation="MTMILPLRLPARLAASRFVRGSLTRLYSLTAEESMIQEKLSKAL
                     QPKKLQVVDISGGCGSMFAIDVSSEKFKGLSIVKQHKLVNEILKEDIPRWHGLQLRTK
                     AE"
     gene            complement(<868552..>870747)
                     /locus_tag="HG536_0F04510"
                     /db_xref="GeneID:59327340"
     mRNA            complement(<868552..>870747)
                     /locus_tag="HG536_0F04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284903.1"
                     /db_xref="GeneID:59327340"
     CDS             complement(868552..870747)
                     /locus_tag="HG536_0F04510"
                     /inference="similar to AA sequence:RefSeq:NP_015006.3"
                     /note="ancestral locus Anc_7.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140799.1"
                     /db_xref="GeneID:59327340"
                     /translation="MATEFEDIKLEEIPVDDVDFIDLEEQYKVTNDFSFDQYIVVSGA
                     PVIPESKVPVLKKALTGLFSKAGKVVDMEFPIDAETKKSKGFLFVECASAADADRIIK
                     AFHTKRLDLKHRLYLYTVRDVEKYNSDSFEVEFKEPDMPGFVPSSALKSWLLDEQVRD
                     QYVVQKDDLTTVFWNSSLEDADNVVESRENWSSNYVRFSPKGTYLFSYHDQGVVAWGG
                     PHFERLRRFYHPNVRTSSVSPNEKYLVTFSADPILCKDDDKDSPFSKRNEGHQLCIWE
                     IATGLLMTTFPVVKSPFLHWPLVRWSFDDRYCARMVGDTLVVHDSRNGFAPMDNKALK
                     VPGIRDFSFAPSGVKLYPFRQNDEPSVLLAYWTPETNNMSCKGTVVEVSRGRVLKTVN
                     LVQVSDVSLHWQNQAEFLCFNVERHTKSGKTLFSNLEICKLTEKDIPVEKIEFKDCVK
                     AFEWEPNGNRFVAIADRDIGDDNPAIPRHVISFFAPEAREKEKGQQVAGVKKWKKVVE
                     IADKFSNTVSWSPAGRFVVIATLVKPNVRKSDFLFFDMDFAGEKNINDVKDVQASVKD
                     VAKPTFMSATDMTWDPSGRFLCVWSSALKHKMENGFKIYNVGGALVKEETIANFKNFA
                     WRPRPESLLSNAEKKKVRKNLREWSAQFEEQDAMEADSAMRDLILRQRELLKEWHDYR
                     ESSSERMLEVFGYKAFDVPPLDGDEDDYTIIEEVKEEILEETEEKVDDE"
     gene            <871153..>873435
                     /locus_tag="HG536_0F04520"
                     /db_xref="GeneID:59327341"
     mRNA            <871153..>873435
                     /locus_tag="HG536_0F04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284904.1"
                     /db_xref="GeneID:59327341"
     CDS             871153..873435
                     /locus_tag="HG536_0F04520"
                     /inference="similar to AA sequence:RefSeq:NP_009352.2"
                     /note="ancestral locus Anc_7.21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140800.1"
                     /db_xref="GeneID:59327341"
                     /translation="MVEGLVRDDGLALSPRVTVNGDSLSFTSAPCVAEGTSPAGTTGG
                     ITARRPFLGSPGDVDTTDEEDMAYDSSGLAIPRLRESMTPWRSVEGKARKEGKRRASR
                     SATLVDGASPSNSRPDTRNSLFSLDGAYTVATSTTCNDVEQLQKQLTTYKLKVRALLE
                     VIKQLNYGDDEQRNRDSFYGKLLSTLSQSEELEELRRKLSTLENSDSKKQTRIEELEK
                     DIFELSDKLAATKNEHAETLEYANEYLEHSELLAKKIDEMLNLLLENVEFSAEERDAL
                     QKTIQISSSFAMVKMNALVTTFGRVLQDMKSSASQAEIEENHGQTSVAAVDAIANSTE
                     ANDTNESVMAEKTFEFPVNESAMDTRLEIAIEGLHQEYDKFFHGIRSKIERSADLEKL
                     LLSRLSQQDRLLNRLAGMSESKALEQSLERHKESVQTIDGKESTSRANLDLSKSYKDH
                     IDNLNSLVQAMNSAMSEKNEELQQVKDQLKDQDVMRKNEQRLRTELQEYKKLSKLKEN
                     NWESFASDLEKSLGILQMEKDQMLEVMEQLRSDLQIKESKVEELLMDAQRTNQTVRNM
                     TNLHDQDKMELNEKLKDKIRQVKDLQNECTSLRAMLTERTNSFSLEEKYQNEFERFKD
                     HLLLHLEKVFTTLGKILQQKSIDQSKRKLEIVRRMHGPTAVRSMQPKLESLYNFIETA
                     QESIVESYTSMVLLEKERKSESHSSKELQLRIEELGRKWISERERRKLDITAAESRIS
                     RLEAENDLLREQLYSSTIRK"
     gene            complement(<873524..>874357)
                     /locus_tag="HG536_0F04530"
                     /db_xref="GeneID:59327342"
     mRNA            complement(<873524..>874357)
                     /locus_tag="HG536_0F04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284905.1"
                     /db_xref="GeneID:59327342"
     CDS             complement(873524..874357)
                     /locus_tag="HG536_0F04530"
                     /inference="similar to AA sequence:RefSeq:NP_015007.1"
                     /note="ancestral locus Anc_7.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140801.1"
                     /db_xref="GeneID:59327342"
                     /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKFND
                     GVVFAVEKLITSKLLVPKKNVKIQVIDRHIGCVYSGLMPDGRQLVNRGREEASSFKKL
                     YNKPIPIPALADRLGQYVQAHTLYNSVRPFGVTTIFGGIDEEGPHLYMLEPSGAHWGY
                     KGAATGKGRQTAKAELEKLVDKYPDGITGKEAVKQAAKIIYMAHEDNKEKDFELEISW
                     CSASETNGLHKMVQGELLEEAIEFAKKEANGDQDSDESSDDEPTNSAVVVDAEGDVNI
                     E"
     gene            <874643..>876601
                     /locus_tag="HG536_0F04540"
                     /db_xref="GeneID:59327343"
     mRNA            <874643..>876601
                     /locus_tag="HG536_0F04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284906.1"
                     /db_xref="GeneID:59327343"
     CDS             874643..876601
                     /locus_tag="HG536_0F04540"
                     /inference="similar to AA sequence:RefSeq:NP_009351.1"
                     /note="ancestral locus Anc_7.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140802.1"
                     /db_xref="GeneID:59327343"
                     /translation="MTKETIRVVLCGDNGVGKSSLILALVKDRFIPNLQDVLPTVTIP
                     RDFSSSPYSPKNTVLIDTSNNDPLELQRQLKSADVIWLVYSGHESYERISLYWMMTFR
                     SLGLNIPVILCKNKCDDCGENTTGLEAEDTKVEDEEFIPILMEFKEVDTCIKTSAKTR
                     FGVNQAFYLCQRSITHPIAPLFDARIGELKPLVVTALKRIFLLCDEDQDNYLNDEEIT
                     ALQKKCFHRNIDANELSFIKQTLTDISAPSQEYSDCELYVPEKGITRDGFLVLNKIYA
                     EKGRHETTWGVLRAFQYTDSLSIQNKVLYPKLNIPDTSSIELSPKGYRFLVDLFLRVD
                     KDNDGGLNSKELHFLFKCTPGLPKLWSATNFPFSTVVNSRGCITLQGWLAQWSMTTFL
                     DYRITTAYLVYFGFQEDARLALQITKSRKMRRRAGRLYRSPVTDRKVFNCFMIGNAKS
                     GKSMVLESFLGRSFTEIYSPTLKPQIAVNSLELKGGEQYYLILQEFGQQETSVLENKE
                     KLKECDVLCLTYDSSDPESFSYLAELFDKYEYLNNYPVLFVALKADLDKVQQRCHLQP
                     DEFAEQLHVNHPLHVSSTWLSSLNELFMKITEACLFPGKHTPGFPPEAALQESNYRQT
                     AMVLGSAAGFLALFAFGVAKLIRPSRYS"
     gene            <877048..>877785
                     /locus_tag="HG536_0F04550"
                     /db_xref="GeneID:59327344"
     mRNA            <877048..>877785
                     /locus_tag="HG536_0F04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284907.1"
                     /db_xref="GeneID:59327344"
     CDS             877048..877785
                     /locus_tag="HG536_0F04550"
                     /inference="similar to AA sequence:RefSeq:NP_009350.1"
                     /note="ancestral locus Anc_7.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140803.1"
                     /db_xref="GeneID:59327344"
                     /translation="MASHPPAACCFKGFYHEGTPKGSIAELYDIETYITGVASNEKVI
                     VILTDVFGHKLKNTQMIADHLGDAGYRVYIPDILFGEALERLDGSVDFNAWKERHNVA
                     KTKSVVDQFLSGLKKEHSPKFVGVVGHCFGAKYAVQQIHATEGAADACAIAHPSYVSI
                     EELAAIGKEKPLLISAAETDAIFPPEMRHLSEEKLTEIGARYQLDLFSGVSHGFAVRG
                     DENNPCVRYARNKVLLDQICWFNNFSS"
     gene            complement(<877879..>880845)
                     /locus_tag="HG536_0F04560"
                     /db_xref="GeneID:59327345"
     mRNA            complement(<877879..>880845)
                     /locus_tag="HG536_0F04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284908.1"
                     /db_xref="GeneID:59327345"
     CDS             complement(877879..880845)
                     /locus_tag="HG536_0F04560"
                     /inference="similar to AA sequence:RefSeq:NP_009349.3"
                     /note="ancestral locus Anc_7.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140804.1"
                     /db_xref="GeneID:59327345"
                     /translation="MYMQPLGLDSGSGSTALGSLEEGQMPPSSGADAHTKKRNRISFV
                     CQACRRSKTKCDREKPRCSRCVQHGIQCVYDVEQQPAPKNPSKDATIARLEKEVAYWK
                     SKAQDGLNKEQHYTGASKRLRESSYPSGTQQAKKVKGWPAYGVPDLDDIQVNLYRTHP
                     CMIMNRVMKREVKPLSENYAITQDPFLSGLIAAVFLGPSNNTMIPALSANASVSRALP
                     SVRDNVSKLKEKLISQCHNEAQKARINEFTERILQNNTKDRVRVGMLPNAMRSSFDRN
                     YLEDICPSNGDYSEALKSFILEMQEILPPLKILNSYKAHFYECVFPDLPFLNKQHFEE
                     SLASTLFEDEDDPTKIKIKLGRSRLRSKMENLCILLVILKLSYISLLFLNEGAEEMDS
                     DSNRDVINKYPIGNETILLAENVLSAENLFACANENIITCLLYIWSFFIYSPEEGDFF
                     LEHPTDVLTGVIVMLASSIGLHRDPSDFPRMCELEDPSVIIHRRTLWIAVITTVCLES
                     SLKGRHALSLDTAMDQFMNLKGSHAMEDYMRKIKRDKLGQDAFEIRVHELCLKRSFLA
                     LLIYDMDKLSLTYRGSFNLGEMEELRGRIEDFLAETFDTRNLEKAPDGAIHETTEFRK
                     SNMGKAQNSIGLHSVMMSRVVLLRASMALFYHFESAAIENSEQLPLYGKYLVRVCSDA
                     LTLISFITKYFGDGYKSSLLPSYCYNITKGTQIALSSTFFGMLGIIMRIEMANNIIFC
                     NYQDEASNNSDHLQTSNQKMETLKALKMDLESALESVYRVASKHLRFTYFSVFKMLAL
                     FDVIIQRMKKGELWNTMLRLRHVEKMNQRSVKALSMALALDLDGRGTVISQLKKRNHL
                     VRLPAEHLSAIFREVRGVIDGENAIIPKQESAASYPAFSDRSLAGNNVNLGNFDKLFS
                     AAALSQNVDIQSSSLGTCEASHASNDRAAANNDARLINDHKNDLDLASAVPMDFPGLF
                     GGLDLFDYDFLFSNDG"
     gene            complement(<881148..>883451)
                     /locus_tag="HG536_0F04570"
                     /db_xref="GeneID:59327346"
     mRNA            complement(<881148..>883451)
                     /locus_tag="HG536_0F04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284909.1"
                     /db_xref="GeneID:59327346"
     CDS             complement(881148..883451)
                     /locus_tag="HG536_0F04570"
                     /inference="similar to AA sequence:RefSeq:NP_009348.2"
                     /note="ancestral locus Anc_7.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140805.1"
                     /db_xref="GeneID:59327346"
                     /translation="MKWNWLQGGLAALVLVLRCALVGANNVSASSSHLRTSSLLTCME
                     NSEFTASYFDVRYYPGNSSVVFKIDATTTISENVTVKAELITYGLKVVEQTFDLCSLN
                     EVTLCPLSAGRIDVRSSYTISSDITKQIPGVAYTIPDLDAQIRVVVYSRNDTEYSRPL
                     ACVQAVLTNDKTVQTKYASWPIAAVSGIGVLTSGFVSVIGYSTTAAHIASNSISLFIY
                     FQNLAITAMMGVARVPPIAAAWTQNFQWSMGIINVKFMQNIFDWYVQATNGVSTVVVA
                     NKDVLSISVQKRNLERLAKRISLASSADYSFESLLDDSELYTTTERNTTEYSSRILVL
                     RGIERVAFKAGIELSNLFLTGIVFFLFFLFCVVFCLIFFKALLEVLTRARLMAESSNF
                     FQYRKNWGSIIKGTLFRLAIIAFPQVSLLCIWEFTQIDSPAVVVDAVVMLTVVTGLLA
                     YGTVRIMIKGRESQRLYKNPAYLLYGDAGFLNRYGFLYTQFKADYFWWLVPLLCYSFL
                     RSLFVAVLQQYGKAQAMIIFVIELAYFVCLCWKRPYLDKRTNIFNIAIHLVNLINSLF
                     FLFFSNLFKQPAVVSSVMAVILFVLNAVFALFLLIFTIITCTLALLHRNPDARYQPLK
                     DDRVSFIPKVQGPNGTAFEHANKSEAELFELRKAAMDTNETDQEKILRADAFGNGNNK
                     TLFDDEASTYTFSSSSNRFGAQSGVPQPVQPTSAVLGNTETLGSYDHPRANAANGSRS
                     NLMRPETSFYSHNNNASHSPYHSNSYL"
     gene            <883893..>886025
                     /locus_tag="HG536_0F04580"
                     /db_xref="GeneID:59327347"
     mRNA            <883893..>886025
                     /locus_tag="HG536_0F04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284910.1"
                     /db_xref="GeneID:59327347"
     CDS             883893..886025
                     /locus_tag="HG536_0F04580"
                     /inference="similar to AA sequence:RefSeq:NP_009347.1"
                     /note="ancestral locus Anc_7.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140806.1"
                     /db_xref="GeneID:59327347"
                     /translation="MAPTANVSLTQDGPSLAVPKPAKAAAVAQQHDTPREYEHLTSVR
                     AVKQLPIAERLQPGLAPHYSPHLEGISEYERLYRESIENPAKFFGDRARQFLNWTRDF
                     DTVFVPDPVTGKPSFEQNAWFLNGQLNACYNCVDRHALASPQRAAIVYEGDEPGQGYT
                     LTYRELLEQVCKVAQVLYHTMGVRKGDTVAVYMPMVPQALVTLLAIVRIGAVHSVVFA
                     GFSSNSLRDRINDADSRVVITTDESRRGGKIVETKRIVDDALKECPRVRHVLVYKRTH
                     NEAVSYQRPRDLDWDDEVKKYKGYCPCEPVDSEHPLFLLYTSGSTGSPKGVQHSTAGY
                     LLGALLSMRYTFDVHQPDVFFTAGDIGWITGHTYVVYGPLLYGCTTLVFEGTPAYPNF
                     SRYWEIIDKHRVTQFYVAPTALRLLKRAGDSFIEGYSLKSLRCLGSVGEPIAAEVWEW
                     FSSRIGKDQIPIVDTYWQTESGSHLVTPLAGGVTPMKPGSASFPFFGIEPAILDPTTG
                     REIVGDHAEGVLAVKGAWPSFARTIWNNHDRYLDTYLRPYKNVYFTGDGAARDKDGYI
                     WILGRVDDVVNVSGHRLSTAEIEAAIIEDAIVAECAVVGFHDDLTGQAVAAFVVLKNK
                     SNWSQASDVDLQDIKKHLILTVRKDIGPFAAPKLIVIVDDLPKTRSGKIMRRILRKIL
                     AGEADQLGDVSTLSNPGVVRHLIDSVKL"
     gene            <886065..>886715
                     /locus_tag="HG536_0F04590"
                     /db_xref="GeneID:59327348"
     mRNA            <886065..>886715
                     /locus_tag="HG536_0F04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284911.1"
                     /db_xref="GeneID:59327348"
     CDS             886065..886715
                     /locus_tag="HG536_0F04590"
                     /inference="similar to AA sequence:RefSeq:NP_015012.3"
                     /note="ancestral locus Anc_7.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140807.1"
                     /db_xref="GeneID:59327348"
                     /translation="MYHLLKTLNVFACSEGLMSYGTAADVTSLDEDLKLLRERKFSQE
                     SIEDIKRWVFQSVLEDQQPAQSLLESLKDGTVLCRLANRLYIADVGDGRELIKWRKST
                     MPFVQMEQISQFLGFARSYGVPEDELFQTVDLFEEKDPAIVYQTLKSLSRYANKKHPQ
                     KFVVLGPQLATKRPRPPVKQKPSHLQTGWSTTEYGYMGGASQSTEKVVFGQRRDIK"
     gene            complement(<886723..>887154)
                     /locus_tag="HG536_0F04600"
                     /db_xref="GeneID:59327349"
     mRNA            complement(<886723..>887154)
                     /locus_tag="HG536_0F04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284912.1"
                     /db_xref="GeneID:59327349"
     CDS             complement(886723..887154)
                     /locus_tag="HG536_0F04600"
                     /inference="similar to AA sequence:RefSeq:NP_009346.1"
                     /note="ancestral locus Anc_7.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140808.1"
                     /db_xref="GeneID:59327349"
                     /translation="MRSRDHSRRLLGVVGAISAVCVTGGLIAYWALSPSTSDGSKQER
                     RGSRCILVTKTIADSNKINWESLLKEDVVLVVVPGVMFLHQSYKVIRCSTMSGLWSCV
                     RHLKKKQLLLKPDDLETSMPADVPRYVGQVIHIASELDLAD"
     gene            <887248..>888387
                     /locus_tag="HG536_0F04610"
                     /db_xref="GeneID:59327350"
     mRNA            <887248..>888387
                     /locus_tag="HG536_0F04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284913.1"
                     /db_xref="GeneID:59327350"
     CDS             887248..888387
                     /locus_tag="HG536_0F04610"
                     /inference="similar to AA sequence:RefSeq:NP_015013.1"
                     /note="ancestral locus Anc_7.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140809.1"
                     /db_xref="GeneID:59327350"
                     /translation="MRRDGTLFNASTVHIDHITTALNCLIPFGIKEEVIIFIDNDGLS
                     FARELNHVMRIQLFLARELFMSFSYDNGNDNEEPTKVCVKISHLLDSFNVANRNIDDV
                     VECTMSYDGYGSPFVLIFEDSTVSERVEYSTYLVQGSTNGGLEIDRDQVIFECIIKGD
                     VLYAAMNELKETGCKECYLFAKTNDNGDHVFALISDSQLGLSKIRLPNSRSILEKLEI
                     YDTDYETVIHGRLVIASFDFNLFDKMRMSIRIASKVLFKMDAHGLLSVNILSQTDDVL
                     VSETRPTINRARSLDGPRQMQLPRDYPGIVVEVCLIEREQFDDSAKRNIEILMDSGER
                     EKAASSGIGAGSNSRGNIPTFHREEIDLQNGRRASPFKNDLPLFF"
     gene            complement(<888456..>888884)
                     /locus_tag="HG536_0F04620"
                     /db_xref="GeneID:59327351"
     mRNA            complement(<888456..>888884)
                     /locus_tag="HG536_0F04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284914.1"
                     /db_xref="GeneID:59327351"
     CDS             complement(888456..888884)
                     /locus_tag="HG536_0F04620"
                     /inference="similar to AA sequence:RefSeq:NP_015014.3"
                     /note="ancestral locus Anc_7.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140810.1"
                     /db_xref="GeneID:59327351"
                     /translation="MSDVEEVVEVQEEVVEQTAEVTIEDALKVVLRTALVHDGLARGL
                     RESAKALTKGQAQLVVLVSSVTEDNIIKLVEGLANDPENKVPLIKVADAKQLGEWAGL
                     GKVDRDGNVRKVVGASVVVVTNWGAETDERAMILEHFSQQ"
     gene            complement(<889438..>891261)
                     /locus_tag="HG536_0F04630"
                     /db_xref="GeneID:59327352"
     mRNA            complement(<889438..>891261)
                     /locus_tag="HG536_0F04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284915.1"
                     /db_xref="GeneID:59327352"
     CDS             complement(889438..891261)
                     /locus_tag="HG536_0F04630"
                     /inference="similar to AA sequence:RefSeq:NP_015015.1"
                     /note="ancestral locus Anc_7.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140811.1"
                     /db_xref="GeneID:59327352"
                     /translation="MLSPERRPSMAERRPVLSNSSSIVVPHLAGIEDPLPDSTPDKVD
                     VLIVGTGMVESVLAAALSWQGSKVLHIDKNDHYGDSSATMTVDQIKRWVNQVNEGEYP
                     KCYSNAKLYVSTSIENGRGRFASRDFGLDLAPKILFAKSDLLSVLVNSRVHQYLEFQS
                     LSSFHTYENDSFEKLTNTKQEIFTDQNLPLMTKRNLMKFIKFVLNWEEQPEIWEPYSN
                     RPIGDMLVEKFKLDKPQVFELMFSIGLCYNMHTKTPEVLQRIRRYLSSFDVYGPFSVL
                     YSKYGGPGELSQGFCRSAAVGGAMYKLNESLASYDPSSKIAYFNDGSKVSVTEKVVIS
                     PTQAPKYNQNAPEQKYEIHRLTCIVEKSCEEWFTEGESAAVVVFPPGSLKSGNQEVVQ
                     SFILGSGSETCPKGTSIWYLSTTQQGPRAEMDLDAALEAMEASIVRESSSDLENDESI
                     LRFGPNGEPVINSVRLGQSFKEYVPREKIQFLLKLYHIQYTSTPPFAVVDPSLFDINR
                     EDSERLIPGASDNGVLYTAMPSAEISYDEVVTAAKVLYEKIVGSDDDFFDLDFEDGDD
                     AAISKTDFENAIEDDEDDEDAEMSVGVGRSGTAECIGEMEI"
     gene            complement(<891646..>894111)
                     /locus_tag="HG536_0F04640"
                     /db_xref="GeneID:59327353"
     mRNA            complement(<891646..>894111)
                     /locus_tag="HG536_0F04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284916.1"
                     /db_xref="GeneID:59327353"
     CDS             complement(891646..894111)
                     /locus_tag="HG536_0F04640"
                     /inference="similar to AA sequence:RefSeq:NP_009345.3"
                     /note="ancestral locus Anc_7.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140812.1"
                     /db_xref="GeneID:59327353"
                     /translation="MDILHFPQKPRRNLDEEIEKSHEWPEKYHEDKSQMYERLGSRSE
                     ATDFSPLKYATNYVSVISSPIGKHMKAKIRSNNEDWLKKYYMSKKLTSHATLRQGSVT
                     SSSDLSATHSDRSKSNTLLDKFLDCIQDLPDPVDEQLPSYVLDEDFSEEENDKRAIRE
                     SLSTSSYFDHYGKLRTVDLKNRDILKRHTLWMPIMKAEFRKLVTNIKDPTKVITDDKI
                     CPLFIEGTNYILREYDAYGGSTMISSVFSEHKLPAFCYHCAVEVNDQVYILGGLVACH
                     KYDDEGPNLKDFVVDGVENLPPPLLPKIINNPSMINNARLYVLSLTSSHVSRPEVSGS
                     VPPPLLCLRGSKLTERHIFFYGGLEIKTECACDEKGIYHLRKRAFVNNTGYILDTMTF
                     KFSKIELMAQPYKFVSFPTLSARFGHMQMSIAPNHLPCNHEKGNEYHDSACIGMPSEE
                     GTSSWNPSAVSLSSLSRSCIANHGSGVYTILIFGGYRQTGDDNYEAMNDFWRIEVPVI
                     VRGKRGYCKFGDSASATIISRTNGTDLWPSRRAFFGYSLAETTVLGKSTLHDGLLGQL
                     AKNFCIESPTEKHKTKPIFPNIPHARKETSHSRHHATGKEMRSDSNSSLRQRMGSPVH
                     SYGSLQGRKQTSEGGVVVIHGGSDNTKVFGDMWWFDLESETWSSITTYGRDEVEGLVP
                     IEICLVGQSMVTVGPISVSLGGFTQEEVDQLFLNKSIPDTADTSRKIGTDILNIFDLK
                     TQCLQGHTVTMEGEGEDRHPVLADENGDQTNAVTSFGCQVLHTNGTIALVGGLISPRS
                     KVNDCYLRGSVLQCVLPSISLAS"
     gene            complement(<894390..>895988)
                     /locus_tag="HG536_0F04650"
                     /db_xref="GeneID:59327354"
     mRNA            complement(<894390..>895988)
                     /locus_tag="HG536_0F04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284917.1"
                     /db_xref="GeneID:59327354"
     CDS             complement(894390..895988)
                     /locus_tag="HG536_0F04650"
                     /inference="similar to AA sequence:RefSeq:NP_015017.1"
                     /note="ancestral locus Anc_7.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140813.1"
                     /db_xref="GeneID:59327354"
                     /translation="MAPSPPPQPQSQGMSVEEGLTAGMAGSSAAFEPESDSNFFRVIT
                     ENLKYAFHSPLPNTQFPTPYSSNQVQMSQGANQGLQQGGSDNSSSLMENSMLPGLSGA
                     ANAAPGEALNDFNMQPSSVLQCGSAFPNEFLLASPEQFKEFLFESPAGFSILHKTPAR
                     TPLRFVSGSLKDDANSGNLFGNPMISSSHGKDANINKFTQTPLRSIDLNLMFNSNHMA
                     AASSSPSKRVALSLTPYGRKVLHEIGTPYAKTLVSSNSALADFQKARKDVTRLHSSPP
                     TAKKMTKTPPSKPRKKTVVESLSGKAGSQQTLSKESLNTCEGVQEADEDCYGSSPTTI
                     QLNSSITKSSGRLSAQRIRVMTRQISESNVDDRLFKEDVEGLQLSPTPKCNALSSIET
                     LKIPELPKMGSFKSETPPVPTKTATSKNAASSSSSLQSKAGRVKKTTKKQPKFQIIVA
                     NAQKFSVPTSQKSSKKIASLKRSRSMLAEPTAWTPNERKNKNTNSTNDNNNNNNGTSG
                     VNRDSTNKKRSKSFTGNGQLYGFQ"
     gene            <896332..>898650
                     /locus_tag="HG536_0F04660"
                     /db_xref="GeneID:59327355"
     mRNA            <896332..>898650
                     /locus_tag="HG536_0F04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284918.1"
                     /db_xref="GeneID:59327355"
     CDS             896332..898650
                     /locus_tag="HG536_0F04660"
                     /inference="similar to AA sequence:RefSeq:NP_015018.3"
                     /note="ancestral locus Anc_7.7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140814.1"
                     /db_xref="GeneID:59327355"
                     /translation="MEESPSKDLAADLQSFHISSPRSGRKPASTDAAAPDMIGRNVMK
                     QYLPNNEFADSKFVSYVGESESKSYIKRLGDWSMNYGTVQQRSKSPVKKDNELPQFKQ
                     YLNFSLPQKNSKQELSRDPESELILTASLNDISGIPTNTFKRHDHQMKRQQLTNTESL
                     SQDVGEQEDEEEKGATDLDDVDPALEARGVFDNILKTQKSNYDFQQGRDEPLAGSRNR
                     YESDGTSSYLGETPSSLSPNFEPYPEKPAGIKLITPEEMGLVFDNVNGVWYKPPAKNQ
                     DISSSRTIDNADSTMSNISKDQHGIEGIIAASAMMKFGRSKKEARPSLPENTDTVEER
                     YEIEDDTPLDLPQISPEYLLQANAMKNDKKSSGNNATQNMIANVTTVSQVETSFQQSK
                     RELISIITDILPAHKISWSRVRRIDLQDKQLSQVIGLNEILPHLTDCDLSDNDLRGLL
                     GVPTGVLRLSCRNNRISSAYLSLDTLPHLETIDLSHNSIGHNVNILSSSIHLRHVNLS
                     HNKIRSLSGGLGPSRIIKLDLSNNDISGAIDFAQLVRHDRHDEGERGWLSLEELNLSN
                     NKITRLRNVRCLKSLRVLKIDGNPIKELIETAGAIETTVRSNLRTLSITNTQNALTRL
                     GTLIASTTFRDEIPYRRLRILRTDSFSRFCRIRSMPRTLEELSIQGGKVEALPSWSIF
                     PSSLRKLSLKSLQDLREIPHTLAYQLPSLQELDLSRNQLNSCYKLVRALPTSCLVKLS
                     IKDNPLSSSEKDKRDLTKVIGMVCPRLTSFEL"
     gene            <899225..>900781
                     /locus_tag="HG536_0F04670"
                     /db_xref="GeneID:59327356"
     mRNA            <899225..>900781
                     /locus_tag="HG536_0F04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284919.1"
                     /db_xref="GeneID:59327356"
     CDS             899225..900781
                     /locus_tag="HG536_0F04670"
                     /inference="similar to AA sequence:RefSeq:NP_015019.1"
                     /note="ancestral locus Anc_7.6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140815.1"
                     /db_xref="GeneID:59327356"
                     /translation="MFARSAVLARNSSSHIGRIQLRYFSHLPLTVPIKLPNGLEYEQP
                     TGLFINNKFVPSKQKKTFEVINPSTEEEICHVYEGREDDVEDAVKAADVAFNNGSWST
                     VDPLARGNALYKLAEFIEQDKDVIASIETLDNGKAISSARGDVDLVINYLKSAAGYAD
                     KIDGRLIDTGSSHFSYTRREPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKTAE
                     STPLSALYVSKYIPQAGIPPGVVNIVSGFGKIVGEAISNHPKVKKIAFTGSTATGKHI
                     YQTAAASLKKATLELGGKSPNIVFADANIKQAVDNIILGIYYNSGEVCCAGSRVYVEE
                     SIYDEVINQLKIASEAVKVGDPFDENTFQGAQTSQNQLSKILSYVEIGKKEGATLITG
                     GERLGDKGYFVRPTVFGDVNEQMRIVKEEIFGPVVTVTKFKNLDEVVEMANDSEYGLA
                     AGIHTVNINTAIKVADRLKAGTVWINTYNDFHHSVPFGGFNASGLGREMGAETLENYT
                     QVKAVRAKLV"
     gene            complement(<902671..>903228)
                     /locus_tag="HG536_0F04690"
                     /db_xref="GeneID:59327357"
     mRNA            complement(<902671..>903228)
                     /locus_tag="HG536_0F04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284920.1"
                     /db_xref="GeneID:59327357"
     CDS             complement(902671..903228)
                     /locus_tag="HG536_0F04690"
                     /inference="similar to AA sequence:RefSeq:NP_009342.2"
                     /note="ancestral locus Anc_7.4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140816.1"
                     /db_xref="GeneID:59327357"
                     /translation="MAKKVSRHSRAARRAVDEEPEPKALSQLPRAEKTDLTNILTRTA
                     AKNEALLEAKLRNKNKNKVSKKHIKEKLSASVVGADKERFERALNVANRLDGKIARSV
                     SRAKYVQNARKAGWDSTNEQIRRERTTTTNQAGIADKEHEAASEDATENDDPNEVTEG
                     DSDKISDTNSSPKNLFSVLTDDVEV"
     gene            complement(<903366..>904514)
                     /locus_tag="HG536_0F04700"
                     /db_xref="GeneID:59327358"
     mRNA            complement(<903366..>904514)
                     /locus_tag="HG536_0F04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284921.1"
                     /db_xref="GeneID:59327358"
     CDS             complement(903366..904514)
                     /locus_tag="HG536_0F04700"
                     /inference="similar to AA sequence:RefSeq:NP_009341.2"
                     /note="ancestral locus Anc_7.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140817.1"
                     /db_xref="GeneID:59327358"
                     /translation="MRALAYFKKGDIHFADDLPEPTIENDEEVLIDVSWCGICGTDLH
                     EYLDGPIFMPRDGGEHPLSGKRLPQPMGHEMSGIVSKIGSKVTKVKAGDHVVVEAGCS
                     CLDIKRWENSSLKTNAACSACAKGMVNCCAHAGFTGLGVTGGGFAERVTVSQDHCVVI
                     PKELPLDVAALVEPLSVTWHAAKIAGFQKGQTACVMGAGPIGLAAVLVLKGFGASKIV
                     VSELASIRRDLASSLGVEVFNPAEHADAIEELRKIPVGQDGFDAAFDCSGVKATFDTA
                     LHVTTFRGVSVNVAIWGNKPIDYHPMDVTLKEKRLTGSIGYTVEDFREVVEAIHSGRI
                     PLQDCRQLITGKQKLEDGWEKGFLELMNHKETNVKILLTPNNHNELNA"
     gene            complement(<904912..>906063)
                     /locus_tag="HG536_0F04710"
                     /db_xref="GeneID:59327359"
     mRNA            complement(<904912..>906063)
                     /locus_tag="HG536_0F04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284922.1"
                     /db_xref="GeneID:59327359"
     CDS             complement(904912..906063)
                     /locus_tag="HG536_0F04710"
                     /inference="similar to AA sequence:RefSeq:NP_009340.1"
                     /note="ancestral locus Anc_7.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140818.1"
                     /db_xref="GeneID:59327359"
                     /translation="MRALAYFRKGDVRFTEALEEPKIVAPDELIVDIAWCGICGTDLH
                     EYLDDPIFFPKDGETNQISGLGLPQALGHEISGVVSKVGPGVQSLRVGDHVVVEPTGT
                     CRDRYRWSTAAHPNKEICAACKKGLYNVCSHLGLCGAGVQSGGCAERMVINESHCFKI
                     PDDFPLDVAALIQPIAVCWHALKVCDFKRGSSVLIIGGGPIGLGTILALNGFGCTEIV
                     VSEPALIRRELAEKMGAITYDPSLRPHDESIEYLRSIAPGGDGFDYTFDCSGLPVTLK
                     AAIRCLTYRGTAVNVAMWGDHPVSFLPMDVTKQEKRYMGSMCYTADDFLEVIDAFAEK
                     KIDAEKASHMITDKIPLEIGVEKGIKKLITHKDQTIKVLMTPNNSGELC"
     gene            complement(<906515..>907897)
                     /locus_tag="HG536_0F04720"
                     /db_xref="GeneID:59327360"
     mRNA            complement(<906515..>907897)
                     /locus_tag="HG536_0F04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284923.1"
                     /db_xref="GeneID:59327360"
     CDS             complement(906515..907897)
                     /locus_tag="HG536_0F04720"
                     /inference="similar to AA sequence:RefSeq:NP_009339.1"
                     /note="ancestral locus Anc_7.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140819.1"
                     /db_xref="GeneID:59327360"
                     /translation="MSAAPFEPEFQQAHDEIVSSLRDSTLFQVKPEYEKVLKIVAVPE
                     RIIQFRVSWENDKGEQEVATGFRVQYNSAKGPYKGGLRFHPTVNLSILKFLGFEQIFK
                     NALTGLDMGGAKGGLCVDLKGRSDNEIRRICSSFMRELSKHIGQDTDVPAGDIGVGGR
                     EIGYLFGAYRAYRNSWEGVLTGKGLNWGGSLIRPEATGYGVIYFTQAMIDYATKGKES
                     FEGKRVAISGSGNVAQYAALKVIELGGKVVSLSDSKGCIISESGITSEQVSAIADAKI
                     KFKSLEEIVGEFSAFAENKVQYVAGARPWTHAGKVDIALPCATQNEVSGDEAKALVAA
                     GVKFVAEGSNMGCTPEAIQAFETARLTATSSQGAVWYVGGKASNLGGVLVSGLEMAQN
                     SQRMTWTRETVDQELKRGMINCFNDCINAAQTYSNETNKETLPSLVKGANLASFIKVA
                     DAMFDQGDVF"
     gene            908572..908645
                     /locus_tag="HG536_0Ftrna10V"
                     /db_xref="GeneID:59327370"
     tRNA            908572..908645
                     /locus_tag="HG536_0Ftrna10V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59327370"
     gene            complement(<908993..>909880)
                     /locus_tag="HG536_0F04730"
                     /db_xref="GeneID:59327361"
     mRNA            complement(<908993..>909880)
                     /locus_tag="HG536_0F04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284924.1"
                     /db_xref="GeneID:59327361"
     CDS             complement(908993..909880)
                     /locus_tag="HG536_0F04730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140820.1"
                     /db_xref="GeneID:59327361"
                     /translation="MKRDNSFEWHESPLESLALEALKVAVIGGTNGLGRAIALQLASR
                     GAHVIVVGRSFKDSEVQNISFVQADLSSMEVARQIAQQIAPETLDILLFTTGIFASTS
                     KQVTAEGLERDLAVSYLNRLVMLNEIAPKLRRTKNSLGFKPRVFSMGYPGSGELGTID
                     DLNQENSYGAIKAHMNTVAGNEALVRVAAERYPQLNIYGLNPGIVRTNIRDNLLGENS
                     WKSYIIEGIIGWFTQTPEQYAAKMVPLMVAPELEKRSGTFYNNKAQGILPSEGMTPNY
                     AASYVEASEELLKSKGLAK"
     gene            <911557..>913962
                     /locus_tag="HG536_0F04740"
                     /db_xref="GeneID:59327362"
     mRNA            <911557..>913962
                     /locus_tag="HG536_0F04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284925.1"
                     /db_xref="GeneID:59327362"
     CDS             911557..913962
                     /locus_tag="HG536_0F04740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140821.1"
                     /db_xref="GeneID:59327362"
                     /translation="MGKVEDVSANEECVVIATVADSNSSKFSGIETGVVSQVVGNLEK
                     EGIEAVEVSLSEREEAGLDDVDVAEYVIDDTVWEGDPSQMANSPYPDVRDAVPVGDDP
                     GIVLNHWRTWFLTTVFVVVFAGVNQFFSLRYPTLEISFLVAQVVCFPIGKALALLPDW
                     KCKRCSFFNLNPGPFTKKEHAVVTIAVALTSSTAYACYILNAQVSFYHMNLNAGYQLL
                     LVWTSQMIGYGAAGLTRRWIVNPASCIWPQTLISVSMFDSLHSRSVEKTIANGWRISR
                     YRLFFYVLIGSFLWYWVPGFLFKGLSYFNIVLWGPKTRHNFVVNALFGVNSGIGLLPL
                     SFDYTQVSQAMSGSVFATPFWVSANTYAAVGLFFMIILPILYFTNTWYAKYMPVISGS
                     TFDNTQSKYNVQKILNPDFSINLEKYKSYSPMFVPFSYLLNYALNFAAVVAVFVHCFL
                     YHGKDIVRRLKDENFGGMDIHRRIYTQNYKDCPDWWYIVLQVITLGLGFATVCGFDTH
                     FPPWAFVIALLISFANFVPQGILEAITNQHVGLNIITELICGYMLPLKPMANLLFKLY
                     GFIVMRQGLNLSRDLKLALYMKVPPRLIFAIQIYATIISGMVNVGVQEWMRFNIKGFC
                     DSDQPDGFICANGRTVFNASIIWSLPQYLFSPGRIYNPLMWFFLIGLVSPIIIFFLQK
                     RLPKVNFLKYIHTPVFFTGSNSIPPSTPYNYSLFFGMSFVLFTIRRRWPAWFSKYNFV
                     TGAGVEAGVAIAVVIIFLCVQYPGGNLAWWGNSVYKNTYDFESRKFYTLAKGETFGYD
                     KWW"
     gene            <914321..>914908
                     /locus_tag="HG536_0F04750"
                     /db_xref="GeneID:59327363"
     mRNA            <914321..>914908
                     /locus_tag="HG536_0F04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284926.1"
                     /db_xref="GeneID:59327363"
     CDS             914321..914908
                     /locus_tag="HG536_0F04750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140822.1"
                     /db_xref="GeneID:59327363"
                     /translation="MTVFRIGVILGSTRSTRLSPRIAQYVIDRVRSSEWDISFTLSLI
                     DLKEWDLPLMDEPKVPALVTKTEDYESEVARKWSREISSYDGFIFVTPQYNWGYPACL
                     KNAIDYLFNEWKGKPAMLVSYGGHGGHKCYNQLRQVLEGLDMEVTERGVLVPYPTKKE
                     VMYGIPADFHFDQLPEIRETIETAFENLLNLLKKN"
     gene            complement(915244..915314)
                     /locus_tag="HG536_0Ftrna13G"
                     /db_xref="GeneID:59327375"
     tRNA            complement(915244..915314)
                     /locus_tag="HG536_0Ftrna13G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59327375"
     gene            complement(915378..915448)
                     /locus_tag="HG536_0Ftrna14G"
                     /db_xref="GeneID:59327376"
     tRNA            complement(915378..915448)
                     /locus_tag="HG536_0Ftrna14G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59327376"
     gene            <915997..>916548
                     /locus_tag="HG536_0F04760"
                     /db_xref="GeneID:59327364"
     mRNA            <915997..>916548
                     /locus_tag="HG536_0F04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284927.1"
                     /db_xref="GeneID:59327364"
     CDS             915997..916548
                     /locus_tag="HG536_0F04760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140823.1"
                     /db_xref="GeneID:59327364"
                     /translation="MVVERVGHTNADEVQVDSTLTQLRYCKQRGSLEAYNKEYNALSA
                     AIPDELLSPKCKQSFYLSGLEKSLQITVRNLRPDSLETAMILASNSCGEDRSAECATN
                     THRATDTDRRKDHLADGDDLDTQKEIDAIRTGYKRRRPDPSDTHRVKLTEKERRLLQK
                     FGLCFKCRAGKHWAKNCPETRPS"
     gene            <917635..>918759
                     /locus_tag="HG536_0F04770"
                     /db_xref="GeneID:59327365"
     mRNA            <917635..>918759
                     /locus_tag="HG536_0F04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284928.1"
                     /db_xref="GeneID:59327365"
     CDS             917635..918759
                     /locus_tag="HG536_0F04770"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140824.1"
                     /db_xref="GeneID:59327365"
                     /translation="MPFGLVNAPSTFSRYMADIFRDLPFVLVYLDDILVMSTTTMEHI
                     SHLDTVLSRLKDHQLIAKEKKCQFLQKELKFLGYQIAERCIRPIKDKCEAINALPLCK
                     TIKETQRFLGMINYYRRFIPRCSTVARPLIELIAKKTPWPTEQTKAFNGLKRALVSAP
                     LLVPFSPEREYRLTTDASKLGLGAVLEELINNRVAGVVGYFSKSLQGAQNNYPAGELE
                     LLGIIESLRHFKYLLHGKRFKLRTDHISLLALKNRSEPSMRLARWLDHGLFGGHYGDT
                     ITYEKVASKFYWPKMLATIRRYVKSCIQCQIMKNSAHKSQGLLMPLPVPEGRWLDIAM
                     DFATDLPRTRSGYDMIMVMVCRFSKRAHFIPCAKTLDAQV"
     gene            <919099..>919614
                     /locus_tag="HG536_0F04780"
                     /db_xref="GeneID:59327366"
     mRNA            <919099..>919614
                     /locus_tag="HG536_0F04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284929.1"
                     /db_xref="GeneID:59327366"
     CDS             919099..919614
                     /locus_tag="HG536_0F04780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140825.1"
                     /db_xref="GeneID:59327366"
                     /translation="MYCYTGTPATTRDDTGRYSHSSSVHSKLLRSSNDNAFELGLPIV
                     TKKHRVFNIKWLKKLITREGLYYQHPPLSKYARMNKLQDIISIVGYDPDEKIYHCKLQ
                     CVDPQITIAFEEDEIQKLPHQRFRSLLQNLKTLTDFEHPVEDHWEGGRCNSTNWTYRL
                     DKRRLRVWPST"
     gene            919900..919971
                     /locus_tag="HG536_0Ftrna7E"
                     /db_xref="GeneID:59327388"
     tRNA            919900..919971
                     /locus_tag="HG536_0Ftrna7E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAG"
                     /db_xref="GeneID:59327388"
     gene            complement(921781..921853)
                     /locus_tag="HG536_0Ftrna11K"
                     /db_xref="GeneID:59327371"
     tRNA            complement(921781..921853)
                     /locus_tag="HG536_0Ftrna11K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59327371"
     gene            complement(<923013..>923333)
                     /locus_tag="HG536_0F04790"
                     /db_xref="GeneID:59327367"
     mRNA            complement(<923013..>923333)
                     /locus_tag="HG536_0F04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284930.1"
                     /db_xref="GeneID:59327367"
     CDS             complement(923013..923333)
                     /locus_tag="HG536_0F04790"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140826.1"
                     /db_xref="GeneID:59327367"
                     /translation="MKILFDSGSPTSFLHSDMVKILNLRTNQTPPFRFRGFIPTDSST
                     TTQAVSLTFPVEDLQITVAAYVLESMDYRMLIGNPILHRYPKLLSIILTSTPNRTLLH
                     HRLK"
     gene            <924500..>926554
                     /locus_tag="HG536_0F04810"
                     /db_xref="GeneID:59327368"
     mRNA            <924500..>926554
                     /locus_tag="HG536_0F04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284931.1"
                     /db_xref="GeneID:59327368"
     CDS             924500..926554
                     /locus_tag="HG536_0F04810"
                     /inference="similar to AA sequence:RefSeq:NP_012442.1"
                     /note="ancestral locus Anc_1.273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140827.1"
                     /db_xref="GeneID:59327368"
                     /translation="MRKEGDNERQKQPALGAALQESISFDAQRVSIIRCDATSVMFVF
                     WFHVSCYFPVLTACLGPIGNTISIACVVEKWRLLKVFENGVVTGSIPVSDPGGIFAVN
                     VISLVLGFISNIALLLHFGERLSYLKAQWICIVGWTAASFMLMIDVIMCGSKYMGEKY
                     EKSIGYWFAAITSGLYFGCTLTLTTHFVGYLLGKYPARFNLIKNERSLMVFTVSFSII
                     LIWGGGMFSGLLHVSFGNSLYFCVVSILTIGLGDIVPVSLASRILLLFYSLLGFINLA
                     LIIAMTTGIFRSSSGPVVFFHKVEVQRKRELFRIKSNEICYTSEEAFSTMQRIRKKAR
                     SRQKFEALLFTLLAFVIFWHLGSLGLRFAEGWSYFVGMYFCFLCLLTIGYGDYAPASG
                     AGRALFVLWALGAVPMMSAILSNVGDILLEFSDTIDVSIAKKFKLGLQSIIIRGSESW
                     NKYIVNDDEILPEDDSSGQNYDEEDDNDETDSEQDERNNHSSKEAELSASSGPALQEL
                     RSETPVKTPLRSNMHENAECDLRNTLDIFSLFHKDALPVQSSFSSIRFSASDLHRMLS
                     TLRKFRSIAQQNKHYCLTFNQWRELHELHSLTYDASAFDDPAFWLSECSPLRFPLNQP
                     KFVALRLFSRIEQIVSDLLTREERSCYVSDNRTTTVLGSEAREQGRSTAVGLKRARSA
                     TF"
     gene            complement(928023..931418)
                     /locus_tag="HG536_RDN25a"
                     /db_xref="GeneID:59328412"
     rRNA            complement(928023..931418)
                     /locus_tag="HG536_RDN25a"
                     /product="25S ribosomal RNA"
                     /transcript_id="XR_005101474.1"
                     /db_xref="GeneID:59328412"
     gene            complement(931675..931832)
                     /locus_tag="HG536_RDN58a"
                     /db_xref="GeneID:59328413"
     rRNA            complement(931675..931832)
                     /locus_tag="HG536_RDN58a"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_005101475.1"
                     /db_xref="GeneID:59328413"
     gene            complement(932146..933944)
                     /locus_tag="HG536_RND18a"
                     /db_xref="GeneID:59328414"
     rRNA            complement(932146..933944)
                     /locus_tag="HG536_RND18a"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_005101476.1"
                     /db_xref="GeneID:59328414"
     gene            935381..935501
                     /locus_tag="HG536_RND5a"
                     /db_xref="GeneID:59328418"
     rRNA            935381..935501
                     /locus_tag="HG536_RND5a"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_005101480.1"
                     /db_xref="GeneID:59328418"
     gene            complement(936621..940016)
                     /locus_tag="HG536_RND25b"
                     /db_xref="GeneID:59328416"
     rRNA            complement(936621..940016)
                     /locus_tag="HG536_RND25b"
                     /product="25S ribosomal RNA"
                     /transcript_id="XR_005101478.1"
                     /db_xref="GeneID:59328416"
     gene            complement(940273..940430)
                     /locus_tag="HG536_RND58b"
                     /db_xref="GeneID:59328417"
     rRNA            complement(940273..940430)
                     /locus_tag="HG536_RND58b"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_005101479.1"
                     /db_xref="GeneID:59328417"
     gene            complement(940744..942542)
                     /locus_tag="HG536_RND18b"
                     /db_xref="GeneID:59328415"
     rRNA            complement(940744..942542)
                     /locus_tag="HG536_RND18b"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_005101477.1"
                     /db_xref="GeneID:59328415"
CONTIG      join(CP059251.1:1..942542)
//
DBGET integrated database retrieval system