GenomeNet

Database: RefSeq
Entry: NC_050734
LinkDB: NC_050734
Original site: NC_050734 
LOCUS       NC_050734             914501 bp    DNA     linear   CON 09-NOV-2020
DEFINITION  Torulaspora globosa chromosome 8, complete sequence.
ACCESSION   NC_050734
VERSION     NC_050734.1
DBLINK      BioProject: PRJNA670758
            BioSample: SAMN14605265
            Assembly: GCF_014133895.1
KEYWORDS    RefSeq.
SOURCE      Torulaspora globosa
  ORGANISM  Torulaspora globosa
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Torulaspora.
REFERENCE   1  (bases 1 to 914501)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     The yeast mating-type switching endonuclease HO is a domesticated
            member of an unorthodox homing genetic element family
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 914501)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 914501)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2020) Conway Institute, University College Dublin
            (UCD), Wolfe Lab, Belfield, Dublin Dulin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP059253.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: HGAP v. 3
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100.0x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..914501
                     /organism="Torulaspora globosa"
                     /mol_type="genomic DNA"
                     /strain="CBS764"
                     /isolation_source="soil, St Thomas, West Indies (strain
                     received from Westerdijk Fungal Biodiversity Institute)"
                     /type_material="type material of Debaryomyces globosus"
                     /db_xref="taxon:48254"
                     /chromosome="8"
                     /country="USA: Saint Thomas, West Indies"
     gene            complement(<4208..>4879)
                     /locus_tag="HG536_0H00100"
                     /db_xref="GeneID:59327902"
     mRNA            complement(<4208..>4879)
                     /locus_tag="HG536_0H00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285414.1"
                     /db_xref="GeneID:59327902"
     CDS             complement(4208..4879)
                     /locus_tag="HG536_0H00100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141310.1"
                     /db_xref="GeneID:59327902"
                     /translation="MVAFYGLDARGAPATHAELLLADSQRLVTSHRRAMEKLERDQEL
                     AARKRAAKVPPSLALERKRIKRDFHEPHEYTDILLYVSLPTDMAAGLFLQGVDIHFCP
                     SDTFTRKEGCKDCLKDYNLCVSAGGQHKSYRRIACEALALRRMLLDDERYDKHLEEME
                     PFRTDPVGYLHAFVKEREQLQTAVKRKYLWFYELTTGVSQIVTLQSIRGVGSCRLFRG
                     SAADV"
     gene            complement(<5799..>6491)
                     /locus_tag="HG536_0H00110"
                     /db_xref="GeneID:59327903"
     mRNA            complement(<5799..>6491)
                     /locus_tag="HG536_0H00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285415.1"
                     /db_xref="GeneID:59327903"
     CDS             complement(5799..6491)
                     /locus_tag="HG536_0H00110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141311.1"
                     /db_xref="GeneID:59327903"
                     /translation="MDGVTSDHLFYFIVVLGQMQINVLRGSSRTICDTMDPQSAKLME
                     HMSAERTRIALLTYIFLDSNSGDLINYYTFSKYLTRFPKGERESVTFQELRQGLIALI
                     REYVDKSAGEVQHTWQSLTHEVMANHSVRTAYSTYAVDNFSLSSVAGSKAIQLQEEAS
                     RRWIAWLQLENCAPAQEEVAAPAAEMPVLSYEHPVEPKSFDDLPVAGENCLDRSSNSG
                     TVHRRTCATRFI"
     gene            <7764..>8228
                     /locus_tag="HG536_0H00120"
                     /db_xref="GeneID:59327904"
     mRNA            <7764..>8228
                     /locus_tag="HG536_0H00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285416.1"
                     /db_xref="GeneID:59327904"
     CDS             7764..8228
                     /locus_tag="HG536_0H00120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141312.1"
                     /db_xref="GeneID:59327904"
                     /translation="MFSAGVLSLLFLVVAELSLSVSGQGVTYGDVLHNILTGNITNYE
                     DSFGVIEYYSEQPFSATANISIASIDNAEVLNGTIQLYEWATFGQKWGDAVFLNLFMK
                     YNGQANNYLESDDLKRDLIKLADGNDTLFRIWAESSSDEDLSNLYQSLHKGE"
     gene            complement(<8680..>10368)
                     /locus_tag="HG536_0H00130"
                     /db_xref="GeneID:59327905"
     mRNA            complement(<8680..>10368)
                     /locus_tag="HG536_0H00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285417.1"
                     /db_xref="GeneID:59327905"
     CDS             complement(8680..10368)
                     /locus_tag="HG536_0H00130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141313.1"
                     /db_xref="GeneID:59327905"
                     /translation="MPIEQNQVDNTKEQVKELYKNGIYYRELVAGKAPEIVVENLDLS
                     FDGKTLFTDLNFTLSCGDKVTIVGENGSGKTTFLKLLSGFEEYPYSGSIEIEGRLGFL
                     PQHFEEVDGDDLAINLVLRSLCDYEVDHFLESGLEPFSHEWLQELSSLGGHEIFKQSS
                     LIGLGDEILKRPFKSLSGGEKTKSLLCALSILEPDFILLDEPTNHLDKKGIEWLESFL
                     KRYTGGVIIVTHDRSLINSVSSMISELSPHSKRFAHFRGGYKNYLEEEDKKRRRLIEQ
                     RRFQDKELKKLKSKVQQAQSKVRARIIRSGSDRDKLSYDNREQRAQKGTTGLVNLLTE
                     KAEYLNESLVEVIPERLQLSFDFDELPAFSFLLGITVEGISKSYEKLLFSNLSFTLIK
                     GERLVIQGPNGCGKTTLNQILLGLTEPDHGTVSISGNAVVGYLDQEQENLPLDKSPLK
                     LLEEDNSINASKQTAIRNLRDFGIYKWHDLKSPLKELSVGCRRKAQLCQIIMRKCSIL
                     VLDEPTNHIDFPSLEVIEDALLTFPGIIIATTHDRYFTEKVATRVIDLSSYSSE"
     gene            <13029..>13952
                     /locus_tag="HG536_0H00140"
                     /db_xref="GeneID:59327906"
     mRNA            <13029..>13952
                     /locus_tag="HG536_0H00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285418.1"
                     /db_xref="GeneID:59327906"
     CDS             13029..13952
                     /locus_tag="HG536_0H00140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141314.1"
                     /db_xref="GeneID:59327906"
                     /translation="MAEVENQRPKISPSEGSENGMTETEAERPGMPSGGPSKKSYRLF
                     PYQPKQPVFRIGSESVRGHCVAAFGEFCGTFMFLWCAYVIADVANHDVFLKEFPNGSH
                     PGQLIMIALGFGFSVMFSIWCFAVVSGGALNPAVSLSLALARAINPTRCVVHWIAQML
                     GGMAAGGAASAMTPGPVLFANSLGLGCSRSRGLFLEMFGTTILCFTVLMTAIESRDGS
                     FMAALPIGISLFIAHLALTAYTGTGVNPARTFGAALAARSFPTYHWIYWIGPLLGSIL
                     AWFLWQLLNWLNYQDVVACEKRKGKEEEPSA"
     gene            <16758..>18659
                     /locus_tag="HG536_0H00150"
                     /db_xref="GeneID:59327907"
     mRNA            <16758..>18659
                     /locus_tag="HG536_0H00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285419.1"
                     /db_xref="GeneID:59327907"
     CDS             16758..18659
                     /locus_tag="HG536_0H00150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141315.1"
                     /db_xref="GeneID:59327907"
                     /translation="MLSGDHCSVEPGSSERSKKKYDEDLEPRNFIDHSGAPSSIESDA
                     YAYESASIGSGKKYIKGSGTVNIEIYKREYSRPLYKMMLFFSIFLVAYTYSLDGLVRF
                     TYQYQATSEWKNKSSLKVVKCVKTVLCTAGQLGIARSADIFGRTTVLNMSILLYIVGT
                     LVQCKASNISMFGAGTCLYQLGFVGVQLTLQLIAMDFSDLNWRLVASFVPAWPFVINI
                     WISGYITQAIGQRWSWGIGMFAFIIPCACVPLGFCLLHMRYLAYKNAQGKVQNEFKMY
                     KQLTLREYLVDIFFWRLDFIGFILLCVFFGCILIPLLLGGGTSSHWKEVHIIVPEVLG
                     WVAALPAFLAWEAKVAKHPLLTWEIIGDRGIIAALMIAFYINFNWHLFGDYMFTVFLI
                     ALDQSVLSATRITSLYSFVCIISGTLLGFVIVKARRTKPFIIFGISCWFLAFGLLVHF
                     FGKKLSMPGISVSLGIMGLGAGFFTYTTQASVQAAVKTHAKMAVATALYLSVYSLGSA
                     VGSAVTGAIWTNVLSREVYKTLNHTDADAAYNSPNLFILTNAYGTEPRRGLVTAYAYT
                     QKILCIVGLCFCVPLFLAALFLRNHKLESTVALENVDARTVEEDEKRHDIISKIKRRR
                     HEESGNLPR"
     gene            <20330..>22054
                     /locus_tag="HG536_0H00160"
                     /db_xref="GeneID:59327908"
     mRNA            <20330..>22054
                     /locus_tag="HG536_0H00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285420.1"
                     /db_xref="GeneID:59327908"
     CDS             20330..22054
                     /locus_tag="HG536_0H00160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141316.1"
                     /db_xref="GeneID:59327908"
                     /translation="MVFVHIPRRKKNILGGIFIVVCLYWVLLQRALFKDRLTNGVNHF
                     CLQSLERLEERPVKWPTIPEPNGRIGDDVIETLLDLRDYEKCVMFNPALDYDRLKIVQ
                     KGLFPYLNLDLLYADEKKFWPVYSRWDGQSVQGFMPRFSEDENKFLGFSKIKYDQRLS
                     FWGNWHRNIMQPASRGIVISAGAGQVEDCARLVKVLRHLGNRLPIEIVHRGDLSVDEQ
                     RQIFQISTEEASSHFPAQDLWFLDVSSMLNPVYAKRFKSFSNKWLAVVFSTFQNPVLL
                     DADTIPFTSLDLYYNFHQFKTTGAVFFKDRKVNSDLLDKEQLDTLKRIFLNLTDITPI
                     ENESTESMKDKLKASFNDDIAAETVYNMIVKGQKHHMESGLVLIDKTQHLTNLLASIA
                     LQFSSVSGYFHGDKEWFWIAQALQKQSFTLHPKEASNVGKLGRVVSDEKGEFYQLCSV
                     QLSHTDVDGSLLWVNGGLRTCKKDSWTSDYRDNRRISSMFDSEEAVREYYQSPVQLEA
                     AIIPDAEIKPWIMTGECAMFTYCTLYREGEFGEVIKFNETQKNAYREIVRVWNSVIHS
                     TEGPSSVI"
     gene            complement(<22375..>23976)
                     /locus_tag="HG536_0H00170"
                     /db_xref="GeneID:59327909"
     mRNA            complement(<22375..>23976)
                     /locus_tag="HG536_0H00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285421.1"
                     /db_xref="GeneID:59327909"
     CDS             complement(22375..23976)
                     /locus_tag="HG536_0H00170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141317.1"
                     /db_xref="GeneID:59327909"
                     /translation="MKIASMMKETILGENSSDTKEKNFITIGPPVDEDEGSLEEITSF
                     AGVDKKHAVGAEFINELFDTDFDADLDYAKLRRKIDTWLLPVLCVTYMLQFLDKLSLN
                     YASAYNLKEDLHLKGNEYGDIAAIFNAGYMVGTIPGNWLIQRVPVAKFTGCTLLVWSI
                     LLVAHIGARNYSDMMALRFLLGIMEATISPSNMMMCGMFYNKQEQPFRMCTFLSMNGI
                     ATMVGALLSYGLGHCTNSSLAPWKLIFLVIGLINFAWALIFLYLAPDSPTNARFLSHE
                     EKLKVINRVSKNQMGIKDTKFKFSQALEAQKDLNCWILALIGLGCGVINGGTSNFISS
                     LIKGFGFSGLNATVLQLPTGAIEFVCVFTAGMLAITSKKNIRTILLFMLCTPTLAGLI
                     GIHLIPLEHKWALVGCCWLLYIIGGPIIMCWILINATVAGSSKITTVKISWFLCYTAG
                     NICGSKIMYPDEAPKYISGMKGLISSYAGIMFLSIVYYVMMYYRNKTRDMKYGKLTPE
                     DVKEGVINGFKDLTDFENAYFRYSY"
     gene            26265..26350
                     /locus_tag="HG536_0Htrna4Y"
                     /db_xref="GeneID:59328400"
     tRNA            join(26265..26304,26314..26350)
                     /locus_tag="HG536_0Htrna4Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:59328400"
     gene            <26533..>28290
                     /locus_tag="HG536_0H00180"
                     /db_xref="GeneID:59327910"
     mRNA            <26533..>28290
                     /locus_tag="HG536_0H00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285422.1"
                     /db_xref="GeneID:59327910"
     CDS             26533..28290
                     /locus_tag="HG536_0H00180"
                     /inference="similar to AA sequence:RefSeq:NP_014011.1"
                     /note="ancestral locus Anc_8.849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141318.1"
                     /db_xref="GeneID:59327910"
                     /translation="MSDYDIAPNDQDTRTKGYRKYDIHEGIIFCIELSESMFSELEEL
                     NYKVQLVEILETLDQLMSQLVITRPSTGIGCYFYNCARSGTKDGIFSLFSLRDINARN
                     MKKLSDLLEDLQYGRTSLRQFFSFDIQKRTPLESLLELVRDEFVRDIPDQKAFNNKKI
                     FLFTDNDSPPEASDPAAKSRLRYLVNDLDDRFINFTTFFIGSETRPFDNSFYSDILRL
                     GASTKANTEYDGPNTTPISATFIKSRVLRKQEIKRIMFQCPLILDEPSKLIVGAKGYT
                     IISHEKSGVRYKLVYENEEVRQEASSHRKYLNAKTGEETKEGLTKVFPYGDLEINLSD
                     KEFNEMKKDYAEDESFLKVIGFKTTESSLHYYNNIEKAVFVVPDETRYEGSIKTLSFL
                     FINLKRKGKVAIVWGKLKSNSNPAIFILSPSDDLSPNEGFYLFRVPFLDELRRFPHVL
                     GNPSILSDDYENLKEVTAKIVGYFNLKTGYEPSEFKNPSLQKYFKVLHDYLLQVEEEP
                     EKDDEEWHKLKMLEEDDSLRKISQIRDKIMESNASDDPQMQRLSKYMKIWNSLYHRIY
                     EQCTVEDAPKIKRKKTINL"
     gene            complement(<28307..>29827)
                     /locus_tag="HG536_0H00190"
                     /db_xref="GeneID:59327911"
     mRNA            complement(<28307..>29827)
                     /locus_tag="HG536_0H00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285423.1"
                     /db_xref="GeneID:59327911"
     CDS             complement(28307..29827)
                     /locus_tag="HG536_0H00190"
                     /inference="similar to AA sequence:RefSeq:NP_013588.1"
                     /note="ancestral locus Anc_8.850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141319.1"
                     /db_xref="GeneID:59327911"
                     /translation="MTDTASDRQCGVSLELGNAVLDQKSENDEVAKKQGKKDKGKRRN
                     RKEEMSPEHVAKVRAEREAARKAKREALIAKGMDPDYPPELQFIRRPMLTLHDGEPTK
                     GFTFRLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLRHEFEVYRPDVLCLQEIDYI
                     QYQQFWKEELGKLGYDTQFYKQPTKNHGVSIAWQRDLFQMTDRMLIDFDNERSGNIKR
                     RTLTHNSGLILSLRFTDKVKQKYPHNTKCGILIGTSHLFWHPFGTYERTRQCYVVLNK
                     VKEFMKRVNVLQNGNDGNLTQWVPLFCGDFNSQPFDTPYLSMTSKPVEYKGRARTVIE
                     CSTSYTFSKLRNGEEEADDEEGGNIEKFGKDQPQTPVPETFTANAEQSRLVHEMQSLH
                     NSLDMRAISLYSVAYNKVHPDNAGLDNKRGEPEMSNWANTWRGLLDYLFLITQWDSDD
                     RRSVDPLDVFEKENSIKIRGLLRMPPSSEMPHHGQPHEGEYASDHLSMMCELEISP"
     gene            <30246..>30506
                     /locus_tag="HG536_0H00200"
                     /db_xref="GeneID:59327912"
     mRNA            <30246..>30506
                     /locus_tag="HG536_0H00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285424.1"
                     /db_xref="GeneID:59327912"
     CDS             30246..30506
                     /locus_tag="HG536_0H00200"
                     /inference="similar to AA sequence:RefSeq:NP_014013.1"
                     /note="ancestral locus Anc_8.851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141320.1"
                     /db_xref="GeneID:59327912"
                     /translation="MVFYKITLSRSLIGVPHTTRSIVKSLGLGKTGSVVYQRVTPSCA
                     GALAKVKELVKVEVTEQKLSKQAQRELRKSNPGFTVEKRPTA"
     gene            complement(<30575..>31546)
                     /locus_tag="HG536_0H00210"
                     /db_xref="GeneID:59327913"
     mRNA            complement(<30575..>31546)
                     /locus_tag="HG536_0H00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285425.1"
                     /db_xref="GeneID:59327913"
     CDS             complement(30575..31546)
                     /locus_tag="HG536_0H00210"
                     /inference="similar to AA sequence:RefSeq:NP_013587.1"
                     /note="ancestral locus Anc_8.852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141321.1"
                     /db_xref="GeneID:59327913"
                     /translation="MPYRGAEEPRHSFKSKISSPTKRTLNNKNYLAEDATPVLDYTGC
                     LGQDLTDNLRISPGSKSPYAKAGEPMLQPEPPYFIQNYRMAYTPGHRASQQPPRTVQT
                     SNRTSPGKSAKAANAKAKNVRCKEKQDASMVPFLNKAQKQRAIANRYFSPPVDLQKRK
                     RAEGKLRPLIDVAYSSGQNSTNYRNYKLFSPVMLGDKRYHVVSKEIENIYRREYCKAQ
                     PLYRFGDKDISYNSLQEMTAGLTEYLRDIKTPAAAGGGRTLATGSSWNESFELSFDGK
                     AIDRSDIFRIVDSFSVALSDDDPEEESNRDGLPSTNVLPAEMSSPAF"
     gene            complement(<31783..>34557)
                     /locus_tag="HG536_0H00220"
                     /db_xref="GeneID:59327914"
     mRNA            complement(<31783..>34557)
                     /locus_tag="HG536_0H00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285426.1"
                     /db_xref="GeneID:59327914"
     CDS             complement(31783..34557)
                     /locus_tag="HG536_0H00220"
                     /inference="similar to AA sequence:RefSeq:NP_014014.1"
                     /note="ancestral locus Anc_8.853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141322.1"
                     /db_xref="GeneID:59327914"
                     /translation="MVPGRWLARALHGSGARLRSAARRPAARYGTRDELEVPPLPSTS
                     SVPDAQAISEQFLARTGDLEPGMEVKELPQIRREFGSRYEARYSKPSRAWLQRCWRGR
                     DEHPEGSAAAARLTPGALMRRPLAVGDLVLLRAHAAELCMCVDVPVSTRDPRYTFATV
                     DGSLRFGSRSAVLLRIPRELPAELSRPATLLVREAKHGFEPVGTIKNRADETLLLPVA
                     ARRLVTSGAAEQISQSAWAQLPIALKKLELLHRRLQDAAGPQALPFFNLVLMVQSLEL
                     SRAVGSADGDRYVERVIAESVATSRSEMDASCLLACYWGLEAQQKSHLWGDITMSRAL
                     LSPVAVTVLPFESQHLFYARLKEELKADGHVKINEFARLANGGRYRELADSFPQIIQL
                     FKDYAAGNLQSNETAVSLIANIFRKIREFAEGDITRDRCEQLLSRTLVEDVVENPIHC
                     NFALALPGSSPRSQVNETVYELAKPVEQKEAAVERFDFGDLPVYCIDAEDAHEIDDGV
                     SIEDAGKGRFTLHVHIADPTALFPESGLNEESGIRDEILKMAFERAFTTYLPDIVVPM
                     LPRAYCEAGDLGKQGRKTKCVTFSVDVKVSGERIEVLYETYKIRLGLISNFPKVTYEV
                     VDQYLEDAGKGKAVTPLVRDLQKMHRISGLLRKSRIFNDDAVVFGSGFNQGLVALSPV
                     DREISFFDQKETASTLLVSELMILANTLAGRYFAENNIPGVFRCYQTLSMRDQAEREY
                     ENMKRKVKKGILPTTKDINMLSSLLNSSFYSEYPAAHSMIGAKQYLTVTSPLRRFPDI
                     INHLQIQKVLRGLPLCFTQKEVSRLLWHIQYRDAVLKSAASHQASYWTLKYIKKLIQD
                     SPDMKFSVNITSVSQFNMVQCALSDFPSARGTLKLKPGATTVPAIGDTVKNCKVGKID
                     CLDGLLELEL"
     gene            <35003..>36589
                     /locus_tag="HG536_0H00230"
                     /db_xref="GeneID:59327915"
     mRNA            <35003..>36589
                     /locus_tag="HG536_0H00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285427.1"
                     /db_xref="GeneID:59327915"
     CDS             35003..36589
                     /locus_tag="HG536_0H00230"
                     /inference="similar to AA sequence:RefSeq:NP_013586.1"
                     /note="ancestral locus Anc_8.854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141323.1"
                     /db_xref="GeneID:59327915"
                     /translation="MLSHLSKNKKVLLAGSRLARMASTGAVSSGAAAPAGSSHPQTTS
                     VEKAGTGPASFKTAKVIETNHDDKPNVVILGSGWGAISFLKHIDTKKYNVSIVSPRNY
                     FLFTPLLPSTPVGTVDEKSIIEPVVNFALKKKGNVTYYEAEATSINPDRNTVTIKTIS
                     TVQQLTKQEQFLGISQEDAAEIKYNYLITAVGAEPNTFGVPGVEEYGHFLKEIPHSLQ
                     IREKFAKNLEKANLLPKGSPERKRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPS
                     LAEEVQIHLVEALPIVLNMFEKKLSSYAQKVLTDSTMKLHLRTAVGKVEKDHLIAKTK
                     HEDGSVTEQTIPYGTLIWATGNKARPIVTDLFKKIPEQNSCTRALAVNQFLQVKGSNN
                     IFAVGDNAFAGLPPTAQVAHQQAEYLARSFDKMAQLPGFHEKLAQRKEKADVLFEENG
                     FKSFNYIHYGALAYLGAEKAIANISYGKRSLYTGGGLITFYIWRVLYLSMILSARSRF
                     KVITDWMKLAFFKRDFFKDL"
     gene            complement(<36842..>37741)
                     /locus_tag="HG536_0H00240"
                     /db_xref="GeneID:59327916"
     mRNA            complement(<36842..>37741)
                     /locus_tag="HG536_0H00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285428.1"
                     /db_xref="GeneID:59327916"
     CDS             complement(36842..37741)
                     /locus_tag="HG536_0H00240"
                     /inference="similar to AA sequence:RefSeq:NP_013585.1"
                     /note="ancestral locus Anc_8.855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141324.1"
                     /db_xref="GeneID:59327916"
                     /translation="MATNNRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDV
                     EHSHRRFLGNMTLNLWDCGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESQEVMKDI
                     EIFTRALKQLKHYSPDAKIFVLLHKMDLVQLDKREELFQLMMRKLQETSAEYGFPNLV
                     GFPTSIWDESLYKAWSQIVCSLIPNMATYQANLKELKSVMDACEIILFERSTFLVICS
                     SNAANGERLDPKRFEKISNIMKNFKQSCTKLKSGFRTLVINENIYVSELSSNMVCFIV
                     LNTSDDCQQMVLENIKKAKQFFQ"
     gene            <37909..>38529
                     /locus_tag="HG536_0H00250"
                     /db_xref="GeneID:59327917"
     mRNA            <37909..>38529
                     /locus_tag="HG536_0H00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285429.1"
                     /db_xref="GeneID:59327917"
     CDS             37909..38529
                     /locus_tag="HG536_0H00250"
                     /inference="similar to AA sequence:RefSeq:NP_012059.3"
                     /note="ancestral locus Anc_8.856"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141325.1"
                     /db_xref="GeneID:59327917"
                     /translation="MKAMSFVALSRPFRAFAVCYKLSRRYLTTCITGIGNPEPKYSNT
                     RHNAGLVLLDLLKNHLAGRERTYKPCSNAAAKYLPISSGLILIRADGNFINLSGKTVL
                     PLWRKLPQDKTVHIVAHDELSLPLGKVQLRKPGTSLRGHNGLKSIYDQLGNGNFYRLA
                     VGIGRPTERDPAIVSEYVLTKFTPAELDVLASESLNKALERLKGYI"
     gene            <39155..>40483
                     /locus_tag="HG536_0H00260"
                     /db_xref="GeneID:59327918"
     mRNA            <39155..>40483
                     /locus_tag="HG536_0H00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285430.1"
                     /db_xref="GeneID:59327918"
     CDS             39155..40483
                     /locus_tag="HG536_0H00260"
                     /inference="similar to AA sequence:RefSeq:NP_012060.1"
                     /note="ancestral locus Anc_8.857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141326.1"
                     /db_xref="GeneID:59327918"
                     /translation="MGKVTQLLAHPVELKAALTLKFIRQPLYAADDTKATPELRRCYE
                     LLGRTSRSFAAVIMELHPELRNVVMLFYLVLRALDTVEDDMTLEPSVKVKLLREFDSK
                     LDTKDWSFDGNGPNEKDRVVLVEFPCILHEYHQLKPAYQRIIKEITKKMGNGMADYIQ
                     DEQFNLNGVQTVKDYDLYCHYVAGLVGDGLTQMIVYANFGTSDLYSENEQLYESMGLF
                     LQKTNIIRDYAEDLEDGRSFWPKEIWSQYADKLVDFSKPQHTQKGVQCINALVLNALG
                     HVIDVLIYLSSLHEQSAFQFCAIPQVMAIATLALVCNNPDVLHTNVKIRKGTTCYLIL
                     KSRTLRGCVEIFQYYLRDIKSRIPVEDPNYLKINIQVAKIEQFIEEMYQNQLPPGVKP
                     RETAAYLKTLQRSKCDKLVLATEREEQLKFNMFYSAVCALGLALLFFYYK"
     gene            <41118..>42863
                     /locus_tag="HG536_0H00270"
                     /db_xref="GeneID:59327919"
     mRNA            <41118..>42863
                     /locus_tag="HG536_0H00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285431.1"
                     /db_xref="GeneID:59327919"
     CDS             41118..42863
                     /locus_tag="HG536_0H00270"
                     /inference="similar to AA sequence:RefSeq:NP_013583.1"
                     /note="ancestral locus Anc_8.858"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141327.1"
                     /db_xref="GeneID:59327919"
                     /translation="MSEMKDGEIHHEVREKNITKGGNAAFHNFINDFAHIEDPLERRR
                     LALKKIDDASFGWYHVRAILVAGVGFLTDSYDIFAINLGIAMLTYVFWEGNMPSSTNT
                     LLKVSTSVGTVIGQLGFGLMGDIIGRKKVYGIELIIMISATILQCTAGHSPGVSFVAV
                     LTFYRIIMGIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAFGQLAAGIIALILV
                     AAYKSELVNVKNGKQCGPSCQKACDQMWRILIGLGAVPGAIALYFRLTIPESPRYSLD
                     INADLSKGTADIGKFVSGEYGDAEADQIQRLERAPTAVEAVDIQPPKASFKDFCTHFG
                     KWKYGKILLGTAGSWFCLDVAFYGLGLNTAVILQTIGYAGSENIYKKLYNTAVGNLIL
                     ICAGSLPGYWVSVFTMDIIGRKPIQLFGFFILTVLFCVIGFAYHKLSDGGLLGLYIVC
                     QFFQNFGPNTTTFVVPGECFPTRYRSTAHGISAASGKVGAIIAQTALGTLINHNCAKD
                     GKKQNCWLPHVMEIFALFMLVGLFLSFLIPETKRMTLEEVSEKYHDEIDPSAYRGAVA
                     GSNQTSADSTELEHV"
     gene            <44141..>44872
                     /locus_tag="HG536_0H00280"
                     /db_xref="GeneID:59327920"
     mRNA            <44141..>44872
                     /locus_tag="HG536_0H00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285432.1"
                     /db_xref="GeneID:59327920"
     CDS             44141..44872
                     /locus_tag="HG536_0H00280"
                     /inference="similar to AA sequence:RefSeq:NP_013582.1"
                     /note="ancestral locus Anc_8.859"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141328.1"
                     /db_xref="GeneID:59327920"
                     /translation="MVDNEAIYDMCKKNLDISRPSFANLNNLIAQVVSSVTASLRFDG
                     SLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKNKAYHEANSVSEITNACFEPGNQMVK
                     CDPRTGKYMATCLLYRGDVVTRDVQTAVAQVKNKKTVQMVDWCPTGFKIGICYEPPTA
                     TPTSQLTSVKRAVCMLSNTTAIADAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTE
                     AREDLAALERDYIEVGADSYADEEF"
     gene            <45131..>45613
                     /locus_tag="HG536_0H00290"
                     /db_xref="GeneID:59327921"
     mRNA            <45131..>45613
                     /locus_tag="HG536_0H00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285433.1"
                     /db_xref="GeneID:59327921"
     CDS             45131..45613
                     /locus_tag="HG536_0H00290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141329.1"
                     /db_xref="GeneID:59327921"
                     /translation="MTKHYFTVIFFFFLSFCIIEARISGLEEALLHYLEMPCEDAAQS
                     LRRSTDFIAYVYSLATTRNGCKVTTAGTLQALRVKTAKTLTSQHKSAISILLSNRQLD
                     FIGIFLRCFFSDKIRGWHRDITKMKKFGEVDLQPEVQFHPLKVLVCLVQNCVPDRRLE
                     "
     gene            <45618..>47213
                     /locus_tag="HG536_0H00300"
                     /db_xref="GeneID:59327922"
     mRNA            <45618..>47213
                     /locus_tag="HG536_0H00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285434.1"
                     /db_xref="GeneID:59327922"
     CDS             45618..47213
                     /locus_tag="HG536_0H00300"
                     /inference="similar to AA sequence:RefSeq:NP_013624.1"
                     /note="ancestral locus Anc_8.861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141330.1"
                     /db_xref="GeneID:59327922"
                     /translation="METMSFPKSLSVPPRRNFAFRNWAGIYSSRAQLYFQPTSVQEVV
                     EIVNEARRQKKTVVTIGSGHSPSDMCMTKEWLVNLDKLNQVHEFKEFPEDHYADVTVD
                     AGMRVYQLSELVGARGYAIQNLGSISEQSVAGIISTGTHGSSPYHGLVSSQYVNLTIV
                     NGKGEVVFLDAENEPEIFRAAMLSLGKIGIIVRATIRVVPAFHIKSTQEVIDFDTVLS
                     RWNSLWTSSEFIRVWWYPYSRKCILWRGVKTEDPLTAPRRSWWGTSMGRLFYESLLWF
                     TVKVYPPLTPVVERFVFRMQYGDVQLGGGDIEVANSIDSLNMDCLFSQFVDEWACPLE
                     NGLEVLRSLDHFVGQAAQNKDYYVHVPVEIRCSNTTLPPQVLDTKDRTSVSPGPVYGN
                     VLRPYLDNTPRREYEPLADVTNSQLTLYINATMYRPFRSNTPIRKWYTIFEETMAAAG
                     GKPHWAKNFLGSTSLVPHPEKKESDYADHEMRGMAKRFQECYGDDLRAFRKVRREQDP
                     ENVFVSNREWSLRNGIVEAEELD"
     gene            <47367..>48302
                     /locus_tag="HG536_0H00310"
                     /db_xref="GeneID:59327923"
     mRNA            <47367..>48302
                     /locus_tag="HG536_0H00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285435.1"
                     /db_xref="GeneID:59327923"
     CDS             47367..48302
                     /locus_tag="HG536_0H00310"
                     /inference="similar to AA sequence:RefSeq:NP_013581.1"
                     /note="ancestral locus Anc_8.862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141331.1"
                     /db_xref="GeneID:59327923"
                     /translation="MSVQKEEPNILDNPLHGIFIPSGLLLLGIAVTTYQSGEKRLLLV
                     IPLALAFLLHRAYGAHKRRVSITPDKWSALELEDQTVVSKNTAIYRFKLKTSFETLDL
                     PPGRHLAVKIPIDGADEIRFYTPISPRFAQGYFDLLVKSYADGKVSKYFAGLRQGQTV
                     EFRGPVGTFNYEANTTKVIGIVAGGSGITPILQVLNEVITVPEDLTKISLIYANETPN
                     DILLKDELDEMAEKYPNFEVHYTVRKPNDKWEGPIGQVTEEMMRACLPGPAEDHRLLI
                     CGPEGMNKAVTQYAVNLGWKFSGQDCKGDDQVFVF"
     gene            complement(<48391..>50346)
                     /locus_tag="HG536_0H00320"
                     /db_xref="GeneID:59327924"
     mRNA            complement(<48391..>50346)
                     /locus_tag="HG536_0H00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285436.1"
                     /db_xref="GeneID:59327924"
     CDS             complement(48391..50346)
                     /locus_tag="HG536_0H00320"
                     /inference="similar to AA sequence:RefSeq:NP_013622.1"
                     /note="ancestral locus Anc_8.863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141332.1"
                     /db_xref="GeneID:59327924"
                     /translation="MVYLERQHTGEGSEQDFSGRQSENRLCLVALPPEVLINIFSHVD
                     EKDLYVLQQVCSYFSCLINDEELWKNLFVSKIHTSFFPSFAQSHKYSVEYMERVRGLK
                     QWKHNRAIKTKYVLSPSPRFQAQIEKLIFDYPRCACYNDGIITLVQLHSRRKKDRLIY
                     IPCTTPQGCSTMSFNINAAVFGRFDGRVFGKLLSNKSYLTPVTEFDARHSSCVTAITT
                     SVSQDSLEDWCVSGSESGDLIWWCETHMVNSLKISSKVILQVALYKNWTVALDIEKVY
                     VIRDMKDIYKITLPKVKNSDGMDMTIQVQFQKVDFGSMSLVIADTRHIFVISLNPEGD
                     FGRWRSMFVSEGISNLEIDAGTSRREQNKNLAGQDGCYVAIMTVENSIKILNIRAPGN
                     NLKVENDLRFDEHIFTCQISNLVLVCALSGQLQIFDAAGATLIKTVQKTDKYPQLLAI
                     SQGKMVIGSGNVIHFLEYTPDASYGKKRRGSGLRGHSNKWERRVDAELALYDEEESLR
                     RKKAVEHERLLETYGGDLSDDELQLRIALMESETSNEPGPGSTRENDEDADLKRAIEE
                     SQRMHQNQRFLETFADEEDDEFLEALERSSTEQRQVQGRSLSRRTPRIMDGGRNDTGS
                     NETYQPHVPDDDEALQLALALSLSEMR"
     gene            <51142..>52527
                     /locus_tag="HG536_0H00330"
                     /db_xref="GeneID:59327925"
     mRNA            <51142..>52527
                     /locus_tag="HG536_0H00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285437.1"
                     /db_xref="GeneID:59327925"
     CDS             51142..52527
                     /locus_tag="HG536_0H00330"
                     /inference="similar to AA sequence:RefSeq:NP_013580.1"
                     /note="ancestral locus Anc_8.864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141333.1"
                     /db_xref="GeneID:59327925"
                     /translation="MTETKKQKTLYHPARPQNIGIKGIEVYIPSQCVNQADLEAYDGV
                     SPGKYTIGLGQTNMGFVNDREDIASMCLTVCSRLLKNYDIDPRSIGRLEVGTETLIDK
                     SKSIKSVLMQLFEGNNDLEGVDTLNACYGGTNALFSSLNWIESSAWDGRDAIVVCGDI
                     AIYDKGAARPTGGAGTVALWIGPDAPLVFDPVRGSYMENAYDFYKPDFNSEYPYVDGH
                     FSLACYVKALDQVYKNYSRKAIAKGLAREPAGPEAVNVAKFFDYNVFHVPTCKLVNKS
                     YGRLLYNDFRADNSLYPQVDSQLASVDYEKSIADKNIEKTFMGVSKELQKERVAPSLI
                     VPTNTGNMYTGSLYAALASLLFFVGSDNLQGKRIGLFSYGSGLAASLFSCKVVGDLTK
                     ITDVLDLQNKLDSRKTESPEDYEKAIHLREEAHLKKDFLPQGSIELLQSGTYYLEKID
                     DRFRRTYSIKN"
     gene            <53115..>56774
                     /locus_tag="HG536_0H00340"
                     /db_xref="GeneID:59327926"
     mRNA            <53115..>56774
                     /locus_tag="HG536_0H00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285438.1"
                     /db_xref="GeneID:59327926"
     CDS             53115..56774
                     /locus_tag="HG536_0H00340"
                     /inference="similar to AA sequence:RefSeq:NP_013619.1"
                     /note="ancestral locus Anc_8.865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141334.1"
                     /db_xref="GeneID:59327926"
                     /translation="MAFKSFKYKFYSKGYHSAAQKSSTSFFDSSYQYLRQNQGLVNLD
                     TAIPQSNVPHLSPFPVLGANVNFNIVDDILLQDAEVVITEDVSDSHDCDEQQALSRRR
                     SNSIALAGNCASAGAMMRRKSMGELGRPLFPPMQKDVVIDQALFRRYYSNASPTVSGT
                     TLVQKPKQAAIAPSTVDVAAREEVKTPWEEDTEPCLNVETFLNTHITEINRCYEKGDF
                     NMINSLYQALKRNGIVPPLETYSKVLESLSRRDLDKDDLDYKMSELLTCYQDMIVNKL
                     KPSDEIYNTVLGCLFRGSILAFRTRNPNGADFYKIASELFQAIDTQHRHHQFSKSVLD
                     HALLAMNLYPGHISLKTAQEIVHSSPLYRKDSFYYLAFFSYARLTNDKAAIKELYDEY
                     RNALVSDQSLQHDEFEVYSMVISAFVETGELELAIKMLDRIIIEVREQNGLASNVSLI
                     LTNFLISVSKIDSEKAYKLWLKFHKMKWIPEFSYEFYLVLMANSFHDWKLTKKIYDCV
                     FPMKPVFRNETNKLSDFLLYPMGVESVISSLLDYALQLKDNEVIMKVLEESVIKGFRV
                     NSAVYPFIFSYLKEIRCPDDYLLRFVQSHGATLKNEGAVTDSFEFLNALIEHFPSQVI
                     LKKVVEMDFFADLCRNLNIADSKCVNYGGLVGCMTSFWASPQTIDKYAYNLEIHSILL
                     IRLLDFEAYCAIMGNEMLIDFRDKVVERFRKLTTNYRRLNLDPNKAPGVVSQVVKMID
                     LPEDVVSFYTHPGDWDKSYPLALGSAIRNSSRTGVKEFRRLQHEGYCFDYDTYKELIK
                     QRTVDTEIASKALELCPNQKEMKYLANLMVSKCSAELLNDTILGHHSFQKKMLPSLTD
                     ESLLRLAKYAPRIQEWMKAVDFPGRFKSIAVQAEFKSSIQFAYERLYHQKSYLEIQQC
                     NKICPVLDVEILLKSCIRSGEFELYRKIFDKYKGTLGSMALDIQSEFLINNLKVDEAV
                     NLIKSASIRTPHKTLDLYTFGLFLQSFSKNITYYENPENTLQLANILSSHSSFSGMLA
                     FYDVVSHSDIFNFSNEISFAVKNEVLEQMLNNLHDALSLVDVSKTEVIKTFYKKLQNY
                     FRFRAFLKMPHLARNDISQLLKIWAKTDAYYVDTFFNNMVETIYLNPGGRCLYLECDM
                     TFHFKPDDIFELNLQLEDFYSTEKDEENVLKVRKFKDLVEKLYNKNTNENSGGSKLLE
                     SPDRSPREISKASVQ"
     gene            complement(<56899..>58671)
                     /locus_tag="HG536_0H00350"
                     /db_xref="GeneID:59327927"
     mRNA            complement(<56899..>58671)
                     /locus_tag="HG536_0H00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285439.1"
                     /db_xref="GeneID:59327927"
     CDS             complement(56899..58671)
                     /locus_tag="HG536_0H00350"
                     /inference="similar to AA sequence:RefSeq:NP_013579.1"
                     /note="ancestral locus Anc_8.866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141335.1"
                     /db_xref="GeneID:59327927"
                     /translation="MSAFSANSPTPGGVDSPISGAGAPGDEFRNGEEEASNGNMFMNL
                     LPIPIKVSRDQSSGMTTAATTKSLQYSLGNLAVFQNLPRETSRGVDDLTRMKMAIMSG
                     IPEEVKWALKKYLAYSNKAPYMISLKDLPELLPLFKKFIRDLEPLIERFDEPLMGDSE
                     ALDYLQTGLNSILILRNLAQDSESVQVLVSDKYIKELVLHVLQKFELVATADPNWQVF
                     ESNASFFNELTHYVLDIMEAISSYIAPAKKDDMYFQTLLSLFNYTKDRYMVISILRSL
                     SRLLVRSAADEESAADNLDQQTLSKIVSFLIIECDSELMTAALDFLYQYILPGSQRIA
                     LLLGDSHRFSILTAILPKLLTYNINKPDYSILDKTPIKLIKRLRPPAPTVAPDLDKEL
                     FEQILAMNEPMRSTTWLKCCFEPVVDAEFTQINLWRAYESKFAQPVRESGRKLLPAVE
                     FIKNVSNAFSEASAMVITDSSTGKKRFVMKGIQPRPKPLRIPEAEVAAKHPLPPLQSK
                     FLNNATNIVPARQEQLPEVRFPAKLSEVSKAATTFLCLLSNEPEGPGSEFCKVIKPVV
                     LHKLADVPPLSCALSEYMDNTPGL"
     gene            <59224..>60735
                     /locus_tag="HG536_0H00360"
                     /db_xref="GeneID:59327928"
     mRNA            <59224..>60735
                     /locus_tag="HG536_0H00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285440.1"
                     /db_xref="GeneID:59327928"
     CDS             59224..60735
                     /locus_tag="HG536_0H00360"
                     /inference="similar to AA sequence:RefSeq:NP_013578.1"
                     /note="ancestral locus Anc_8.867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141336.1"
                     /db_xref="GeneID:59327928"
                     /translation="MRFSLVSLCAVVAGAVVAENFEVDFEGWTHNDLKQYVQDHSKKL
                     ENLGSKTMEELKAELAERWQKNAQPKPWWQIWPAHKDAYLGEGVPSSLISEWLFETWP
                     EQDLRKFLDRNNVKYEAKASRNQLIKAAKDNFHQLSKRLGCSGFYPSEEYFGDWSEED
                     LKKWLGEYDIPYEKIENNRDALLDKVRENIYHASKLEEERRSELLSSLDLANKQITDK
                     AGEIKDDVFNSWSTESLKQWLLSHKVAVDEKVADNRDELVKLAKRQINYLKDDLEWYT
                     NYMKKKSSRFICKTPEYVASVWGQTVGKLGNKMGSFFGYYRDKTGDAINDAFLVGLDS
                     WSRDRLKTYLDVRGVKYHMLSTNNELRRLAVENRNKPLRRLQENYNKLTEGLTYDSMK
                     DWAQHKAEKIQDSDAYSSMTSSVDSLNKDTQKWANDFTKKWSDSLSSWSVDDLKSYLK
                     SFGVDTSSLTKEDLVETARLKTQLFFGTFNEPWYSRWWYKTRFYLRHPFRLFV"
     gene            <60952..>61161
                     /locus_tag="HG536_0H00380"
                     /db_xref="GeneID:59327929"
     mRNA            <60952..>61161
                     /locus_tag="HG536_0H00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285441.1"
                     /db_xref="GeneID:59327929"
     CDS             60952..61161
                     /locus_tag="HG536_0H00380"
                     /inference="similar to AA sequence:RefSeq:NP_013577.1"
                     /note="ancestral locus Anc_8.868"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141337.1"
                     /db_xref="GeneID:59327929"
                     /translation="MSKYAWYTRVTDAVHRLTVLTIVGGSMYMAGGLVYTLYKNGSKY
                     EKQVTQQKDESSELSQLEGAASSAE"
     gene            complement(<61223..>61699)
                     /locus_tag="HG536_0H00390"
                     /db_xref="GeneID:59327930"
     mRNA            complement(<61223..>61699)
                     /locus_tag="HG536_0H00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285442.1"
                     /db_xref="GeneID:59327930"
     CDS             complement(61223..61699)
                     /locus_tag="HG536_0H00390"
                     /note="ancestral locus Anc_8.869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141338.1"
                     /db_xref="GeneID:59327930"
                     /translation="MSDYKGHLFNKEAILEWLLTPGREDYTKAQIAKFSHIRRLDDVV
                     ELHGVKEHANTLKCEYGDVALGEASAKLVYLVPCGDVLPRQVLSDGRCPQCGASYQET
                     DVIAINSSSAKVIKSLKDRMTRLQQEMRHHNGKLRRKLKPKPERMEEAPPNKIRKL"
     gene            <62056..>62646
                     /locus_tag="HG536_0H00400"
                     /db_xref="GeneID:59327931"
     mRNA            join(<62056..62087,62148..>62646)
                     /locus_tag="HG536_0H00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285443.1"
                     /db_xref="GeneID:59327931"
     CDS             join(62056..62087,62148..62646)
                     /locus_tag="HG536_0H00400"
                     /note="ancestral locus Anc_8.870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141339.1"
                     /db_xref="GeneID:59327931"
                     /translation="MSNRYDSRESCNFYYKIGACRHGDKCSKRHVRPSRSHTIVMYNM
                     LYFPAGGLDNSRFDELYEDVYIEACRFGPVRSMVICENGNDHLKGNVYIHFESEEDAL
                     RARDSFNTRWFDERPIYCDLTHISDFRDAICRKHDTRACERGDECNFMHVRRPSTKLR
                     IDLEKSQAKKWHTRTP"
     gene            <62795..>63547
                     /locus_tag="HG536_0H00410"
                     /db_xref="GeneID:59327932"
     mRNA            <62795..>63547
                     /locus_tag="HG536_0H00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285444.1"
                     /db_xref="GeneID:59327932"
     CDS             62795..63547
                     /locus_tag="HG536_0H00410"
                     /inference="similar to AA sequence:RefSeq:NP_013618.1"
                     /note="ancestral locus Anc_8.871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141340.1"
                     /db_xref="GeneID:59327932"
                     /translation="MADRYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVV
                     IASEKKSSSPLALTETLSKVSAITPDIGAVYSGMGPDFRVLIDKSRKVAHTNYKRIYG
                     EYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWK
                     ATAIGRGSTAAKTFLEKRWNEELELEDAIHIVLLTLKESVEGEFNGESIEIAVVGEEN
                     KDMLGYTGVPTDKGPRFRRLTAQEIDDRLDAL"
     gene            complement(<63646..>66207)
                     /locus_tag="HG536_0H00420"
                     /db_xref="GeneID:59327933"
     mRNA            complement(<63646..>66207)
                     /locus_tag="HG536_0H00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285445.1"
                     /db_xref="GeneID:59327933"
     CDS             complement(63646..66207)
                     /locus_tag="HG536_0H00420"
                     /inference="similar to AA sequence:RefSeq:NP_013617.1"
                     /note="ancestral locus Anc_8.872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141341.1"
                     /db_xref="GeneID:59327933"
                     /translation="MAKRKSKSRSKLAKRAQNALEIAEKEMGGNASGSDDGYGSGDDN
                     GHVVNLLKKVQGTNGEDSGEESFEDEELDSDAALGSDDDYDVLDSKMSQAIRDRRKNN
                     KESLSEDEAGYTSIDEEELVPLSQVWDMDDKQEERDSSEAEDADEKLQLKSSGEESSE
                     EDSEESSSDDEDEEEEEDPFDEISEDDEDVELATITNDLLKQTDSKRNRKLDNFGSGK
                     DSEYSLPSNRSMKKLNLTDMMDVVEDKEAAASARLIQKDSAAVAVPLPQRIQERHNRK
                     AAYEISKQEVDKWQDVVQQNRRAEHLSFPMNAPGEQNHASAFTRSTEQPRSELQQKVD
                     KVLEDSNLVEDQKNTTFEDLATAKMSPEEMKKRTAELRLMRELMFREERKAKRLKKIK
                     SKTYRRIKKKEMLRNREMAGLSDESDDDQEAARAKERMTLKHRANSKWSKDMFKHGMA
                     NDQETREEIEEMLKQGERLKQKILDRGSESEEDAKLTDVEDEEQKSSEDVQLRETVGK
                     TGVMNMAFMKNAEAREREANKELVADLRAMEAADDEEQDPKDELLFDDGFNIHINKGR
                     RVYTPGINAAKSDPGEDKQTTTKIEAEVTEERAVELPREQPTEKQATSDEPNPWLGTS
                     DDENDNNVVRSAKVSIVGKDSSKLVKSAKKIEKASDRQQEKSAKKAQRDDDLLLDLND
                     TNRLQLVDPYGDPDDDSNNFMFKQQESIAEAFAGDEVVDNFEEEKKRTAIDEDDKEQD
                     VTLPGWGEWAGAGANPAKKRKFVQKIKGVASKDKRKDKNLKNVIINERANKKNLKYQS
                     SAVPFPYENREQYERSLRMPIGQEWTSRASHQKMIKPRILTKPSHVISPLKAPFK"
     gene            complement(<66379..>66744)
                     /locus_tag="HG536_0H00430"
                     /db_xref="GeneID:59327934"
     mRNA            complement(<66379..>66744)
                     /locus_tag="HG536_0H00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285446.1"
                     /db_xref="GeneID:59327934"
     CDS             complement(66379..66744)
                     /locus_tag="HG536_0H00430"
                     /inference="similar to AA sequence:RefSeq:NP_013616.1"
                     /note="ancestral locus Anc_8.873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141342.1"
                     /db_xref="GeneID:59327934"
                     /translation="MARSKFAECIEDIKAISSPENKDQKLLVPASASLYLPGRVVDNN
                     KFMVDVGTGYYVDKNADEAIAFYEKKVAKLNKEAVQIQNIIKEKSQYSLAIEDKIRQV
                     SLSRHEEMARQQKTAGAAK"
     gene            <67078..>67695
                     /locus_tag="HG536_0H00440"
                     /db_xref="GeneID:59327935"
     mRNA            <67078..>67695
                     /locus_tag="HG536_0H00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285447.1"
                     /db_xref="GeneID:59327935"
     CDS             67078..67695
                     /locus_tag="HG536_0H00440"
                     /inference="similar to AA sequence:RefSeq:NP_013614.1"
                     /note="ancestral locus Anc_8.874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141343.1"
                     /db_xref="GeneID:59327935"
                     /translation="MNNTDPTSFQSILAGVKRLREKEGGKEDNAESNRKDQRSGSATE
                     SATVVEKPGRVINAFNQQGRIRPSAGTAEGGPKSQAGVNAGKTILVNTTQKENPLLNH
                     LKNTNWRYVSSAKGTKVYYDYLIKKRSVLFLTLTYHKLYADYIGRRILPLQNNGDNIL
                     IFVVDDTNSEDILKDITKMCMFKGFTLLLAFNFEQAARYIEYLNS"
     gene            complement(<67705..>69255)
                     /locus_tag="HG536_0H00450"
                     /db_xref="GeneID:59327936"
     mRNA            complement(<67705..>69255)
                     /locus_tag="HG536_0H00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285448.1"
                     /db_xref="GeneID:59327936"
     CDS             complement(67705..69255)
                     /locus_tag="HG536_0H00450"
                     /inference="similar to AA sequence:RefSeq:NP_013613.1"
                     /note="ancestral locus Anc_8.875"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141344.1"
                     /db_xref="GeneID:59327936"
                     /translation="MCGILLHYAPDQGTKQGLVDEYVEYGECPVTTDKKSKTSDIFEQ
                     IVPYIKARGPDYCSFRSLREHCTAWFSSVLSLRDPFTSQSVDIDGRYILQFNGELYNA
                     EVQNNDTQFIVSKLLAPEADVYQIVQSLQGEFSYTIYDLKKHKFFFGRDNVGKRSLGY
                     RLCRESGELYVSSVSGAIDGFVDCAAGAIYVYDPATKSLDHSFELTSPYTVSPAVDHE
                     LTGLDCAVTQLYDVLDLAVRKRVRSIHPIHIENSPIGILFSGGLDCTVIAALVCRQLQ
                     QCSMTRKVVELINVGFENPRTGIMPADTPDRKLASSSARFLKRQYPDIDIRLIEVDVP
                     YEEYLQQRDTVIDLMYPKDTEMDLSIAIAFYFASRGAGKLRSSAGETVAYQRQAIVLF
                     SGLGADELYGGYHKLANKSLAELQQELSRQINNIHDRNLNRDDKVIAINGVEVRYPFL
                     DHDVIQFSTQELPISYKINKLALRKLASDKLALDGICDEPKRAIQFGTKSAKMTKDGN
                     KHGTDRLK"
     gene            <69417..>70766
                     /locus_tag="HG536_0H00460"
                     /db_xref="GeneID:59327937"
     mRNA            <69417..>70766
                     /locus_tag="HG536_0H00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285449.1"
                     /db_xref="GeneID:59327937"
     CDS             69417..70766
                     /locus_tag="HG536_0H00460"
                     /inference="similar to AA sequence:RefSeq:NP_013612.1"
                     /note="ancestral locus Anc_8.876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141345.1"
                     /db_xref="GeneID:59327937"
                     /translation="MSQEQIEKDKDVGNTVDPPSPAAALGETVDDIPQSSVKKPMQTL
                     EEDEEEPFYDFQKFSKQLQDPRAEPIVKYTKSFLRNFQTQRALWSADEQTKLVKDFKI
                     FIYDKFREYEPFKSLDGLSLRNAEEGLEKLIMGKLYHRCFSPCLKSLGGDLDEGHAKD
                     LSNDKRLREKIAEFKFLKPEDLDIPSALSGRLSKFVQLSGEELNKVNRFKAPRDKMIC
                     ILNSCKVIFGMLRHHRLADKGADSFIPLLIFTILRGDIEALASNVSYIDRFRFDDFIR
                     GEASYYLNSLQAAMNYIMTLEVGSLQCAGDESFKTRYDQNRELLRKERAREVSDKPGP
                     PPTPKATTVHSPAPSEYILSPLDEVTNVVVTKFTELFGNKPELAKPETSAQPHPTSAG
                     DSLDVDVLAKRIQEREQRETLETLQSMFPEMDKEIIEDVCIAKKYRIGATVDVLLSL"
     gene            <71073..>72767
                     /locus_tag="HG536_0H00470"
                     /db_xref="GeneID:59327938"
     mRNA            <71073..>72767
                     /locus_tag="HG536_0H00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285450.1"
                     /db_xref="GeneID:59327938"
     CDS             71073..72767
                     /locus_tag="HG536_0H00470"
                     /inference="similar to AA sequence:RefSeq:NP_013576.1"
                     /note="ancestral locus Anc_8.877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141346.1"
                     /db_xref="GeneID:59327938"
                     /translation="MKLRSIIVALSTLSVCLGQGENSTGNRSEVDAKSVFQPPVVNNG
                     SFFCTIDKDELVSPTCDVTFKEINEINGKIRKDLVSLVGTDFFKYFKLDLYKQCAFWD
                     DNNGFCVNRACAVDVVEDWDNLPEYWQPEVLGGLDKVNGTSGSDDECKFLQDLCGGAD
                     GSAKQTEPDIDYCDIGDFINSQAVLVDLSANPERFTGYGGQESALIWSSIYRENCFSP
                     GEMGQSLAKSVFYRLVSGLHASIATHLSNDHLNTETGKWEPDLELFMARVGNFPERVA
                     NVYFNYAVVSKALWKIKPYLSHLSFCNSYNQDVKSMIMNILSRLDSNVFNEDLIFEDE
                     LSSKVKDDFRARFKNVTKIMDCVHCDRCRLWGKVQTTGYATSLKILFELDDGDEESKQ
                     QVVDKLTKYELIALFNTFDRLSKSIESINNFERLYEIQAAGGKLASFFQNNNFFKLLK
                     KARNSIKDSVQAINSSINSSSSEDERPVFADLRMPEKSAAKNTEQIENKWKKAWHTET
                     HNVLEALKFIYRSYLDLPRNLWHLLLSTSNRLWNKFLGIQYLSEEDDSVMYKLDII"
     gene            complement(<72810..>73292)
                     /locus_tag="HG536_0H00480"
                     /db_xref="GeneID:59327939"
     mRNA            complement(<72810..>73292)
                     /locus_tag="HG536_0H00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285451.1"
                     /db_xref="GeneID:59327939"
     CDS             complement(72810..73292)
                     /locus_tag="HG536_0H00480"
                     /inference="similar to AA sequence:RefSeq:NP_013611.1"
                     /note="ancestral locus Anc_8.878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141347.1"
                     /db_xref="GeneID:59327939"
                     /translation="MSKKLKRTSLFSKDVSSLLYAYGDVAQPLPETVQCLDELVSGYL
                     VDVCSNAFRVAQGSRRSKLKLEDFKFAIRHDPVKLGRAEELIATNKLITEAKRQFNGT
                     DNQALKRFRAGEEEDDEQDADAEADEDAETAEATAAPSGRRTKSKAHKGKQSKRSKQQ
                     "
     gene            <73559..>76072
                     /locus_tag="HG536_0H00490"
                     /db_xref="GeneID:59327940"
     mRNA            <73559..>76072
                     /locus_tag="HG536_0H00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285452.1"
                     /db_xref="GeneID:59327940"
     CDS             73559..76072
                     /locus_tag="HG536_0H00490"
                     /inference="similar to AA sequence:RefSeq:NP_013610.1"
                     /note="ancestral locus Anc_8.879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141348.1"
                     /db_xref="GeneID:59327940"
                     /translation="MSDEEPDRLAGRASRGQVKGKRAKTFTGCWTCRSRKVKCDLRRP
                     ACERCEKSGLECGGYDIKLRWTKCINFDMYGIQVPTAPAYSTNEEQQYRRRNIDFVRY
                     GEEYKYYEDMDEELSALHKPPPEKIENGKTWLIKKFGVFRGTEPAVELRDSLPKGAAN
                     HLESSKSESTTVLDTAIEQTGAFDFLENDPFLLRFSTGHEWISKELEDDVLSSATAFR
                     GFPMTTLPLSSTSTTTTTPMDYGFCKNGGIEGQFNAANVSDSDRVENSAQTVRSLDID
                     KDTEASALSYDQHTESQTHGLSGEEEIMIDCSAFGATMPSVAMETIDNPWPGPNIFGK
                     AASNKHFVGPPATSLVVHGLTRFLLDYYFRNVADIMPVVAIPTNPWKTLFFPRALQAL
                     GEIAGLGTTSNSRNSLLNSLLAVSCFNLSSKFARDSECSQYFIKLGIEFRSQASCFLR
                     LCLAETAENERYKDVLTALLSINSVDVVWGTMRDCQHHLTMCEDFVKARMRMRPKLSH
                     KAKVLHKIFSFLKLIQDSTSLDKVGEEEITLKSVQNIENFDERAANNKPGSLSKYSEQ
                     DEETEPIKRIRYKELLDEMDGKIKIQSVEECEKTKIDRLQDDNTPLFMDVVSESYYSV
                     DPKQSDYSILGTDDLYALPKSLILLFSDCVHLAKHKEYYKIRHIALPQQFIRLLQKLE
                     SRLMTWRPEWKFLKADSEEFINDTVKGVYHHTMSFYNGLLIYFFTMIRELNESDLQTY
                     VEEVLLHLKALGELVTFKGIRIVPLMWQGFIAGCGSTDLRTQKEFKSWAAGLAQNGIG
                     SYWGARQVMFEVWRRRKNKEGGDDWYTVYKDWEVNLMLS"
     gene            complement(<76357..>78513)
                     /locus_tag="HG536_0H00500"
                     /db_xref="GeneID:59327941"
     mRNA            complement(<76357..>78513)
                     /locus_tag="HG536_0H00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285453.1"
                     /db_xref="GeneID:59327941"
     CDS             complement(76357..78513)
                     /locus_tag="HG536_0H00500"
                     /note="similar to TDEL0B00490, dicer"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141349.1"
                     /db_xref="GeneID:59327941"
                     /translation="MASDKDVRRAALLRRYCKLQTSLTEVCEALKVIDENALTSEEIR
                     VLSNNDDDLEQVIAKSSVVSLTTYLKETDSTSRALQSYESKKFKEDAKWFNGLVNYPV
                     VSDAALENLAFRHKSSTSMHAHATKIDMAVATNERLEFLGDSWLGALISYILYKRYPY
                     ANEGALSKMRSAIVNNGNLSKWCKKVGFDQRLQANIPRMVNHVKDWTSKYHADCFEAY
                     VGALVVDRYAAEFGGIAEWLEQLSGEIFEQMGSQMVADPTNKNAKYELSQLLLQNKAG
                     AQLAYHRLNSSSPFKVEVRLGDISLATGEGSSIKEAEQRAAMKALLDTTKLKTYSLYE
                     IEDRLIEPARKNGEPIALLGDIDEQALQRELEVTSSDENLVSPNVPEAISVNAEATVP
                     PKVPQPAPAPEGISQAQMDEIVEMLTGKLKETVLSTVKAAIKDTGLQLRSTGDKVDKS
                     AAQAEKAGEVSKYGQIVQDSPAQAREMQTKPSNGAQRLPLNQAPFAAPAKIDSLASSI
                     LPKPQALPKPQAMPKPQAMPTTQAMPTTQAMPTTQAMPTTQAMPTTQAMPTTQAMPTT
                     QAMPTTQAMPTTQPTSIPVLPSASKPSIATSYDALRSISKPPYPGPTAQRPTDDQTLQ
                     QAPGVESFQIDSSWKQRLYAFLGPRGCKPYYKTEAIGLQTFFSSCMIEGFTVVLGTGT
                     ASSKKQAEQIAAYRGLHSEELKEFLANPLSFSVANN"
     gene            complement(<78967..>80628)
                     /locus_tag="HG536_0H00510"
                     /db_xref="GeneID:59327942"
     mRNA            complement(<78967..>80628)
                     /locus_tag="HG536_0H00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285454.1"
                     /db_xref="GeneID:59327942"
     CDS             complement(78967..80628)
                     /locus_tag="HG536_0H00510"
                     /note="similar to TDEL0B00500, FET4-like"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141350.1"
                     /db_xref="GeneID:59327942"
                     /translation="MGRIGKFFGNPGSRPDVRQRAPVIVPNFALESATGKASHEEQTS
                     LVSTSDESSTEYSTVTVADNGWIRTSHGFTGLQKDLTDRILDNLVWMAGTEYVFFTMW
                     AILIVWIILGCVYGAPNVWQVVMQDGQSLQCYFWDTLLMRQQLISAHEQKVICGVVRS
                     RIAGFKMLARKSRLCLDQRLKDNEVTVTDAAIDIDLSGKLPVENWYDRLANWFSVIIG
                     SLYSMIAFWIGIIIWIVCGVIPKPGDNQPPYTGETAGSNPRLTKFSSTWQLYINSATA
                     VVLLVSSMFLQNIRARHDKFISKFIVKIFAADREIEERLRTDAGDFETGNPATTVVSA
                     KRTEGQKIIDFYADVVGTGIGVVIAIGAIVAWLSVGKVMNWNDNWWLIIGTYTGLVGF
                     LDGFVIREVYYRIVTDEERNYEIVAQDDLELFDVLDISCPEEFNGKPPNGQRKALDFR
                     ISTWINRLCSSQWSVVFSIVVIIGLIIAASALHWTTTGQLLANTPTMIIEAFFMIVLI
                     QAHNWADCQRRVELTALLARRQIILHHLDRRGCNLGHNTVVSKGE"
     gene            <81613..>82491
                     /locus_tag="HG536_0H00520"
                     /db_xref="GeneID:59327943"
     mRNA            <81613..>82491
                     /locus_tag="HG536_0H00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285455.1"
                     /db_xref="GeneID:59327943"
     CDS             81613..82491
                     /locus_tag="HG536_0H00520"
                     /note="similar to Saccharomyces cerevisiae INM2 (YDR287W);
                     ancestral locus Anc_5.294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141351.1"
                     /db_xref="GeneID:59327943"
                     /translation="MTLSREELKEIENTLVELATTQVGPLIKGQAGTKFDSYEDKANN
                     VDLVTVVDKKVENIIYEALSKKYPDFDFIGEESYVVGETKIGEKPTFIVDPIDGTTNF
                     IHGYPYSCTSLGLAEGGRAVVGVVYNPHLNQLFHASKGNGAYLNGEPVTVAPRALTLQ
                     KSVVAFEGGSERSEGPEGNFDCKMATLKNLLSDKGGYIHGFRSVGSAAMNLCYVANGM
                     LDAYWEAGPWAWDVCAGWCILNETGGVMVDANPNRWDIPLDNRSYFAVRGGSSVQEQK
                     WFIEAFWSHVEGTMKF"
     gene            <82726..>84378
                     /locus_tag="HG536_0H00530"
                     /db_xref="GeneID:59327944"
     mRNA            <82726..>84378
                     /locus_tag="HG536_0H00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285456.1"
                     /db_xref="GeneID:59327944"
     CDS             82726..84378
                     /locus_tag="HG536_0H00530"
                     /inference="similar to AA sequence:RefSeq:NP_014009.1"
                     /note="ancestral locus Anc_8.847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141352.1"
                     /db_xref="GeneID:59327944"
                     /translation="MLKQNHGVAKILRAFSSTLAMDHAAAEAMKIGISHVMDNAAGVI
                     PSTSETTAVGATSTIRDTLSRLEDLHAVSRISYRSRRKESIPTNKLRADLRKRQHVRC
                     LIDIMIQDHLNKHFISKLFHDNEISKSEFSMLVNRLLKERNLEAKLSNIVPDTVHTEI
                     LFRLFEIYCEFALQNPAGKLTVSELHDVNLFIKTFIDEAQLGKAQRCLQFVLDRQGLE
                     STLHSGDVWTIIHFLQLRCGAVVKFWDTVQGDKRMLGQNSTTFKQPKTFKSWNNQAFS
                     KVISVILKDKAWLSRNSTELSSAIIYSLANMGQAKLIEQFIELKWGVPQSGSVKLHNA
                     VAPEAGTLIAIVSSFCLKASDMSKGLAYLDQLLKQYPEIKLEKLFWRRLLQLSFQSWD
                     KHKDKKGQVCHASWEIMKQWHDEKSMNMSYDHGTLELLYQLFQTTNNGREAMEVISRC
                     FGSLYARQGYQRSASEMGLLQKYQKLALKTMALKGNYHKPLQFIKEWHVDRANQQLLI
                     QYFTRQRQRYILRQKRIGAKRDELQTQYDAMEEEDMLLGRLW"
     gene            complement(<84413..>85237)
                     /locus_tag="HG536_0H00540"
                     /db_xref="GeneID:59327945"
     mRNA            complement(<84413..>85237)
                     /locus_tag="HG536_0H00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285457.1"
                     /db_xref="GeneID:59327945"
     CDS             complement(84413..85237)
                     /locus_tag="HG536_0H00540"
                     /inference="similar to AA sequence:RefSeq:NP_014008.1"
                     /note="ancestral locus Anc_8.846"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141353.1"
                     /db_xref="GeneID:59327945"
                     /translation="MNISAASVKIVKLILLAWLLFVVSTARIAARNSLQWSRHLNVAT
                     EQVDSITLIIAHPDDEVMFFAPTLLQLDHLLPESVQFNFVCLSKGDADSLGPIREREL
                     RKSARLLMGRSGRGFEVFQHDFPDGFDETWDVRSVASSIEDSVFIDGRAPRTVLVTFD
                     EHGVSGHPNHVACHRAVKHIVAQRPGVQALLLKSHHGNIVLKYCGFVYDVLKLYFETF
                     LERSDSGLSFVNTFPQYLLAFASMANAHESQLVWYRYGWWSLSRFVFVNDLEVVVQ"
     gene            <85728..>89681
                     /locus_tag="HG536_0H00550"
                     /db_xref="GeneID:59327946"
     mRNA            <85728..>89681
                     /locus_tag="HG536_0H00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285458.1"
                     /db_xref="GeneID:59327946"
     CDS             85728..89681
                     /locus_tag="HG536_0H00550"
                     /inference="similar to AA sequence:RefSeq:NP_014007.1"
                     /note="ancestral locus Anc_8.845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141354.1"
                     /db_xref="GeneID:59327946"
                     /translation="MKSEKTVNDGPKIIRTMGSQALGGLNSLASGRNSQNSSMSRSPS
                     AGVEDGQNAIAIRGSKKAKSPSVVLEQTPSQRLPRLNTELAEVGSFTSVSSMGNSNLR
                     VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL
                     EAENRRLVALCDIKEQQIHLVSHCSPGKGKQNGKPQESDEQMLQELRSANGGQLRLSS
                     TNLFLLNRARDSNQATTEEDHGFETQKIQDSQQGKTHMCDGLHCSDKLHSKPVSTSLN
                     DPTCVSFEQDEAPGLPAVKALTTMATRERSTQLAALVALSVLRSTEEILFMPQLLARI
                     MQIHGFTSKQCLYTVSLLSSLKSNLPEPQLLKWDQLDCLKTTNLWEIDNLEQFFSETL
                     KFRILEDGTKENKDEESSFGLSIAEIDELVELFFEFWSPHIPILDRQEFFSYYNKLKS
                     DVETQPGLFQDGSNNFTRRNNIISYKIFACILFTVCQMGLLMKVKRDKITDTSSKCIK
                     LISYYHRAISLIYSNAYFSVLTTSLQSVQFLSLLLFYFLNTGNVSAVYELRGRVVSMA
                     QQLRLHRCPSAVLSGSGSTMNKMEQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIE
                     CALPVADNENKKVNLAGQMIRLEGHVSQFSLAMIRYAKVLGNILDTIFKRGMTESITK
                     KSALIHENALDNWRRGLPHGLTFEIDVNGTINMDEFNRLKQESGIDGQMKNMILILFY
                     FLAKCMIHLPVIATTRLSSNDDSNGEMKDENSAQLDKRNETESELAVRSSSSYVLLQQ
                     ATNTMLGIMNSLQSIYLPLPINVARQKTVYSLISARGSLEYIKGGALYLDSKALLLDV
                     VKSIEEDRKLEIPGIISWHSLKLLDMTINLLLQPANIKVEKLDKLLKKKLNYYNRLMG
                     QPMLRTPSGKQEVSKKRKSAGDVEDYSRPSTADIIRTSNLTPVSSKSDDSPQEKRVKL
                     EDEPEKHTGLQHSKSLNQTTAPVATQTAIAEALQLDPVLSSNILSDADLAAFFGGHLS
                     LPNSNLFAPVPQPVNPEKSVPPFTGKSAHDTQLKHQMPNSGSKLELDGLFRVPSNANF
                     LIDEHFPSGGSQLDLALLASNHQSSGFGSNGNNPLRKQNDLVPSTNHPVPHISNNSNP
                     SAYHDGFGTAASGHFGATAINGASGFNFSVDASLGLAPLLDWSPEMHHSPSKTISHHS
                     DNSGIILDSTIHHEEELANGSRAPTTAMTRTGSGQGSAHGSHFTPAQSHQVDQLPTGL
                     HDGDDPGQPMLTLGSRRGPRRRHMAFSSAQDSGLAANRTSRDQDLNNLFYWQNSK"
     gene            <90432..>93752
                     /locus_tag="HG536_0H00560"
                     /db_xref="GeneID:59327947"
     mRNA            <90432..>93752
                     /locus_tag="HG536_0H00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285459.1"
                     /db_xref="GeneID:59327947"
     CDS             90432..93752
                     /locus_tag="HG536_0H00560"
                     /inference="similar to AA sequence:RefSeq:NP_013589.1"
                     /note="ancestral locus Anc_8.844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141355.1"
                     /db_xref="GeneID:59327947"
                     /translation="MAMQSKGSAHQNQQPNHTEYGGSGKMMNTPVVYPQMGSMGNQFV
                     NAQPVFYHAGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPDLFQQSHYHQYANQR
                     RHGSSHSKPSSGRSFAKVATAYPAPPPLSSPPISRNAGFPINSREFGRDSYYKPIRTA
                     DASKLFGDPFIVTYTILPRGNDEFRTRSLLLENVNNSTDLHAFVTNHTISAPVESVYM
                     FEKEKGSNHVSILLSFFSRTICLDFYNSVLQRFSEYKSDLDSKGLTLSFVSLEYKVPG
                     TDREVVEHEDDTKLDAFSITAAGSLRYDIINRGAARSIAITFDKACSKNELIDKKLEF
                     LKAKNNSRYVLESVDLISANEPTKNFPENYAILTFLNIFMAVEMLDYIRLHSQKLGIV
                     NCFFVSVLPQSSDSKRRSVSASSNSKSSESGNISYRDKNGSITSLESCSSLLSLDPEV
                     DEVTSRLEKSKLEKCLLEIRASQYKDPTFQAYTDHLSNVTVSEAASMEFQLHLPRPQE
                     VTVNEISLPSRGLSFSGEMDVIRGGQRFNTATQPIPHLTSFTNTPDSPYMPPHSASRE
                     NNINKQITQNLQQHYATSAEVSSSMGGGVGNRTIYIGNIHPRSKAEDICNVVRGGILQ
                     GIKFLPERHICFVTFIEAASAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSISLA
                     VTVGASRNVYVSLPEYAFKDKYINDPQYKEYAQKYKLPTEQQLRKDFSHYGEIEQINY
                     LSDGHCCWVNFMNISAAIKLVEEVKYDDEKKSQEFFNNRYEGLIIGYGKDRCGNVNKN
                     LIAGKNSRFYKKVKKPSFNIRLSKMEAERRQHEESLRNQQRNNSEKLIQFGSLGITLD
                     REGKKSFDDNSVTDSEVEVDFVEGTKKTVKQEDGKESEQEERELLKLSNKSEISEGLG
                     ITDSAANEKKNKNLSDLASSASNDEEAASHSRSDVSSEIELIIQTPADDRREVQASQP
                     PEGSLKKTKSISEKDKKSTAYDVSTTFSGLSLDANPPMAPATISRNYSLMLKKQYEDD
                     KLNETKVNKGQDASGEVPEVSNHRKGRSKRRQGKFIPGSDVMAQYLAQLQHSTFIYAA
                     NILGASSEEESLDGNRKS"
     gene            complement(<94287..>95807)
                     /locus_tag="HG536_0H00570"
                     /db_xref="GeneID:59327948"
     mRNA            complement(<94287..>95807)
                     /locus_tag="HG536_0H00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285460.1"
                     /db_xref="GeneID:59327948"
     CDS             complement(94287..95807)
                     /locus_tag="HG536_0H00570"
                     /inference="similar to AA sequence:RefSeq:NP_013592.1"
                     /note="ancestral locus Anc_8.842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141356.1"
                     /db_xref="GeneID:59327948"
                     /translation="MAFLWGSKREKRKEDDSYRLPVSRSKLNPRPNTRWWSGSRKKRV
                     ANWLLIGAICFLAYRIIGVLILEARESSSGIGTVGRNYKTITLSEEAYYDYDFEDIDP
                     EVIKKFDNGVTYYQITQFGEETMTAEQQEAFEKDVTMLVDSTVEKYDLRDFSGSSNGA
                     ANQEHLLLCIPLRDAEKVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALVAF
                     SRQLQNGTLSQVFAEMEADEKKRSEGTEKLYLQYMDQNYIKKVHDAFSPPFHADYDKS
                     FRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRD
                     ADVELCPGSVIQDLMSKGYDVIVPNVWRPLPVFLEAEQPYDLNSWIESTEALELARTL
                     DEDDVIVEGYAEYPTWRGHLAYFRDADGDPNEVVDLDGVGGVSILARAELFRRGIQFP
                     AFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLKEIANKEREKRRE"
     gene            complement(<96115..>97995)
                     /locus_tag="HG536_0H00580"
                     /db_xref="GeneID:59327949"
     mRNA            complement(<96115..>97995)
                     /locus_tag="HG536_0H00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285461.1"
                     /db_xref="GeneID:59327949"
     CDS             complement(96115..97995)
                     /locus_tag="HG536_0H00580"
                     /inference="similar to AA sequence:RefSeq:NP_014005.1"
                     /note="ancestral locus Anc_8.840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141357.1"
                     /db_xref="GeneID:59327949"
                     /translation="MAGNGTGKAAGGVPADLNGVFSLWLAQDSDEETRCEILELYRAG
                     RWCELHERLDTRLAFGTAGLRARMGAGFNRMNALVVIQTTQGLAQYVKKQSPERLVAV
                     VGHDHRYRSQRFAAATAATLVEAGFTVHLLNKDGKLVHTPMVPFAVNEMGASVGVMIT
                     ASHNPATDNGYKVYYSNGCQIIPPHDSGIAQAIEENLGLWPRAWKWDEVLEEALRSGS
                     LLHDGGILTCGYASKMEAFLVDKTFAGAGRNGRPWFVYTPMHGVGFEIFSKIVEKTMG
                     LVVDEDYLCVRQQQQPDPAFPTVQFPNPEEKGALDLAISLAESNDIGLVLANDPDADR
                     FSVAYKDPSTRVWRQLTGNEIGFLFAVYEYQRYQTLDAEFRKRRPLAMLNSTVSSQMM
                     KKMAETEGFHYVETLTGFKWIGNRALDLEAMGYYVPFGFEEAIGYMFPSMEHDKDGIA
                     AAVVFLQAYRRWLDSEKKTLSMIIEEGYQKYGVFKEYNGYYVVDEPAKTDEVFHYIRN
                     EYPKGHDPYPYQVGNELTVTHFRDLTEGYQSDTVQNIPTLPVDASSQMITVCAKLAGT
                     NVTETVRFTLRGSGTEPKLKVYIEACAKTEEQAQKNARMTWEILKREWFRPEITGLTT
                     NF"
     gene            <98258..>100429
                     /locus_tag="HG536_0H00590"
                     /db_xref="GeneID:59327950"
     mRNA            <98258..>100429
                     /locus_tag="HG536_0H00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285462.1"
                     /db_xref="GeneID:59327950"
     CDS             98258..100429
                     /locus_tag="HG536_0H00590"
                     /inference="similar to AA sequence:RefSeq:NP_014004.1"
                     /note="ancestral locus Anc_8.839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141358.1"
                     /db_xref="GeneID:59327950"
                     /translation="MTTPVFSPEVLPYPITIDQLIAPIGSDVEKGQRLFAFKFWYMVE
                     IASSPDESEDGHGKKRVRESIEFFEAPFEGKLMSWNVDVGDEIASPNQAICEIFRPCN
                     HDIVYGGLCTLCGKEVDESEQMGANLAISHTDVNLRVSRKEAADIEKSLKVRLRESKK
                     LVLVVDLDQTVIHCGVDPTIGEWKRDASNPNYETLKDVRSFALEEETILPLLYMGPKP
                     PARKCWYYVKVRPGLREFFERVAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGDRIL
                     SRDENGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVIPYNFFVGVGDINSN
                     FLPRQQNTMLQLGRGSRKKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLSHQIAT
                     GEETAAPESKEQLARKIEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELFYLKET
                     LAKVHDEYYRALEEKSEQDADMKVLMPTMKSRVFENCHFVFSGLIPLGTNISRADIVL
                     WTDMFGAQSSAEIDENTTHLITRTSGTYKARIAKAFNDKIKVVHPDWVFECLVLWKRV
                     DEQPYELIIEQSATEEELEEYKRNLEKRSNALAESKRDAVIESTKDGPVDLFSAGTSW
                     LNDDEEEEIPESSESSDEEVEENDSQDEEEKADKSSTEDQHPKTATKFESFDQSAKRS
                     LGDTAGSFDNAGDIKRAHLEEPKAEDSDSELEEELLNALDE"
     gene            complement(<100998..>102578)
                     /locus_tag="HG536_0H00600"
                     /db_xref="GeneID:59327951"
     mRNA            complement(<100998..>102578)
                     /locus_tag="HG536_0H00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285463.1"
                     /db_xref="GeneID:59327951"
     CDS             complement(100998..102578)
                     /locus_tag="HG536_0H00600"
                     /inference="similar to AA sequence:RefSeq:NP_013593.1"
                     /note="ancestral locus Anc_8.838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141359.1"
                     /db_xref="GeneID:59327951"
                     /translation="MVDPSHSKYVQLTRLPTLKEVHHEVNESTGEKILGKAVALQLKP
                     MNAEISKFAFDYLLLLVEEQLNDMIGFLHKSSNIQRRELVAKADLQLFLEGFNLSPSD
                     LELQQQISQHYSKIYRKELAALHSLQETVSEAIAEDEGTSQDVINSLVPPNNPLAKSV
                     PKWMPILPPDHTYRFTPQYNHPITDETVIRRKIVEEGKLSEVALSHLLRVSSMPAPSP
                     EVQMSDADQALAAEESMAIYGNKYKKRRKQTAYSSDLLSKLPQSNFNVEEYARSRVEL
                     ARRKVLEYEEKQLQLQQNPFIKFSKMVLSTSPEKLNRRQLNKEINSMLKRSLYSLVKS
                     IPKLQEAKQEARKSAEKARDERLQELRAQREAQERHSEQFETGDINLLDLDNHSDDFF
                     NYSGSDNDEQERQVASGEANQQDIQRSQVSATGDAEVAPEPVPPTQEDYSHHAEIGRI
                     DQTEHSGQAQIVGQGEAPESEVRPTDTEAAGKGEDHEAEQKQENPLHNDEDDEIDLDN
                     TNFLFGENDDLENEDIQL"
     gene            complement(<102834..>103910)
                     /locus_tag="HG536_0H00610"
                     /db_xref="GeneID:59327952"
     mRNA            complement(<102834..>103910)
                     /locus_tag="HG536_0H00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285464.1"
                     /db_xref="GeneID:59327952"
     CDS             complement(102834..103910)
                     /locus_tag="HG536_0H00610"
                     /inference="similar to AA sequence:RefSeq:NP_014003.1"
                     /note="ancestral locus Anc_8.837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141360.1"
                     /db_xref="GeneID:59327952"
                     /translation="MSITVQIKSGQNKWQVVTEPAKTVAEFKDEIAKVSQIPAANQRL
                     IYSGKILKDDQTVESYKIQDGHAIHLVKSGGNASAGPQASSQGDGARSVPSNIASGQT
                     GGFNPLSDLTSARYAGFANLPSADMFGPDGGMSNMPNQEDLLGMLDNPIFQSQMNEML
                     SNPQMVDFMIQSNPQLQAMGPQARQFLQSPFFRQMLTNPQMIRQSMQLSSMLNPNGAG
                     DGGSEAASFPAPGDTNTEARTGETASAASPGAAPENPFAALFNPANNPFAAMMNSGQN
                     AGAVRGDQQAPPFDPSLLASLLGGSAQQNVERDNRPPEERYEQQLRQLNDMGFHDFEK
                     NVAALRRSGGSVQGALDNLLNGDV"
     gene            <104347..>104910
                     /locus_tag="HG536_0H00620"
                     /db_xref="GeneID:59327953"
     mRNA            <104347..>104910
                     /locus_tag="HG536_0H00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285465.1"
                     /db_xref="GeneID:59327953"
     CDS             104347..104910
                     /locus_tag="HG536_0H00620"
                     /inference="similar to AA sequence:RefSeq:NP_013594.1"
                     /note="ancestral locus Anc_8.836"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141361.1"
                     /db_xref="GeneID:59327953"
                     /translation="MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRLDEPDRAV
                     RSKSQDAISSRDLEAVDALRELNNSPPQQQLPQQKLQYPQQLSREAPDTTSAQAVSLV
                     AQNQQLSNAAAGVPGAFAFQSVGPYMVSPQYMHTAAGVSSPLLVPLARGGCPAESATG
                     SSSAVLENSRGSSGDDATGTVLVHTST"
     gene            <105078..>105956
                     /locus_tag="HG536_0H00630"
                     /db_xref="GeneID:59327954"
     mRNA            <105078..>105956
                     /locus_tag="HG536_0H00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285466.1"
                     /db_xref="GeneID:59327954"
     CDS             105078..105956
                     /locus_tag="HG536_0H00630"
                     /inference="similar to AA sequence:RefSeq:NP_013595.1"
                     /note="ancestral locus Anc_8.835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141362.1"
                     /db_xref="GeneID:59327954"
                     /translation="MDSFEARLQFIQILKNLQKSLNILRTGTDDDGRSDSPSLSRSAG
                     TDPIQFYLKNYTQHYEDFHQCLFDTMSKMDPLDRINIVLYYSRIISILKNRETDFNST
                     VLNQHLLPSVDRLLLLALPANDWTSLSNLKACIEVFQWLNEVCGNVVEWSDECDQPDA
                     SVPLSELAWFEPASDTTDVAHSFQSATILLKDRLAKRKYLIEYYRGNGVCGMPTATAA
                     STILHRMENDREKHKRLKENTWVLERPTNSIVDPQEFQSIWENAPYNGMTKEDYRNIK
                     ELNGIAQQSYSIGYKH"
     gene            <106250..>109006
                     /locus_tag="HG536_0H00640"
                     /db_xref="GeneID:59327955"
     mRNA            <106250..>109006
                     /locus_tag="HG536_0H00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285467.1"
                     /db_xref="GeneID:59327955"
     CDS             106250..109006
                     /locus_tag="HG536_0H00640"
                     /inference="similar to AA sequence:RefSeq:NP_013596.1"
                     /note="ancestral locus Anc_8.834"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141363.1"
                     /db_xref="GeneID:59327955"
                     /translation="MVDTNATVNCNEGGDIRERRSSRSGLSSGSKTGSRRRSRAEPSS
                     RGRSAEVTQQPTSWIRSASTSSLLRLKRNDKIHNRNRKDKTEMNRSESLCKVETQLAE
                     QRKKADAAVVVDVLPSFEMYNSLHRHIPQGNIDADRHDFPPCYQKVQSQYNSILRGSD
                     QPESIALGVADPNGAGSASSASVGNLHPLSTRHLNLHEPSNVSDGELNAIEDDLNDSD
                     NINIDKLYSLPRLVTPIEIDIRIAKHAIKPHERPEEESMLKEYTSGEIIHGYCVIENK
                     STQRVKFEMFYVTLEGYISVTDKQKGKRTVKRFLRMVDLSASWSYGCVDISSGIKVVP
                     GDIDFDNTVLGLTNNRILEPGMKYKKFFMFKLPNQLLDVTCKQEQFSHCLLPPSFGID
                     RFKHGGKYSGIKINSILGCGHLGIKGSPILTYDMAEESLSINYTIDAKFVGKDKKTQQ
                     LNIMSEHQYHLRVIPFGFNSPVIGEKDSSRQLEDLTALVQERLEALSRVFERLKNREP
                     ISAVDIHGTDISGTVSDIQLDSEEILARKMHQLHLNNRVDPQYYLSREKDLKGCAYEA
                     DFCEAELSYKLKSKSASTLTSGIFTGFKSSQSNPNDGTKDKLNKVGLMVLKAKHPDLA
                     LPYLSPSLLRKKNKFGEKNEHDQENWLRISSLVPEEVRNKLEYIDIELECIQSNNSAP
                     HEPPEIQSVTTELICITGKSDNSIPIKLDAKILMNQDKLQHVKRQYSAFVSEIQNYSE
                     MFEKNLVELNELYSLDCVSALSRQLSFTDFISDQIRNDVESLANLSTSVVNLHEVFKK
                     QAHTMKKSSQDSMSSNSSSSSLSKNGSVTFIVGSSFEIPGASTKHGEQTAREWVNDSP
                     MHYKRTVRVNLEYSDNIKETLVPTFESCLCCRFYCVRVKIKFDNHIGTASIDIPVSVK
                     NLHC"
     gene            complement(<109081..>109977)
                     /locus_tag="HG536_0H00650"
                     /db_xref="GeneID:59327956"
     mRNA            complement(<109081..>109977)
                     /locus_tag="HG536_0H00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285468.1"
                     /db_xref="GeneID:59327956"
     CDS             complement(109081..109977)
                     /locus_tag="HG536_0H00650"
                     /inference="similar to AA sequence:RefSeq:NP_013597.1"
                     /note="ancestral locus Anc_8.833"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141364.1"
                     /db_xref="GeneID:59327956"
                     /translation="MLKSVARSSAAWRSQSRLARPFSQTLSAFNAKSDNTETAQFTHF
                     GSKRVPKVEKEKLVRHVFSSVASKYDLMNDVMSLGIHRLWKDHFINKLDAGKRPNSTE
                     PLHFIDVAGGSGDIAFGILDHAEQKFHDTESSMHIVDINPDMLKEGEKRAMEQQKYFN
                     DPRVTFLVQNGETLDKIESNSKDVYTISFGIRNFTDIQAGLNAAYRVLKPGGIFYCLE
                     FSKIQNYLVDSAYQQWAKILPVMGSIVANDYDSYQYLVESIEKFPDQETFKEMIQKAG
                     FESAGYESLTFGICAIHWGVKV"
     gene            <110338..>111294
                     /locus_tag="HG536_0H00660"
                     /db_xref="GeneID:59327957"
     mRNA            <110338..>111294
                     /locus_tag="HG536_0H00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285469.1"
                     /db_xref="GeneID:59327957"
     CDS             110338..111294
                     /locus_tag="HG536_0H00660"
                     /inference="similar to AA sequence:RefSeq:NP_014001.1"
                     /note="ancestral locus Anc_8.832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141365.1"
                     /db_xref="GeneID:59327957"
                     /translation="MTRTSAFLLSLYVAVSYVAAIYTTSRDLEDYPSGRDDPRVIRRR
                     MKRITLVVLMNMFLIPWLISRYGDAEKAVSFREAVLDLGVVPGYRRNGIWDIVGYLQE
                     ICRAISLIGLLYVGPLTDAFLYYLLVPGKHWYTDFKEEMFNIWGLRNYVFAPITEEIV
                     YTSMLVNIYCSTFPADSPVRLKTVIWKTPLFFGVAHLHHAYEMQRQGVASFATILFSC
                     TLQIAYTTLFGSLTNYTFLRTGGNLWACIAIHALCNFLGFPESSKLAMHYTVVKKVDS
                     PHLSRLLNIWKKCYLALLVMGLLFAKNMYQVLLQSDGNQIVL"
     gene            <111665..>114607
                     /locus_tag="HG536_0H00670"
                     /db_xref="GeneID:59327958"
     mRNA            <111665..>114607
                     /locus_tag="HG536_0H00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285470.1"
                     /db_xref="GeneID:59327958"
     CDS             111665..114607
                     /locus_tag="HG536_0H00670"
                     /inference="similar to AA sequence:RefSeq:NP_013598.1"
                     /note="ancestral locus Anc_8.831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141366.1"
                     /db_xref="GeneID:59327958"
                     /translation="MGRVDDRPKLSLEGEDRSSQGNSITESQREKRKSEVLIAAQSIE
                     NEVQSVKSLKRISIGSIDLLIDPEMEFRVSNPNARRSWSSNSSSSGEEADIRTISSHE
                     NELNINSQASGDIRGTDGPETSFDITSADYLQSSDSVPDGSDTLSSSSYSQRTGSPQH
                     SVRRILTGVGSLRRGGVNAAVSEDSSSVPVDDGSSGPGNSILSKQLFWVPANQHPSVK
                     PENYLELVQDTLHSIQLDDKDEMPDSADQNDADLASFERAPIDLARKRDSLVRRPSRL
                     RKSYTEFEDDAESEEDENYQEGYRKAADEAKGPGQSLRGSMRAVSLKDITEELNKISN
                     NAGLTSSDAITLARTLSMAGTYSNADNNSKEGDVTKGGPNTINAYGSTKYEDEGEFAS
                     NMLMRYGVVIPARSSLRRSKFNTYRIRSSGSTSSLTSEHSNVENRGVTEIKEQARASH
                     ESRKELSVKHQPDRNDLVKAKLPTEKQTESTLSSPSTISDFQDIYDHYRHSSVEWEKE
                     LDVGLPRQADSPLANSYVKLREKEIHAVGNSPSIQDTKLLETGSLAENEEDPAAIAAQ
                     DSSEKKSSWSWLNGITTRDSIAEKQVKSDSKPLATPDDEAYLSNNLERVRDHSRAHLG
                     KLANQSSNHSKNRHSPIFNASESAKPGRPPAESDGASSNSSNLKRQRFEKKFVNLFKR
                     KAKNKLTGHKISKDSVNGDASGNSSGENLPRSGKLNKNHIKLKSESGAEEHLRNAQSA
                     LGHVSSGGPEEHSAKQESDVDELPALQPAVSVTSLKSNHGLTNEPSVVESVRELNGDD
                     SQDVSADQSADSSIDLMQEALVIKEPTNDLQANGKPVPPPSNKHVIPPRKLTFDDVKR
                     PDRPNAAMNFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRDLR
                     QQVILSNFMYAYLNLVNHTLYMEQAAQEDELSSNSVVDNPSNTPSSSAAYKIEHNSAN
                     GSICIPDI"
     gene            <114662..>115108
                     /locus_tag="HG536_0H00680"
                     /db_xref="GeneID:59327959"
     mRNA            <114662..>115108
                     /locus_tag="HG536_0H00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285471.1"
                     /db_xref="GeneID:59327959"
     CDS             114662..115108
                     /locus_tag="HG536_0H00680"
                     /inference="similar to AA sequence:RefSeq:NP_013599.1"
                     /note="ancestral locus Anc_8.830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141367.1"
                     /db_xref="GeneID:59327959"
                     /translation="MVVPDEYVATELKNLEDILHGRPIHSRLHQTIASLPDHCGTMGD
                     NDNLYHMIILLEEAMEADEPAEGSDEQETKKIHEFVEELVLPFTVDELDALNKWFDKF
                     DEDICIPNEGHIKYEITSDGMMVLILDKEYEHLITNVRDFVEANSS"
     gene            <115737..>116891
                     /locus_tag="HG536_0H00690"
                     /db_xref="GeneID:59327960"
     mRNA            <115737..>116891
                     /locus_tag="HG536_0H00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285472.1"
                     /db_xref="GeneID:59327960"
     CDS             115737..116891
                     /locus_tag="HG536_0H00690"
                     /inference="similar to AA sequence:RefSeq:NP_013999.1"
                     /note="ancestral locus Anc_8.829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141368.1"
                     /db_xref="GeneID:59327960"
                     /translation="MSVDQSKTLQLFSRKQVSEHNTADNCWVTVSHRKIYDVSRFLNE
                     HPGGPKYILDHAGEDITEVLKNKTIHEHSESAYEILDEDYLVGYLATEDEEKKLLSNP
                     SHKVEVKLAGADETFDSTTFVSDLPTEDKLSIATDYNKDFKRHHFLDLNKALLPQVLF
                     GNYTRDFYIDQIHRPRHYGKGSAPLFGNFLEPLSKTAWYVIPIVWLPVVLYNVAVAFK
                     HMNPVFTVFFFCVGVIVWTLIEYGLHRFLFHLDDWIPEHNIFFALHFLLHGVHHYLPM
                     DRYRLVMPPSLFVILCAPFYKLVFRLLPLYVAYAGFAGGLFGYVCYDLTHYFLHHSKL
                     PPYMRRLKKYHLEHHYKNYQLGFGVTSWFWDKVFGTYLAPNSPVSQMKYE"
     gene            <117408..>117911
                     /locus_tag="HG536_0H00700"
                     /db_xref="GeneID:59327961"
     mRNA            <117408..>117911
                     /locus_tag="HG536_0H00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285473.1"
                     /db_xref="GeneID:59327961"
     CDS             117408..117911
                     /locus_tag="HG536_0H00700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141369.1"
                     /db_xref="GeneID:59327961"
                     /translation="MLSMAWRIYEKWEFSEQPCQPHYSSTLADEFKRTFSRSYEVRIH
                     FQGLWDSVNSVGILRNKLFPCTQRSAIADHVRHAVSLDERKGKFKQQLFVPYPMLNQP
                     TTDVPNIDAVNQDEFESRNRSTDTRTGVSPDLIEKWFPGDHSDIGGGWGLIAQPEKIY
                     RIFLCAG"
     gene            119269..119340
                     /locus_tag="HG536_0Htrna6Q"
                     /db_xref="GeneID:59328404"
     tRNA            119269..119340
                     /locus_tag="HG536_0Htrna6Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAG"
                     /db_xref="GeneID:59328404"
     gene            complement(<119418..>120416)
                     /locus_tag="HG536_0H00710"
                     /db_xref="GeneID:59327962"
     mRNA            complement(<119418..>120416)
                     /locus_tag="HG536_0H00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285474.1"
                     /db_xref="GeneID:59327962"
     CDS             complement(119418..120416)
                     /locus_tag="HG536_0H00710"
                     /inference="similar to AA sequence:RefSeq:NP_013600.2"
                     /note="ancestral locus Anc_8.828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141370.1"
                     /db_xref="GeneID:59327962"
                     /translation="MDPDVSDRLEVVRRKLDVGECGTRRHKGWSPGSDEHARGILKKW
                     RYRSRRVPEGRGSPWNRFLPRKLQRLTPLHDDLVELAVREWHGARLCNLQELLERCSG
                     IQDGSRSVVVEWDAKWINPLSLASKGWEFSSSDHKGRMVCRCQSCRKTIVLDLRLEEA
                     SSEYLRQSYWVNGVSKGHSACCPWRNVQFDLEKEYYLHKSNLVHDIERIKKAVSKPCS
                     ASKAEKCPGTFPADQLTQLKKVFHYNGDDQLLSLLVRGYEPIGDAVVRCSACFRNAFL
                     RNCSALNYHESWCRYREENKLAEMILSSLPLDLESCGKPDSVEKRLHNLETYLEEL"
     gene            <120816..>121493
                     /locus_tag="HG536_0H00720"
                     /db_xref="GeneID:59327963"
     mRNA            <120816..>121493
                     /locus_tag="HG536_0H00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285475.1"
                     /db_xref="GeneID:59327963"
     CDS             120816..121493
                     /locus_tag="HG536_0H00720"
                     /inference="similar to AA sequence:RefSeq:NP_013601.1"
                     /note="ancestral locus Anc_8.827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141371.1"
                     /db_xref="GeneID:59327963"
                     /translation="MPAVLEDYQKNFLDLAVESQALRFGSFTLKSGRKSPYFFNLGLF
                     NTGKLLSNLATAYAIAIIQSDLKFDVIFGPAYKGIPLAAIVCVKLAEIGGSKFQDIQY
                     AFNRKEAKDHGEGGNIVGASLEGKRILIIDDVMTAGTAINEAFQIIAQANGQVVGSII
                     ALDRQEVVSTDDREGLSATQSVSKRYGIPVLNIVSLTHIINYLDGRISPEEKKEIEQY
                     RQTYGVL"
     gene            complement(<121592..>122380)
                     /locus_tag="HG536_0H00730"
                     /db_xref="GeneID:59327964"
     mRNA            complement(<121592..>122380)
                     /locus_tag="HG536_0H00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285476.1"
                     /db_xref="GeneID:59327964"
     CDS             complement(121592..122380)
                     /locus_tag="HG536_0H00730"
                     /inference="similar to AA sequence:RefSeq:NP_013602.1"
                     /note="ancestral locus Anc_8.826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141372.1"
                     /db_xref="GeneID:59327964"
                     /translation="MPKIEEVEDYDDIDNLEMDLAELDPSLRTPIAPKITPTVVRSQD
                     GERQTVAESSRNQVSFINPETGKVEGSAQISKEELEEVKGFQVLYPCYFDKRRSHREG
                     RRVPLKLAVENPLAKTVADAVRSLGLLCIFEGEKTHPQDFGNPGRVRVLLKEDGRLVP
                     SAAGYKGGKRQLMVQIAEYLIKHPTTPESLREIPYGPEFDGIEFRRVPMVKGFKMNDI
                     VPLHSPFLLGHPMTKSIYDTAKPAAAAPEKQFKAMKNKFKVIRR"
     gene            <122547..>123620
                     /locus_tag="HG536_0H00740"
                     /db_xref="GeneID:59327965"
     mRNA            <122547..>123620
                     /locus_tag="HG536_0H00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285477.1"
                     /db_xref="GeneID:59327965"
     CDS             122547..123620
                     /locus_tag="HG536_0H00740"
                     /inference="similar to AA sequence:RefSeq:NP_013997.1"
                     /note="ancestral locus Anc_8.825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141373.1"
                     /db_xref="GeneID:59327965"
                     /translation="MSDSEDDGAGSEGRPIDQEVVKTANELLDSLEQSHRSDLALHLY
                     SSYLLKNLLYRANERKHGLEIDRFVRTHIRDNWTRWPDPRTVVDPQVNRLYEDDNYGE
                     RQDSELEPGEISAKALVHASNMLRMELDSFWQHSLAQSAAKAEVALDVDKMAMPKELS
                     DHVMWKLDHFFNGIHNKIAARNKIEIQQAQSSQQLTVSQASNDKVKASNRTELTYHDI
                     IARGCEMGEDMEEIYVKSLELFNDIPSSFDKSRYKLPKSVIRSFKSTAPSKSCLSAMK
                     GSRDDYVALEKLLKDKRLLASDKIHLRKISKRSIDQNLSKKSFFSVQAAKSYEQEIHA
                     RDDPDIDSYTQEDCLVKIPRLNR"
     gene            complement(<123591..>127019)
                     /locus_tag="HG536_0H00750"
                     /db_xref="GeneID:59327966"
     mRNA            complement(<123591..>127019)
                     /locus_tag="HG536_0H00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285478.1"
                     /db_xref="GeneID:59327966"
     CDS             complement(123591..127019)
                     /locus_tag="HG536_0H00750"
                     /inference="similar to AA sequence:RefSeq:NP_013603.1"
                     /note="ancestral locus Anc_8.824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141374.1"
                     /db_xref="GeneID:59327966"
                     /translation="MVKNAYRSQFYGVALTLVLCSVTHRVAAIAILAGIIGATVTLVC
                     IAIKSSFPEVEYPRASRRLKRTSDPPASSTTHPSNWENSDFARNHPGIARQLDEISQL
                     LVQNYVSSWFQHIDAAGASGFEEAVKETVRGSVAKLGSLLEHMDGTGLLVLKLVPLLT
                     KHFEAFRVARRAVQDDRASAGNTELQLAVEYNKLRKLHHCLSLRPSSLAHDVEVHLTA
                     KMEKLLPFLIDEKELSSTFVFILLRDILAMCALKPLVMKLSNADFWNLAMISISDKVL
                     EEQDQVSQVRRFLSRELEVQNSDAVKAASINTVSHVEQELRPGITGTQFELYLRQISQ
                     LSSVENLQKERLSIVAKLLRLRNDKSVLNSSDYQKRLLLSLNLLQTRLRSVDSRGTST
                     KRYAYTVNLADAMKIADQFESFLKTVKLTDILQEPKCSIYFEKFLTIKLYRRGLCYLN
                     FWKLTENMRNPLEDAHEGLIVTISPWEIAQLRETALQFFQNEQLEFMRMLDPGLVTNI
                     LLFIKDTGSDTNRTFPLARRSILLLQSEAQRILEDDFFQTFKGSNIFLDMMASADFSD
                     TESYARIVAESQFRELLASPRTQDRLTAIRVFTNPEVENAIEDILNRTSSERERGYIK
                     VQQNGEMKGNPLEINDIELYKDTLFRDEDEDNEALSLRKRSAAPDEVHGPHLVENESI
                     GGSLQKFADLKDEIARLTVSVDQIDKQLELLNHFILKAELTNNQKQLKLLRKSQLALI
                     RDMDNKELLKQQLIICQNANSLYKKTKVAIKSYFVDSSHNDGRAVVYYLISVEHINKG
                     QVATWTVPRRFNEFYNLHNYMKAKYKSSLKSVRHRESFPKKVSLFLSLQTREMLRRER
                     KIKLERYIRTLLKLPEICQDDLLRKFLTDSTAFSESSIIITSINSKEAKESSSAEGSI
                     RSLTPENDVIRQNNSSCAAVALDASDENDDEFSFFEDGRSSIESNDIQTNEHDRTFVK
                     AICDMFISVFLLNKANTGWLRGRAIVTILQQLMGSAIEKYIVDTMARLTSESQISGFL
                     TLLKDKLRENGVRRNERSKPERLPAEIERTRARSKIMFKCLFTEVCGKVVGLKNAQEA
                     AALLHEMAQNSYLTTSLLLEILDTLYEELLLCSRQISCDTQSPKSSPVETRNLD"
     gene            complement(<127418..>127954)
                     /locus_tag="HG536_0H00760"
                     /db_xref="GeneID:59327967"
     mRNA            complement(<127418..>127954)
                     /locus_tag="HG536_0H00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285479.1"
                     /db_xref="GeneID:59327967"
     CDS             complement(127418..127954)
                     /locus_tag="HG536_0H00760"
                     /inference="similar to AA sequence:RefSeq:NP_013996.2"
                     /note="ancestral locus Anc_8.823"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141375.1"
                     /db_xref="GeneID:59327967"
                     /translation="MDSKEYLISYGWKEGEALRKGGLKKPILVKHKKDKKGLGCAPGQ
                     DDSEAWWERLFDGQLKNLDVSCSSTSGKIEFKQNESVATGVSKSVSPLYRWFVRGEGL
                     KGTIGHTPLKSSVVVASQKRKRHDKDGEELRKLKNARKEKKREKKEKKKHRREKKLKK
                     QKRKEAESLRDDAIACSS"
     gene            <128181..>129431
                     /locus_tag="HG536_0H00770"
                     /db_xref="GeneID:59327968"
     mRNA            <128181..>129431
                     /locus_tag="HG536_0H00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285480.1"
                     /db_xref="GeneID:59327968"
     CDS             128181..129431
                     /locus_tag="HG536_0H00770"
                     /inference="similar to AA sequence:RefSeq:NP_013995.1"
                     /note="ancestral locus Anc_8.822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141376.1"
                     /db_xref="GeneID:59327968"
                     /translation="MKRLFEGGDLPRSKKNGAKTGTRREVTTVLVRNLPKSYNQAKVR
                     KYFLDCGEIREVSVSDSLDKSSRLARIQFGRHDEAITALTKTYKRIGQSEITVSLLEN
                     CTIWVTNFPPFYTARNVKELVQSVNVVVLSVRLPSLRYDSNRRFAYVDVSSTTEVVTA
                     VEELNGRVIERYRLVVKKSNPLEKAQRTDYGAAERREVMVRQLSKQQLTEQYLRQHFS
                     ECGPVESVVVPANQIESSEGYAFITFQDQSAAKAAVQVEKLDGKQVQVILADKKAFIE
                     RQKVKRIMTSRLTDDRIIALYPLSDKTSKSQIEALLLDKVIATRDAINEILLVTDRQA
                     AFVSFKEPQVAAKCIISLNGVEFQRQILHCGTVSDLRHPKVDKTQNRPSLGNETPSPK
                     PALEDREDGQKLSNNDFRKMFLGK"
     gene            complement(<129491..>134359)
                     /locus_tag="HG536_0H00780"
                     /db_xref="GeneID:59327969"
     mRNA            complement(<129491..>134359)
                     /locus_tag="HG536_0H00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285481.1"
                     /db_xref="GeneID:59327969"
     CDS             complement(129491..134359)
                     /locus_tag="HG536_0H00780"
                     /inference="similar to AA sequence:RefSeq:NP_013604.1"
                     /note="ancestral locus Anc_8.821"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141377.1"
                     /db_xref="GeneID:59327969"
                     /translation="MTSDVAVGDLSFVDVASFLRSYQPGRTGLDSNHNVLEQFLLINI
                     SAIVCISSFQGNQDAMQNLKPLKSIELRGFTCQTIAESSCSQAISLVKLTGLDYKELL
                     RVFTQAKSKISPRLTSVQLAHRAFQERNAVLDILLSLLNDKELATSQEKVMDTIIKKK
                     SEICTDMIRLLREITLDLSAEPEDVSSDLSEREVAEILQLKKCQNLIYLTNILRALTM
                     LVLNVSVPIDVVHLWFDFLNETRLSLHTMCSGNTSIPKLISAKIESLITLVTLLMLGL
                     DSTTLSIDLDAPYYQDVECFKKINLVLKKDFISPVVLYMWSFILFFKSCAFEENPDRE
                     VQFIQKVFADESIHDVMTIFAARAESGDVFGSIKKLSVALSAESLYSAIISAYVSLSI
                     NFIPLNSHSSDMIKDVLLKAPKEFIESFLSDGEFEKKLTVLKAKLPLIDEALLPLINL
                     TTVHPQFANFEWKSLSTYAVKSKLAAFNYDISDGGEAADLIVLKEETYVKPPLEFDKN
                     VYLPLPEDTKGKILPVAPSSDEEVIVFIYEYSGWALLGRVLQNICELYVRNDRKLKTH
                     TRDIMISIIELTTQIVSPATPFERSMEIIEYLSASVTEGDIVSVILRILDHSLHKRNY
                     EVASICSEFLFSLFPNYPHFVWSHIARSDLLDRYGKTGLASTILGSVELATGKYDFTL
                     SLVKLADEMASESISLESGFSSRTKKDILEKLTNYLIDIFESYQYWKYANVLQRFEMG
                     YYLTSFFTKVLYAVYGLDPGSSPSEKVTKTLSVCGTTIMDAFLGSRAPGVRPAKALLN
                     ILLSFENSQIALVGDGAFGYVCSRLVKQSFELASLLISLRGLLKMAPSSLEKMMYASS
                     PKLVDIYNLHPSLKRHVVRLFHSLVKVPWSENYLFLLSFLGEEHAEILLNSISSDLDS
                     PLSNHKLSKDLYIFFGALMESKQDGLSILFLTGSIATNETQSQQEETIGKTSVLSILK
                     KNALNLNALPDDVACCLLDSIAYAFNTWANAKDCDADAELISVLLHKVKAFAAKEVRS
                     VNDMNAELVRYRLISRIVEIFALYLFTSSEIDSQISSLLNRQDLAQFIRPFFQLNGYD
                     KPLHDSLSKRFEEKWPKLKLSRFAVTPLYNTGIFSQDSIFAISLMDQIFGDDEKWMGS
                     ETTDGYRDEIIVASSNLKYVTHKIAAAKAWGALLTTFVKKNSQPLQASFLDLAACFLQ
                     INLDMGIEVPLFAGVYCERLQLVFYILYSFQKKAEPVGEKILFQLLELLAAVFKTDEV
                     GFVSNIGHSARKNFYRPVLRSILLVLSFVTTGTHFIEMESDTLLELFELSFSKGVYLI
                     LSEILSDISTSTSSGRQVTIYNMEERVQDLFLMLSIFTTIKALRPPNRFNLIMASSLR
                     EVGTLKVILNLYSSSHLFKFNGESVFGPLTLTFISELCTVSHIAESFIASGLFAVILE
                     SPLSVAIQQGGIQPERQTNLHSVWTNGILSVILLLLSQFGGKIMPECCLFASYFSQQI
                     RSAIYRWSDSKPAVSSALIRETSQLILFQRIMRTLDYQQFLTKSPARYEIGDQQEEVE
                     LIVGLDTAHERKALKNTLNRLLTHPKYLNSRIVPTSLEEQHLLENETTRLEFVKTICK
                     HIKELQECLSEA"
     gene            complement(<134508..>135407)
                     /locus_tag="HG536_0H00790"
                     /db_xref="GeneID:59327970"
     mRNA            complement(<134508..>135407)
                     /locus_tag="HG536_0H00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285482.1"
                     /db_xref="GeneID:59327970"
     CDS             complement(134508..135407)
                     /locus_tag="HG536_0H00790"
                     /inference="similar to AA sequence:RefSeq:NP_013994.1"
                     /note="ancestral locus Anc_8.820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141378.1"
                     /db_xref="GeneID:59327970"
                     /translation="MSKISLARIAQLKRVLISTRKFHSVERGSKYSASYRNYLKLANG
                     EIGSYFHDVPLELDANNRTANMVVEVPRWSNAKFEISGKLEFNPIVQDTKKGKVRFVH
                     NIFPYHGYIHNYGALPQTWEDPSRASVDGLKGDNDPLDCCEIGSKILTTGTIQKVKIL
                     GSLALIDDGELDWKVIAISVDDPLANEIEGLDDVERKLPGILDATREWFRNYKIPAGK
                     PANSFAFDEEYRGIDDTIATIKVCGGAWQTLIDGTLLAQEDDCQVTRAGKGITMKPDL
                     KPPHEIPSEVNKWSFLYRDLPGQ"
     gene            complement(<135612..>138332)
                     /locus_tag="HG536_0H00800"
                     /db_xref="GeneID:59327971"
     mRNA            complement(<135612..>138332)
                     /locus_tag="HG536_0H00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285483.1"
                     /db_xref="GeneID:59327971"
     CDS             complement(135612..138332)
                     /locus_tag="HG536_0H00800"
                     /inference="similar to AA sequence:RefSeq:NP_013993.1"
                     /note="ancestral locus Anc_8.819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141379.1"
                     /db_xref="GeneID:59327971"
                     /translation="MAGEAKSEGTSTSQVLTAIVSNSTIFGIFMAIFLVLRLKLKRMY
                     EPKSSFDLISDEKKPEPLPRGLWQWLLPLLKKSDNFVIQQAGLDGYFFLRYLFLVCAY
                     CVVSMAYMFPILFSVNASNGNHESGLDQLAFQNVKHSGRYYAHVFCGWVFYWIFMFVV
                     YRELYFYNSMRQVVLSSPRYAKKLSSRTVLFQTVPEQYLSEREFAKLFNGVQRVWITR
                     GGNNKLAKKVDKRDSMVTQLENVLNKYIKSGVKKVKKIRKKTPDAMVSSDISQYIPEN
                     KRPTHRLKPLIGRKVDSISYLSEMIPKLNKEVEELQANYINQYPFNSVFVEFESQYQA
                     QVALQTVTHHLPMSMTPSFVGIEASDIIWMNMRLYWSERIARNVVAIAAIIALAAFWA
                     IPVAFVGMVSSITYLTNKLPWLKFIYQLPKPLLGLLTSLAPTIALAWLMSMLPVIIRF
                     LAKVNGAVSLQGVEYFTQQGYFVFQVVQVFLVTTLSSAVTSTATQIAEQPTRAMTLLA
                     SNLPKSSNFFISYIILTGMSVSSGSLAQIIPLFFRYVFGYLLDSTPRKKWSRFIDLDA
                     PGWGTTYPVYTNLAVIIFSYAVISPIILLFAACGFFLLYVAYLYILLYIQKEAPDMRG
                     ICYPRALFQTLVGIYIGQVCMLGLFAVGTGWGPIVLQVVSLVVTTFIHLKLNSAFDHL
                     MKFVPVDTMKALDGKSDTPSFKNIYNDQLEEDEIRELPKFSIKKYESKNPFSSHSDRV
                     SSLLSEKTIEYNDNVKYHENSENRITWIPLLADGVRSQIPPAPFYKRFLLPHIYCSFQ
                     AVKSKLPEIYGLFDPEEAVSEEKIASSYNYPPANATCPSVWIPKDPYGFSTHQVEQLN
                     TIVDISDSNASIDEKGKVTWREGPPTANTAEDQRDPADVKGTRDPFSDKK"
     gene            140021..140131
                     /locus_tag="HG536_0Htrna5P"
                     /db_xref="GeneID:59328401"
     tRNA            join(140021..140057,140095..140131)
                     /locus_tag="HG536_0Htrna5P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:59328401"
     gene            <140532..>141752
                     /locus_tag="HG536_0H00810"
                     /db_xref="GeneID:59327972"
     mRNA            <140532..>141752
                     /locus_tag="HG536_0H00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285484.1"
                     /db_xref="GeneID:59327972"
     CDS             140532..141752
                     /locus_tag="HG536_0H00810"
                     /inference="similar to AA sequence:RefSeq:NP_013992.1"
                     /note="ancestral locus Anc_8.818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141380.1"
                     /db_xref="GeneID:59327972"
                     /translation="MEDHGPLRKWNSCKDHLLIPATPRSGITKLHVYDFDNTLYCSPH
                     PNRQLYTKVLYDTLFNSSTILDGGWWSEPSFLEQSFRDMLNSDEEQQAQYWNQEIIKL
                     AQTSYEDPHTISVVLTGRKEVYFHDIFNEMFSSFGKAFFNAICLKRANISSTTAEYKI
                     SLIEDFLDHYKSLQELIVYDDRLAQVKKFEKVFGRDKVIHVQPSFKMLDMSEETRLVG
                     QIFQRSKMKECLAWTPKAAGFILDYSSHKKLVRWTFNFFRKKYKMSSLPQWPTYIPLT
                     FESDLEIARIWSNNDLVTVQSQDKVKQICDSFYSQPNLQGEKMFQFDVVKMGYSVTDK
                     RRSKVTIFYKAIPADNAYVSSTSQTMFVISTEEETTRNPSIAIGVRWASLDRRIRVRT
                     CFGHSERLTYVAKP"
     gene            <142516..>143988
                     /locus_tag="HG536_0H00820"
                     /db_xref="GeneID:59327973"
     mRNA            <142516..>143988
                     /locus_tag="HG536_0H00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285485.1"
                     /db_xref="GeneID:59327973"
     CDS             142516..143988
                     /locus_tag="HG536_0H00820"
                     /inference="similar to AA sequence:RefSeq:NP_013605.1"
                     /note="ancestral locus Anc_8.817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141381.1"
                     /db_xref="GeneID:59327973"
                     /translation="MEASNLQIYWHESQPIYSLCFQPSQDAKPKLVTAGGDNRIRVWH
                     LNFDEVSKNKIDTIDYLSSLNQHEQAVNVVRFNHSGDILASAGDDGQLLLWKLNETKI
                     KEFGVDEAEFEEFNETWSVWKRLRSGGGGGAYEIYDIAWSPQDEYIVTGSMDNSIRIF
                     HVTSGECISHLTDHNHYVQGVFWDPLDQYIISQSADRAVHVYEIIRSQGQDDKLQIKL
                     KNKIMKCELPQWQKDTDRLDLTKTKLSFLFHNETLPSFFRRPAISSCGSLFCIPAGIM
                     KSDAGPETAGSSDSNSAVYLYTRASIKSGSNKPSMCLPFLKKPAIAVSFHPCLYELSP
                     NNTSYLKLPYKLVFAVATSNEVLIYDTENVKPLAIVGNLHYTPLTDLAWSPDGNLLMI
                     SSTDGFCSYISFHADTFGRRISAENSARLLATFQSSETLEKPKGPLTAATKVSSGDIV
                     NILPIKRKDSTRDNKLTNESDDTNTQDDKGKRRVQPTLVT"
     gene            complement(<144112..>144711)
                     /locus_tag="HG536_0H00830"
                     /db_xref="GeneID:59327974"
     mRNA            complement(<144112..>144711)
                     /locus_tag="HG536_0H00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285486.1"
                     /db_xref="GeneID:59327974"
     CDS             complement(144112..144711)
                     /locus_tag="HG536_0H00830"
                     /inference="similar to AA sequence:RefSeq:NP_013991.1"
                     /note="ancestral locus Anc_8.816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141382.1"
                     /db_xref="GeneID:59327974"
                     /translation="MDKSTVTFLVTIIIGFILLKWFTQAEQHPSARQLAGEETGQTRG
                     ANAGHQQATESSRQFATRRVRRAVTPDMIEVVQSLAPHLHVEQIRYSLEQTGSVEETV
                     ERFLRGDDFPYPPGYRATPANRASPRGTVDHGDPRKKDNIRPDNLLEKFNVDLSEDLS
                     GQDVKDMDIEARKKFMVWQARRNLEKRLETDESLRSLVN"
     gene            complement(<144882..>145388)
                     /locus_tag="HG536_0H00840"
                     /db_xref="GeneID:59327975"
     mRNA            complement(<144882..>145388)
                     /locus_tag="HG536_0H00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285487.1"
                     /db_xref="GeneID:59327975"
     CDS             complement(144882..145388)
                     /locus_tag="HG536_0H00840"
                     /inference="similar to AA sequence:RefSeq:NP_013990.1"
                     /note="ancestral locus Anc_8.815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141383.1"
                     /db_xref="GeneID:59327975"
                     /translation="MARNTNSNSESESRARSTNVNAAATAASTGSRSNVKQRLTAAQQ
                     QYIKELVRTSITNNHPSLTRKPDPVDFESYSDDFLRRYKDHYHIPMADNMTLRGYLLG
                     SDLGSKTHSYKQNRPGSQNARVFKKDLASEVKKHFTSHTVKETECIPHFIYKVKSQKR
                     RFRMEFKG"
     gene            complement(<145497..>146411)
                     /locus_tag="HG536_0H00850"
                     /db_xref="GeneID:59327976"
     mRNA            complement(<145497..>146411)
                     /locus_tag="HG536_0H00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285488.1"
                     /db_xref="GeneID:59327976"
     CDS             complement(145497..146411)
                     /locus_tag="HG536_0H00850"
                     /inference="similar to AA sequence:RefSeq:NP_013989.2"
                     /note="ancestral locus Anc_8.814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141384.1"
                     /db_xref="GeneID:59327976"
                     /translation="MSRFVDAHCHVSSGDELHGELDVEGPTLRCVMSNNGFDWERLKT
                     VGDAGRLRRGFGVHPWYCHLYSLGETDKRSHYESVLEWKDDDAFESLLERLPEPVPME
                     EYISREFDPSKVDVVGEIGLDRMFRLPESGYYVHSKRQAPLSRVKVKMAHQMAVFQRF
                     CRLARESRKPVSIHDVRCHGVLFETCVREILPCEEVRVCLHSYTGSPQTLTECWLRRF
                     PEDRLFLSVSKYINFRTEDVGEQLLKLVPPRCILTETDFPVDIEPEEDLQDQLEYTCR
                     QLARVLRLGELDEVKALIYDNYQRFVAS"
     gene            <146750..>149989
                     /locus_tag="HG536_0H00860"
                     /db_xref="GeneID:59327977"
     mRNA            <146750..>149989
                     /locus_tag="HG536_0H00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285489.1"
                     /db_xref="GeneID:59327977"
     CDS             146750..149989
                     /locus_tag="HG536_0H00860"
                     /inference="similar to AA sequence:RefSeq:NP_013608.1"
                     /note="ancestral locus Anc_8.813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141385.1"
                     /db_xref="GeneID:59327977"
                     /translation="MAIIIASLFLPHQPQFELEGPLDEKQGLVDSNLVKINESSASLG
                     RKRASSVHSNSPFTGYDGSQELLKPADGTRSRVASPAPGGGVRQEELLSSEKFMKSLT
                     AHGTQASTPANAVVSGSQSGSAQEFFSNKDIVSPFASVPGSPGLDAAGPGAVSQDSTA
                     NLLKNVNKSLLYQSVLNSANTSQSALEGRAKLDRRSSSGTVITPKSRAVPDVHSAVVD
                     FAKVKQQQQSSSLPAMKRVPRTVSMNSVSAKSGPSHLKYSQMAKDLENTFSDESYISE
                     SDSEEVVANGSESDLEMEQELHYHVPKFGGYSNNAKLRASLLLSSHELFGRVPWKIVP
                     SLKGNGALRNAVQNATAEKIIKDKVTWVGTIGIPTDEIPENVSRQISKKLSAEYNSEA
                     VLTDDVTFKGAYKNFCKQILWPSLHYEIPDNPNSKAFENHSWNYYRQLNQLFADKIIS
                     TYKAGDTIWIHDYHLMLVPEMVREALPHAKIGFFLHVSFPSSEVFRCFAQREKILKGI
                     LGSNFVGFQTKEYARHFMQTANKLLMSDVIDNEIKFKGKIVTVHNTPVGIDLFRLNSQ
                     LKNERVLQWRQLIQDKWKDKLLIVCRDQFDRVRGLKKKMLAYERFLKENPEYAEKVTM
                     IQICIGAQRDAELERSVMLVVDRINSLSANLSTSQPVVFLHQDLDFEQYLALSCEADM
                     FMVDPLREGMNLTCHEFIACSEEKHAPLLLSEFTGSAEILKDGALLVNPWDIESVSQM
                     IKKALEMPPEEKRLRWKKMVKSVINNDSDNWITTSLQDINNSWEFNKERSTVFNLSVD
                     QILSDYRESKKHLFIFKISEPPTYRMISILNDLSAKNIVYVMNSFSKTTLESLYSRVA
                     NLGLIAENGAYVRLNNVWYNIVEQVDWKSEVVKILDDKVERLPGSYYKIADSMIRFHT
                     ENAEDQDRVAGVVGEAITHINTLFDEKGIHAYLHKNIVFVQEQGLSSTATQFLLKFYN
                     SRTDAYDNSSMPVTPADIGSTATTRGGYFTSKGKSQYHVDFACVTGSSSPAIEPIFQL
                     IKEEISRGTLRFGYSLVYDGATSTYAKEHVDGLNGLFAILQDITRTPHR"
     gene            <150207..>150668
                     /locus_tag="HG536_0H00870"
                     /db_xref="GeneID:59327978"
     mRNA            <150207..>150668
                     /locus_tag="HG536_0H00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285490.1"
                     /db_xref="GeneID:59327978"
     CDS             150207..150668
                     /locus_tag="HG536_0H00870"
                     /inference="similar to AA sequence:RefSeq:NP_013987.1"
                     /note="ancestral locus Anc_8.812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141386.1"
                     /db_xref="GeneID:59327978"
                     /translation="MGKKNTKGGKKGRRGKNESDGPKRELYYKEEGQEYAQITKMLGN
                     GRVEATCFDGVRRMAHIRGKLRKRVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEART
                     LKNQGELPENAKINETDNFGFESDEDVNFEFGNADEEEEEEDDEELDIDDI"
     gene            <150968..>155242
                     /locus_tag="HG536_0H00880"
                     /db_xref="GeneID:59327979"
     mRNA            <150968..>155242
                     /locus_tag="HG536_0H00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285491.1"
                     /db_xref="GeneID:59327979"
     CDS             150968..155242
                     /locus_tag="HG536_0H00880"
                     /inference="similar to AA sequence:RefSeq:NP_013986.1"
                     /note="ancestral locus Anc_8.811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141387.1"
                     /db_xref="GeneID:59327979"
                     /translation="MNQDARESIESIKDLLLKYNPSKIGPDNQEEVLKQFVECCQELF
                     VYFQKKTDGISDSLALLATDTFSIWVLRTSQVISHKKIDTSGYIKVVKDEILTFEGST
                     VIFEYVVDFWKNGNPAFINALKNLFTKLLHLMRLIHPRTECDKLFSSWLDRTFQVPSD
                     LAVQYYLIEALAEELDLYPVLQKRPTFVDESLRLMQSDILSNPVGKSLCKILTNAFYN
                     HFGGDLSNLPSWLGFWQEPVIFHLSNQKCRKSIELYILQPMFKEVPPNAFRAFVKGIP
                     RHNPSVLLSVIRVGQELGIEEEPFHNDRLIPIDMIGSFLKLDESKLAAFELLTFATKK
                     SSPIHSNIFHLIKENLTIFFVDTRIEVRNYFCSSFKHFIYRIRDSAHSLHKRASSLKR
                     AGKFPAEQKAKFGYVQECQSFLEWLLGFLKLQICPGTQYQRNDVALKLFNIIIESGLD
                     ASIPAKYLDMKNPRSYPFSVPIFRDNSIVRLLLDCLASNFADIRQMAKMLLLQALEGS
                     DSSILKKSIDWNYLKTQADSLLRQYQYSDIGAALESTRFCAAPDKVAFVEGMIDTLHE
                     KICNSKEDFLRHIHEPISGYLTSLTLILEDNQLEEIITGPIVEKCIEIVLINWSAVKH
                     VICHESCEDNLWMMYPDGNIDAQLVLSTAFRTTKESSMLLRVLLSKYALSPDQLIVIG
                     DFLINQLFDIRHSGAFQSVTPTFSVLCLRCKKENASQLLEWLRTVLESVEVKTQNVTR
                     RSGGIPPMLTVILSAESGKERPLLKYAFERLIKIASTAMEEHQDKVDLPQVNAFNCIK
                     AIFTESKLSQASEPYTPAALSLALKTFDSDTWALRNCSIMLFTSLQNRLFGKSGKSVS
                     ARMFFTRYPGIREDLLEILRPASTVTKDRSQIESTFLVLSVLLRLKPTPGYKGLDAFN
                     SEVKKSLESSNWKIRELAARCISSLAENPIEISRELADRMNIKHQNSLHGYLLAISEM
                     IPSLKSFNNEQLSGLIETLHRKCNELLGHNKCFLTAKLYISLMGNILEFIDDDIFRDQ
                     QDSLLNYITQFFNQHSRLYTINGSKQICLAAALETLFKYGEGECVSTLLEQAICSPFY
                     EVQEVALRFAMNSHKNMPHITKTFIDSIIRLANDEDIAPSVRSLSLRVLKNLDEKTDL
                     HLLMDIIEKPPSEDLQVAAIESLGKNVTLDNVEILEKLSEQYYADGQPVDFRIACFQS
                     MIDYPEVSNNVRLLLILNQMLSDDDEDIRLAVASSLNRIFRLTGDSETLNPVETSRML
                     LTRIVKHFDVKLVAENVIRILKEFFEGYDLFAPEIRGNCVFETEKDNQFRNDFELNLQ
                     YARLLQITGYDDQFVHWLVALKDKVIAYLHATGMRDGPFGWVSSGEVFSRLLLLRALL
                     ALIGTRHILNFDQVLIDSRIHPVILNHEFLDSINLSTARLNEMSLS"
     gene            156091..156164
                     /locus_tag="HG536_0Htrna7N"
                     /db_xref="GeneID:59328405"
     tRNA            156091..156164
                     /locus_tag="HG536_0Htrna7N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:59328405"
     gene            <156309..>157967
                     /locus_tag="HG536_0H00890"
                     /db_xref="GeneID:59327980"
     mRNA            <156309..>157967
                     /locus_tag="HG536_0H00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285492.1"
                     /db_xref="GeneID:59327980"
     CDS             156309..157967
                     /locus_tag="HG536_0H00890"
                     /inference="similar to AA sequence:RefSeq:NP_013985.1"
                     /note="ancestral locus Anc_8.810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141388.1"
                     /db_xref="GeneID:59327980"
                     /translation="MVEKDQLLTILSKTSFFLNQNDLLSLAQTSRKLHDSLAIEKLYH
                     NITVTRDPVRRSDFWFIDCGRSYLSGYRALKKSADQNDLFLYDRIERLLESRHLRHLR
                     QLVIQDSVFQDRKTGDPLLRQLLDKVIDLDQVELLDIRDPLLFHEYKAKILNLSNLKS
                     IRLIDIASIERTKSLAGLTSIEWALQYPSMPDKPLPSHVVEFLSNKLAKAELMFDNAE
                     TSSLLLISYLHSQGVKCSSLKSLKLNHVHGKNSHDRHLHQIEFGHLEEMVNLQTLQKL
                     ELGLSCENVGCGCVDDFLQDLAPRLQSLKELALIEKSTAVSTDHQAKEDWDIMINKFL
                     LHIPDVGANLRKLSIRHQTPLNGLSDDSVHGNYFRRRTLYETVLPKLKSLQTLIAPTM
                     LQSLSAYEVLVCDLLWNGCQCDYCGKVLPIFDQYIMNHQYYSKESGRYMDVIPTVFFA
                     YAGDFLTHNSMDLVEWDLEAFNCCLFYRAWDLHGYEALHHFENYDCLFDESTFHPLSV
                     VITHFFDSYMDSLVQILPSLRTALLSGIYYAVDNESHSYESVYS"
     gene            <159028..>161409
                     /locus_tag="HG536_0H00900"
                     /db_xref="GeneID:59327981"
     mRNA            <159028..>161409
                     /locus_tag="HG536_0H00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285493.1"
                     /db_xref="GeneID:59327981"
     CDS             159028..161409
                     /locus_tag="HG536_0H00900"
                     /inference="similar to AA sequence:RefSeq:NP_013984.1"
                     /note="ancestral locus Anc_8.809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141389.1"
                     /db_xref="GeneID:59327981"
                     /translation="MLRRKPFLCPTVRIFHLFEAGWTVSQTHRYFTCLRSAERESEDD
                     IADWVKGSLYEPIPSQHFQVPGSNHGGFASKILHPPLKVVSEESYLKEWHARFVEADL
                     RTVSLVLEGIRNKTMLFSLPHLMTLLRSLHSIRRYYEIHEIYCVLEDCASFIKDEDTY
                     PNIRQEFLKIVLNAEDILGNYKLCESVFSEYIKLPTLERYSISIGLKSFLRNDNLQLA
                     KQFFIQILENPETFPITKTEFKMFCRELSNLQDLDSMMFIFKLWVKKRCMRDGSITCC
                     DLDYETLSLFHRLFIQSGDRKGLEEFLEHEVVKKTGYQADVVFQITEFCQSLHQIKRE
                     SSSVEDATTKKIDKFLTILEGRPIDRRHFCLSVLDALVMGDDFSSIRHVIEKVQQDKE
                     IHLDGSFHLTIAKFFVRHGMLNQMVQYYSDIVLNRAAGRIRLKISHVEQLWDCALQAY
                     PTLTREITNELKVILTKKQYIRAFPQLHQVLKQTSKVRKRKVMGGEEHFKSGLPQVDY
                     ERLRRFESFIASHDIASATDTALESLKRGTKPHFDFYLCAIRECLSSSLPNLAKTLSD
                     MLSKRYKVPLKLNILWLRYDIASKYQSTISQSEMLSFRKVPLLEAQLAEFVRLHRESL
                     NFQNYLQLSQISILIRDYNHADILISEAANLIDKRSRQQWLMYYMTALKIAARLYRAD
                     DFLALLRAWNQNGDAKLVTRGCIRQVKAYRKLFEKRADRLAAVHNASLADISKEIELL
                     VEKHVFFKFEGLNESRKLYTLLQRWLSQEIKELLRIERKRRKTLTSTAYSDKA"
     gene            <161732..>163459
                     /locus_tag="HG536_0H00910"
                     /db_xref="GeneID:59327982"
     mRNA            <161732..>163459
                     /locus_tag="HG536_0H00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285494.1"
                     /db_xref="GeneID:59327982"
     CDS             161732..163459
                     /locus_tag="HG536_0H00910"
                     /inference="similar to AA sequence:RefSeq:NP_014587.1"
                     /note="ancestral locus Anc_8.808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141390.1"
                     /db_xref="GeneID:59327982"
                     /translation="MSSSGDTTGVTPLAELLFRKSEECQKEVLLKVIDSLICSICQDY
                     MYVPMMIQCGHNYCYGCLSAWFNSNPEEELSCPHCRGNVVNMPCLNSALQQLLQTVIE
                     ASSAGKGDKIDDSKLKKVLDAKKLCEDEYRKDFKGDQLFRGVFRNTAVGIADEEDDGI
                     LRCSNCHWELEDDEDDVCPHCNLRIRSRARPARASPSESEEEYDAALEEHLESQYPYL
                     DGSWFEETGRAAYSYAATIASLVRGRTADELLERCYNSEPSPIYRDPHFPLVFVSFSL
                     ADGTVVHFPSYILYLSLVNPRKGEREARAISILERLQNVELSQREGAIDDLLSHYSDF
                     IREHVVSPAPFQREVRKYGALATKYETLVREELEKSPSEDYSSPSALSPSGLDEYNYP
                     FLVERKTTKGERLVFPSFSIFVRADPELTENERNRALPLARRLEQAVINRGDFSQMAR
                     TTSQDEEYDSVNDFIASDDDGVTDGIADLRTGSGSSEGSTGEGPDSEDPDSDYFEHNE
                     GDGYVSGDSLDDGDHAVRTRPEFSDQDSGQEQDEQDNDEEDDDESSRVRIPRKRNRAI
                     VDISDDDSA"
     gene            <163649..>163828
                     /locus_tag="HG536_0H00920"
                     /db_xref="GeneID:59327983"
     mRNA            <163649..>163828
                     /locus_tag="HG536_0H00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285495.1"
                     /db_xref="GeneID:59327983"
     CDS             163649..163828
                     /locus_tag="HG536_0H00920"
                     /inference="similar to AA sequence:RefSeq:NP_013983.1"
                     /note="ancestral locus Anc_8.807"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141391.1"
                     /db_xref="GeneID:59327983"
                     /translation="MSNRIIELQKLFQSSTKPLWWRHPRSAFYLYPFYGLMAVAVVAP
                     LLYIPNAVRGIKAKK"
     gene            <164241..>165260
                     /locus_tag="HG536_0H00930"
                     /db_xref="GeneID:59327984"
     mRNA            <164241..>165260
                     /locus_tag="HG536_0H00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285496.1"
                     /db_xref="GeneID:59327984"
     CDS             164241..165260
                     /locus_tag="HG536_0H00930"
                     /inference="similar to AA sequence:RefSeq:NP_014588.1"
                     /note="ancestral locus Anc_8.806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141392.1"
                     /db_xref="GeneID:59327984"
                     /translation="MIHTRLFCTRYIGGFGHRVRYLRQSGRWFATKPEDPKYVFSKPP
                     EQAATQHDGTHNDVRNAKYIFSTPIEQVEDSRDGNEESNVLAQAILHQRRKRRKQMAR
                     FVLFGLVGSVLGYSVGYKVLYLREQSFIPLFPASRIRKLSDRDRTRIDVDGVKKLSQT
                     RVLQQLSQHEMIKEQYGVPLHDTETNEIPQLQEFSIWCEDQDFSVTGILIEPNDGRSS
                     SHQWYRIPFLVKWRLTHRPLSIHKFVDELMESIGRSSSDLYQIIAPERVYGSFKYEFP
                     LRGDNQAKHIWFLGEMRLSNDSLVVYKGKYHVDVKLEEIDLLRKEEGKLVRYILYRED
                     ESIRK"
     gene            complement(<165272..>165664)
                     /locus_tag="HG536_0H00940"
                     /db_xref="GeneID:59327985"
     mRNA            complement(<165272..>165664)
                     /locus_tag="HG536_0H00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285497.1"
                     /db_xref="GeneID:59327985"
     CDS             complement(165272..165664)
                     /locus_tag="HG536_0H00940"
                     /inference="similar to AA sequence:RefSeq:NP_013982.1"
                     /note="ancestral locus Anc_8.805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141393.1"
                     /db_xref="GeneID:59327985"
                     /translation="MVLESKWADVPDVPPSGQPDKSSRRKAKPKTPRKKGPRDRKIPE
                     KEQNSPAPRLTFSLKDKPATPTDHSDKNELLKKKIEEQRKIYEKNQHQKQQKQLLDEF
                     LNGDTKLQWSDEDEEDEILAKLNKSLKI"
     gene            <165993..>167078
                     /locus_tag="HG536_0H00950"
                     /db_xref="GeneID:59327986"
     mRNA            <165993..>167078
                     /locus_tag="HG536_0H00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285498.1"
                     /db_xref="GeneID:59327986"
     CDS             165993..167078
                     /locus_tag="HG536_0H00950"
                     /inference="similar to AA sequence:RefSeq:NP_013980.1"
                     /note="ancestral locus Anc_8.804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141394.1"
                     /db_xref="GeneID:59327986"
                     /translation="MSKKDSSEELEVAGRLHSEQSRSTEYASPNAGLVLLVISYFFNS
                     SMVVSTKVLETDHEHAPGREPIKPLQILLVRMSITYVATLLYMFKNRSTIANVPFGPP
                     EMRKWLVLRGVMGFFGVFGLYFSLMYLSLSDAILITFLTPTVTVLLAWIALRERLTTV
                     EVIGSLVSFCGVVLIVRPSFIFGVATAPDGSAESENTTDRLIATVLSLVGVFGASSVY
                     IIIRHMGSKAHAILSVSYFSLVVTVISLLGVLLVPSMTMQTPTNLKQWLLFANLGVCG
                     FVFQYLLTLGIQKERAGRGTLMAYTQLIYAVFWDVALWHNWPKLWSWLGMLIIVGTAL
                     VVIRCKPEGELARISDEERESFQLEEM"
     gene            <167190..>167474
                     /locus_tag="HG536_0H00960"
                     /db_xref="GeneID:59327987"
     mRNA            <167190..>167474
                     /locus_tag="HG536_0H00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285499.1"
                     /db_xref="GeneID:59327987"
     CDS             167190..167474
                     /locus_tag="HG536_0H00960"
                     /inference="similar to AA sequence:RefSeq:NP_013979.1"
                     /note="ancestral locus Anc_8.803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141395.1"
                     /db_xref="GeneID:59327987"
                     /translation="MFGRAAKRLAFKTWYELDAREKQRFVDAFVDAHQRQYPWSRSNR
                     SLRALSARHDTRHQDSPSLFAVFYSDIRSNRCRRFSDPSFQRLLVEKKTH"
     gene            complement(<167627..>167803)
                     /locus_tag="HG536_0H00970"
                     /db_xref="GeneID:59327988"
     mRNA            complement(<167627..>167803)
                     /locus_tag="HG536_0H00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285500.1"
                     /db_xref="GeneID:59327988"
     CDS             complement(167627..167803)
                     /locus_tag="HG536_0H00970"
                     /inference="similar to AA sequence:RefSeq:NP_014589.1"
                     /note="ancestral locus Anc_8.802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141396.1"
                     /db_xref="GeneID:59327988"
                     /translation="MQFSKLVVSAVAFVGLASAQNASNQTTTGGAAALGGSNAALSAG
                     VVGAAAAGALAFLF"
     gene            complement(<168228..>170000)
                     /locus_tag="HG536_0H00980"
                     /db_xref="GeneID:59327989"
     mRNA            complement(<168228..>170000)
                     /locus_tag="HG536_0H00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285501.1"
                     /db_xref="GeneID:59327989"
     CDS             complement(168228..170000)
                     /locus_tag="HG536_0H00980"
                     /inference="similar to AA sequence:RefSeq:NP_013976.1"
                     /note="ancestral locus Anc_8.801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141397.1"
                     /db_xref="GeneID:59327989"
                     /translation="MLHRHSAKQKRPRTLVYHREELHSPKLEEAGLLPEQIHGLHLGT
                     VMENQSASENGGSHFQPNRYRIPQKGLPEATAYDLIHNELSLDGNPHLNLASFVNTET
                     SAIATKLITENINKNLADNDEYPQLIELTQRCISMLAQLWHCDEDKYDPLGCATTGSS
                     EAIMLGGLAMKKRWEHRMRGAGKSTAKPNILMSTASQVALEKFARYFDVECRLIPVSA
                     KSNHCLDPQLLWDYVDENTIGAFVILGTTYTGHLESVEHVCDVLTEIENAHPDWSNTE
                     IPIHVDGASGGFIVPFTFSERQMASYRMQRWGFNHPRVMSINASGHKFGLTTPGLGWV
                     LWRSEDLLADELKFKINYLGGVEESFGLNFSRPGFQVIHQYYNFVSLGRAGYHAHFAK
                     SIFVARAFCHELLVSERMPGFFEVVSSIHERIDAPPGRSRLPDSVNEYWEKPAEFKPG
                     VPLAAFKLSRAFHDQYPEIPQSMLAALLRSRGWIVPNYPLPSSTDGSDQHEVLRVVFR
                     SEMKLDLAQLLIVDIEHVVTKLIKSYKILLESLPANEHSQHRRDFVYKMLLKLASPTS
                     GDEPPLELQPERRESLSKNYKGTC"
     gene            complement(<170216..>171415)
                     /locus_tag="HG536_0H00990"
                     /db_xref="GeneID:59327990"
     mRNA            complement(<170216..>171415)
                     /locus_tag="HG536_0H00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285502.1"
                     /db_xref="GeneID:59327990"
     CDS             complement(170216..171415)
                     /locus_tag="HG536_0H00990"
                     /inference="similar to AA sequence:RefSeq:NP_014590.1"
                     /note="ancestral locus Anc_8.800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141398.1"
                     /db_xref="GeneID:59327990"
                     /translation="MTVTEKELTNHTYIDHELSANLDSAEAFEGPEKLLEIWFYADAQ
                     DIPEPRGTKKTLRDIEVAKWVEILKLVKCEVLSVRSTAVMDAFLLSESSLFVYDHKIT
                     LKTCGTTTTLLCLQLLFDTINTELGWDVCKRIESTGKYFPYKVFYSRRCFMFPLKQRS
                     IHKNWSNEVDYLNTFFSCGRSYLVGRNDESNHWNLYVTETNKSMVQKAKSEDPDETLE
                     ILMTGLDHERAKQFIRKRGLCEQQTAEKSEEDEGHMLGFNITKSTKLDLVYENNIKAA
                     FHHDAFAFTPCGYSANMMLDEEYYYTLHVTPEKGWSYASFESNVPVAKISQGKQDNVQ
                     VLNHVLQVFQPNDFCVTFFTKDDLKESYSRYMQIGEQVPGYSRRDRIIYDLEDYQLLY
                     MRFERSL"
     gene            171976..172048
                     /locus_tag="HG536_0Htrna10A"
                     /db_xref="GeneID:59328390"
     tRNA            171976..172048
                     /locus_tag="HG536_0Htrna10A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:59328390"
     gene            <172245..>176933
                     /locus_tag="HG536_0H01000"
                     /db_xref="GeneID:59327991"
     mRNA            <172245..>176933
                     /locus_tag="HG536_0H01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285503.1"
                     /db_xref="GeneID:59327991"
     CDS             172245..176933
                     /locus_tag="HG536_0H01000"
                     /inference="similar to AA sequence:RefSeq:NP_013975.1"
                     /note="ancestral locus Anc_8.799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141399.1"
                     /db_xref="GeneID:59327991"
                     /translation="MSFGGVNTFQQYSTDFGFGHNGVKLSFNYFDGFPEPSLLNSLAS
                     NDLKLIFKSLLKRDETTKEKALNDLLKLVENYTKNEGLFDSDIFFLCWSQVYPKLLVS
                     ESKTIRVSSHLVTSKLVKLLNKKVSKFLRDVMPLLLLGTCDTDSSVSKACNAFLNDIF
                     DCNTSKVNSLWSVFQEDILKITEELVVKENEETISDERFVGKEDSLLRFNRLITSAMQ
                     LLTNLISSDSFDSVKHEEITHDVLISECLWQLLSLTNTHFLKSYEAALVLQKTLYKNN
                     LLQRHKDVLKLSTKKLLKSLSHVNAKNSLKVAHLAGPILDNLTMLDHYQKGKIWTYDK
                     SARDRFLQFVVAASKNPVPGFFDALYKFYEESSSHELLDEKKQWLPLWRGSNDTLREK
                     QFLGRHGPELLGEFWANYRKFISHCSVPDVSEVAKEDVLNILRSGKQLSRLPSLKAAL
                     IDFLDPEIVANQIKAAVNQDDKEAGLLLNNLMLLLCSAANGEAALHDVASAMLELMSK
                     DQDDFGPKKQKVLEVYSYFVNSGIISVADEVTQFVYEVPTWIDKNTYKSLSIFISDYS
                     KSVIAHKDKNFATVMEDFITAASSAEGIAESRIVRTLNLLDNGVSPAVLSSTIVQDFV
                     QNYINSYAYNDYGELFNGRLIDEHNVVQLYEKSVEGKQTEFFLHHLSSLNYHALEALL
                     TESDFLSGNLFEGSLEQAESIYQLIKPLLNNGPIVKNLANAIISYAKTKPRLVGNDFV
                     LRIAEELITLQRDGLDIFVPPDLELVFFDAVPFIDYRLALVSSLKLNTHLFELSSDEL
                     NLSKAEQLIRYGLFLDALISRVPAGLDNKLSVFLTMVCDLAEDFNCLSEDPQEEITEF
                     KNTLFRGKLEGFSFEDVTDLVCQVNPNDERPLDILSHLIADSSSITVTYYHLRILQKI
                     LQNKIDSITSASFIRKLPSIERFVISTIRSKDKSQHNYLLCGIILSAAEKFTDLEIFG
                     KLRNVLASECIGVKENELLEKSYKNIILLSNLLQSQGSTESPPPIPYQRLNMMLNSLS
                     QWLDSDLAYESGFTQVRLSLLKLCALLARTPSITEASKGFYEFSMALLSDSLSMCLLD
                     DTYFLLELRLYCLVLHEELTKSVWKQHLNTGSDEMLSGLVELSLINFATEKNNQISAV
                     FYRTLFRVLSGYQVKQVVKFYPDVLSAFLSNEGFANINRTRMLFAELKRLVIERQKDA
                     FLELEFEKQKKQKKETEHQSDEGAGEDLPVNDKFELPPGLIEKMCVEIPEDYLECEDE
                     YGFLKYLWFWDLAFCFFNDASYDLRQKFIDQLRSRNLITIFFDFVSDQIDLQDTRFWS
                     EAGSAAIQEYSVQSNDFSPYREDLYPECKKLLGHSMYNMFLNVGSLTSNWWLNIKDRT
                     LQAKIEKFVTTFISPILITKELDEVAEKTSKLESNDTALTIKINKVTNEIKASYLIDE
                     QRLELSFKMPANYPLTNVEAIGLSRVGISEQKWKQWILSAQRVITGMNGSVVDSLDLF
                     SKNVNLQFSGFEECAICYSILHVVDRKLPTKTCPTCNNKFHGACLYKWFRSSGNNTCP
                     LCRSEIPFRR"
     gene            complement(<177217..>178263)
                     /locus_tag="HG536_0H01010"
                     /db_xref="GeneID:59327992"
     mRNA            complement(<177217..>178263)
                     /locus_tag="HG536_0H01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285504.1"
                     /db_xref="GeneID:59327992"
     CDS             complement(177217..178263)
                     /locus_tag="HG536_0H01010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141400.1"
                     /db_xref="GeneID:59327992"
                     /translation="MGLFGRKQRESTPPVERRDLTPCDRVFVDPPKNYGRPHPPPRIT
                     EEQFEKYTRMLEHFQDGALQLPLNSSSPEETRGLIAEEKCWLSRECLLRFLRAAKWDV
                     DQAVKNLTSTLVWRREVGLSRADDNVKPLGSEVVAVENQTGKQVILGFDINRSPLFYM
                     KNGRQNTEPSFRQVQLLIFMMECAVILAPQGVETITVLIDFKSYKEPGVISDKMPPLS
                     IAKLCLAVMQNHYPERLSKCVMFNIPWFAWAFLKMVHPFLDPRTRQKAIFDEPFENHI
                     DPSQLEAVYNGKLDFKYKHEIYWPDMVAKVEELNEKRFKRFVDFGGVVGLSEFDLKGS
                     GDDILYPVDYRNVV"
     gene            <178776..>180236
                     /locus_tag="HG536_0H01020"
                     /db_xref="GeneID:59327993"
     mRNA            <178776..>180236
                     /locus_tag="HG536_0H01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285505.1"
                     /db_xref="GeneID:59327993"
     CDS             178776..180236
                     /locus_tag="HG536_0H01020"
                     /inference="similar to AA sequence:RefSeq:NP_014965.3"
                     /note="ancestral locus Anc_8.798"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141401.1"
                     /db_xref="GeneID:59327993"
                     /translation="MLIWKRKFRLVLFVALGVAIVSCFVRAVVQFQLNKEIKYFKRYF
                     EQKKEHLEALYNPLAIKQIPEETIDLMYNLRLAGKKGPIDWSSYAYVNYATDANYLCN
                     TLIMFDALRKFGTKAKLLLLISRELVESEGSPDSQQVNKMLDQMKRDGGGQVVIKYVD
                     NIVKPADSSQWSQSMTKLLVFNQTEYERVIFLDNDATLNDKLDELFFIPDYIQFAAPV
                     SYWFLSEGDLAEAYREVRDYEKLPVNLARYTDKLHDRIKKGKMIYNHLPSLPPNLYLN
                     TENVAQDLIRSKFSLASLFDHHASDKSTKVKLASYVMVIKPSAEAFSSIMKSSVPIFL
                     KKKGKYDGDVINDDLFNLRKVLHTQFKTFRRLRSHFVPSVLVLPYARYGLLTGSIRDE
                     SQHVLLRNDVLGCQRLDTSGKEIEKDIAAITRNAKYVHFSDYPLAKPWQYQSVDEIKC
                     KVDETHSKDIDSGKKLCHLWNDLYSTYLNSRGLCTA"
     gene            complement(<180255..>180893)
                     /locus_tag="HG536_0H01030"
                     /db_xref="GeneID:59327994"
     mRNA            complement(<180255..>180893)
                     /locus_tag="HG536_0H01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285506.1"
                     /db_xref="GeneID:59327994"
     CDS             complement(180255..180893)
                     /locus_tag="HG536_0H01030"
                     /inference="similar to AA sequence:RefSeq:NP_014964.1"
                     /note="ancestral locus Anc_8.797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141402.1"
                     /db_xref="GeneID:59327994"
                     /translation="MNASVNNPETTVYVGNIDPTVTKEDLYELFVQVSPVAGIRYPKD
                     KVLQVHQGFAFVEFYTSEDCQYVIQLMNNCVQLYERTLKVRRANAQQSGDAASIDLKI
                     QPVAKIFVKDLDTSIDELHISKLFSKFGPLAGAPEIFYLTHGQVRCAYVYFKSYEHAD
                     NAIATLNGQLVVNKKLTIDYAFKENGKGNAKYGEEVDRLLNKEARKHGLLKW"
     gene            complement(<181154..>181609)
                     /locus_tag="HG536_0H01040"
                     /db_xref="GeneID:59327995"
     mRNA            complement(<181154..>181609)
                     /locus_tag="HG536_0H01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285507.1"
                     /db_xref="GeneID:59327995"
     CDS             complement(181154..181609)
                     /locus_tag="HG536_0H01040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141403.1"
                     /db_xref="GeneID:59327995"
                     /translation="MHFPFKTKNHLKRFSNNTSTDPHLRTTTFHGGDPISGPSLKVKW
                     KSSLCLLKDRIHKAHQTTPFFAVSHTWPGTDVALYGSETCSYQHHHRNHDLDLHQCEK
                     LTKRMSSKKENVKWLSKSISKRLSSHFNRTIKSKKSRKISTSNGSSLDW"
     gene            complement(<181780..>183870)
                     /locus_tag="HG536_0H01050"
                     /db_xref="GeneID:59327996"
     mRNA            complement(<181780..>183870)
                     /locus_tag="HG536_0H01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285508.1"
                     /db_xref="GeneID:59327996"
     CDS             complement(181780..183870)
                     /locus_tag="HG536_0H01050"
                     /inference="similar to AA sequence:RefSeq:NP_013974.1"
                     /note="ancestral locus Anc_8.796"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141404.1"
                     /db_xref="GeneID:59327996"
                     /translation="MARYTVEVGKAANEHETAPRRNVTNAKEAMIRPAGYSCDTVYEF
                     AMEAFGKGGSRQAMGWRDVVDIHEEKKMVTKKISGKEQQVEKTWQYFELTPYRYNTYK
                     ELITIMHDLGRGLVKIGVKPGQTEKLHIYASTSHKWMKMFLAAQSQNIPVVTAYDTLG
                     ESGLIHSMVQTGTNAMFTDNHLLQSLIRPLEQTPEIKYVIYNEAIEESDKRQNGQVYL
                     NAKNALNKLKEVRPDIKFYSFDELLETGRNAKDEVELSLPKAEDVSCIMYTSGSTGDP
                     KGVVLTHANIVAGIGGVSSNTSDIIGPRDRIIAFLPLAHIFELVFELISFWCGGVLGY
                     ATVKTLTSNSVRNCQGDLQEFKPTVMVGVAAVWETVRKGILAQINKLPVLSQKIFWTA
                     YHAKIKMKRYHIPGGDSLGNLVFKKIKQATGGNLRITLNGGYPISIDAQEFITNLMCP
                     MLIGYGLTETVANTCVLQPNRFELGVAGDLTGAVTVKLVDVEELGYLAKNNQGEVWIK
                     GASVLKEYYKNPEETAKVMTDDGWFKTGDIGEWTSNGHLKVIDRKKNLVKTQNGEYIA
                     LEKLEAVYRSNAYVQNICVYADQSKVKPVGIVVPNHGPLAELAVEVGVMKDGDDVESH
                     LHDSNLQKAVLERLLKTGKAQGLNGIELLEGVVFFHDEWTPQNGFVTSAQKLKRKEIL
                     NAVKEDVEKVYNEK"
     gene            <184325..>184672
                     /locus_tag="HG536_0H01060"
                     /db_xref="GeneID:59327997"
     mRNA            <184325..>184672
                     /locus_tag="HG536_0H01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285509.1"
                     /db_xref="GeneID:59327997"
     CDS             184325..184672
                     /locus_tag="HG536_0H01060"
                     /inference="similar to AA sequence:RefSeq:NP_013972.1"
                     /note="ancestral locus Anc_8.795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141405.1"
                     /db_xref="GeneID:59327997"
                     /translation="MGWFSKEEDNEYHPIDRSSRRQCWDSRDEFFECLDKIDVINPLD
                     PSQQNKIKQNCQKQEAKFHSSCAESWIKYFKEKRVVDYKKEKFLKEMEQQNATRIELS
                     PEQALGGAKGGSN"
     gene            <184918..>186018
                     /locus_tag="HG536_0H01070"
                     /db_xref="GeneID:59327998"
     mRNA            <184918..>186018
                     /locus_tag="HG536_0H01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285510.1"
                     /db_xref="GeneID:59327998"
     CDS             184918..186018
                     /locus_tag="HG536_0H01070"
                     /note="ancestral locus Anc_8.794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141406.1"
                     /db_xref="GeneID:59327998"
                     /translation="MVEFLLKGGNQAVSVNPPHDLDFHITKQGSSWLWAVTSVFGLLV
                     VVYAILFFIAEMRSTSLVRYSLAAPLLVSLFMCFFYFTYASNLGWTGIQAEFGHVKVN
                     TPVTGLNPGVRQIFYSRFVAWFLSWPLLLFLIELSSVSTAEQHGETFSVFDMIHSLLV
                     QIFSAYFWIVALLVGALIRSTYKWGYFTFAAVSMLIMEAMLIRRQFVTLKTRAFNAAM
                     LGFILVVVWLYFICWGLSEGGNRIQPDSEAVFYGILDLIVFAVYPAYLLFIIKAFGDW
                     PAFSWKGGFARRVDEEHAEKPSGQTSVRQSGETAVPQTHVNHPAAAAATGPALAPTAE
                     HPNVAAGHATTAHQTTTTAEIPAAIPVTRETA"
     gene            complement(<186244..>187176)
                     /locus_tag="HG536_0H01080"
                     /db_xref="GeneID:59327999"
     mRNA            complement(<186244..>187176)
                     /locus_tag="HG536_0H01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285511.1"
                     /db_xref="GeneID:59327999"
     CDS             complement(186244..187176)
                     /locus_tag="HG536_0H01080"
                     /inference="similar to AA sequence:RefSeq:NP_013971.1"
                     /note="ancestral locus Anc_8.793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141407.1"
                     /db_xref="GeneID:59327999"
                     /translation="MFSDSQSFFALFSVLGLLETVSAAPAALPDSQRSHHDHAAKRGG
                     TCSFPNFEGMVAVQKDGQNGGWAMHSDQQCAYGSWCPYACKPGQLMGQWDPSVTSYSY
                     PGSQNGGLYCDSNGNLQKPDNGRPYCYDGAGTVVAKNSAGGNVAFCQTVLPGNEEMLI
                     PTDIGSGSSQTLAVPGPDYFAGTAAHYYVNPPGVSVADGCKWGDDSHPYGNWSPYVAG
                     ANQQSDGSTYVKIGWNPIYLDSSFKGTKPSFGIRITCDDESNCEGLPCSIDPSSSNVN
                     DVSSSQSASGAGGGNFCVVTAKNGAKANIEVFSV"
     gene            <188096..>189397
                     /locus_tag="HG536_0H01090"
                     /db_xref="GeneID:59328000"
     mRNA            <188096..>189397
                     /locus_tag="HG536_0H01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285512.1"
                     /db_xref="GeneID:59328000"
     CDS             188096..189397
                     /locus_tag="HG536_0H01090"
                     /inference="similar to AA sequence:RefSeq:NP_013970.1"
                     /note="ancestral locus Anc_8.792"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141408.1"
                     /db_xref="GeneID:59328000"
                     /translation="MKLTGKEIRICSLLALDTVFFLLELIIGYMSHSLALIADSFHML
                     NDIISLLVALWAVNVAKNRNADASYTYGWKRAEILGALVNAVFLVALCFTILIEAFQR
                     LISPPEIENPKLVMYVGIAGLLSNFVGLVLFHDHGHSHGHSHGAGGDEHDVETQTHSH
                     SHFYNATNGVEESNGSIDSNNGNIREVWPQSVVERISFEGTALLQKRDSDSKNGATKN
                     KKVKSLNMHGVFLHVLGDALGNVGVIVAALFIWKTDYSWRFYSDPVVSLVITLIIFSS
                     AIPLSRKCCRILLQATPSSISADAVQRDILSISGVRSVHDFHIWNLTESFFIASLHVQ
                     IDASPDRFSDIAKSIRSIFHSYGIHSATVQPEFIKGNASLDASRRFSMIAGGSSMSVD
                     QESVDSSTQDPSPSAYGATAFGDRCLVDQAAKCNPNECLPK"
     gene            complement(<189473..>190327)
                     /locus_tag="HG536_0H01100"
                     /db_xref="GeneID:59328001"
     mRNA            complement(<189473..>190327)
                     /locus_tag="HG536_0H01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285513.1"
                     /db_xref="GeneID:59328001"
     CDS             complement(189473..190327)
                     /locus_tag="HG536_0H01100"
                     /inference="similar to AA sequence:RefSeq:NP_014960.1"
                     /note="ancestral locus Anc_8.791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141409.1"
                     /db_xref="GeneID:59328001"
                     /translation="MAKMGNDEPSDAVPFSTPIKRKQAPLPETPNKRGRSSLAETVNI
                     TPSKAPRLVQPVARSAEDALKRGRLIFQSGHTDSDESSATDSDCSPWSDAGSISPLSD
                     ISSVPSSSPELEKLSYLDAFATKSILEKETMELNRRICSSVVKTRWRSSFEPCHRYKS
                     PKRPILRPRNNSLNLLVRSSRGSLEDATIYATEINASITAHANVKMPMINNAYERMTI
                     PVNSAIKRKHKLLKKALLGDDYEINEADFDVPDAALIEGFEIKAIDGGEEMGNGVRQI
                     QWADRLAV"
     gene            <191520..>192599
                     /locus_tag="HG536_0H01110"
                     /db_xref="GeneID:59328002"
     mRNA            <191520..>192599
                     /locus_tag="HG536_0H01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285514.1"
                     /db_xref="GeneID:59328002"
     CDS             191520..192599
                     /locus_tag="HG536_0H01110"
                     /inference="similar to AA sequence:RefSeq:NP_014958.3"
                     /note="ancestral locus Anc_8.790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141410.1"
                     /db_xref="GeneID:59328002"
                     /translation="MSVFHRKHSNSPSKNQPVLLSLERPNNSQVDSLPEEVLGQVEDV
                     AEKTIAKTKGERKIPNRTIEHVKSYPLVQQTRSLLYRLPVARVVIANTKPVVKQVLES
                     KPLQLAFPVTNFFDNVANSSLNLTEKIVPAIKTKTYQNLKDDAMMPCNTTVEYSKKTT
                     GKIVSLVEDNVCKPSHDQVIKFRKFYNEKIYDTKGKPLIRSTLNPITAPFNNLFENLT
                     IKYFPEGEKVPTEGYSSELNRSVALAWNFVNRSYPVVQKKIVDVSMIPCNYVIYVNNV
                     FNESLDSQPNLQPKHCWQATKIALTRVRKETMDSIKAKSPHRIFKKRQTVNKPNLVKP
                     NRTPVEAFHERIREVENQLHENVTA"
     gene            <193502..>193942
                     /locus_tag="HG536_0H01120"
                     /db_xref="GeneID:59328003"
     mRNA            <193502..>193942
                     /locus_tag="HG536_0H01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285515.1"
                     /db_xref="GeneID:59328003"
     CDS             193502..193942
                     /locus_tag="HG536_0H01120"
                     /inference="similar to AA sequence:RefSeq:NP_013969.3"
                     /note="ancestral locus Anc_8.789"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141411.1"
                     /db_xref="GeneID:59328003"
                     /translation="MRIFAPNEVVAKSRYWYFLQKLHKVKRASGEVVSVNEIHEAHPT
                     KVKNFSVWVRYDSRSGTHNMYKEIRDVSRVAAVETLYQDMAARHRARFRSIHILKVAE
                     IEKTADVKRQYVKQFLTKDLKFPLPHRVEKSAKTFAYKRPSTFY"
     gene            <194272..>195126
                     /locus_tag="HG536_0H01130"
                     /db_xref="GeneID:59328004"
     mRNA            <194272..>195126
                     /locus_tag="HG536_0H01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285516.1"
                     /db_xref="GeneID:59328004"
     CDS             194272..195126
                     /locus_tag="HG536_0H01130"
                     /inference="similar to AA sequence:RefSeq:NP_014956.3"
                     /note="ancestral locus Anc_8.788"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141412.1"
                     /db_xref="GeneID:59328004"
                     /translation="MVEVGASTPSCNDATHSGSTELRKRKETTPAKKDDEIAEIDWDL
                     HVPLTEIRLKSHEWFGEFITKHEVPRKVLHSSIGFITLYFYTQNVDYKKVKWPLVYGF
                     VTLFILDLIRLRWKLFNRAYCRTVGALMRRKEIHTYNGVLWYLLGLIFAFSLFPKDVA
                     LIALFLLSWSDTAASTIGRKYGHLTPKVARNKSLAGSLAAFCVGVTTCFMFYGYFVPH
                     YASFNSPGEISWTPETSRLSLATVSWLGGFVAALSEGIDLFNWDDNFTIPVLSSIFLH
                     GVIRVFKK"
     gene            <195426..>196955
                     /locus_tag="HG536_0H01140"
                     /db_xref="GeneID:59328005"
     mRNA            <195426..>196955
                     /locus_tag="HG536_0H01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285517.1"
                     /db_xref="GeneID:59328005"
     CDS             195426..196955
                     /locus_tag="HG536_0H01140"
                     /inference="similar to AA sequence:RefSeq:NP_014955.1"
                     /note="ancestral locus Anc_8.787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141413.1"
                     /db_xref="GeneID:59328005"
                     /translation="MAYVLTETSAGYALLKASDKKIYKSTKLIQDLDSSEKVLKEFKI
                     AAFSKFNSAANALEEASAIIEGKVSPQLQSLLEDIKKDKKATLVVSETKLANAINKLG
                     LNFNVISDAVTLDIYRAVKEYLPELLPGLTDGDLSKMSLGLAHSIGRHKLKFSADKVD
                     VMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKA
                     AETDMSSILPEEIEERVKTAAEVSMGTEITQIDLDNIKCLAEQIVEFAAYREQLSNYL
                     SARMKAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKH
                     DTPKYGLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARA
                     KVENRLSQLEGRDLRTTPKVVREAKKVEITEARAYNADADAAPVENADSDDEDEDEGE
                     SEQKVKKDKKKEKKEKKDKKRKRDEEEEDSKESKKSKKEKKEKKEKKEKKEKKSKKEK
                     K"
     gene            <197274..>198914
                     /locus_tag="HG536_0H01150"
                     /db_xref="GeneID:59328006"
     mRNA            <197274..>198914
                     /locus_tag="HG536_0H01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285518.1"
                     /db_xref="GeneID:59328006"
     CDS             197274..198914
                     /locus_tag="HG536_0H01150"
                     /inference="similar to AA sequence:RefSeq:NP_014953.3"
                     /note="ancestral locus Anc_8.786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141414.1"
                     /db_xref="GeneID:59328006"
                     /translation="MPDEISLSLEETNKIRASLGLKAIAPANDQDNGSYEGIDKILPK
                     RASSTVERSEGPRFIENDKIHMLRRKLAALKDASGLSRSAGNDESSSQGDWLSRIGSK
                     PVKISFDEDGDEEGDELPLVRVSHKVEDIADPKGVILTLKENSVLADGDDTLEAENLV
                     QEREEAKRIHMSQMNKNRRRMRRKIQVSSAEIELQEEAENEDNILAIGVAKNYNSTSD
                     EPEPKHSGKLKVSFSGTDSDASDGGDFKPVQIKKRKKNGTGARTKAKSITLPPRIQPV
                     ELKNHDLDFEDLEQDLFVPFNSVKRSKLLSEVATPEELAAQIAKEKREREQKIAQVAE
                     ASDNLIIDEGTRFLESLRTAILEKPAHPDSADVQEDVGLQESAPTTVETSKKWRDDRE
                     APDFYEGLASTLNFIRERNVLPKLQSLTSDSSKPAIPNYQKEARKIRERNNSQMRQDK
                     TQYTAKELEEIENYQDEQIARRISELQAKTLQDYDPEVKLQYKDESGNQLTTKEAYKK
                     LSQKFHGTRSNQRKQAKAQSRIEARKTQQQKSSVFDVL"
     gene            <199613..>200974
                     /locus_tag="HG536_0H01160"
                     /db_xref="GeneID:59328007"
     mRNA            <199613..>200974
                     /locus_tag="HG536_0H01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285519.1"
                     /db_xref="GeneID:59328007"
     CDS             199613..200974
                     /locus_tag="HG536_0H01160"
                     /inference="similar to AA sequence:RefSeq:NP_014952.1"
                     /note="ancestral locus Anc_8.785"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141415.1"
                     /db_xref="GeneID:59328007"
                     /translation="MITVQSTTTRRRSSVHQNLFDPKLYRTCEPAKEVSEKEEKDKYA
                     QPSLSQIVGKVSEIAVLLQKEFVRLFPRSVQDYLPEVDLKVTLVCLTWYVTSSISSNV
                     SKAILRDFTHPVALTELQFLFSALLCVFFIAVVNMAQLPSLSRTAIARAVASFPEGIL
                     PSYLSGDFRQSVVGKFLKPSKLIFLATFPMGIFQFMGHISSHKATALIPVSLVHSIKA
                     LSPIVTVSYYRVFQGKKYNAMTYWTLVPLIMGVMITCWSTHGSKKMDAANGRLSMLSG
                     LLYASVSMLIFVSQNIFAKSILTVKSKKGILPSSAPASPQIGKAEVSPFQIDKITILF
                     YCSCIGFALTLPPFLTGELMQHQSVFKDLTWKVSSLIVFHGVTHFFQALLAFQLIGML
                     SSVNYSVANIMKRIVIITVALAWESRFNIAQVIGLLMTLSGLYGYDKWGTFRKIDKQM
                     TAL"
     gene            complement(<201057..>201983)
                     /locus_tag="HG536_0H01170"
                     /db_xref="GeneID:59328008"
     mRNA            complement(<201057..>201983)
                     /locus_tag="HG536_0H01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285520.1"
                     /db_xref="GeneID:59328008"
     CDS             complement(201057..201983)
                     /locus_tag="HG536_0H01170"
                     /inference="similar to AA sequence:RefSeq:NP_013968.1"
                     /note="ancestral locus Anc_8.784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141416.1"
                     /db_xref="GeneID:59328008"
                     /translation="MSQQPAELKKKPISFSNILLGAGLNLCEVTTLGQPLEVVKTTMA
                     AHRDFTFFNAVKHVWSRGGIFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKVLGL
                     NNFAAGIMGGVTGGVAQAYLTMGFCTCMKTVEITKNKASAGGVPQSSWGAFKDIYRKE
                     GIRGINKGVNAVAIRQMTNWGSRFGLSRLVEEFIRKMTGKTNPDDRLSALEKIMASAI
                     GGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKAFRYIYQSNGVKGLYRGVTPRIG
                     LGVWQTVFMVGFGDMAREFVGKLTGEKPAAKH"
     gene            complement(<202209..>202907)
                     /locus_tag="HG536_0H01180"
                     /db_xref="GeneID:59328009"
     mRNA            complement(<202209..>202907)
                     /locus_tag="HG536_0H01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285521.1"
                     /db_xref="GeneID:59328009"
     CDS             complement(202209..202907)
                     /locus_tag="HG536_0H01180"
                     /inference="similar to AA sequence:RefSeq:NP_014950.1"
                     /note="ancestral locus Anc_8.782"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141417.1"
                     /db_xref="GeneID:59328009"
                     /translation="MLNRLRCLPGRRWKSNSTIKRFIDENRAIANTTVFQGTLYEHTV
                     MRELQGKLAMTSLQKTGGANDRGVDIRGSWDVAKVFHTMNPILKLDQTEVPARCKLNG
                     VTFKPFRHKLPRETQLKVLVQCKAFTSSKVAPKEFRELLGTFASLVSGPQRNKTAIMM
                     CSPNMLTKDGLSLINSVPMPLIYLRIEMLRLKGADYDIADSGRLLNYYENEYAAQFLQ
                     GMGIKEWLKLSMFK"
     gene            <203003..>203242
                     /locus_tag="HG536_0H01190"
                     /db_xref="GeneID:59328010"
     mRNA            <203003..>203242
                     /locus_tag="HG536_0H01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285522.1"
                     /db_xref="GeneID:59328010"
     CDS             203003..203242
                     /locus_tag="HG536_0H01190"
                     /inference="similar to AA sequence:RefSeq:NP_014949.3"
                     /note="ancestral locus Anc_8.781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141418.1"
                     /db_xref="GeneID:59328010"
                     /translation="MDTDKLAIKDDQPLANSATNAKGARSENRDEGVVTIFDVTNKIE
                     WALKQLETKVEENEKQFERSLNALEDQISRWNERD"
     gene            <203474..>204877
                     /locus_tag="HG536_0H01200"
                     /db_xref="GeneID:59328011"
     mRNA            <203474..>204877
                     /locus_tag="HG536_0H01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285523.1"
                     /db_xref="GeneID:59328011"
     CDS             203474..204877
                     /locus_tag="HG536_0H01200"
                     /inference="similar to AA sequence:RefSeq:NP_013967.1"
                     /note="ancestral locus Anc_8.780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141419.1"
                     /db_xref="GeneID:59328011"
                     /translation="MARRSNRRKRGHDSSEVAEKHKIAKLIESQASKKRKSPHTSEDT
                     TGLREQYGTLLSRFSNLADQPLDDASGLVATVELQIPNGEADGETKEDENAPVDEKQQ
                     DHKISKRQLRKMAKPSLSELKKTALYPEVIEWYDCDAQYPALLVNIKSSKNIVQVPAH
                     WQTKREYLSGRSLLEKKPFELPDIIKQTDIEVMRKTIPEDENGKEDPSLKQTSRARVQ
                     PKLGSLDIDYKKLHDVFFKLGARWKPDILLAYGDQYYENRNLHEEAVWKKYRDQKKPG
                     KISSKLRQAMGLSEGQLPPWCAKMRTLGMPPSYPDLKIAGLNWDIENLRGEVYGSLKD
                     PDATKNTHPLFGTIISAYDEPETTEESKTKRKEAQEHTVEQALEPVKTIIVDDGKQVT
                     QTTKVSPPAGSPVPQESPKASKALYTVLKEKAVEETARRQGVAYVIHDVVKQDDNRTQ
                     TEVSEQIEDQIDTKFKF"
     gene            complement(<204905..>206443)
                     /locus_tag="HG536_0H01210"
                     /db_xref="GeneID:59328012"
     mRNA            complement(<204905..>206443)
                     /locus_tag="HG536_0H01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285524.1"
                     /db_xref="GeneID:59328012"
     CDS             complement(204905..206443)
                     /locus_tag="HG536_0H01210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141420.1"
                     /db_xref="GeneID:59328012"
                     /translation="MSTYDVVIKNGIICTASDFYPADIGIIGEKIAAICDCIDPVHAG
                     EIIDAEGGIVTPGGIDAHVHVDEPVKLLGDVADTMGEATRSAVAGGTTTIIAFASQDL
                     SLTGPHALSQSVKNTTDMYSKQRLYCDYGLHMILARLEGTGTATRDILDQQLENVYQD
                     CGVSSIKVFMTYPGLQMSDYNLLNAMYASRKNGITTMIHAENGDIVRWMTESLEEQGL
                     LEPYYHGVSRPTIVEGEATNRAVTLARTMDNPILFVHVSSPEAIDTIRRAQTAGLKVY
                     AETCPQYALLSDEDTKCAHGDDFAGAKNICSPPLRPEEVKQAIWRGMNNGSFTIVGSD
                     HCAYLYSSKEKGKHNAFAKCENGRFRYIPNGMPGVCTRMPLLFDAVMRNRLSSLMKFV
                     EINCTNPAKIYGCYPQKGGLLPGSSDADIIVWYPNDKQYDLQPEVITNDLLEHACDYT
                     PYEGVEIKNWPRFTIARGKVVYKEGKLMHDNARGQYIRRKKSSLSSPNNAWPSEWRPA
                     YDKK"
     gene            <206824..>207411
                     /locus_tag="HG536_0H01220"
                     /db_xref="GeneID:59328013"
     mRNA            <206824..>207411
                     /locus_tag="HG536_0H01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285525.1"
                     /db_xref="GeneID:59328013"
     CDS             206824..207411
                     /locus_tag="HG536_0H01220"
                     /inference="similar to AA sequence:RefSeq:NP_015266.1"
                     /note="ancestral locus Anc_8.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141421.1"
                     /db_xref="GeneID:59328013"
                     /translation="MALNCSSSYITCGHNGAGDSAYLILMGKVLFEGHLIVRIQPYSS
                     KIRTVDMFASRFLSIKPRLSLGSFSSVVRHQSKLFMSSETRKAIDEAVASAPVVLFMK
                     GTPEFPQCGFSRATVQMLGQQGVDPAKFAAYNVLEDPELREGIKEYSEWPTIPQLYVN
                     KEFIGGCDILTNMAQTGDLAALLEEADALVPEDGE"
     gene            complement(<207859..>209484)
                     /locus_tag="HG536_0H01230"
                     /db_xref="GeneID:59328014"
     mRNA            complement(<207859..>209484)
                     /locus_tag="HG536_0H01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285526.1"
                     /db_xref="GeneID:59328014"
     CDS             complement(207859..209484)
                     /locus_tag="HG536_0H01230"
                     /inference="similar to AA sequence:RefSeq:NP_009722.3"
                     /note="ancestral locus Anc_8.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141422.1"
                     /db_xref="GeneID:59328014"
                     /translation="MKAFCRRFSTNATSFTHQGRPLPEGGLLTRKERDQISALPFFIE
                     SSHGRSRTRRTSTRQEYLEKKLPDVRRAFGCDPDNPGYLPFKLPKERPNPYWDAHLGR
                     TVDPDTGKQTLHGKPRLSVTKLLTKRWCELRESYDIYAKAPIYEHPQVIEGLETHQKL
                     EDETHRIPEDWHEFMEHFEVAIPTDEYHELVGSWYESIGKLVNLFTVGEAREVLCHGF
                     LDPNSCQMVEGPVVSEEEVLVSGVIDHLVLTRRARFHGKPLGLIGCIESRPNLYIADV
                     LNQIEGQKELLKQKYGIVLSDIKTRSIRKIPTQNSVVKSTKLQVMYYRSFLETLGSSP
                     SGTYQRLLLNAQRRKMDIDRPIEPSKLISMMAATDLIISDMRCLRDGENIGFETYDGY
                     FSGRDQGDAYDVTHFYDLITDVSVIQKFEEFFTLWSRPPTLRYFAARLAQMYHEVAPL
                     LSDTLLIEYYCQGENFHNIVFDYDPELMKSECFNSASFWFGKRDIEPIKPTLKNVMTY
                     CKHCDYEEVCLWRKQITDKCRQLGSDLEKITEE"
     gene            complement(<209817..>214343)
                     /locus_tag="HG536_0H01240"
                     /db_xref="GeneID:59328015"
     mRNA            complement(<209817..>214343)
                     /locus_tag="HG536_0H01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285527.1"
                     /db_xref="GeneID:59328015"
     CDS             complement(209817..214343)
                     /locus_tag="HG536_0H01240"
                     /inference="similar to AA sequence:RefSeq:NP_015267.1"
                     /note="ancestral locus Anc_8.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141423.1"
                     /db_xref="GeneID:59328015"
                     /translation="MSSKEAHEDKDFSSNDENHSYAESVQSFARGADDAEQLGVTSQL
                     SRHLSQMLSNEEGVERLASMARVLSTKTKKQMEKFEVDTLDFDLRALLNYLRSRQLEQ
                     GIEPGDSGVAFRNLTAVGIDASAAFGPSVEEMLRGIVSAPKHLGRLFGRKTDLPLRNI
                     IQNCTGVVESGEMLFVVGRPGAGCSTLLKCVSGETGELVEVQGEFSYDGLDQHEMMSN
                     YKGYVIYCPELDFHFPKITVKETIDFALKCKTPRVRVDQMTRKEYVNNIRDMWCTVFG
                     LRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQA
                     IRTATNMVNNSAVVAIYQAGENIYQLFDKTTVLYNGRQIYFGPADKAVGYFQRMGWVK
                     PNRMTSAEFLTSVTVDFENRTLEIAPGYEDKVPKSGAEFEEYWLNSEEYQEVLRSYDD
                     YQARHPPEETRDRLEIAKKQRLQAGQRASSQYVVNYWTQVWYCMIRGFQRVKGDSTYT
                     KVYLSSFLIKGLVVGSMFHRIDPKSQSTTAGAYSRGGLLFYVLLFAAVTSLAEIANSF
                     ATRPIIVKQKSYSMYHISAESLQEIITDIPTKLVAIIILSLVSYWIPYLKFTAAAFFQ
                     YLLYLFTVQQCTSFVFKFVATLTKDGETAHAIGGLWILMLCTYAGFVLPIGQMHHWIR
                     WFHYLNPLTYGFESLMSTEFHGREMLCSQLIPSGPGYENVSIANQICHAAGAIKGHLY
                     VSGDTYIKSQYHFAYKHAWRNWGINVVWTFGYIVFNVVLSEFLKPLEGGGDLLLYKRG
                     HMPSFGTESAEARTATREEMMEALNGPGVDLTKVIAEKDVFTWNHLNYVIPYDGSTRQ
                     LLSDVFGYVKPGKMTALMGESGAGKTTLLNVLAQRINMGVITGDMLVNAKPLPASFNR
                     SCGYVAQADNHMAELSVRESLRFAAELRQPASTPLEEKYEYVEKIITLLGMQNYAEAL
                     VGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRALADSG
                     QSILCTIHQPSATLFEQFDRLLLLKKGGKMVYFGDIGENSSTLLSYFERQSGVKCDKS
                     ENPAEYMLNCIGAGATASADADWHELWKNSPECAAAREEVEELHRVLPSRPTADDPEL
                     AGKFAASYATQMKALVRRTALQFWRSPVYIRGKFLECVSCALFVGLSYVGVNHSIGGA
                     QQAFSSIFMILLVSVAMINQLQVFAYASRELYEVREASSNTFHWSALLLSHFLVETMW
                     STACQFMCYICYYWPAQYSGRASHAGFFFFFYVLIFPAYFCSYGLWILYLSPDVPSAS
                     MINSNLFAAMLLFCGILQPRQKMPGFWRRFMYNVSPFTYVVQALVGPLVHNKPVICSE
                     HEFTVMDPPAGQTCGEYLGTYLSNNPGYLVNHDATENCQYCPYSMQDQVVAQYNVKWD
                     QRWRNFGFMWVYIAFNLFAMCACYYIMRVKVWSLKSVLDFKKWFNGPRKERHEKDTTI
                     FQQKPGDADKIKKN"
     gene            complement(<215085..>215282)
                     /locus_tag="HG536_0H01250"
                     /db_xref="GeneID:59328016"
     mRNA            complement(<215085..>215282)
                     /locus_tag="HG536_0H01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285528.1"
                     /db_xref="GeneID:59328016"
     CDS             complement(215085..215282)
                     /locus_tag="HG536_0H01250"
                     /inference="similar to AA sequence:RefSeq:NP_009721.1"
                     /note="ancestral locus Anc_8.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141424.1"
                     /db_xref="GeneID:59328016"
                     /translation="MAVQTPKQRLANQKFAKKNEKHRKFGKKKAKGDSQTGFTISKPW
                     LLLLAFLIIGGGIIELVSYLL"
     gene            <215970..>217397
                     /locus_tag="HG536_0H01260"
                     /db_xref="GeneID:59328017"
     mRNA            <215970..>217397
                     /locus_tag="HG536_0H01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285529.1"
                     /db_xref="GeneID:59328017"
     CDS             215970..217397
                     /locus_tag="HG536_0H01260"
                     /inference="similar to AA sequence:RefSeq:NP_009720.1"
                     /note="ancestral locus Anc_8.515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141425.1"
                     /db_xref="GeneID:59328017"
                     /translation="MKFIKSLCAASLTALSVAQAGCVMSGGNYYCSETDAVVFSNVGY
                     SGSYKDVTSMDESSGVCLQDTVSFSGSLAPLDEELSVHFRGPLRLLQFGVYYPSGGSS
                     LGKRDNQVQEEPCEETVQSHKHKREVAVEYVQVTSTVYVNNKGQPVTSSVAQQEAPGN
                     PATDVVSSYTFVNTIVTPSTSATPSTGTSATTVLTGGRAGSSSPEPASSSSIVSLSSS
                     TKSSASASSTSGSSTSGAWVRSSYFQPGSASNCVFMNHQGGSAGSGVWSAAFGNSICY
                     ASSDGVSGASSAQALGDVTIKSGQEYMIFSGSQCSGNDCGYYRKNIPAYHGFGGENKI
                     FVFEFSMPYDTAGSGYNQDMPAIWFLNAKIPRTLQYGKSECSCWKTGCGEFDLFEILS
                     PGSDKLITHVHDGQGSDGTSTGGGGTQDYFQRPTSGTMKAAVIFNGSDKTIHIVKVDD
                     DFDAQLSSDVVNSWLQKSGSTAALA"
     gene            complement(<217585..>218691)
                     /locus_tag="HG536_0H01270"
                     /db_xref="GeneID:59328018"
     mRNA            complement(<217585..>218691)
                     /locus_tag="HG536_0H01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285530.1"
                     /db_xref="GeneID:59328018"
     CDS             complement(217585..218691)
                     /locus_tag="HG536_0H01270"
                     /inference="similar to AA sequence:RefSeq:NP_009719.3"
                     /note="ancestral locus Anc_8.514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141426.1"
                     /db_xref="GeneID:59328018"
                     /translation="MRKELKYMILGNLAIVSVILYVTFDLLTLAIDDTFQDALLESDL
                     NPVAGSEKPQLIPKIIHQTYKTTDIPEVWKEGQQKCIDLHPDYKYILWTDEMALQFIR
                     EEYPDYLETFQNYKYPIQRADAIRYFILSHFGGVYIDLDDGCERRLDPLLTVPAFARK
                     TSPTGISNDVLGSVPQHPFFLKLRDSLHRYDRNWLVPYITIMASTGPLFVSMVWKQYK
                     RWGVPENGVVRILQPGDYKMHTYSFFSISRGSSWHLDDAKFVKSLANHILACVVAGFV
                     FAFFVLYCEYCFYCWLCSKSGNNKGFVSRFYRRILAAVGLQSRSDNASVIVNARSSND
                     DVRLRRLRKDSNLPHSFVLSDLEKNHPTFTDMST"
     gene            complement(<219222..>220118)
                     /locus_tag="HG536_0H01280"
                     /db_xref="GeneID:59328019"
     mRNA            complement(<219222..>220118)
                     /locus_tag="HG536_0H01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285531.1"
                     /db_xref="GeneID:59328019"
     CDS             complement(219222..220118)
                     /locus_tag="HG536_0H01280"
                     /inference="similar to AA sequence:RefSeq:NP_009718.3"
                     /note="ancestral locus Anc_8.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141427.1"
                     /db_xref="GeneID:59328019"
                     /translation="MSSELVNYKRLEKVGEGTYGVVYKALDLRHGQRVVALKKIRLES
                     EDEGVPSTAIREISLLKELKDENIVRLYDIVHSDAHKLYLVFEFLELDLKRYMEGIPK
                     DQPLGDKVIQKFMMQLCKGIAYCHSHRILHRDLKPQNLLINRDGNLKLGDFGLARAFG
                     VPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDIWSIGCIFAEMCNRKPIFSGDSEIDQ
                     IFKIFRTLGTPTEAIWPDIVYLPDFKPSFPKWHRKELAKVVPSLNAQGIDLLNNLLAY
                     DPINRISAKRAAMHPYFEEMLT"
     gene            complement(<220320..>221354)
                     /locus_tag="HG536_0H01290"
                     /db_xref="GeneID:59328020"
     mRNA            complement(<220320..>221354)
                     /locus_tag="HG536_0H01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285532.1"
                     /db_xref="GeneID:59328020"
     CDS             complement(220320..221354)
                     /locus_tag="HG536_0H01290"
                     /inference="similar to AA sequence:RefSeq:NP_009717.1"
                     /note="ancestral locus Anc_8.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141428.1"
                     /db_xref="GeneID:59328020"
                     /translation="MSCFMDQLHSVGGKSKILNALLWCIFGFGVVKATTLLLRATALI
                     LDLFVLPSVNYSKYGAGKGKYCVVTGASDGIGKEFATQMARRKFNLILISRTLSKLEA
                     LQKELQGKYGIDVKILSIDVSHDVPENYVAVKELCQGLPITVLINNVGLSHNCPVPFL
                     ETEEQELRNIITINNTATLLFTQIITPTIIETAASSKCRGLVLTMGSFGGLLPTPLLA
                     TYSGSKAFLQSWSNALAGELKEANVDVELILSYLVTSAMSKVRRTSVMIPNPRNFVSS
                     ALSSVGRRCGAQERYATVTPYWSHALQHWFIEETVGVYSRIANAMNLKMHKSIRARYL
                     RKKLREEKKQ"
     gene            complement(<222565..>223455)
                     /locus_tag="HG536_0H01300"
                     /db_xref="GeneID:59328021"
     mRNA            complement(<222565..>223455)
                     /locus_tag="HG536_0H01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285533.1"
                     /db_xref="GeneID:59328021"
     CDS             complement(222565..223455)
                     /locus_tag="HG536_0H01300"
                     /inference="similar to AA sequence:RefSeq:NP_015270.1"
                     /note="ancestral locus Anc_8.511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141429.1"
                     /db_xref="GeneID:59328021"
                     /translation="MSHPNESGSSTNGHYHGSTRDAPEQPGNSSRFNDFPSYRGGHSG
                     RGYYKGSGGPARFGPYGDGSDVNGPGASGPHQSYSAYSNYRNDYYYGGRSDTSRYYNG
                     RPNSAHQFYGQSGRRYGQSEHQYNYQGSARRASEGYRGGRTNGNYNARYKSVPKPYTP
                     REGHRYSPHPHDSGSNTPTDQYNRSHSQPSTDAKPINEESSLRPSPITNIKKRVEQGE
                     SGFFYLTDLDRSTDDPAKLAEIRETLREGERLDKDLGSHCLKMLKTELELELLTTQCE
                     RDALNVQLTQEKLDSLLMQG"
     gene            complement(<223625..>225052)
                     /locus_tag="HG536_0H01310"
                     /db_xref="GeneID:59328022"
     mRNA            complement(<223625..>225052)
                     /locus_tag="HG536_0H01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285534.1"
                     /db_xref="GeneID:59328022"
     CDS             complement(223625..225052)
                     /locus_tag="HG536_0H01310"
                     /inference="similar to AA sequence:RefSeq:NP_009716.1"
                     /note="ancestral locus Anc_8.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141430.1"
                     /db_xref="GeneID:59328022"
                     /translation="MRFEIGRSFKRSREPQAVDTRPLKKCSPTPSEYHPDEDFRQMGL
                     QEPLTPTVSPSKVDFESADKLSIPSPLSRDFAHLSLLRQASPTPWRRDRRRAHQIFEI
                     PEILEKILRHVAMAEEAPAENTCARRRPLSYRHAALIYGDEKRAAEVWKQSLREAAGR
                     GTRESRVPGPLFSCLLVNKLWHSIALPCLLERVHFRDSDRFSAFMVNRERMLATDGEM
                     ARPCVFTLEKLHRLSQSEFDRLSALVAVDRLKWLELYICPKVLPPLSWIPNFKRLEKL
                     ILPGNKVINDKFLFELSHYVPDLKKLDLRACDNVTDSGIVAIALRCTKLELCNLGRHR
                     NGGRITSISVVALAKHTQIETLGIAGCNVTDAGIWELAQLRGPHMTRLSLNNCSLLSN
                     HSIPLLLAFNHFPNLAVLEVRNIDGITDVRNLVHFKLWKKSQRIPILIEGCERITKLM
                     LDEEARLRRANSQVALKDMTYWVNS"
     gene            <225799..>226644
                     /locus_tag="HG536_0H01320"
                     /db_xref="GeneID:59328023"
     mRNA            <225799..>226644
                     /locus_tag="HG536_0H01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285535.1"
                     /db_xref="GeneID:59328023"
     CDS             225799..226644
                     /locus_tag="HG536_0H01320"
                     /inference="similar to AA sequence:RefSeq:NP_015271.1"
                     /note="ancestral locus Anc_8.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141431.1"
                     /db_xref="GeneID:59328023"
                     /translation="MGSPRQKDPAGSHCNSTGHYHGRHRRRFKSKKSSEPITTEVAPV
                     TARPMFSPQQQKAIFEHQLITKNHAGQKAYAHVPCKFFRQGTCQAGDSCPFSHSLDAS
                     AADQTPCEYFRRGNCKFGSRCANAHVLPGASIDEEDEQEAEEDGVFPHDEQFYLPADF
                     AELLAPERLTRRNSGSSMTSFSAASLGPSLSSASSSYTATAASPLLHQQLAYLHPSAK
                     SFSPWSPPPNSRNSFSWLLGDLASLRIDEEEPLVYTDCYDATNTANLPDTQFLFDDLP
                     DNTRF"
     gene            <226996..>227535
                     /locus_tag="HG536_0H01330"
                     /db_xref="GeneID:59328024"
     mRNA            <226996..>227535
                     /locus_tag="HG536_0H01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285536.1"
                     /db_xref="GeneID:59328024"
     CDS             226996..227535
                     /locus_tag="HG536_0H01330"
                     /inference="similar to AA sequence:RefSeq:NP_009715.4"
                     /note="ancestral locus Anc_8.508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141432.1"
                     /db_xref="GeneID:59328024"
                     /translation="MEPRDEYTRMRRFSFPNSENFRSRTGEAGAGGPLFEQPSHRNFL
                     GGEQAPEPSVTRRVKERLRSYSRCVTPQKLVVEEKENKADAASLSPLPPEQGKNYVYQ
                     SPRNTILDTNEQIKRNSSGRFGSLVEFAQHHHMDTTGKVFAHCAETGDVPQPTIDLDL
                     VNSAQHSGSTGGSGDASGL"
     gene            <227698..>229806
                     /locus_tag="HG536_0H01340"
                     /db_xref="GeneID:59328025"
     mRNA            <227698..>229806
                     /locus_tag="HG536_0H01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285537.1"
                     /db_xref="GeneID:59328025"
     CDS             227698..229806
                     /locus_tag="HG536_0H01340"
                     /inference="similar to AA sequence:RefSeq:NP_009714.3"
                     /note="ancestral locus Anc_8.507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141433.1"
                     /db_xref="GeneID:59328025"
                     /translation="MDWAIQAARRKTQRLPGSSRSIIETLNVFNNVTEEGQKRIDAVL
                     QEANEWLNGEVLVARAETTKLPRQEEEKSAMVSPEKTLNNVEFDPNIEEAEDVPASGT
                     PLRVVREAPSATPKSLADDNYTEEVARDQDPAVLKAASGKVSPWSPFRNEKSLRGGLA
                     DQTSAPSSRTENSRATDKWGLTEEVRTSTASDSNATSKSVEQIVRDRSQRRSNMFVPL
                     PSRDPLVVQQAVPAAPKVSNVLPSSGSPKDPTVTRAPVEKKPSSTHPKPVLANKKISA
                     RTTQSPTYSSTSTRISQATSSVFDRLSSLPTKSFENKVTSKFAGRRISASSSIDVTGS
                     PIRRRSPVLRSSGATETTYQDTLKSIFFAKDKRSDWGSRSGKDKTTLARTRQADTTRA
                     GKNGDPRVSPRSKNGRISKYHASQAENNRGYQKSKSASRALQKADITERKAAPLKHSV
                     EQANAARESPAKPAFSGSSTLRSPAIKLRAIDRSGQKTSADPQLNGKTQESHIRSPKN
                     KPKNQDRLTKFQLIPPAESENHDLKEKLNKRLSEVMRTQQNQNRRRIDQQKRKSQLDE
                     DFKRRTRLWNEMKETPLSLSTAVRRNSNVTPTQTNTVLYDLSITDHRTVIGEEAESRD
                     PTADNHTLPEIQSDSDDDADFTLASWAKSPFLQQQLYRQQNWDPREIFGPLPPLHIDQ
                     IFPDMRTNKLKPLQHSAKRI"
     gene            complement(<229856..>231010)
                     /locus_tag="HG536_0H01350"
                     /db_xref="GeneID:59328026"
     mRNA            complement(<229856..>231010)
                     /locus_tag="HG536_0H01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285538.1"
                     /db_xref="GeneID:59328026"
     CDS             complement(229856..231010)
                     /locus_tag="HG536_0H01350"
                     /inference="similar to AA sequence:RefSeq:NP_009713.1"
                     /note="ancestral locus Anc_8.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141434.1"
                     /db_xref="GeneID:59328026"
                     /translation="MVETYKKPQRYVPGPNDPALPPQLSEFQNKTTDEVLEELNRMPF
                     FMTKLDNTDGEGGENKELEALKALAYEGEPHEIAENFKNQGNELFKCKRFKDARELYT
                     KGIEVDCNDARINDSLYANRAACELEVKNYRKCLTDCKAALQFNPKNLKCYYRMGKAF
                     LAINKLEESRESVEFGLQIDSSNKSLKNLLDVIAQKQEEVELRKVKNLQEQRAREGMQ
                     VILDNAMKLRKIINVKTHAPPDIIRDCKIALEDPFDYESQLIYPALILYPTTDQFDFV
                     AEVGELTSVQELLSIIMDRPEEWFKAPGHENFSAKKLVVYMETNSGGLVKIGKKITFH
                     DVLKMEKPKIPLFDNALKVYFVPKTESEEWVQKWDKSRAIEKRLISSDQS"
     gene            complement(<231183..>232670)
                     /locus_tag="HG536_0H01360"
                     /db_xref="GeneID:59328027"
     mRNA            complement(<231183..>232670)
                     /locus_tag="HG536_0H01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285539.1"
                     /db_xref="GeneID:59328027"
     CDS             complement(231183..232670)
                     /locus_tag="HG536_0H01360"
                     /inference="similar to AA sequence:RefSeq:NP_010771.1"
                     /note="ancestral locus Anc_8.505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141435.1"
                     /db_xref="GeneID:59328027"
                     /translation="MAIFVSKRLLRFGLLAGVCVALVLFLTSSSQTDQSSLSDLIPSM
                     PKWSSPSLFGGSQSDSPLTAEEKDAEKLREETEKALLENHADPNAVPLDEQTMDQGAK
                     ALKDAAENLGEAGKAEALKDPAADSKKPEAIANPNNDPARDMETDPAAKSKALGSTWE
                     FMAPSYAKKGQRPKACFVSLVRNSELSEILPSIKDVERRFNSKYHYPWVFLNDEPFTD
                     HFKLKVTEAVSGEIEFGLVPKEHWSYPNFVDQEKAAEERKKMEEEGVIYGGMESYRHM
                     CRFQSGFFWRQKALDKFDWYWRVEPSTKLYCDINYDVFQWMQDNEKVYGFTITIHEYE
                     RTIRTLWSTVKKFLNKYPSVISKDNLMKFISGDRGKTYNLCHFWSNFEIANLNFWRSP
                     AYREYFNYLDQTGGFFYERWGDAPVHSIAASLFLPRDKLHYFSDIGYHHIPYDNCPLD
                     DTVFTENKCDCDRNNDFTFQSYSCGVEYYDAQGMKKPQGWEKYRQ"
     gene            <233653..>234493
                     /locus_tag="HG536_0H01370"
                     /db_xref="GeneID:59328028"
     mRNA            join(<233653..233871,233873..>234493)
                     /locus_tag="HG536_0H01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285540.1"
                     /db_xref="GeneID:59328028"
     CDS             join(233653..233871,233873..234493)
                     /locus_tag="HG536_0H01370"
                     /inference="similar to AA sequence:RefSeq:NP_015273.2"
                     /ribosomal_slippage
                     /note="ribosomal frameshifting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141436.1"
                     /db_xref="GeneID:59328028"
                     /translation="MVHETLLRKQANVIRLLSTEEVQERISRPDNAAVAFTFPITCLL
                     KSKKTQAASTSAQLYTYSLDEDGFKDWRADIAKPAGTSCEDEVELYWDMIMLTEGQFL
                     LPAAGSDERREKRNLKRFQKYVVKRMGARLDQIVNSKKAPAAVETASWRKLGFRYTLA
                     YLPLHFKDVIWCKSDDVYIHVILPETDLGSRRQTNEREWLLALLELASTMDMQRMRLY
                     IRRDDLNGVSTFLRNLSWIGGKMVPNEDRNARIGATAAGGDDEIDEMLLGDEAFVILE
                     FEC"
     gene            <234586..>235032
                     /locus_tag="HG536_0H01380"
                     /db_xref="GeneID:59328029"
     mRNA            <234586..>235032
                     /locus_tag="HG536_0H01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285541.1"
                     /db_xref="GeneID:59328029"
     CDS             234586..235032
                     /locus_tag="HG536_0H01380"
                     /inference="similar to AA sequence:RefSeq:NP_010770.3"
                     /note="ancestral locus Anc_8.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141437.1"
                     /db_xref="GeneID:59328029"
                     /translation="MSYNGIGLKSAKGSSTSGHIQRSLAHNDESKRTQLKNYTARRKA
                     DKIDKPNGQPSGSIQKARLPSQESMMKHLSRRQIEVAVCELRDELEDRDVEEDVIEQR
                     CDELRTKLLKEQETEQRISKLYQTRSQRLKDAGERQSNEELVKTQN"
     gene            <235241..>235837
                     /locus_tag="HG536_0H01390"
                     /db_xref="GeneID:59328030"
     mRNA            <235241..>235837
                     /locus_tag="HG536_0H01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285542.1"
                     /db_xref="GeneID:59328030"
     CDS             235241..235837
                     /locus_tag="HG536_0H01390"
                     /inference="similar to AA sequence:RefSeq:NP_015274.1"
                     /note="ancestral locus Anc_8.502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141438.1"
                     /db_xref="GeneID:59328030"
                     /translation="MFHLAKGLYNNWNRKEQYSILILGLDNAGKTTFLETLKKSYSLH
                     SKELSKITPTVGQNVAQVPMDKNCILKFWDVGGQQNLRAMWPEYYPQCHGIIFVVDST
                     DRSRIGECNDVLATVMMDEDVEGVPVLMLANKQDRPDAMEVQDIKQIFNKIAEHLGAR
                     DSRVLPLSALTGEGVREAAEWLLIRLQRNKSNRPPQYR"
     gene            <236200..>237840
                     /locus_tag="HG536_0H01400"
                     /db_xref="GeneID:59328031"
     mRNA            <236200..>237840
                     /locus_tag="HG536_0H01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285543.1"
                     /db_xref="GeneID:59328031"
     CDS             236200..237840
                     /locus_tag="HG536_0H01400"
                     /inference="similar to AA sequence:RefSeq:NP_010769.3"
                     /note="ancestral locus Anc_8.501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141439.1"
                     /db_xref="GeneID:59328031"
                     /translation="MRVSTSSKSLGSNPRNSVKVWIQTLLLLTGLLSLFRKQLLQCLT
                     SNSAVVFSESKKKNVIFFVTDGMGPASLSLARSFRQYTENLPIDDTLTLDKNFIGSSR
                     TRSSSSLITDSAAGATAFSCALKSYNGAIGVDPDKNPCGTILEGAKLEGYLTGLVVTT
                     RITDATPAAFSAHADYRFQEDLIALHQLGKYPLGRTVDLLIGGGRTHFYPPHADKKYG
                     SHGSREDGRNLIQEAQEDGWQYVGSRQEFDQLQGGNNVSLPLLALLADYDIPFDIDRK
                     DDEYPSLAEEAMTAINALTIASQDSDKGFFLMIEGSRIDHAGHLNDPAAQAREVLAFD
                     RAFKAVKEYVEKSDIDTILISTSDHETGGLAVGRQVTTQYPEYIWFPRILDRAQHSGE
                     YLTKKLLAFRDQGEGCERSFIKHELFEKGLAIKEYTEDDVDAVVSTDDPGRIQDKLND
                     MVSVRAEIGWSTHGHTAVDVNIYAYANRKDTWDTLLDKLQGNHENIEIGQFMADHLGL
                     NLAEVTEKVRDTKHSPEPAEASTATAQGFDEYYHRISP"
     gene            complement(<237961..>239151)
                     /locus_tag="HG536_0H01410"
                     /db_xref="GeneID:59328032"
     mRNA            complement(<237961..>239151)
                     /locus_tag="HG536_0H01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285544.1"
                     /db_xref="GeneID:59328032"
     CDS             complement(237961..239151)
                     /locus_tag="HG536_0H01410"
                     /inference="similar to AA sequence:RefSeq:NP_015275.1"
                     /note="ancestral locus Anc_8.500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141440.1"
                     /db_xref="GeneID:59328032"
                     /translation="MASLQFIAYRLRKSSWFIIAFPLITLALIYLLFIRSSGPLLGYD
                     GLSISDHKWVHEKENTFYFPYASKYKMPKYSYKKKSNWLSNDRVEDIIPEGHIAHYDL
                     NKLHSTSEAALNKEQVLILTPMQTFHQQYWDNLLQLTYPRELLNLGFIVPRTQSGDVA
                     LAKLEDAVKKVQTDKKNQRFAKITILRQDTKSFDKLMEKERHALEVQKERRAAMALAR
                     NELLFSTIGPHTSWVLWLDADIVETPPTLIQDMTAHSKPVLAANVYQRYFDEEKKESA
                     IRAYDFNNWAESDTGLELAAQMADDEIIVEGYSELATYRPLMAHYYDANGSPSAEMAL
                     DGVGGGCTLVQADVHRDGAMFPSFPFYHLIETEGFAKMAKRLNYEVYGLPNYLVYHIE
                     EWND"
     gene            complement(<239404..>240636)
                     /locus_tag="HG536_0H01420"
                     /db_xref="GeneID:59328033"
     mRNA            complement(<239404..>240636)
                     /locus_tag="HG536_0H01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285545.1"
                     /db_xref="GeneID:59328033"
     CDS             complement(239404..240636)
                     /locus_tag="HG536_0H01420"
                     /inference="similar to AA sequence:RefSeq:NP_010768.1"
                     /note="ancestral locus Anc_8.499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141441.1"
                     /db_xref="GeneID:59328033"
                     /translation="MGKDDKMVERSASEEEDDLKSEKREKLGKLCASLGLQPSRMTDK
                     MLSTIEMSKDIERNQRDVIKKLSSTSPRVEEDEDEDEDARDGCQSIVVDDDSAEVERD
                     GEMQLNTVGKSLKRKRIPPPLSISETNSTTASLHGSGGGSNVSYRLDGESMYARSAPA
                     HVPKFPRSSVDKRFPTMGKPRVQYLGRVSSGVPRRDSPIQSTNAYKLKTPYLSYFPSY
                     PMPPPVPGPSMAAYAPYHPYGYPGQLPLYQSTPQQMYNAPMVPQWQPRSAVPYSSQAR
                     HHQDMITKGKRGRLQNDHQTKKARTKETDERLRDNQSKDADNDSANPPADNEQDQDAE
                     NGDDTESAHLAIEDDPRPFPSSEPRDQNIVGEIRISGNVFSYEFPSQRPSIDKKMFMS
                     ICDKVWDESTRLLDECSP"
     gene            <241171..>242424
                     /locus_tag="HG536_0H01430"
                     /db_xref="GeneID:59328034"
     mRNA            <241171..>242424
                     /locus_tag="HG536_0H01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285546.1"
                     /db_xref="GeneID:59328034"
     CDS             241171..242424
                     /locus_tag="HG536_0H01430"
                     /inference="similar to AA sequence:RefSeq:NP_015277.1"
                     /note="ancestral locus Anc_8.498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141442.1"
                     /db_xref="GeneID:59328034"
                     /translation="MSQKSVLYSNFRIRSWVPRALVRYLGLDVQVVNPYCEEAEKEFA
                     QHFPLKKLPAFLGPNGFKLTEQIAINHYLINSSKDEKIKAQLLGAPADIKTQAEILRW
                     ESLANSDLIVFMVRVFKPLIEEGVPYVKKDADAAWAVVEEIAGIYEARLSEKTYLVGE
                     RITLADLVSAAAFTRGFNYLFGAAWRKQHPSIVRWFNTVTAGEILRDEYRDFKFIDEP
                     VKPPQNVSKKKEKKKEAAPAASKPKPEVEEKPAEARKPKHPLELLGKSSFVLDEWKRK
                     YSNEDTRPVALPWFWEHYNPEEYSLWRVDYKYNDELTLTFMSNNLIGGFFNRLSASTK
                     YMFGCLVVYGENNNNGITGAVMLRGQDHVPAFDVAPDWESYSYTKLDPSNEQDKEFVN
                     DMWAWDRPVVANGEPREIADGKVLK"
     gene            <242678..>244237
                     /locus_tag="HG536_0H01440"
                     /db_xref="GeneID:59328035"
     mRNA            <242678..>244237
                     /locus_tag="HG536_0H01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285547.1"
                     /db_xref="GeneID:59328035"
     CDS             242678..244237
                     /locus_tag="HG536_0H01440"
                     /inference="similar to AA sequence:RefSeq:NP_010542.1"
                     /note="ancestral locus Anc_8.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141443.1"
                     /db_xref="GeneID:59328035"
                     /translation="MSGRGEGEGKGNDNTNSSEVRKDRVVTTVEGMPINEPFATQRVG
                     QHGPLLMQDSSLIELLAHFNRERIPERNPHAHGSGAFGYFEVTDDITDICGSAMFSEI
                     GKRTRCLTRFSTVGGEKGSADTVRDPRGFSTKFYTEEGNLDWVYNNTPIFFIRDPAKF
                     PHFIHTQKRNPQTNLKDPDMFWDFLTTPENQVCIHQLVILFSDRGTPASYRHMNGYSG
                     HTYKWSNKKGDWHYVQVHIKTDQGIKNLTNEEAMRIAGENPDFCQKDLFDSIEKGNAP
                     SWTVFIQTMTEQEAKRLPFSVFDLTKVWPHKQFPLRRVGKLVLNENPQNFFAQVEQAA
                     FAPSNTVPYQEASADPVLQSRLFAYSDAHRYRLGPNFNQIPVNCPYASRFFHPAIRDG
                     PMNVNGNFGAEPNYLANSKQYQFLQQERPIQQHQEVWAGPATPFHWATSPGDIDYVQA
                     RDLYRKVLARQPGQQENLAHNIGVHVAGARPDIQQRVFEMFARVDKQLAADIRKECSA
                     ASSGSELRSKL"
     gene            <244523..>244813
                     /locus_tag="HG536_0H01450"
                     /db_xref="GeneID:59328036"
     mRNA            <244523..>244813
                     /locus_tag="HG536_0H01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285548.1"
                     /db_xref="GeneID:59328036"
     CDS             244523..244813
                     /locus_tag="HG536_0H01450"
                     /inference="similar to AA sequence:RefSeq:NP_015278.1"
                     /note="ancestral locus Anc_8.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141444.1"
                     /db_xref="GeneID:59328036"
                     /translation="MPELMESMSNGIFHNLITTLIQDLVARETSKEQLLRARYPDLKP
                     YHYSTDHQLDIHGKPKQQESSHYLHCDNCGRDVSANRFAAHLQRCLGRGSRR"
     gene            <245010..>246227
                     /locus_tag="HG536_0H01460"
                     /db_xref="GeneID:59328037"
     mRNA            <245010..>246227
                     /locus_tag="HG536_0H01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285549.1"
                     /db_xref="GeneID:59328037"
     CDS             245010..246227
                     /locus_tag="HG536_0H01460"
                     /inference="similar to AA sequence:RefSeq:NP_010541.3"
                     /note="ancestral locus Anc_8.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141445.1"
                     /db_xref="GeneID:59328037"
                     /translation="MSTLLHTLQTEFDKFYDSSSREPITKRCAEETQTFKLQLKKLKA
                     HLAKHIQDSESASSEGNEIEKEKSKRRKDYVVDKLRKSHKSWDQSLKKQVKHLSQQHA
                     RFGRVALVKLFDFGGIDDVYVNKLPAGSKKAVDGAISFHISRYNIGNLSVNGGAEMTR
                     YLNDMYGIPEKTSSKFVEMGQIVQDLKLGDSTSCRKWCVENSPLIFELYVLECLQLFA
                     RGNTLETYHHLTAKLPPCSFHQITKHVSPILTQLVLGQTIQNIDEAIQLQLKKCISLF
                     TKEYCARKNLPFDSPLFLIVLSGVISFKFFMKYTTIRAASHVDWTTEDELPFDVQLPN
                     FLCHFHPIFICPVLKEETTEDNPPYSLPCHHILSKKSMERLSKNGTSTFKCPYCPVNA
                     SKSKTRRVNFVML"
     gene            complement(<246233..>246526)
                     /locus_tag="HG536_0H01470"
                     /db_xref="GeneID:59328038"
     mRNA            complement(<246233..>246526)
                     /locus_tag="HG536_0H01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285550.1"
                     /db_xref="GeneID:59328038"
     CDS             complement(246233..246526)
                     /locus_tag="HG536_0H01470"
                     /inference="similar to AA sequence:RefSeq:NP_015279.1"
                     /note="ancestral locus Anc_8.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141446.1"
                     /db_xref="GeneID:59328038"
                     /translation="MSTVRLISNDNTEIEISREAASISSTLKSMLEGPFKESDGRIEL
                     PTFDSKVLQKVVEYLEYNLQYHDAADDIEDIPEFEIPTEMALELLLAADYLGI"
     gene            <246692..>249079
                     /locus_tag="HG536_0H01480"
                     /db_xref="GeneID:59328039"
     mRNA            <246692..>249079
                     /locus_tag="HG536_0H01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285551.1"
                     /db_xref="GeneID:59328039"
     CDS             246692..249079
                     /locus_tag="HG536_0H01480"
                     /inference="similar to AA sequence:RefSeq:NP_015280.1"
                     /note="ancestral locus Anc_8.493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141447.1"
                     /db_xref="GeneID:59328039"
                     /translation="MKIPSFSWERLRDVFYRSRILCESKWPALDDVQYAISTTLIAIE
                     VNEAIEIYDYQGELEATLDKKAFPDVVAFEFDENDNLIIATPNSIIMVRSWRPLNLSK
                     CLLKDEVQDSIWDFKQSLLVTRQNQDIYRYQNHKIELICKNSGRYTLLTKEHWGSDRK
                     KAVLLDVNHVFQLEIEDKLLSKSLQDSQWQNVVISPDGLICLYSSKFNKLQIYKDPQR
                     ILLEHSLDGVPKIIKWCGNDSIACSFTDEVRLYGPENSYVTFWYPHEISALFTEADGL
                     KIFTEEDVRFISRVSSSTSNAFRVGSTEPAAILLDSLDLLDSNISGAIENLKIINLEK
                     AVEDCIAAAKEEFDPHIQKQLLSAASFGKASLAYRSFDSDKFVHACDKIRLLNLLRGR
                     AMFLTAAEFDRISLNGIIERLLVRHKHYHAIAICRLTKNLSFLPKVFSSWAITKLQLS
                     PELEDDELLSLIKEKFFDLQTKADGHMARVAHAAFLEGRFRLARDLALLEPSTTLKIS
                     ELLGLEDDNLALTVSMEARSPELTLSLLLSLRERLTTTQLIRLLTINMSNEQLYPYYN
                     RKYHSLLYDYYRQMDQYVDLAQLLIAQAKQQGSLRAFLPQVRELYSKIPNNPLTKENT
                     ELLLRQEKLYTYQDSLSSKYGQNFIDMSLDETLSKLIDLRQERQAQDLVKRFNVTDKK
                     FYHLKCKRLIENKLFEDLYEFAISRKSPIGYRPFYNYLKRKGYNAEAVNYVDMISGIS
                     YKQKWDLYLECKGYYEAIRLAGKEKDVLGLKELYRIVPANEPRLKAEINQIMSKL"
     gene            complement(<249098..>250450)
                     /locus_tag="HG536_0H01490"
                     /db_xref="GeneID:59328040"
     mRNA            complement(<249098..>250450)
                     /locus_tag="HG536_0H01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285552.1"
                     /db_xref="GeneID:59328040"
     CDS             complement(249098..250450)
                     /locus_tag="HG536_0H01490"
                     /inference="similar to AA sequence:RefSeq:NP_010540.3"
                     /note="ancestral locus Anc_8.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141448.1"
                     /db_xref="GeneID:59328040"
                     /translation="MEEAVSAKMELEDRLIPYNDRKFVLRKLLRLPLTALGHLVIHWA
                     SKYGVESRSGFARIQASVETLQKRRVKRRILATRIILDYWPRGMYLYQLAQIDCYLLV
                     HRPSLHYWASSTAWNAKNEKQIMHLDFDNFVQRLKEDLQTLYLCNVHSFKHPEMPLLI
                     CRVQLFDHSNKFRADPARSLDGSSSLNAPIEHQLISRSPYYIAFPLNSPNIIHSPDED
                     SYAKLILQSVQKIYSEREPVMLRPNQTIAVRSLEALQILQGASRHSSALGPWACYAGV
                     SFEISPLGKIERHESMRGRRVLSSSGDLPDDSLPEAKRLRHEKAMVRFKGSREGVMKR
                     KAYETKRFIQRIHNPDKEPSASADESEINISKYSSLIPVEKVEFTLTKDLSPASRQVS
                     VRFKFRGKDVFGGLHELCDKELIQVEKVPGWLAGENGADSGTIINGEFINCTQKGGLL
                     "
     gene            <250756..>252825
                     /locus_tag="HG536_0H01500"
                     /db_xref="GeneID:59328041"
     mRNA            <250756..>252825
                     /locus_tag="HG536_0H01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285553.1"
                     /db_xref="GeneID:59328041"
     CDS             250756..252825
                     /locus_tag="HG536_0H01500"
                     /inference="similar to AA sequence:RefSeq:NP_015282.1"
                     /note="ancestral locus Anc_8.491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141449.1"
                     /db_xref="GeneID:59328041"
                     /translation="MASVERHVVHGKTGGEETRQDNGLDMKTLFVRSIPADVSDEELS
                     EFFSNFAPIKHAVVVKDAQKKSRGFGFVSFAVEEDTLEALKQARKTKLRNNLLRIDIA
                     KRRDRSKKRDEVAPAGAVEETKSKNDLADEESLLRGKPKIIIRNMPWSCRDADKLKKI
                     FGKFGTVVEAKIPKKSDGRLCGFAFVTMKKLANCRAAIEGSRDLKIDGRSVAVDFAVQ
                     KSKWEEYNKTKEDQAEAGHAHSQSEEEDQVENDEEEGQESGDDSEIESEHSDEELEGD
                     QGEQERLVASNKNRRENFSVFVRNVPYDATEESLAEHFSKFGPVKYALPVIDKQTGLA
                     KGTAFVAFKSENAYNDCLRNAPAAGATSLLIGDDVQPQYVYEGRVLSISPTLKREDAS
                     QMAEKNAAKRKEILGKAPGERDKRNLYLLNEGKVIEGSKLASLLSPKDMEIREASYKL
                     RVDQLKKNPSLHLSLTRLAIRNLPRAMTDKSLKALARKAIVEFSTQVKNGERHPLSKE
                     ELIRSTKEKYKFMSPEEIEREKKKDKKHGVVKQAKVIMEVKGANVGRSRGYGFVEYKD
                     HKHALMGLRWLNVHQVTMEEVQNGDTEEAKTAVDSDSFKSRRLCVEFAIENANVVKRR
                     RENVKQARESAKRRHEEAEDKGNNFKKAKIDSAASKTSDKATKSGLSDDAKRLIGLKR
                     KRKSLKK"
     gene            complement(<252969..>254735)
                     /locus_tag="HG536_0H01510"
                     /db_xref="GeneID:59328042"
     mRNA            complement(<252969..>254735)
                     /locus_tag="HG536_0H01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285554.1"
                     /db_xref="GeneID:59328042"
     CDS             complement(252969..254735)
                     /locus_tag="HG536_0H01510"
                     /inference="similar to AA sequence:RefSeq:NP_015283.1"
                     /note="ancestral locus Anc_8.490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141450.1"
                     /db_xref="GeneID:59328042"
                     /translation="MNNGGEKVSSLYQEMQQRSQPVNGQQNQPPVSGKSLWQNQPQQF
                     TQSQAYGMKNTSRMPHGKQPMLMANNDVFSIGPYKARKDSSRFSVLEKYEIIGYIAAG
                     TYGKVYKAKKRPGTVECDGSDEVLNVEPTGVQTGSHANEAENQISSDIIADPIDTGLR
                     AVEKTSATQNGLQIPASSSNASVPSTSAGEHPGLSRGKVASTFYAIKKFKTEREGVEQ
                     LHYTGISQSACREMALCRELNNKHLTKLVEIFLERKSIYMVYEFAEHDLLQIIHYHSH
                     PEKRMIPPKMICSIMWQILDGVSYLHQNWILHRDLKPANIMVTLDGCVKVGDLGLARK
                     FSNMLQTLYTGDKVVVTIWYRAPELLLGARHYTPAIDLWAVGCIFAELIGLRPIFKGE
                     EAKMDSKKSVPFQANQLQRILEVLGTPTSKTWPHVQKYPEFDQLCKFSKYKDNLATWY
                     HAAGGRDKSALDLLYQLLKYDPMTRIDASNALDHDYFTGAGNAVYENVFEGLNYKYPA
                     RRIHTNDNDIMNLGNTRGKNVNQQQATTAVPSSSSNALGGLGVNRRILAAAAAAAAAV
                     SGNNAASQSAGRTSEHIRKKRR"
     gene            complement(<255338..>255994)
                     /locus_tag="HG536_0H01520"
                     /db_xref="GeneID:59328043"
     mRNA            complement(<255338..>255994)
                     /locus_tag="HG536_0H01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285555.1"
                     /db_xref="GeneID:59328043"
     CDS             complement(255338..255994)
                     /locus_tag="HG536_0H01520"
                     /inference="similar to AA sequence:RefSeq:NP_015284.1"
                     /note="ancestral locus Anc_8.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141451.1"
                     /db_xref="GeneID:59328043"
                     /translation="MLLTLKPINVLIPSRIVSYRLGGSAFRFSVYPLVRGYSARAEKA
                     QRSTLKDKKKVEDRLHRIIGKSKILSRLNKNPKFAGYFDRLSEAGVTSTVTSFLVLHE
                     LTAIVPLFGLWWVLYQLDLPDQYELPLYFTDLLDRCGEAMEKLVGDKYSEGLDRNRLI
                     LAGAISYALVKMLYPVRVLISLWAAPYFGRWLLSPINMLRSKSRIKVGSGSTREPLNK
                     "
     gene            complement(<256435..>259443)
                     /locus_tag="HG536_0H01530"
                     /db_xref="GeneID:59328044"
     mRNA            complement(<256435..>259443)
                     /locus_tag="HG536_0H01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285556.1"
                     /db_xref="GeneID:59328044"
     CDS             complement(256435..259443)
                     /locus_tag="HG536_0H01530"
                     /inference="similar to AA sequence:RefSeq:NP_015285.1"
                     /note="ancestral locus Anc_8.488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141452.1"
                     /db_xref="GeneID:59328044"
                     /translation="MLRRSFTKITCKRCYSDKHSFQKTLILPRTKFPNRSNLLKTLNQ
                     LIPQCSQDAYVSQLNEFLFKIESMDDDAAKVKFIKEKLFVLHDGPPYANGDLHLGHAL
                     NKILKDIINRYQLIRGKYVFYKPGWDCHGLPIEMKALKDFSSDSSHAIAPLKIRSMAA
                     THAAKAIQTQKNQFKQFAILADWNDCYKTMDPGYEINQLEVFLEMLKRGLIKRQNRPV
                     FWGIETRTALAEGELEYNDNHKSTAAFVKFPLTSASNLQLLERLSKNVMVEYLADKER
                     NDTINCLIWTSTPWTLFSNQAICFNEKFTYCLVKLEGGFLIVEEELLQKINVTEPYEI
                     LETFSGELLAGLHYTHPSMRDGVPRPLLHGEHVTKSIGTGLVHTAPGHGSDDYMTGQQ
                     HNLKTFSPVDHRGRYKLDELPVYVHKTLTEPETGLPRKVLDLATTSAILECLKRHNML
                     HAAHEYVHSYPYDWRSKRPVIIRATPQWFADLHDVKKLALDSLEDVEFHPHRGQARLG
                     AFIRARNEWCISRQRSWGVPIPALYKVDEPDQILMTEETVSHIIGVIKKKGMNSWFAE
                     RESDMREWLPPSFAEDANGYARGRDTMDVWFDSGTSWSVLERFYLDCLKLDKIPEKLA
                     DVYLEGSDQHRGWFQSSLLTRVASSGTATTPYKNLITHGFTLDEKGIKMSKSIGNTIS
                     PRHVIEGDQKTGLPALGVDGIRYLVAQADYTTDIVAGPTVMVRVADALKKLRLTLRFL
                     LGNLNVGYTKLSFGDLRPVDQYTVSKLQELMNTTEQYYESFNFSKVLTTVQHHMTNQL
                     SAFYFDMSKDTLYCDAKDSKKRQQILTTLFHILDTYRAIMAPILPVLMQEVWNCLPSG
                     VKELESNEDSPINRAWPQFPFSYEMIKTFEDNELAVLREYQRQFKQLNSNVTKSSQTD
                     VTIVTDAQDLPFDADEINDILQAGQTNIISSSAGDIMDEGALMLSNGVRVKIDVKPSA
                     LMKCPRCWKHNTSNEENLCDRCEKVVHNVN"
     gene            <260982..>261623
                     /locus_tag="HG536_0H01540"
                     /db_xref="GeneID:59328045"
     mRNA            <260982..>261623
                     /locus_tag="HG536_0H01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285557.1"
                     /db_xref="GeneID:59328045"
     CDS             260982..261623
                     /locus_tag="HG536_0H01540"
                     /inference="similar to AA sequence:RefSeq:NP_010539.1"
                     /note="ancestral locus Anc_8.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141453.1"
                     /db_xref="GeneID:59328045"
                     /translation="MSEEALFFSQAAEAIVATSLNAANVDPTIRELLSRIKYSLPGLP
                     PAQAQESQNGVANDAGTVLPETRDVTNGPGVLEYFASPMSLSISNGNGSQTSHTEHFN
                     ISPGNSNAKGSGESTQGVRNQSDKSAEEKKYSCAKCKLEFRRTSDLRRHERTHLPVLP
                     NICPQCGKGFARKDALKRHSNTLTCRRNRSKLLSIGGDINDILERVQQTGNGT"
     gene            complement(<261692..>262180)
                     /locus_tag="HG536_0H01550"
                     /db_xref="GeneID:59328046"
     mRNA            complement(<261692..>262180)
                     /locus_tag="HG536_0H01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285558.1"
                     /db_xref="GeneID:59328046"
     CDS             complement(261692..262180)
                     /locus_tag="HG536_0H01550"
                     /inference="similar to AA sequence:RefSeq:NP_010538.1"
                     /note="ancestral locus Anc_8.485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141454.1"
                     /db_xref="GeneID:59328046"
                     /translation="MPIDQEKLAKLQKLSANNKVGGTRRKMTKKSGSLSASNKDDTKL
                     QSQLAKFHAVTVDNVAEANFFKDDGNVLHFNKVGVQVAPQHNTSVFYGIPQEKGLQEL
                     FPNIISQMGPESIQALTQLSAQLQQAQQAQKAKEGSNDAEKKDESIPELVEGQTFEGE
                     VE"
     gene            262587..262660
                     /locus_tag="HG536_0Htrna9I"
                     /db_xref="GeneID:59328410"
     tRNA            262587..262660
                     /locus_tag="HG536_0Htrna9I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:59328410"
     gene            complement(<262827..>265520)
                     /locus_tag="HG536_0H01560"
                     /db_xref="GeneID:59328047"
     mRNA            complement(<262827..>265520)
                     /locus_tag="HG536_0H01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285559.1"
                     /db_xref="GeneID:59328047"
     CDS             complement(262827..265520)
                     /locus_tag="HG536_0H01560"
                     /inference="similar to AA sequence:RefSeq:NP_010537.3"
                     /note="ancestral locus Anc_8.484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141455.1"
                     /db_xref="GeneID:59328047"
                     /translation="MGSSSMLRVLIVGNNPNLVLYASRFQLAKSVELFHVSSTKSNIF
                     SIETVAYGKEEFKLDNHFTSVSNLIEALKQSGDSASLIFDMIILSASSLQEVSSSASQ
                     INPLININTKLFLESSGFVQLEPFVKMSLDLPQLNIFSIATDYDIRQVGDNLYQQFGG
                     PRNGGSAIFLGESSVIGQQQQQQQNSKNSPANSSSSLSQTATKYPKNVVTLLETFQRL
                     FKKLLPQDTIGLCNYSAAEFVSQQWALAVPKICFDPLLILFEETKPKELHQHILAKPL
                     ISGLVTEVITVMKSMGAKLNGNMENESSLLSHWQRMYPKPDEMPSLVYHYIRRTASLN
                     IDMLLLQPILLADDYGIKTPYLEFLYSAMCQYQKLNEGKSKWFARVENQQDLKSQLVR
                     RTEEKNLFESKAASYESALQEKDALIQQLQSSEQSFKSQVSALQNQIGALRKEMIGLT
                     KKHEMELQQLREEQRIAMANTPHANSNTSAAKEQQETAARDHYGPTGTPNLKDIEDVA
                     LFGINYGDTPRKDEARQHLQQPTPPPTSGSMHSSGSHSGSGSGSGSEVDKSLKERELE
                     IRKKELDLQERELELQRRAVQQQHQRFSKSQKQNNNPTSPTLGNRKSSFPHLQQASGV
                     RPNRSMHGAAPAQALSAGNFVDPLSSSMGYRGGGTFNQTSLIATGQMQSHHSHSIKPT
                     SRKNRNSNMAIIGNASSLGLNDYGRPPPAPNQTRLNSLSTGNLNSQPRLRQQSNVELN
                     NIGQSAYNASTNLNAKLNMPHPIKASSSAAVNQPMSGGSTQQPLEFQTKRQFSSSTTA
                     ENNTTAANMSMSSVVHNPMTETIDQRQTQASAQVQSPPQINIDGPESPLPSSGGMHMS
                     DSNEEIENSTGDSSQPHTDAKKDKKKKFGLFGKKNKSKNPK"
     gene            <266183..>267232
                     /locus_tag="HG536_0H01570"
                     /db_xref="GeneID:59328048"
     mRNA            <266183..>267232
                     /locus_tag="HG536_0H01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285560.1"
                     /db_xref="GeneID:59328048"
     CDS             266183..267232
                     /locus_tag="HG536_0H01570"
                     /inference="similar to AA sequence:RefSeq:NP_010535.3"
                     /note="ancestral locus Anc_8.483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141456.1"
                     /db_xref="GeneID:59328048"
                     /translation="MGYALTGYPSRSDKRRRQSQYRFCAYEDDRRRPKGKARARRKGT
                     VEANGRVAQMKTPPSSLQELPVEVLERIFVLSRDLTLMPALNSYFYHNLKPSSHLLRK
                     FMWEIYSFDYYDYEASVLRGKLSNFNENEVFLIDSIFDNRTFFEFYRDNYAELSKRVR
                     GYIPRYCLEADFSMSHPDVPGYDFPERFYTEFDHLFLHKEMMNDLGNTFTFERVSEVI
                     EGLLEWLFTEFPPYVKNYDQIHEAIVLVLDLGFPDYVDAPAGPLFALLHAVFENKDPQ
                     GLRAFADRLCEEEVEDSRIKLLESFLTRWYAEGESRDCLSDPMLWAELRRLSNMAVVE
                     AIERCGGEPQYDIFF"
     gene            complement(<267318..>268064)
                     /locus_tag="HG536_0H01580"
                     /db_xref="GeneID:59328049"
     mRNA            complement(<267318..>268064)
                     /locus_tag="HG536_0H01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285561.1"
                     /db_xref="GeneID:59328049"
     CDS             complement(267318..268064)
                     /locus_tag="HG536_0H01580"
                     /inference="similar to AA sequence:RefSeq:NP_015294.1"
                     /note="ancestral locus Anc_8.482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141457.1"
                     /db_xref="GeneID:59328049"
                     /translation="MKELKHENIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRMVEN
                     SPQGLEMSLVKYFQWQLLEGVAFCHESKILHRDLKPQNLLINNKGQLKLGDFGLARAF
                     GIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDMWSCGCILAEMVTGKPLFPGTNDDE
                     QLKLIFDTMGTPNESTWPGVSSLPKYNPNFHQRLPKDLRTILQPHAREPLDDNLIELL
                     HGLLQLNPDMRLSAKQALHHPWFAEYYQHP"
     gene            <268560..>270191
                     /locus_tag="HG536_0H01590"
                     /db_xref="GeneID:59328050"
     mRNA            <268560..>270191
                     /locus_tag="HG536_0H01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285562.1"
                     /db_xref="GeneID:59328050"
     CDS             268560..270191
                     /locus_tag="HG536_0H01590"
                     /inference="similar to AA sequence:RefSeq:NP_015295.1"
                     /note="ancestral locus Anc_8.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141458.1"
                     /db_xref="GeneID:59328050"
                     /translation="MGAANVGSQRGGFKFGADRHSLLGAEWYGMYSTQEPVTFKREHF
                     ETAMMNLIREPNINSSVILRADILSEVDITGDREEVIVKDKECLNPEIKEFEAKKINI
                     EDLEVREAAIAPEMDLHIRKQVVRRIIPRNPYKDAIINQTCLVLRGPEEDGPDCLVIY
                     IPHINAEDECPFYIPRVKAVGILLHGDILSVHYVPFDNGEVLRDESQRVVRTAWRLLQ
                     TAFKHSTGVIQGYKKRVNHDQVVDKVNFQNQYINLKKKYSKFLVDNWAESTDPKKHVF
                     EDIAIAAFLIELWRKVKGPDFREKMQFRDLGCGNGVLCYILISEGVTGIGIDARHRKS
                     WAIYPADIQACLKEQVIIPSLLLRPHPEVRKRAPHLQHNGGLFPVKVAHELIAPATVV
                     YSSEDLLRSPQVNVAEFSPETFIIGNHSDELTCWIPLLGYPFMVIPCCSHDFSGRRVR
                     FNVRELEARQTSNSTYAGLVDHVSYIASRVGWKVEKEMLRIPSTRNAALIGYENENLG
                     QFPTQEVYDMVLEDGGPDGWIQNTMALMKRSPRNH"
     gene            <270338..>272572
                     /locus_tag="HG536_0H01600"
                     /db_xref="GeneID:59328051"
     mRNA            <270338..>272572
                     /locus_tag="HG536_0H01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285563.1"
                     /db_xref="GeneID:59328051"
     CDS             270338..272572
                     /locus_tag="HG536_0H01600"
                     /inference="similar to AA sequence:RefSeq:NP_015296.1"
                     /note="ancestral locus Anc_8.480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141459.1"
                     /db_xref="GeneID:59328051"
                     /translation="MFKRLALPIAVAHRCFRRTSLSRYHNRKVSARIFEDESWLVTKP
                     KLNNLPKGATKESSFVQYEFTGLNPTSLYHRDPMFKNLLDRSIQLIYNEKVTADSAED
                     NTKFLAWLKLRDYLYEGLKDPKLTSNTENYRPTLQQTVRPTEPSKLVLQLLKTDEIED
                     SVWNKILSKKEAITVQDKYVYLLRQMYNYIYGQEIVPKMAHTREIRGSHDVDISNPTE
                     WFPEARKMKRHIIMHIGPTNSGKTYNALQKLKNADRGYYAGPLRLLAREIYDRFQEEG
                     VRCNLLTGEEVIQDLDAAGNPAGITSGTVEMVPLTQNYDVVVLDEIQMMADADRGWAW
                     THALLGVRAREIHLCGEKSTLPVIKKIASMAGDRLTINEYKRLGELEVETTVLKKGLK
                     SLRKGDCVVAFSKKRILDLKLKIERETNLRVAVIYGSLPPETRIQQAKLFNTGEYDVL
                     VASDAIGMGLNLSIDRVVFTTDLKFNGQEMVDLTSSNMKQIGGRAGRFKANAGNGEIP
                     KGSITALEPRVLTSVRRGIEAPISYLQTAVIWPTDEICARVATKFPPGTPTSTVLRTI
                     ALQLEQRSDKLFTLSDLKNRLSVLQVFEHMDSLPFLEKLRLSNAPVKDLTMVKRAFYK
                     FCETIAKRQTRGLLTYPFPFEVLDFRCIADEKFTLELYESLYNIIMIYFWLSNRYPNF
                     FIDLESARDMKYFCELIIFEKLDRLKKNPYDKKGLMSTRQGSRYKPKASYSRRSTNNF
                     KNHY"
     gene            <272788..>273984
                     /locus_tag="HG536_0H01610"
                     /db_xref="GeneID:59328052"
     mRNA            <272788..>273984
                     /locus_tag="HG536_0H01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285564.1"
                     /db_xref="GeneID:59328052"
     CDS             272788..273984
                     /locus_tag="HG536_0H01610"
                     /inference="similar to AA sequence:RefSeq:NP_015297.1"
                     /note="ancestral locus Anc_8.479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141460.1"
                     /db_xref="GeneID:59328052"
                     /translation="MSGNVYIVAAARTPVGSFQGSLSSKTAVELGTAAVKGALAKVPQ
                     LNPATDFDEIIFGNVLSANLGQAPARQVALAAGLDNHIVATTVNKVCASALKSIILGA
                     QSIKCGSADVVVAGGCESMTNTPYYMPAARSGARFGETKLVDGVQRDGLNDAYDNLAM
                     GVHAEKCARDWNCSREEQDTFAIASYQKAQKAQKEGKFDDEIVPVVIKGFRGKADTTV
                     TKDEEPDKLNVEKLRNARPVFQRENGTVTAPNASPINDGGAAVILVSENKLKELGLKP
                     LAVIRGWGEAAHEPADFTWAPSLAVPKALKHAGIADVNDVDFFEFNEAFSVVGLANTK
                     ILKIDQSKVNLYGGAVALGHPLGCSGARIVVTLLSVLKQEGGKIGVAAICNGGGGASS
                     IVIERV"
     gene            <274212..>274757
                     /locus_tag="HG536_0H01620"
                     /db_xref="GeneID:59328053"
     mRNA            <274212..>274757
                     /locus_tag="HG536_0H01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285565.1"
                     /db_xref="GeneID:59328053"
     CDS             274212..274757
                     /locus_tag="HG536_0H01620"
                     /inference="similar to AA sequence:RefSeq:NP_010534.1"
                     /note="ancestral locus Anc_8.478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141461.1"
                     /db_xref="GeneID:59328053"
                     /translation="MVPKVLVLAGTAGTGKSSVAAILLKHYTEDYPELEFLEGDLLHP
                     ESNVLKMKEGIPLQDDDRWDWLRQVSKQSSESAQKHGLCIVTCSSLKKKYRELIRTTS
                     PEANFYFLFLYAQKAVILQRLESREGHFMKANMMQSQFRDLELPNCAEESHCKIVHVD
                     GKNFDQVEKEVLKDVQELFSS"
     gene            complement(<274853..>276283)
                     /locus_tag="HG536_0H01630"
                     /db_xref="GeneID:59328054"
     mRNA            complement(<274853..>276283)
                     /locus_tag="HG536_0H01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285566.1"
                     /db_xref="GeneID:59328054"
     CDS             complement(274853..276283)
                     /locus_tag="HG536_0H01630"
                     /inference="similar to AA sequence:RefSeq:NP_010533.1"
                     /note="ancestral locus Anc_8.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141462.1"
                     /db_xref="GeneID:59328054"
                     /translation="MLTNCQINNFQITSQIGSGAYGLVFHAVDMITENEYAVKAVVKS
                     SSLNDVGKPTTQDNLKKSTVLQTQLYHYFKSFQNRLFLPSIDLDSIQALTNAQLAKAP
                     HYKEIALHLKVHSHENIVTIHQVLESPLATFIVMDYYPRDLFTSIVDEKYFSENGLLI
                     KKVFLQLCSALDHCHHMGVYHCDIKPENILLDANDNIHLCDFGLSTTCQYLAPNVCIG
                     SSYYMAPERILYCNENTQDTMVTSFPTATGDIWSLGIILINLTCIRNPWLKAHQTEDN
                     TFNYFTRDSNVLKKILPISEQLYCLIARILQLNPYNRIDIRTLMSEMANITSFTNDGG
                     PLSTVPQLSQELYNTFIIGDKGMSLKEILHSYHDDEETDERQSCESYPSSSGISTYTD
                     ENNTPAGSSNVEITPYSSDVDEMILKVNNALSINNSFAVNERESLSQQQATLPCLQAN
                     LSTITNYSISNVQPEGFNWLPNYNNT"
     gene            complement(<277044..>277688)
                     /locus_tag="HG536_0H01640"
                     /db_xref="GeneID:59328055"
     mRNA            complement(<277044..>277688)
                     /locus_tag="HG536_0H01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285567.1"
                     /db_xref="GeneID:59328055"
     CDS             complement(277044..277688)
                     /locus_tag="HG536_0H01640"
                     /inference="similar to AA sequence:RefSeq:NP_010532.3"
                     /note="ancestral locus Anc_8.476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141463.1"
                     /db_xref="GeneID:59328055"
                     /translation="MAIKSILIINKSGGLVYRRNLSNDESLNSNDYLIVASTLHGAFA
                     IASQLTPKALQLSESPLTSKIDYTIPYIPYVGLPRTGANTTEKSRFSSSSSNNLGTTN
                     SLGSFKGSDYFKEPFQSWNKSGIRQICTDQFTMFIYQTMTGLKFVAISTQTPSSVTNS
                     EYSTISVQIADNLLRKIYCLYSDYVMKDPFYSMEMPIKSECFDCRLKQMVSNLP"
     gene            <277832..>278500
                     /locus_tag="HG536_0H01650"
                     /db_xref="GeneID:59328056"
     mRNA            <277832..>278500
                     /locus_tag="HG536_0H01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285568.1"
                     /db_xref="GeneID:59328056"
     CDS             277832..278500
                     /locus_tag="HG536_0H01650"
                     /inference="similar to AA sequence:RefSeq:NP_015301.1"
                     /note="ancestral locus Anc_8.475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141464.1"
                     /db_xref="GeneID:59328056"
                     /translation="MSQIISHDITQPIHIPQIDGNRLSSRDSLVLRAFKNDVWLPNTT
                     VAEQKHCLVSRELLFQILIVEDISKSKLSQIEDITARLNPNNQRIDRLSSGREKIVIN
                     QVNVESEETNIETSSPPNKKTVYRLTLQDKSGAIFFALNVTNLPWLSVCMLGSKLIIS
                     MGTQFIRGVFLLNDTNCIFLGGVNQTWNENRELKLQDYLESKLQRESESQLSSNTKKR
                     KATQ"
     gene            complement(<278526..>280469)
                     /locus_tag="HG536_0H01660"
                     /db_xref="GeneID:59328057"
     mRNA            complement(<278526..>280469)
                     /locus_tag="HG536_0H01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285569.1"
                     /db_xref="GeneID:59328057"
     CDS             complement(278526..280469)
                     /locus_tag="HG536_0H01660"
                     /inference="similar to AA sequence:RefSeq:NP_015302.1"
                     /note="ancestral locus Anc_8.474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141465.1"
                     /db_xref="GeneID:59328057"
                     /translation="MSIRELYNEKSRPSLSLEFFPPKTETGKRNLLERMVRMSALDPL
                     FITVTWGAGGSTAEKTLELAAITQRSLNVPVCMHLTCTNTDKTVIDNALRTCQQVGIR
                     NILALRGDPSIEDSVGQERVTQEPVDFEHAVDLVRYIRTQYGSYFCIGVAAYPEGHCE
                     GEAEASEQDPLRDLPYLKEKVDAGADFVITQLFYDVKKFLTFQKLFVDHVSAEVPLIP
                     GLMPINSFLLFNRAAKLSHASIPKHILDKIPPEIQPDDNAVKSICVDVLADIIDTIYR
                     ETNGRVKCFHFYTLNLEKAVAHIVAKSDVLHHIMKEAEEEEEEEEAKTNVDQDGDIAL
                     DDGPGTTTLQEDNRKRRRNSSNVSTNFTSNQLAVHKTRRSSIGIPSRKVAISISQGTG
                     TLGRDATWDEFPNGRFGDSRSPAYGEIDGYGPSIKAGSKRALQLWGSPTNVEDLRNIF
                     IKYLENSIDSLPWCDLGLSPESALIQEELIQLNDRGFFTLASQPATNGASSTDKILGW
                     GPAHGVVYQKSFVEMFVQKERWNTSLKHIVDHYGREKLTYYVGGSDGSFGSNLEPGSS
                     NVVTWGVFANSQVIQTTIISEESFKAWRDEAFSIWLEWAKLFPRNSQSNSFLRQMHQD
                     YYLVSVVHHDYNQSDELWEILLS"
     gene            <280657..>283794
                     /locus_tag="HG536_0H01670"
                     /db_xref="GeneID:59328058"
     mRNA            <280657..>283794
                     /locus_tag="HG536_0H01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285570.1"
                     /db_xref="GeneID:59328058"
     CDS             280657..283794
                     /locus_tag="HG536_0H01670"
                     /inference="similar to AA sequence:RefSeq:NP_015303.1"
                     /note="ancestral locus Anc_8.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141466.1"
                     /db_xref="GeneID:59328058"
                     /translation="MASLFIQEDSDDESLQQELSRQISSRKNHEEALLPQQTMLPEDP
                     HIERDATGPSDDEKPLYPLIPREDSGANLKPNIEDIREVDIQLNLPLSFQRQVVENVL
                     VADDPLVVIGKGLCMIVIVANLLHVLGTPTRINGISKRSLVLVLNAKPSDNIHISDEL
                     QELSALSSFENPQDEEPRPFHVINADSQTLEKRRQLYLSGGIFSVTSRILIVDLLSGV
                     LHPNKITGIVILNAESLKEYSNESFILEIYRSMNKWGFVKAFSESAESFVMEFSPLMR
                     KMKDLRLKNVLLWPRFRVEISQCLNNAINPKENKVVEVKVSLTNSMSQIQFGLIECLK
                     KCLAELQRKTPELFRDWWSMANSLDAHFIKSIDMVMIPNWHRISYEAKQLIKDIRFLR
                     NLMKLLVSGDAVDFYEEIQLSLEANKPSISRKYTESPWLMADESQMVVSYAKKRIFND
                     GKYCLEDMPKWDQLINILDEISYQRASKDYLGPTLIMCSDAATCMQLTRVLSLADEKD
                     GFRKNMLHKLQIYKDRREDRKQMVREVRDKEPERATELNVSTAFAKEQLTTKRRRTRG
                     AAAVAAVQRLKNAGIGEDIEAVIDTYSVKQEIEGSHGDESRPDGEDYEMLPILDESDS
                     HVLDQGDEDMMEMLKSDLSRKIWEQRAKNYSYVNTGDEIIVERFDKVSDDTFLQELMP
                     SFIVMYEPDLCFIRRVEVHRAIHKEIPSKVFFMYYGDSVEEQGHLAAIKKEKDAFTKL
                     IREHSMLAHHFEADEDLSHYHNLAERKLKLSRLRKNNTRAAGGQAGLSEMTQDIVIVD
                     TREFNASLPGLLYRYGVRVVPCMLTVGDYIIAPDICLERKSISDLIGSLHNNRLVSQC
                     KKMAKYYKYPTLLIEFDQGQSFSLEPFSERRNYRNKDSSTVHPISSKLSQDEIQMQLA
                     KLVMRFPSLRLIWSSSPLQSVNIILELKIGREQPDPTMSVSFGSTTGQKNPAVKKNKD
                     PSADQERLTKLLDVPGISKVEYFNIRRKVKSFKRLSAMSQQDLTDLFGDDLRQRINHF
                     LQVEELEGEGTGEDT"
     gene            complement(<283927..>287259)
                     /locus_tag="HG536_0H01680"
                     /db_xref="GeneID:59328059"
     mRNA            complement(<283927..>287259)
                     /locus_tag="HG536_0H01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285571.1"
                     /db_xref="GeneID:59328059"
     CDS             complement(283927..287259)
                     /locus_tag="HG536_0H01680"
                     /inference="similar to AA sequence:RefSeq:NP_015309.1"
                     /note="ancestral locus Anc_8.472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141467.1"
                     /db_xref="GeneID:59328059"
                     /translation="MDFFNMGNDDTKPENGNVNYFDTRSTHDNDSTSLSPQAILARNS
                     ISETSNGQNMSNNHISMSPQQMFTPMSSSNISANPVANNNPNSPAVGAATPQQILMFN
                     NNNYQQGYSSQHSPIVQSSNDPARALPVQENSGKAYAERAAMIASLQAKQQQQQQQQQ
                     EQQQHQQPQPQYQQAFNYRGGSVLQNLSPELQKKISIELNNKQYELFMKSLIENCKRR
                     NMPLQSIPEIHGKKVNLFILFMLVQRLGGGEQVSRTQRWDLLSQKLQIQDSQQLASVY
                     YRIVLPYEKYLASPEGLKESQAKKIFFQQFFQELIRKIQANSKPENNAFNQALASTPN
                     SSATPTNISSFKQQPTMQQMQQSMQQKPSIAPKPKKPRKPRQKKKTKKELELERRQQE
                     EMLRKQQQAILEQQQKQRLLVEHQLQRQKEMIRQQYQQELAKLPKVYKRGLARNYKPS
                     QRQMNLTSGYDMNYLSQIGEKIEANKPIFLFPPELGTVNLHAVSMSLQSNDLGEVNTA
                     LNTLLVASADSVLKVPLDRYPETLDAICILGIKLLRDIFTRNIGSNHSARHADHNDNP
                     SPKNVSLIKVTEEINTGGLGDIAADSYNYKAGYCEEYDVNAFLDDRLTSYSKTNDLIN
                     EIFDRYKQHAENMSENDKVIAVDSLTGEDLQQSSIFALTPAQTPKAEEANANSRGDSH
                     RSETQDNSIGWDVLPEPLKDFPGQPFSDLSVPSYLQSLKSINDEIDTVFTKVNTRGAE
                     DKNISITDQISTISMILRNFSFSEKNSKLMAKNTFLKRFYLDLLWMLFLNPNMLIFHR
                     KAFNFKKDTIVTLTNICHAYEINSQLECFLILMLVLSFGEPRKTMPEQDSHVLTYAER
                     PINKGHYSGFSADIFAKLLSLDHPNRRLFKEVLLLFPSEGYGNDGNCQKDIVYHLVNA
                     YCDGDSFRLLNDVVSFLLSLIPFMQADTTPSLIEEKAPVIAQSLTCLLTLINFLDTNE
                     APVRDIKFENVPLRWLTAEENIGASLRRLSDVLSNIGLRTDRNLLHLRRLLLSISSKA
                     IEVTSLMVEKSLELAGKSDRGIFGVCETLASIPGLLPSECQSYTFSTHSVTDPEISKQ
                     NERLYRVRNRVLSHLVKAKSPA"
     gene            complement(<287547..>288647)
                     /locus_tag="HG536_0H01690"
                     /db_xref="GeneID:59328060"
     mRNA            complement(<287547..>288647)
                     /locus_tag="HG536_0H01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285572.1"
                     /db_xref="GeneID:59328060"
     CDS             complement(287547..288647)
                     /locus_tag="HG536_0H01690"
                     /inference="similar to AA sequence:RefSeq:NP_010531.1"
                     /note="ancestral locus Anc_8.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141468.1"
                     /db_xref="GeneID:59328060"
                     /translation="MSGFLLTKYARFKKPVYFVVMICFLIFWIRDDGSSSPLLEHNRV
                     KHMGKQLERSPASLLNRYSRSDVKELGGKTSGSTSWIRSLLSWRGWRKDPSIVIILAA
                     NEGGGVLKWKNEQEWAIEKISINNKVAYAKRHGYGLTIKDLTVAKRYSHEYREGWQKV
                     DILKQAMREFSTAEWFWWLDMDTLIMEPEFSLEEHIFNRLNNLTDRTLESFNPLNIET
                     DIPYIDYTEELNLLITQDCGGFNLGSFFIKNTDWSRLLLELWWEPVMYEQKHMVWEHR
                     EQDVLEALYTNEGWIRSRVGFLPLRSINAFPPGACSEFSNDKRYFYNGEERDFVVNMA
                     GCNFGRDCWREMQLYTSKLEEKNSRWYNRLFF"
     gene            complement(<288852..>290594)
                     /locus_tag="HG536_0H01700"
                     /db_xref="GeneID:59328061"
     mRNA            complement(<288852..>290594)
                     /locus_tag="HG536_0H01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285573.1"
                     /db_xref="GeneID:59328061"
     CDS             complement(288852..290594)
                     /locus_tag="HG536_0H01700"
                     /inference="similar to AA sequence:RefSeq:NP_010530.1"
                     /note="ancestral locus Anc_8.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141469.1"
                     /db_xref="GeneID:59328061"
                     /translation="MNVADCSVGNNPLAQVSKHTQQDRSLQHGSHRLGYGIDGGSAAQ
                     QFKSSEKAMSDVSKFSMTNFINGGAVAGGSGLKLGQSPISRNVGISRGNNFSPSPEET
                     GALISGTNGWSQEFYQQSNSSSRGSLPQQQSHNQRHSQQTPHQQHRMQLPYSTHMLSG
                     PRMMVRPSPGAGMMRQRQHENTKADWDEQFKELETEVAENLKLKESEPVGQEAAAKEP
                     GLDEDIVIGDQYQSEFQEVWDSLQKDSEDLLPEELTGSSAWEADYQKYISGRISGNME
                     YQFDEKNEFLHNPNAYEIGCILMENGAKLSEAALAFEAAVQEDRGHVDAWLKLGEVQT
                     QNEKEINGICALEECLKLDPNNLEAMKTLAISYINEGYDVSAFTMLNRWAETRYPNLL
                     SSSEGITLSDEDERFTLNAKIRKQFLQIANRLPRVDPDVQLCLGLLFYADDEFDKTID
                     CFRAALSVNPNDELMWNRLGASLANSNRSEEAIQAYHKALQLRPSFVRARYNLAVSSI
                     NIGCYKEAAEYLLSALKMHEVEGAPSNGTAAAGNNNILETLKRAFVAMDRRDLLQKVK
                     PGMDLEQFRGEFNF"
     gene            <290834..>292570
                     /locus_tag="HG536_0H01710"
                     /db_xref="GeneID:59328062"
     mRNA            <290834..>292570
                     /locus_tag="HG536_0H01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285574.1"
                     /db_xref="GeneID:59328062"
     CDS             290834..292570
                     /locus_tag="HG536_0H01710"
                     /inference="similar to AA sequence:RefSeq:NP_010529.3"
                     /note="ancestral locus Anc_8.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141470.1"
                     /db_xref="GeneID:59328062"
                     /translation="MSRPPSLSELLRSKSKIKNNDLLRPKFLSKSERQKVIKPSITAQ
                     SQRNSRSQLGMRKLSESNEEEGPQNASDHVKSTVVKRTKFAFDWSEDSDTLAGYQPIV
                     NPQLSSLLQNEQHNSSLELAYMGKPWREKTWEEMTDRDWRILKEEFEITTKGGSIENP
                     LRNWHELGLLGKELENILVKRLGYKEPTPIQRIAIPNICRKDKRDFLGIASTGSGKTL
                     AFLIPILTRMNNSQPRPIAVKTLEGPKAIVLAPTRELAQQIQQEAKKMVDCWNVQHPQ
                     HSYQVVSIVGGHSLEEITLGLSNGTDILVATPGRLIDSLESHLFSARQVEMLVLDEAD
                     KMIDLGFEEQLTKILNILEASSEVITRRQTIMFTATMSPSVERIANGYLHKPAYATVT
                     GTEASVPQIRQIICHISTDEQRFQKIKGLLSEYSAPIIVFITYKKTADWLAQKFYQET
                     SVKVTVLHGSKSQEQREHSLQLLRTGKVQVLIASNVAARGLDIPNVSLVLNFQVPKQF
                     EDYIHRIGRTGRAGSKGTAVSFLGDDENPEIVEAIWKYSRDNNPTNSNEFDYSLKTLY
                     KLGKNEMNEIIL"
     gene            complement(<292582..>294261)
                     /locus_tag="HG536_0H01720"
                     /db_xref="GeneID:59328063"
     mRNA            complement(<292582..>294261)
                     /locus_tag="HG536_0H01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285575.1"
                     /db_xref="GeneID:59328063"
     CDS             complement(292582..294261)
                     /locus_tag="HG536_0H01720"
                     /inference="similar to AA sequence:RefSeq:NP_010528.3"
                     /note="ancestral locus Anc_8.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141471.1"
                     /db_xref="GeneID:59328063"
                     /translation="MATSWKQKVEKKRSQLRSKISKQWLLDDITLEKLKSEKQRLNEN
                     LDLLCSNSENEITNSTILILRHKLSTRELTCVEITEAFCHRAALCHQVVNCLSEVMFE
                     QALNSAKLLDDNRPEILPPLYGIPVSLKDQCNVEGIDTTMGYLGRAFSPKTRDEESYI
                     VQLLRDQGAILYVKTTVPSSMMATDTVSNIFGATLNGLNQMFSPGGSSGGEGALIACR
                     GSLLGLGTDIGGSIRIPSSYHGLYGLKPTHGRVPYLRVDNSFEGRELIPSVIGPLAKD
                     LTDLRYFMSVIVNICKPWQEDVKCVPYHFDFKEHQLSRHYTVGFWFGDGVVTPPPSDI
                     RALKICQDIVQRTPGFKAVKWQPPIELNKELHDIAMEVDIADAGVEIRQEFAASGEPM
                     IDILRPMVLEQCHLPCSINHWWKLNKRAYDAKTAYRKYYNSFGADERPDIIITPLTLT
                     PFRPGDMLKTTLRYVLFVNVLNFPSLSIPITAIDSKIDHLMDTTQAKCAEDEMVMRYW
                     NELISSGDMDGFPVSLQAMSPTYDDDLVCKFGTWLTTELIRHHAQEVSNEI"
     gene            complement(<294537..>295532)
                     /locus_tag="HG536_0H01730"
                     /db_xref="GeneID:59328064"
     mRNA            complement(<294537..>295532)
                     /locus_tag="HG536_0H01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285576.1"
                     /db_xref="GeneID:59328064"
     CDS             complement(294537..295532)
                     /locus_tag="HG536_0H01730"
                     /inference="similar to AA sequence:RefSeq:NP_010072.1"
                     /note="ancestral locus Anc_8.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141472.1"
                     /db_xref="GeneID:59328064"
                     /translation="MSKAKSWKDKPAKVQVPESELPSSIPSQTGLVFNIWYIKWSQGS
                     NEQKRFVSPYRLDPKTHPGVTRGDKDGTAYFCLYFAKGMCCMGRRCQYMHHIPEDDDH
                     ARLALKTEVLDCFGREKHGSYREDMGGVGSFRKMNRTLYIGGLSGALNNKELKPSQIE
                     GRIRFMFGSLGAIDRIRYVENKNCAFVKFKHTSSAEFAKEAMSNQTLLLPSDKEWEDR
                     KEGTGLLCKWANDDPDPEAKRREEEAQKQESVNMMVKLLTGHLSKDAPLQAKMSKGKR
                     TIEDNDSNSSIFSEGVLERLKKRKAIKPLKTGKSNAKPTSSISGSLMEYSSSEED"
     gene            complement(295680..295765)
                     /locus_tag="HG536_0Htrna5Y"
                     /db_xref="GeneID:59328402"
     tRNA            complement(join(295680..295716,295726..295765))
                     /locus_tag="HG536_0Htrna5Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:59328402"
     gene            <297009..>297464
                     /locus_tag="HG536_0H01740"
                     /db_xref="GeneID:59328065"
     mRNA            <297009..>297464
                     /locus_tag="HG536_0H01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285577.1"
                     /db_xref="GeneID:59328065"
     CDS             297009..297464
                     /locus_tag="HG536_0H01740"
                     /inference="similar to AA sequence:RefSeq:NP_010073.2"
                     /note="ancestral locus Anc_8.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141473.1"
                     /db_xref="GeneID:59328065"
                     /translation="MAKEQTKESKSEDNYDARMPAVLPFAQPLASKKLNKKLLKTVKK
                     ASKAKNVKRGVKEVVKALRKGEKGLVIIAGDISPADVISHLPVLCEDSSVPYIFVPSK
                     QDLGSAGATKRPTSVVFIVPGSNKKKEGKAKEDEYKESFNEVVKEVEAL"
     gene            <297691..>299076
                     /locus_tag="HG536_0H01750"
                     /db_xref="GeneID:59328066"
     mRNA            <297691..>299076
                     /locus_tag="HG536_0H01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285578.1"
                     /db_xref="GeneID:59328066"
     CDS             297691..299076
                     /locus_tag="HG536_0H01750"
                     /inference="similar to AA sequence:RefSeq:NP_010526.1"
                     /note="ancestral locus Anc_8.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141474.1"
                     /db_xref="GeneID:59328066"
                     /translation="MAKLTMPTRKRPTTPLAKPQAKKLRRFQNDKCRSQDIWKELDRV
                     RTFNDNADAVLKNSCLFVPVLTKSAISQYANCLRSLHEYIDSKKLQLHKIKSDYGFIA
                     LKQFSLLDCCLVLAALLALKNKRWIAANSSDYFNIPSNASLSGTFYLPVGSIGPDEIK
                     THYPVSIGMSRYRAVMDFKEFYVDAPSGINLAPFMESISLLLSQMKFNNPTSVDRLFL
                     QRFKAVHENLALGLHNSSLPQSLLVDMAIVAKENTPLLKTSIDKLESYAQDLILYNNQ
                     TAPSDDSSSREGSYQAVEEAAEAAKRVPSRQQTTPSDRASMPTERPSGQQASANFGAR
                     FSPNSSFMTQQQIKEHCIATVEASRDIMKTKSPYQIFRLYVKCPRQHYVDVIYQNLND
                     LRSQTNCNIVVLNLNNLHESDSWFDSLDVSPYTKSVQRPHPSTVRVVSVGGIGEHITK
                     ALDLIHKVLSS"
     gene            <299258..>301567
                     /locus_tag="HG536_0H01760"
                     /db_xref="GeneID:59328067"
     mRNA            <299258..>301567
                     /locus_tag="HG536_0H01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285579.1"
                     /db_xref="GeneID:59328067"
     CDS             299258..301567
                     /locus_tag="HG536_0H01760"
                     /inference="similar to AA sequence:RefSeq:NP_010525.1"
                     /note="ancestral locus Anc_8.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141475.1"
                     /db_xref="GeneID:59328067"
                     /translation="MGSDRDVKPERRRSFFLFGSVNLGKSDSSVKSSHAKQYHSSVSK
                     HVAAKGPLDKKPLNSKNPFADSSSIAHAKVTSERNTASVTKHSSNVDPDSREQSNKNA
                     LPSGTSSVPVSNARLRARRPPPPIDMESIRILTQTACQENTGKNLNQTSSAEETLKSA
                     SHSPAKTPVPIQITANQHRRQRSEAEKLVDDLDEYIKQHEDSGLLGPEADESKSWSQD
                     DVDQASSEHSSGVPSACVEPLDISLHDKRISAMSFHEGRSEVESEQEGDSFSFTDSLN
                     DKSVNSIQQIALSEVAGAAPVSMNLHYGNLSVSSSNHSGLPIKAPVADENGSTSSDDE
                     FQEVEQKFASGLPLDETSSESGSKTPKRVFRVVNEDRARFYFDNGDNTTFSTSDNTTA
                     DEEEDKQGYQEDRSESETMPMLRLDPGPEVDKLLTPVSRALSYSSSQHGNADKSKLHQ
                     QLENTLEPDNQATSNELDNIGLLLEAGALTVTSQEDSGNIGHQANTSINQTADRSIQS
                     LKREDSNCTASTTSSKPDKTVRLVSSYVEELRLKYYRSSNFLAAPPNLPISLKQKNNL
                     IQPKNIKVRIRTSSKQIGIKHGGAKQKLLSLETANEDSINSFSSAKFNSGTNRVNVDH
                     TKEFHDLFAKEGLMDPSSKANEPEFPKHDDDYYLENIPGDDAYDSDDAMAPLRKGSSS
                     VARNNTAVSYYTKNQRRFRSGTLDNGYAHLQDLPTNITVKDYEDEESLNANGPEDSII
                     SDDSSSITPALSYGNSQGLHVANPDADSD"
     gene            <301789..>304713
                     /locus_tag="HG536_0H01770"
                     /db_xref="GeneID:59328068"
     mRNA            <301789..>304713
                     /locus_tag="HG536_0H01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285580.1"
                     /db_xref="GeneID:59328068"
     CDS             301789..304713
                     /locus_tag="HG536_0H01770"
                     /inference="similar to AA sequence:RefSeq:NP_010524.3"
                     /note="ancestral locus Anc_8.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141476.1"
                     /db_xref="GeneID:59328068"
                     /translation="MTVDAQQAAYTLVFDPLKDAGSWTVPEFQKALEKGSDEEKVAAM
                     KQILVVMLEGNPLPELLMHIIRFVMPSKNKKLKKLLYFYWEIVPKLDNDGKLRHEMIL
                     VCNAIQHDLQHPNEYIRGNTLRFLTKLKESELLEQMVPSVLACLDYRHAYVRKYAILA
                     VLSIYEVSDHLISDAKELINTFLIAETDPICKRNAFVGLAKLDREAALNYLEENITSV
                     ETLDPLLQAVFVQFIRKDATAEPSLKPQYIDLLVDILSSASSSEVIFETALALTALSS
                     DPSILANAASKLIDLAVKVFDNNVKLIVLDRIQDINEKTPGSLEDLTLEILRVLNAED
                     MDVRSKALDISMELVTSRNVDNVVKLLKKELQNTVSHSEKEKSMEYRQLLIKTIHSIA
                     IKFVEVAANVVSLLLSFIPDLSSAAASGVISFIKEVIEKYPHLRRDILERLLNVMDSI
                     KSAKAYRGALWILGEYAEDAQEIQKCWKHIRASVGEVPILQTELKKMARNSDDDHDDN
                     DDEKAEKKASKRSGPVILPDGTYGSESAFDSVEKSTDEEIDSRPPMRRFILNGDFYTA
                     SILASTIIKLVLRFEKDRKGDTILNAIKAESMLILVSIIRVGQSTLVEKKIDEDSLER
                     IVCAISILMDETDPSEKSTERALVEMAFLDATKSSFKVQVALGKKKSARASAQNLNKI
                     AEPIEKPIQFRQFAQAGSNIDGQDPIEEDLRLAIEGDAAKSSGNSVISKLKKIVPLTG
                     FSDPVYAEAYVTTHQFDVVLDVLLVNQTKETLKNLHVQFATLGDLKIIENPTRTNVVP
                     HGFHRLTVTVKVSSADTGVIFGNIIYDGAHGEDAHYVILNDIHVDIMDYIKPAKTDDE
                     NFRTMWNAFEWENKISVKSQLPSLHAYLRELVKGTNMGILTAAEALGEEDCRFLSCNL
                     YAKSSFGEDALANLCIEKDNSGQVVGHVRIRSKGQGLALSLGDRVALIAKQSSKVKLA
                     RI"
     gene            complement(<304839..>305723)
                     /locus_tag="HG536_0H01780"
                     /db_xref="GeneID:59328069"
     mRNA            complement(<304839..>305723)
                     /locus_tag="HG536_0H01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285581.1"
                     /db_xref="GeneID:59328069"
     CDS             complement(304839..305723)
                     /locus_tag="HG536_0H01780"
                     /inference="similar to AA sequence:RefSeq:NP_010523.3"
                     /note="ancestral locus Anc_8.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141477.1"
                     /db_xref="GeneID:59328069"
                     /translation="MQKMLIAKRSFSGTAKGAKSACSLVKPVHHLVKIDKSKLSPRFP
                     ELKYAKNDIRSPAFMPVTTHQDRSHEHYLNTVQSDLLLISYSHNFEGQKGLKNRPWDG
                     TSPYHINRQPRKPVSSKAQLPDIHPIKWHNVPNIDSIVLNCYVNEAKENPLHAITAAL
                     QLQQITGCKPKPLYSKTDVPSWKVRRGNQMGAKVELKGRPMSQFLSTLTEIVMPRIRE
                     YKGISNRSGNGFGSISFGLTSEDVKFFPEIDSNQDLWPKTFGMHININTTAQTDTQAR
                     TLISSFQIPFHGLEKVKT"
     gene            <305985..>307628
                     /locus_tag="HG536_0H01790"
                     /db_xref="GeneID:59328070"
     mRNA            <305985..>307628
                     /locus_tag="HG536_0H01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285582.1"
                     /db_xref="GeneID:59328070"
     CDS             305985..307628
                     /locus_tag="HG536_0H01790"
                     /inference="similar to AA sequence:RefSeq:NP_010074.1"
                     /note="ancestral locus Anc_8.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141478.1"
                     /db_xref="GeneID:59328070"
                     /translation="MRFSLDCLVDSDDEREDETFAKNDYSSCSSPGSSININEISFVN
                     PNEEDEDVPQLYLPKKKLVPFAVREQSCLSDVNFESLDPELERLIQRLDLQAKLPARD
                     GSKVVVVISRPTEAGKKETSSMLEEAKDVACAGPERMLSAIESSFSSRLEALELENKK
                     QVERMRLLKRQKEEERRRREQEERRKREEEERRKREEEALRRRELEEEVKRKEEAERL
                     KRQQEEAEAKKEEAKRKAEEEEKLKQEAIRSKTVSDFGLIEQKFRRYKEKIVSIKRNI
                     IEPVKKADPALKTLLSRHKRKVNPKFGQLTNSNAQLQNIQRELCTLVDQTKDNQLAFL
                     WILNFIAKAMVRQAETEVRVKPESALPLGKLAVNLMVQYPELKELLMARFVKKCPFVI
                     GYTCSIDSESGRQDMGWKRKADDKWEEDTFYDERMGGMITLFAVITRLPLPQEHINTQ
                     SHPMPISNSWHMIARIANTPRNLLTNSHFVVLGFWWDAAASEFIEAYGNQGNKLLQLI
                     GENLTASVAERKYVGAARLRILLEEWHTTGIKTFPELVA"
     gene            <307794..>308363
                     /locus_tag="HG536_0H01800"
                     /db_xref="GeneID:59328071"
     mRNA            <307794..>308363
                     /locus_tag="HG536_0H01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285583.1"
                     /db_xref="GeneID:59328071"
     CDS             307794..308363
                     /locus_tag="HG536_0H01800"
                     /inference="similar to AA sequence:RefSeq:NP_010522.1"
                     /note="ancestral locus Anc_8.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141479.1"
                     /db_xref="GeneID:59328071"
                     /translation="MTRRAADSPIPDKPEDPFPLVTDYCDIVGGFGRGSAELGIPTAN
                     IPVNQLPKAINDLELGVYFGFAKLRPVDHGEEVFTRKNGAKVLMNYGRNLDRQNGDLD
                     PMPVVLSVGKNPFYGNDFKTVELHIIHEFKDSFYGAQVKFSILGHIRPELNYTTKEAL
                     IEDINIDILTALEALEMDSFKVYRSQLAD"
     gene            <308665..>310701
                     /locus_tag="HG536_0H01810"
                     /db_xref="GeneID:59328072"
     mRNA            <308665..>310701
                     /locus_tag="HG536_0H01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285584.1"
                     /db_xref="GeneID:59328072"
     CDS             308665..310701
                     /locus_tag="HG536_0H01810"
                     /inference="similar to AA sequence:RefSeq:NP_010075.1"
                     /note="ancestral locus Anc_8.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141480.1"
                     /db_xref="GeneID:59328072"
                     /translation="MQLVLRRLTAALFYLASLALIAYAFHNGNLKTLYLEPLLLLECF
                     IALGLIASDFLTASLSHISSNILQISDRVSGLTLLALGNAVPDITSTYQSMNAGATAL
                     ALGELFGGIFFLLTVVLGSMALVRPVKLCPPQVIRNLAQDLEHNLKFEEGTILYSRAE
                     FIQDISIFAGLVLLSAIFLADGHLMFWECAVMVLLYCIYAAYLVLYHKGPVEDTDQDA
                     LFETGESASDLSTVISNTERACQHEGNITLFNNGIQERRANIRRRIRSYLRSNYNGWV
                     RITLRDCLDIWENEGRLQSPEPPTEENQGFLERPSLDDSETSPLVRRASSLQDVRQLP
                     SVHVFEEQASPPASSSRRLAEDDSLLGVYGRPFTQKSLSCDHIPGVFSSVQGCSNLES
                     QLVPSQEPTIRTWPRDFKLFAYLTDCNMCLPTTEYIALLFTTPVAFTLCLLIPYLHHK
                     NGNGSFHAAEILRLTLLPYVLSFLLSDSTSLPHPYWLFGLSLTLFCILTYRKVRSISR
                     YNASFLAIAGFISCISIICFCVHIVVMTLTDWADNFNISGSILGLTVFAWGNSLGDLV
                     SNVVFVQIGILDLALGACFGSPLLYFVFGVGIDGMLLILKSRKSCDKPLYACQIDYEP
                     DSSLGFSGLGIVLAFLIFAVAVPLNHWQIDGKISMLLLVLYAAVNGYNVLQELF"
     gene            complement(<310726..>312351)
                     /locus_tag="HG536_0H01820"
                     /db_xref="GeneID:59328073"
     mRNA            complement(<310726..>312351)
                     /locus_tag="HG536_0H01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285585.1"
                     /db_xref="GeneID:59328073"
     CDS             complement(310726..312351)
                     /locus_tag="HG536_0H01820"
                     /inference="similar to AA sequence:RefSeq:NP_010521.1"
                     /note="ancestral locus Anc_8.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141481.1"
                     /db_xref="GeneID:59328073"
                     /translation="MDKYSSIVNDANFSTLSLKAASHPKALVHWENLLNYLITKASPL
                     NKTLEPSIYNLIKSTYDSMLYNFPYLENYYIDYALFEYKLGNISRVHKVYQQGLRSFN
                     ERSLHLWISYLKICNEVISNHKQLFKLYQKAESLIGLHFMSGEFWEMYLNQIRDRCLT
                     NERYFTVLRKVIEIPLHSFSKFYALWLHCIDDITDLIQLTRIAPKEELLKRLKIDTSF
                     QGRKGPYLADAKKLLRKSTKELYMTVQHQVLEIYSLFESKLHINYYCSAETLIPAEEI
                     ATWDSYLTYTINLRIDALIELNFQRALTCLVHYDSVWIKYAHWLIEYKEDLSSAKNVL
                     LRALSLSHKKTAIVRLLYSVLCKLKDYELLDFILEKEENFYATDVELTDDFEIFWDFI
                     QFRIFCANSRLQTRFETQSDQLMPPKVFDIILRRLSHGESRKGQELLLSSLLQFQSKT
                     NTAILETKIFKHIIEADWTFYLRDGCFWYLYCKLIFFEPTRTYLEKRRYIVGEIWEKA
                     KKYGTAVLPKLRHFCQSYIPEDLDLLEDLFESS"
     gene            complement(<312518..>313501)
                     /locus_tag="HG536_0H01830"
                     /db_xref="GeneID:59328074"
     mRNA            complement(<312518..>313501)
                     /locus_tag="HG536_0H01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285586.1"
                     /db_xref="GeneID:59328074"
     CDS             complement(312518..313501)
                     /locus_tag="HG536_0H01830"
                     /inference="similar to AA sequence:RefSeq:NP_010076.1"
                     /note="ancestral locus Anc_8.456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141482.1"
                     /db_xref="GeneID:59328074"
                     /translation="MKEEIKIGGRRSKLAVVQSVTVKLLIEEEFPNYECPVLALQTLG
                     DQVQQKPLYSFGGKALWTKELEDRLYDADPAKKIDLIVHSLKDMPTLLPEGFELGGIT
                     RRVDPTDCLVMPLGSPYKNLSDLPAGSVVGTSSVRRSAQLRRKFPQLKFESIRGNIHT
                     RLQKVDDPESPYECIILASAGLIRMGLENRITERFTSEVMYHAVGQGALGLEIRKDDT
                     RVLRVLEKITDLESTVCCLAERALMRTLEGGCSVPIGVESSYDIETKKLVLRGIVVSV
                     DGSMAVEDCQELLINDVREDSMKCGRLLAEKMMADGAKQILDDINLDRIDQ"
     gene            complement(<314148..>316211)
                     /locus_tag="HG536_0H01840"
                     /db_xref="GeneID:59328075"
     mRNA            complement(<314148..>316211)
                     /locus_tag="HG536_0H01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285587.1"
                     /db_xref="GeneID:59328075"
     CDS             complement(314148..316211)
                     /locus_tag="HG536_0H01840"
                     /inference="similar to AA sequence:RefSeq:NP_010520.3"
                     /note="ancestral locus Anc_8.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141483.1"
                     /db_xref="GeneID:59328075"
                     /translation="MLRFSRGFHRYGPLRQGQNLTEKIVQKYAVGVAEGKLVHSGDYV
                     SIKPAHCMSHDNSWPVALKFMGLGATRIHDARQIVNTLDHDIQNSSEKNLTKYKNIEN
                     FAKSHGVDFYPAGRGIGHQIMVEEGYAFPLNMTVASDSHSNTYGGIGALGTPVVRTDA
                     AAIWATGQTWWQIPPVAQVELKGELPHGVSGKDIIVALCGLFNQDQVLNHAIEFTGDL
                     LHRLPVDFRLTIANMTTEWGALSGLFPVDKTLINWYRETRLPKLGAGHPRVNEQALSQ
                     LEESLPKWKPDADARYAKKLTIDLSTLNHYVSGPNSVKVSNTVQELSRQNIKVDKAYL
                     VSCTNSRLSDLEAAASVVCPSGTTKINKISPNVKFYVAAASSEVESDARASGAWEKLM
                     KAGCIPLPPGCGPCIGLGAGLLEPGEVGISATNRNFKGRMGSKDALAYLASPAVVAAS
                     AILGKIASPAEVFGTQEHFSTSVATLTEENLSSAETPAPADNTRPAEILEGFPSEISG
                     ELVLCDADNINTDGIYPGKYTYQDDVPRETMAKVCMENYDPEFQTKAKKGDIIVSGFN
                     FGTGSSREQAATAILAKGINLVVSGSFGNIFSRNSINNALLTLEIPALVEKLRTKFKD
                     SPKELTRRTGWFLKWDVANRKVVVTEDSLEGPVVLEQTVGELGKNLQEIIVKGGLEGW
                     VKAQL"
     gene            <316702..>317646
                     /locus_tag="HG536_0H01850"
                     /db_xref="GeneID:59328076"
     mRNA            <316702..>317646
                     /locus_tag="HG536_0H01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285588.1"
                     /db_xref="GeneID:59328076"
     CDS             316702..317646
                     /locus_tag="HG536_0H01850"
                     /inference="similar to AA sequence:RefSeq:NP_010077.1"
                     /note="ancestral locus Anc_8.454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141484.1"
                     /db_xref="GeneID:59328076"
                     /translation="MILARTHRVAKGWSEPFISDWIRMSGAPVEKKAECCGLLLWKNP
                     IETGKVFGGLLVGLLILKKVNLITFFLRVLYTAVFITGSLEFVSKLLLGQGLVTAYGP
                     KECPNTVGFLKPRIDNVLLRLPAQQAKFRKLLFAYQPKNNFKAAVVLFFLHKFFSWFS
                     VWTIAFVGVIGAFTLPLVYSIFQTEIDSAVDSGIRVARTKTGEFSSMASEKTKPYLES
                     LDSKLGPVSKFVKSQYHHANTVTPQSTSSKMAAEVPLEPEQRSHGQTSSSTAFPAAPT
                     TEPLGQQTQEFSVDQLQSELKQSTEGLKHDLQQNNAAI"
     gene            complement(<317777..>319441)
                     /locus_tag="HG536_0H01860"
                     /db_xref="GeneID:59328077"
     mRNA            complement(<317777..>319441)
                     /locus_tag="HG536_0H01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285589.1"
                     /db_xref="GeneID:59328077"
     CDS             complement(317777..319441)
                     /locus_tag="HG536_0H01860"
                     /inference="similar to AA sequence:RefSeq:NP_010518.1"
                     /note="ancestral locus Anc_8.453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141485.1"
                     /db_xref="GeneID:59328077"
                     /translation="MESIAHQSVRLCPFMRKTIASAHGVRQLKSANLAAMAEKCPVVG
                     SALHVRGYATTAAGSAAAVARKVGGEAVADHATQESSFDFDGMFEKEIEKKRLDKSYR
                     FFNNINRLAREFPMAHRQEEDDKVTVWCSNDYLALSKNQQVVDAMKRAMDKYGAGAGG
                     TRNIAGHNRHALKLEAEIAALHKKEGALVFSSCYMANDAVLSLLGQKVKDLVIFSDEL
                     NHASMIVGIRHANTTKHIFRHNDLQHLEEMLQMYPKSTPKLIAFESVYSMSGSVSDIS
                     KICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEAHRLSGISSVGGARTVMDRV
                     DMITGTLGKSFGTVGGYVASSRRLIDWCRSYAPGFIFTTTLPPAVMAGAAEAIRYQRR
                     HLDLRQQQQRHTSYVKKGLKDLGIPVIPNPSHIVPILVGNADLAKQASDMLMENHRIY
                     VQAINFPTVARGTERLRITPTPGHTDDLSDLLLDAVDDVFARLQLPRVRDWESQGGIL
                     GVGEKDYVEQENLWTEEQLQLTNDSLHPNVLDPVLQQLEVSSGIKV"
     gene            complement(<319710..>321269)
                     /locus_tag="HG536_0H01870"
                     /db_xref="GeneID:59328078"
     mRNA            complement(<319710..>321269)
                     /locus_tag="HG536_0H01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285590.1"
                     /db_xref="GeneID:59328078"
     CDS             complement(319710..321269)
                     /locus_tag="HG536_0H01870"
                     /inference="similar to AA sequence:RefSeq:NP_010078.1"
                     /note="ancestral locus Anc_8.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141486.1"
                     /db_xref="GeneID:59328078"
                     /translation="MYREQYHENRYEKHIKMFPPGARTAARAAAGAEPVAPYPLDDVT
                     EVIGSVPAYKPTSAGSSRRQAGNGVPEAVSGRYDRPFQIESERSSEGQERVLPPPYEE
                     SETRALQEKAYRTETDVKESPPRERRRDLSEFSPSGLKFYEIYSQTVADSAKFTPEVQ
                     MKWCETLLEYAFDDEFLSHYNINAEKLKRELRPEERQKNQKVILEHSFKVLAKLIGLK
                     WGPALYLMGTLYSHQPYLQIKNKHIVARNDERALEYYGRAAGSDHADACYRAGVCYEL
                     RRGVPPSTSQDESLVMALNYYRRGADLCDNSACMYKLGMFYLYRPQFQDAPQAIEWFK
                     RASRRGDSPQALYELGKIYEFSSLAPNIQQLLTDNGVKRQPSRALKCFYKCAIDCDYP
                     LAQWKLGHCYEFGELHLPVVAKKSIAWYAKAALAKPKGNAMAMLALSGWYLTGATGVL
                     RPNDNEAFRWARESCTASDGKLARAEYALAYYYENSIGCPRDLAKAKSHYQRAASIGH
                     PKAINRLQVGF"
     gene            <321582..>322160
                     /locus_tag="HG536_0H01880"
                     /db_xref="GeneID:59328079"
     mRNA            <321582..>322160
                     /locus_tag="HG536_0H01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285591.1"
                     /db_xref="GeneID:59328079"
     CDS             321582..322160
                     /locus_tag="HG536_0H01880"
                     /inference="similar to AA sequence:RefSeq:NP_010517.1"
                     /note="ancestral locus Anc_8.451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141487.1"
                     /db_xref="GeneID:59328079"
                     /translation="MVWWLSGGKKEEAEKAEDGGPKSDAKQGQLTNYSRGQRILLEDT
                     KPRFNGETSQSQLAVSQEEANFRRAWNSISKEDFSFGKLTAIPCFRDAGLVGFTCMFV
                     TGAVTFLYHKNPTRAANWSVGGLLLGSVVGWEQCRLRRKRSFQVAQMARQTVAAKPKP
                     MLNAVAHDEKTKHQWDGHTQQEQQGKSWYKFW"
     gene            complement(<322376..>323647)
                     /locus_tag="HG536_0H01890"
                     /db_xref="GeneID:59328080"
     mRNA            complement(<322376..>323647)
                     /locus_tag="HG536_0H01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285592.1"
                     /db_xref="GeneID:59328080"
     CDS             complement(322376..323647)
                     /locus_tag="HG536_0H01890"
                     /inference="similar to AA sequence:RefSeq:NP_010515.3"
                     /note="ancestral locus Anc_8.450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141488.1"
                     /db_xref="GeneID:59328080"
                     /translation="MDNRISGTTSPERFAPHLSEFYPIVNNTRTASIGGLPKMDSGEL
                     GSGSSGYKRRMTPASVRSGMSSISDLRTLVTKRDMKDTVDAMSELRSSSRGYACSLRE
                     VSNHAGCMAQALEKLARLKGCSDGTAEKFLSASGLFYLVANHENIMARCLDSALDEEL
                     LEEIDEFQVGFRTMENEFKKECKEQSMKLKLQEKHNTKLAKRKVRNLVQYKESLLNLQ
                     LQLDHLETLRHDFYQNSYNLVESTCDKVLDKMATVSRARVEISESVARKGWSGGGLDE
                     LLIDAEDPFGKDEETICSDEDMSPEAPNRALSSDDRDSKGNTVQEPSTPKKAGSTSKT
                     LKSPLLSSLRTHASSLNEEQEDRDREDDEAAFDNSFSLPLAGSGRSRNEASEDNERTI
                     LAGLTTLALEPTETRSDPDRENGQDHPDLSP"
     gene            <323880..>324614
                     /locus_tag="HG536_0H01900"
                     /db_xref="GeneID:59328081"
     mRNA            <323880..>324614
                     /locus_tag="HG536_0H01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285593.1"
                     /db_xref="GeneID:59328081"
     CDS             323880..324614
                     /locus_tag="HG536_0H01900"
                     /inference="similar to AA sequence:RefSeq:NP_010079.1"
                     /note="ancestral locus Anc_8.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141489.1"
                     /db_xref="GeneID:59328081"
                     /translation="MELTRLLGFRVGVGSALKRVGFWSREYGVASAKTRLQSHTDAAG
                     RVTVKPADSRKTFLIDSYKHLMEANPVVLFVHYNNLLKNEDQHYRSLVKQNGGKLTML
                     RNGVFGAYLKNSHAADPCGPISRKERNRNHPLLPLFKGPTAAISFPETSPASVAKILK
                     VLEKAQDKLFVVGAKVEAEVYDVASLNQFKTLPGKTELQAQLVGLLNVLGGAGLVRTL
                     EAGSQTLYLTLSSHHESRSSKTGKEE"
     gene            <324831..>325691
                     /locus_tag="HG536_0H01910"
                     /db_xref="GeneID:59328082"
     mRNA            <324831..>325691
                     /locus_tag="HG536_0H01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285594.1"
                     /db_xref="GeneID:59328082"
     CDS             324831..325691
                     /locus_tag="HG536_0H01910"
                     /inference="similar to AA sequence:RefSeq:NP_010080.1"
                     /note="ancestral locus Anc_8.448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141490.1"
                     /db_xref="GeneID:59328082"
                     /translation="MKTKPLSQDPGSKRYAYRVNKEENRKELKHVKIDENSVAQKNGK
                     LDLPKKKFYRQRAHSNPFSDHQLDYPASPDEMDWSKLYPHFYDQETGKMAKQVTIADI
                     GCGFGGLMVDLSPEFPDELILGMEIRVQVTNYVEDRIIALRSNHAKEEGYQNINVLRG
                     NAMKFLPNFFHKGQLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLKEGGVVYTI
                     TDVEDLHHWMVKHLEEHPLFERLSESWENEDKCVSIMRNATEEGKKVERKRGDKFVAC
                     FRRVQTPEII"
     gene            complement(<325799..>326359)
                     /locus_tag="HG536_0H01920"
                     /db_xref="GeneID:59328083"
     mRNA            complement(<325799..>326359)
                     /locus_tag="HG536_0H01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285595.1"
                     /db_xref="GeneID:59328083"
     CDS             complement(325799..326359)
                     /locus_tag="HG536_0H01920"
                     /inference="similar to AA sequence:RefSeq:NP_010081.2"
                     /note="ancestral locus Anc_8.447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141491.1"
                     /db_xref="GeneID:59328083"
                     /translation="MEESLTYFEVECKSTNAFLVIRDVSSRLVYLSLGLHNGQGLKNA
                     TADFQKLSRKTKVNYVLREGSPENANPKFMAIAESVKAFLDDCTPLTEDYEYLFGTPF
                     QQKVWNELREVPAGQIVNYSTLAKNIGLPKATRAVGHAVGQNKLALIVPCHRCLPVSG
                     DVGNFRWGPSLKKKLLAHERRRKQIN"
     gene            complement(<326530..>328584)
                     /locus_tag="HG536_0H01930"
                     /db_xref="GeneID:59328084"
     mRNA            complement(<326530..>328584)
                     /locus_tag="HG536_0H01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285596.1"
                     /db_xref="GeneID:59328084"
     CDS             complement(326530..328584)
                     /locus_tag="HG536_0H01930"
                     /inference="similar to AA sequence:RefSeq:NP_010082.1"
                     /note="ancestral locus Anc_8.446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141492.1"
                     /db_xref="GeneID:59328084"
                     /translation="MDNGDKAGRETPAAGGNVGIDAGTVLRQEQIDNEHADMGLGGLQ
                     GRTASSEALGDNSLRRNSSVSPRTSVGKLFDPSRRPDVIKMEHLRVKDSILTGRPLLY
                     FTSIFVSLGVFLFGYDQGVMSGCLTGPYFKKQFNNPSRAAIGNMVAILEIGALISSLL
                     VGRLGEKWGRRRTIMYGSLIFVIGGLFQGFAGKMIHLIIGRTISGLGVGLLSTIVPIY
                     QSEISPPHNRGKLACIEFTGNIVGYAASVWIDYGCSFIEGNASWRVPLLLQSVIGSAL
                     FCGTFVIVETPRWLLNHDHDVEGLIVIADLHSDGDVQDQKAREEYQAIKETVLISRME
                     GEGKSHLQVFRRYRRRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGREAILMTG
                     INGLIYVLSTLPPWTLVDKWGRKPILLTGGFFMGCALVSISMSLLANIAATPRLVVAF
                     VIIFNAFFGFSWGPIPWLYPVEIAPLSARSAMASSSTATNWLCNWLVGIMTPVLQEKI
                     SWRLYLIHATSCFTSFAVVFKLYPETAGLRLEDMDSVFDDRSSSFSFSRSSDINTGSF
                     AMDIDALSTKSTGPVPDRLPPAVPIAAGAGPLSWSNQSIQSRTPAANVFPLGSLEPPS
                     IGQVLEFKAEQSNKGIKTAFRRGSESLSLLVSRIVNLGGRGNNDTGAYGTLSTNDIEF
                     SS"
     gene            complement(<328827..>329729)
                     /locus_tag="HG536_0H01940"
                     /db_xref="GeneID:59328085"
     mRNA            complement(<328827..>329729)
                     /locus_tag="HG536_0H01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285597.1"
                     /db_xref="GeneID:59328085"
     CDS             complement(328827..329729)
                     /locus_tag="HG536_0H01940"
                     /inference="similar to AA sequence:RefSeq:NP_010083.1"
                     /note="ancestral locus Anc_8.445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141493.1"
                     /db_xref="GeneID:59328085"
                     /translation="MAGNDRKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTK
                     ITSAVELNRVIFREHSAEPLGKRLMTLFPGLGYAAVYKVLQRVYKYGGQPFANEFLNK
                     HYKADFDNAFGEKTGKALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPESFRGRGFVR
                     ILRDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWGQNFISSI
                     VGASASLIVSAPLDVIKTRIQNKNFDNPQSGFNIVKTTLQNEGITAFFKGLTPKLLTT
                     GPKLVFSFALAQSFIPMFDKLLQK"
     gene            <330135..>331985
                     /locus_tag="HG536_0H01950"
                     /db_xref="GeneID:59328086"
     mRNA            <330135..>331985
                     /locus_tag="HG536_0H01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285598.1"
                     /db_xref="GeneID:59328086"
     CDS             330135..331985
                     /locus_tag="HG536_0H01950"
                     /inference="similar to AA sequence:RefSeq:NP_010514.3"
                     /note="ancestral locus Anc_8.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141494.1"
                     /db_xref="GeneID:59328086"
                     /translation="MDKEGEIIVKDFVSILEELTFNSRPIITTLTKIAEENMPYAQHF
                     VDALEARIDRCPPKQKLYALYALDSICKNAGSPYTIYFSRNLFSLYKKSYLLVDNATR
                     TKMIHLFKTWMDSGDTLAGAPLLFERSALEKIEQFLIKASALHQKNLQSMLPTPTVPL
                     LTREIDKLTALTTERLKNQPMDEKLKMKLVVLTQLKQELHREKLAPGALKQLQLQLRQ
                     IFAQDQQVLQDIQRQQQQHEMAMLQQKQLHQRELQSENQTLPSNSGSFIPLFGDSSGS
                     SGMSSLFGSSMSAVGPPNLTALDKTYQLSKIQGLYHSLEAEGLLYKPPKESIVSLYSK
                     LGGHNHLASGTLAYQQGVNLPPLPLLQGILSDCKAHFATVNIDILNTPNLQLSQQTIE
                     DDNPVVGSSLIHLLYRAKPNKCNICGKRFGNSVGEKKSQADHLDWHFRINKRIKGSEM
                     TANASGSVTGPTQKNIQSRNWYLQDSQWISFKDEEIVSTTFSLSTDGTAHKMTTANLE
                     DQTQYSSTAATDTGAQESEKFTVDEGILLRKHVVVPESAVDMSFQCPICKENVTGLYD
                     EELGEWVWRNAMEVNNKYFHATCYYEAARNSDNPLGLQLDLEKLKHLASE"
     gene            complement(<332067..>333767)
                     /locus_tag="HG536_0H01960"
                     /db_xref="GeneID:59328087"
     mRNA            complement(<332067..>333767)
                     /locus_tag="HG536_0H01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285599.1"
                     /db_xref="GeneID:59328087"
     CDS             complement(332067..333767)
                     /locus_tag="HG536_0H01960"
                     /inference="similar to AA sequence:RefSeq:NP_010084.1"
                     /note="ancestral locus Anc_8.443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141495.1"
                     /db_xref="GeneID:59328087"
                     /translation="MGDQILGHYAGSRGFGKGIPGKDEKTGDDVSNFEQKLKKIWIYS
                     SGKKIGSFGQTRNGNKVSNAPVSVSKPTVSPRIKLNGCLRQSPVNRQSQIKLDGLLNH
                     RMLPSGVADNEKQGENGFLSDNRRKEVQKTSSLPPKSSTSSGNLGSSVELPLEKREIR
                     ESLQKMSDEIMRYELRLASLYGRIAVLSKENERLRDDRALRESLAAQLVDETKSRESK
                     RLDIGVQEHNKRVDSAPSIGESGEGEHATTEGQGVSPRELSKSNETAYGKLKQLESRI
                     LGRLEEYETLTAIAEQNISATSDERKAFQLESPFVMELKAKIIRLHEELTQVRSIHDA
                     RLTNMKRAFQREQDTRFQLEQRLAYDKQIFQKWARFGQTAGEYIKQFKFEIQEQNKTI
                     LYYKNKEAQMNNLQGNYKTAVESYKSLSELAEARRKDIELLNTQLEHSKLENKSLEAV
                     IHRQREQIEGLSRAETRPLTDFPASTPQDGLPHSHLLHSTTHEYRVNNFNSEAANQRL
                     LSSNTSFRAATPSNMQNGINDSGRAIKQESPVLNPMSDKVDVYLESPSANEHRDRTSL
                     "
     gene            complement(<334055..>337855)
                     /locus_tag="HG536_0H01970"
                     /db_xref="GeneID:59328088"
     mRNA            complement(<334055..>337855)
                     /locus_tag="HG536_0H01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285600.1"
                     /db_xref="GeneID:59328088"
     CDS             complement(334055..337855)
                     /locus_tag="HG536_0H01970"
                     /inference="similar to AA sequence:RefSeq:NP_010513.1"
                     /note="ancestral locus Anc_8.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141496.1"
                     /db_xref="GeneID:59328088"
                     /translation="MQNDSDSSSGSSVSPASRSSPISTQTIPLLSKLPAAEQSRVSDE
                     PSLLDNRTPPPRQIPLFRFTPTAESWKQKSTSASPSASRPALGIVPQSKSSPKNKKAT
                     DQEKLLKPTRIPKDRLLSLLRSKSKVGNFHNVTVNKADMQQLSRSGTTIPEFISVNQS
                     TRVRTAPSEKVTERPGEGGHTNLGELAHEKLTPYEVFSKNRTFTSSVKNLLQLDISNQ
                     ATKQAPDAKVHKEMPTIESDSTQRSDAVEKPPAAKEETQLPSAINDTSRKIESSVARK
                     RTFDVAMSEDQQSAADAASPNKYFKEAEHGTAVAEDRERNSDIVSMNKDFKAPRSDAV
                     IAEDQRPKAGAASLNKNVRMPRNIEANQEQDLGTDTVSLNNNSKPQAHGEVTSLSKIP
                     SVASLLNNEEDYNARDIIKDRSPSSESNKDIPAVVSHTRTLTANRDAKSTSAGIHKAP
                     QESSEMRNSVGNQKQEQFNKENNILNPVHPTTAKKSMDSGPLMGIAEKWNNALLQEPP
                     NTSSQRQALADLFTKLYQNNMLIKSEDTHSIDGSARSTSGLDEDRKPEHPVEARIVTD
                     IELFTSEKINDKRPNITPRQKPHHLRGAVVIQDTAPPKLAADQQLEEDKNLSRPQLFY
                     LTDSEETSTDNEEQSPKGFVNPGRNESPKAHSSVQRPVSHGTLHENSSIDRPISAGKD
                     SLHQDPEVERRRINRELAIKVRAKFDEKSWFSKSTVMNLVEPGIAKHSSMASHPKVSV
                     TNNICSTENYEHSHAYYYQQLHKRSKLEFIPLRGPLAAEFGKEGKQSPSKVLAGSSLP
                     KQVRLPEKRPGEMWKRSWRALLQTRSILFDFGPGPSSQKSDNLHSKQIAQLRRIFDSE
                     FGTRIASQLDADVEIVISSDNFKAAKAVESILNDPLRASALNKNLRVWSIEKAYQFLE
                     NMGINVKEWTKQASATEESVTKATVKQVPISKIPATGTMKVGADNAIAKGAEAKEHVV
                     KGPFAGERVAEDSNFLKEWTKRATATEESVPKATIKQVPASKMPATGTMEVGAEKAIA
                     KGAEAKERVSKEPTAEGNIARKPHTRETITEEPVAKVPAAKEPVVRIFAPNMAPLTKA
                     FAVQSSTARLGVNKILGTKTRIRDTTTTTNAPEKTAIIESVKPAHKESRQETAPTGRN
                     AVQQSQTSVAEIVDIDMDKTDSESDALEEEFEPILREASEQLEKKDKQIEAARKLILA
                     LCQDVMKKELEITSLHGKLKVSERQLKEKDKSIEDYTEALYQRELQLRKITKNKRDLA
                     NRFD"
     gene            complement(<338105..>338782)
                     /locus_tag="HG536_0H01980"
                     /db_xref="GeneID:59328089"
     mRNA            complement(<338105..>338782)
                     /locus_tag="HG536_0H01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285601.1"
                     /db_xref="GeneID:59328089"
     CDS             complement(338105..338782)
                     /locus_tag="HG536_0H01980"
                     /inference="similar to AA sequence:RefSeq:NP_010512.1"
                     /note="ancestral locus Anc_8.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141497.1"
                     /db_xref="GeneID:59328089"
                     /translation="MAQETSNDSIRMVLIGPPGAGKGTQAPNLVERFHAAHLATGDML
                     RSQVAKGTPLGIEAKKIMDKGGLVSDEIMVNMIKDELLNNEACKNGFILDGFPRTIPQ
                     AEKLDQMLAEQGRPLQKAVELQVDDELLVARITGRLVHPPSGRSYHKLFNPPKKDMID
                     DETGEPLVQRSDDNADALKKRLQAYHEQTEPIVGFYKKTGIWSGVDASQPPATVWQSI
                     LKALGRN"
     gene            <339579..>341546
                     /locus_tag="HG536_0H01990"
                     /db_xref="GeneID:59328090"
     mRNA            <339579..>341546
                     /locus_tag="HG536_0H01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285602.1"
                     /db_xref="GeneID:59328090"
     CDS             339579..341546
                     /locus_tag="HG536_0H01990"
                     /inference="similar to AA sequence:RefSeq:NP_013320.1"
                     /note="ancestral locus Anc_8.440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141498.1"
                     /db_xref="GeneID:59328090"
                     /translation="MVFGMNKRERRVPDLSRYDYHYQNKDDFNRSSRLSAAAAHAASA
                     GAYAPGTLRSQPQRSQSMTHSSSQAIRRVAPNRGPARVPKSGSGHNYPTYSLQGSTQP
                     RRASVTSNNSAARVRNGNGSRANSITVKTTEVRDPQGRTQSITRRTIRRVNGYEYVET
                     TTTTTQAIPIVDAEKHFDEFSGNYIIQEDDGAEEPSEGEQPSREPRSGHAYTALTEPK
                     RSSGAALAGGSEGELPLDQTSSLSQFSDALEYIPDQTNRHSRQQRKTVRQGPAAGSRK
                     SPQQASQTRKQQPKRALTEKEMYAKAYAIAQQSVYKTDDSGSGASAPQSRMGQRTLRD
                     SASVDVGSTISSGSSGKPKSKPKRISSFFQRNGKNQNEVTEQSVPQEIEKPQIQAPKS
                     PLPKAPVITAKQKLSDEEMYRQALAIAQEKYGQNQKPVPTNPAPAEPQEQVNEPLQHT
                     SRQEPVKATSSEAVQRSNSNVEEQDSDVFERPEATTATKTTTPEANEGAQINEWERYD
                     MEHPEPEGKKASGERKSKIKNMFEKVKQFSIENSGYQPSKGSTTKAVAVESQAAEEIN
                     IIKVAPLGRNQSISSHGASTTRNVEESLETTNRHFDDQASETSFHRSIKKTVAAEPPQ
                     QQETAPTEEPTARNETKRTKNNFLKKLFSRS"
     gene            complement(<341704..>342102)
                     /locus_tag="HG536_0H02000"
                     /db_xref="GeneID:59328091"
     mRNA            complement(<341704..>342102)
                     /locus_tag="HG536_0H02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285603.1"
                     /db_xref="GeneID:59328091"
     CDS             complement(341704..342102)
                     /locus_tag="HG536_0H02000"
                     /inference="similar to AA sequence:RefSeq:NP_010511.3"
                     /note="ancestral locus Anc_8.439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141499.1"
                     /db_xref="GeneID:59328091"
                     /translation="MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQR
                     IGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNV
                     TIAQGGVLPNIHQNLLPKKSAKPGNASQEL"
     gene            <342647..>343048
                     /locus_tag="HG536_0H02010"
                     /db_xref="GeneID:59328092"
     mRNA            <342647..>343048
                     /locus_tag="HG536_0H02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285604.1"
                     /db_xref="GeneID:59328092"
     CDS             342647..343048
                     /locus_tag="HG536_0H02010"
                     /inference="similar to AA sequence:RefSeq:NP_010510.3"
                     /note="ancestral locus Anc_8.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141500.1"
                     /db_xref="GeneID:59328092"
                     /translation="MSAKAEKKPASKAPAEKKPAAKKTAPSTENKMKRAKIRKETYSS
                     YIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTA
                     VRLILPGELAKHAVSEGTRAVTKYSSASSQA"
     gene            <343824..>344768
                     /locus_tag="HG536_0H02020"
                     /db_xref="GeneID:59328093"
     mRNA            <343824..>344768
                     /locus_tag="HG536_0H02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285605.1"
                     /db_xref="GeneID:59328093"
     CDS             343824..344768
                     /locus_tag="HG536_0H02020"
                     /inference="similar to AA sequence:RefSeq:NP_013321.1"
                     /note="ancestral locus Anc_8.437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141501.1"
                     /db_xref="GeneID:59328093"
                     /translation="MSVVALKNAVVGIISSRKENSPLLTNDNSSSASREFYGTNADLE
                     SGRPDPANLNRSSSSTESGKQSSDADRNNSSRSKRSESGWFNSVDPRVISDMIIGLSD
                     GLTVPFALTAGLSSLGDSKLVITGGIAELISGAISMGLGGYLGAKSESDYYHAEVKQE
                     KRKFYDNTALINHEIEDILLEINPNFSDETIVSFIKDLQKTPELMVDFIVRYGRGLDE
                     PAENRQSVSAATIGGGYFVGGLVPLLPYFFVSEVGTGLIWSIVIMAITLFWFGYFKTQ
                     VSMSNNCTLQKKISEGFQMVAVGGIAAGSAWFFVRILG"
     gene            complement(<344869..>345456)
                     /locus_tag="HG536_0H02030"
                     /db_xref="GeneID:59328094"
     mRNA            complement(<344869..>345456)
                     /locus_tag="HG536_0H02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285606.1"
                     /db_xref="GeneID:59328094"
     CDS             complement(344869..345456)
                     /locus_tag="HG536_0H02030"
                     /inference="similar to AA sequence:RefSeq:NP_013322.1"
                     /note="ancestral locus Anc_8.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141502.1"
                     /db_xref="GeneID:59328094"
                     /translation="MAEGEVRAAKSAAKKSRRRKKRRTADVSDSSDSDSCSDNDYGRE
                     NNKSLEEVKEEDIQLTDDEAIGGPEVSKETSVEKLDDEVRDQLNAIPFTRTELTDRTD
                     HIKGQGADLVKVKRTLEEDRKKLSSALEGQRTSRTDAENKNAYLSIMFENYGEEINSL
                     RDAPDFTNKSLVMLANVLKDGTGMFDVDTLKTILN"
     gene            complement(<345692..>348109)
                     /locus_tag="HG536_0H02040"
                     /db_xref="GeneID:59328095"
     mRNA            complement(<345692..>348109)
                     /locus_tag="HG536_0H02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285607.1"
                     /db_xref="GeneID:59328095"
     CDS             complement(345692..348109)
                     /locus_tag="HG536_0H02040"
                     /inference="similar to AA sequence:RefSeq:NP_013323.1"
                     /note="ancestral locus Anc_8.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141503.1"
                     /db_xref="GeneID:59328095"
                     /translation="MDLRTSFKNESLSPIYAGSGAICTVSEDGKILATPILDEINIIQ
                     LQPCYELLHTIENDDEQEITALSLTPDGKYLGYVSQAQLLKIYSLESKKVLRSMKISS
                     PSYVLETDSTSTLVAIGGTDGSITIVDVENGYVTHSLKGHGGTISSLRFHGQLNGDKW
                     LLASGDTGGVVKIWDLVKRRCLSTVQEHTGAIRGLDFSKQDGTSHVRLLSGGRDDIVN
                     LWEFDMKKKCKLLTTIPVHQQVESCGFIRDTNLIYTAGGEAFFQIISLESQNIIKKTQ
                     RPIEELFIVGVLPIMGGKKLYLVLSDQTLQLIDMDETLSDIGNATINIQSCIAGNHGT
                     IADIRVVGHSLNKLALASNSPALRIIPMPLASESAMPIAVEIYEGHEDLLNSLDATED
                     GQWLATCSKDSTSILWRYNSELDRFVAYAKFMGHSSSVTAIALPNLMHKGWPEFLITA
                     SNDLTVKKWKVPQPDAQNLGALQLVKQSEYTFHVHAKDINALSLAPNDSIFATASYDK
                     TCKIWDVETGENRATLAGHKRGLWDVSFCQYEKLLATCSGDKTIKIWNLETFSVVKTL
                     EGHTNAVQRCSFMNKQRQLVSSGADGLIKIWDCATGECLKTLDGHGNRIWAMNVCNDG
                     EVIISADADGVFQFWRDCTEEQKEQDLEKEKLKVEQEQTLQNYLAAEDWTNAFLLALT
                     LDHPLRLLNVLRQSIAKSEDDAAFVFNRQLDELISKLSDEQILLLMKRCRDWNTNAKT
                     HSIAQKVTKCILLHHDIGKLCEIPGLVQLVDAIIPYSKRHFSRVDNLIEQSYLLDYAL
                     VEMDRIL"
     gene            complement(<348421..>351405)
                     /locus_tag="HG536_0H02050"
                     /db_xref="GeneID:59328096"
     mRNA            complement(<348421..>351405)
                     /locus_tag="HG536_0H02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285608.1"
                     /db_xref="GeneID:59328096"
     CDS             complement(348421..351405)
                     /locus_tag="HG536_0H02050"
                     /inference="similar to AA sequence:RefSeq:NP_010509.1"
                     /note="ancestral locus Anc_8.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141504.1"
                     /db_xref="GeneID:59328096"
                     /translation="MVAKTARKNVVSHGGKYRTGQKLPANASSVKRSKPGIAVRPRRF
                     SLLYSSDSSLSDVSDLGDNRSRNEKSPTKRKMEKVRSISNNATGKRSKLIQDSTEDSS
                     DGQAVESDSEEEEDGDDSSDDDDESDSDGSESDTSSDDESIDFVKLTAQRKKRAMKAL
                     SALKKNKSPTKSPAKSPAKSPVKATSGQRRRSSQLRDSKTQERQHNRKPEGDSDSSSN
                     EKALAFNFKKDDDGIRYAEATQQSEEDIGEEVKDSNGPAPDLPFDDNLNQLHVPEFSV
                     SEESEYDIDQDAYFNVIDDESMGEMDTGLDTGEDEMPILHEEEKILMAELQNADDLSL
                     DGSIHEDGSDPDEKLRSPFVEGKPEVADEEDSDDDDEIMTVFDMPFYEDPKFASLYYC
                     EDGDEPRLSLSTSLPLLVSGEKLKRMKKRKALKLARQERIQRRKLLKEKSKANGIKTS
                     QIDGDEYIFGVFFQSDNENGDEATKRHSTLRGNLDLESPLRRLGSAAASDASSDDEYD
                     NILLDVAHMPSDDEVRGNGHDSPKLRQTDQDSSSSMSDSSAIDLDDESDLIDYDRSDD
                     DDYLSDTNVFIDIDDLDPDSFYFQDRDDENMSSFSEIMTDETDISHEENSKEEALETV
                     KYFDDESTDEDDNLPPPNSRSKMIGSKAKEIVSANIVGLKPPKLGTWETDSKPFTIID
                     GLSTKSLYPLIQEHQQFIEQQQRAHSQSPDLRSGYELSSANGDELTLNELLNMSELED
                     EDHSTPSFMQAVSNWYEKPKVPLSAFRNKGINEHEDDEYMLPVNSTRKVPIGYIGSER
                     TRRKIDRMKELQRKKTEKRRRTKKKKKLLKLKRRQERLEKERHRQGEQTIQAANTNLT
                     LGTPDLNQQTDPESAAPLPRSRKSSVKSVGLEEIHEILGKDNSDLLDGGDPDCALIDG
                     EHEIDLADADILASLTAPIQLDSIGGAPSWRRRQSMAEAAAENLRFTKNGLFSESALA
                     DIEDIIGTGVSSGAFEFSASLQ"
     gene            <351922..>352797
                     /locus_tag="HG536_0H02060"
                     /db_xref="GeneID:59328097"
     mRNA            <351922..>352797
                     /locus_tag="HG536_0H02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285609.1"
                     /db_xref="GeneID:59328097"
     CDS             351922..352797
                     /locus_tag="HG536_0H02060"
                     /inference="similar to AA sequence:RefSeq:NP_013325.1"
                     /note="ancestral locus Anc_8.433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141505.1"
                     /db_xref="GeneID:59328097"
                     /translation="MFPMNELPVEILWSLLKECPRELRSVNKQFYRLHNEMYKRKVSR
                     LLSEVEEREFWNSVLRPLQQYVKSLDFLRKNSRLIVSAEGGTECIDDSWYVIYNALLG
                     PLKCENRLVNSPAGDSLDYQRPIFTGHCVVPPNVRCRINAWFYIDNLDAARKLATLVT
                     EFRDSPYERYQTVSPVPYIADFVTEAGVYCFNLGRLPKIDSQTFPATLELRLVERSMT
                     LPNYFESPSLEFLGYDFNNYDRRPWLFFRIDRIFKSTLFNPFETQLSESLVRFDGRFQ
                     LPGEDAGTARRNKLL"
     gene            complement(<352935..>354131)
                     /locus_tag="HG536_0H02070"
                     /db_xref="GeneID:59328098"
     mRNA            complement(<352935..>354131)
                     /locus_tag="HG536_0H02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285610.1"
                     /db_xref="GeneID:59328098"
     CDS             complement(352935..354131)
                     /locus_tag="HG536_0H02070"
                     /inference="similar to AA sequence:RefSeq:NP_010508.1"
                     /note="ancestral locus Anc_8.432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141506.1"
                     /db_xref="GeneID:59328098"
                     /translation="MLGGNKDKVKFVPIREVKSEEDYTLVKDIKQLEWFVKSQGQALK
                     SNGFFKAVKKSVETRAETQTLYFTDLQSGRCGFVQLLYSSVMGGVYKGFQLNFKVFRS
                     REGDKEDIDIWESFKVEDIEYFEPLRVASKEVSFEFKSAPHDDELVATLVIKVDIPKR
                     SKGSSGVKLDLMVDLFEGFMIKPDGCSYYLEKGVTEDELREQQDKLQSKKMLRHLFVP
                     RAKCHGTISYETKTGHKVTFDLVDVPGLYIDAVQGLAPQKAACRWNFLCYQDRVSSLL
                     CMEFTTSEDHKHTKVTVWCHTEQNKIKAVGSSINGGHVKFDATEKDTETGWSNPTSIS
                     FPLDFKEKRLRLVNRYDVLGEMPYVVRSLVENLANVKPFIYQYCQDSEYNGESGISII
                     ESTFIS"
     gene            complement(<354480..>356432)
                     /locus_tag="HG536_0H02080"
                     /db_xref="GeneID:59328099"
     mRNA            complement(<354480..>356432)
                     /locus_tag="HG536_0H02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285611.1"
                     /db_xref="GeneID:59328099"
     CDS             complement(354480..356432)
                     /locus_tag="HG536_0H02080"
                     /inference="similar to AA sequence:RefSeq:NP_010507.3"
                     /note="ancestral locus Anc_8.431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141507.1"
                     /db_xref="GeneID:59328099"
                     /translation="MVLIQTLVPILGGAVVAANGGIDETGSFVHGVEPLRQELYVGDS
                     NDNWSCLSNPSVVLNVSQINDGVCDCPDGSDEPGTGACGTKAPLFYCRNEEFIPKYIS
                     QSKVNDGVCDCCDCSDELLSPAEPFYRGSGCSELQEAFEKIKKTELKKHEEGSRELRS
                     LYKRFHLKDGSGNVDRMLLAEEIEKISGQLMDSELTLSSLKTKHVEQLKTENPLLYQF
                     KQLDADYIASEIASSFERVVEVSRAYESLVKILDALSDNYLRSLNDRVVNDNVKKYDF
                     MRSQSLRKISCDSKVEEQQRDQLVEYFQRELPQMFCEGKIDKPSKYIIGKITFVESMV
                     FGKVDYVPVVISKIQQLSGLMSEVAENYNVNYQDSGVKEAVESYKHWLLQYQALGDGA
                     LLPEEFVEKFARLKEFVLASAGEILASSSGEQVDSTFQGVLQHIKFLARKAAAYFRPN
                     LASEIAALESTMEQLKRQLDTKREQYRTLEDEQQGGGIRELQRLKQLIGALSQQHVLT
                     NAIDNYVYQISLGGPIYQIENSPTGNQVKIGDLKDLRLQSEDSQPAFFSYLKSTYPDE
                     GDLFPALVSETASDQEEYLFGNLHEASNGLVLEYSGGDRCWNGPQRSAQLKVRCAKDF
                     QITKVYEMTKCNYGIEMTGPIGCNLL"
     gene            <356897..>358114
                     /locus_tag="HG536_0H02090"
                     /db_xref="GeneID:59328100"
     mRNA            <356897..>358114
                     /locus_tag="HG536_0H02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285612.1"
                     /db_xref="GeneID:59328100"
     CDS             356897..358114
                     /locus_tag="HG536_0H02090"
                     /inference="similar to AA sequence:RefSeq:NP_010505.3"
                     /note="ancestral locus Anc_8.430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141508.1"
                     /db_xref="GeneID:59328100"
                     /translation="MRDASSERTPLSLTELPLNVLFQILCFLEREELRNVARCCRMLR
                     ILANENLMLSNSLVELHGCRNQWTRRLLFDVFDILNGSRNLLMKLTLEHNVSVFESVR
                     YVQQRCELECQASGTQMLLLRNEEENFVEHVRNANENNRKNDGKMTYLKILQGFNNLA
                     LAARDSNKSETIQEEVETPTRSGDPVSYEPALDETKTVSPAVSNYSKSSAASIFSDLP
                     PKLSNRGWHSSIYELEHVSDHTDASTSDSDTSSSADSIVRLRNSTKVRDKAALFEKLF
                     SEDYEVSKSPKKCRKKKSYGALAATTRPDLAGSRPASGKRSISQGYLEELARCNLASQ
                     PSSLPGSNEEQTSQNPILKYQDHVLNEYDVDINTLEDQTDKRRTRPRARIFRRSKLTA
                     FVTDDNKICYEKS"
     gene            <358370..>359560
                     /locus_tag="HG536_0H02100"
                     /db_xref="GeneID:59328101"
     mRNA            <358370..>359560
                     /locus_tag="HG536_0H02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285613.1"
                     /db_xref="GeneID:59328101"
     CDS             358370..359560
                     /locus_tag="HG536_0H02100"
                     /inference="similar to AA sequence:RefSeq:NP_013327.1"
                     /note="ancestral locus Anc_8.429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141509.1"
                     /db_xref="GeneID:59328101"
                     /translation="MSVGNVQKAPTGPNKPAERSKSNGAEEPKSQFNPRLLWPDMIKI
                     PDNPWTFTCKEVIEKLGTNPQATAEMKRCMEKCLIYFYTVKKKLNLLDHTYTAACILF
                     FRYWFVYGLPHTLTDCIHVSQAILVTACKTMENNRPIDAYVKATCEFLVKDLSGLRTK
                     QNMDKLRWDVRDRLVESEKAILCSFGFDLNIENPKDLIEEMFSGYYRFNRDYDLPEEF
                     KLVFPKILQEARNFIVQAVTQPVSLLCDGYTFIALSLIYCGLQFKKLVDKDFRFPANF
                     FSDKFPVAVTAQRFEEIFTDYRIIEENFFDLKSNKGDKLEISAADINSVIQEPEVPEE
                     CPSAAANPYDYELMKSGEVKQELIDHIEKRVQELFDRTVMEVKKRSSENPSEVEPAVK
                     KAKI"
     gene            <359880..>362960
                     /locus_tag="HG536_0H02110"
                     /db_xref="GeneID:59328102"
     mRNA            <359880..>362960
                     /locus_tag="HG536_0H02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285614.1"
                     /db_xref="GeneID:59328102"
     CDS             359880..362960
                     /locus_tag="HG536_0H02110"
                     /inference="similar to AA sequence:RefSeq:NP_012110.1"
                     /note="ancestral locus Anc_5.712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141510.1"
                     /db_xref="GeneID:59328102"
                     /translation="MVANCDKEVSFTPEYSNELLGFIQNTYEEHIKHSYAHLKLEKLL
                     DLLEHTEYLFESYVEFLQEKNSQDALTAFTIGCYYLYLVVPQSIQFQTRNKSYSIFND
                     LKKMYENQANMTNVLLMVKDEVDGILDKSARDLNEFQRSITRKRAYSVPDRQLAKSLA
                     NLKISDNPLPEAVQQTDAKLEHGNAETEKAPDEDTTQVWTAPSLEPNDQLKLALDPAP
                     LSPSLMSLDRPLETDQSDATSLQRHSVSRLRQGSVPTKPASHLPDGVARENPDSMVFF
                     EQDGANENFWSANVDRQHTHRKDSYHSVYMFEGEGDEHSDSISDSLIQTLERLQKQSI
                     ITAPELFAILSSPEERGKLLLIDLRLSKRSRVNHIVAPYTVEIDPRDLWNAQTKTPVS
                     SSVALDHIIKKSAFLERGSFEYIVYYTDMRTYMTVNFDYMFTLFYLLTSPPTVNLKSL
                     PTHLLGGYEKWKKLMKNYSTNYNIELGDYIYRPYGELKKSALEGGDSKSPEMPPWKPP
                     AVPLRIRKRPPPPSSLSMPSEEGLPAPPPVPPKISLDRGRESESSLPEHGLTVDSDPS
                     KSSKKLARSTGVSHPPNNQQYWRLQRHYSIPTIEKSSNTYVSLSITGLRNLGNTCYIN
                     GMLQCLFATTKFRDLFISGKYETFLNQNFKNQPQLSKSFSILFKKMYINGGCSVVPTG
                     FLKVLNYLRPDLRIPDDQQDTQEFLMVVLDRLHDELSNQALVADEYPDLLLYDQERMN
                     VQSKEYKKWFEEHVIGNGLAPIDHIFQGQIENTLECQRCGNSSYSHSTFYVLSLAMPK
                     PSSSTFSRSKRVKLEDCINMFTSEEILSGENAWNCPNCCGPLNAASNSKKSKKRKKLD
                     YGGESHSKSSIFKLHSKRSRSKSPFRVLGGTRSLMGDRKPKELTSKKTLNFIVVPPVL
                     VIHLSRFYYDLTKKNDTIISYPLILNIVLKNNEVAKYRLYGVVNHSGNLISGHYTSLV
                     NKDPMHRLDKGWQKWYYFDDEIVKEETNHGNLEQGVIKVSSADVYVLFYERLDN"
     gene            complement(<363150..>365084)
                     /locus_tag="HG536_0H02120"
                     /db_xref="GeneID:59328103"
     mRNA            complement(<363150..>365084)
                     /locus_tag="HG536_0H02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285615.1"
                     /db_xref="GeneID:59328103"
     CDS             complement(363150..365084)
                     /locus_tag="HG536_0H02120"
                     /inference="similar to AA sequence:RefSeq:NP_012111.1"
                     /note="ancestral locus Anc_5.711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141511.1"
                     /db_xref="GeneID:59328103"
                     /translation="MFARAGRLFLPRALAVTGAVATAGVVAGVKYKERWEEQMIANDV
                     AMRSPVDIPDVKLPSRKDLLSKLSKTDEFDVLVIGGGATGTGCALDASTRGLNVALVE
                     MNDFASGTSSKSTKMAHGGVRYLEKAFFELSKAQLDLVVEALNERGHMLNTAPHLCKI
                     LPIMIPVYSYWQVPYFYVGCKMYDLFAGSQNLKSSYLLSKRQASDIAPMLDSTVLKAG
                     LVYHDGSFNDSRMNAALAITAIENGATVLNYMEVNQLIKDKTTGKVQGALVTNRETGE
                     QYTVRAKVTVNATGPYSDRLLQMDKNPDGLPDPVKQSPNATVATEVAVQNPNMVVPSA
                     GVHIVLPSFYCPREMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPQNPTAAES
                     DIQDILQELQHYIKFPVKREDVLSAWAGIRPLVLDPRKKTKNSGGATQGLVRSHLCFT
                     TDNGMVTIAGGKWTTYREMAEETINEVVKVGNFDVKPCITKKLKLAGAENWTPNLQAL
                     LAQKYHLSGAMSKHLSENYGTRAPLICELFKEDERNQLPVTFGGRENVTVYGNVNFDS
                     FRYPFTIGELLYSIDYEYTRTALDFLLRRTRFAFLDARQALDAVEGTVKVMGDKLGWD
                     SSRRKDEIGKSKEYIKTFGV"
     gene            complement(<365432..>366490)
                     /locus_tag="HG536_0H02130"
                     /db_xref="GeneID:59328104"
     mRNA            complement(<365432..>366490)
                     /locus_tag="HG536_0H02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285616.1"
                     /db_xref="GeneID:59328104"
     CDS             complement(365432..366490)
                     /locus_tag="HG536_0H02130"
                     /inference="similar to AA sequence:RefSeq:NP_012112.3"
                     /note="ancestral locus Anc_5.710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141512.1"
                     /db_xref="GeneID:59328104"
                     /translation="MSLPGHKSILLTGTDGTQTRLNSGGVAKSEGSATGTGQGSGGVQ
                     FDSEQLARGRSRTKMRNGPGLNASTSRSRSRSRVSSIIAEEEFLKWTVLRRDPSMRLQ
                     PSQEDASTSELGSDASDEEDSGDEELSDEEQVTDVDNDVDIDEEFDYDQGMKVLPNFV
                     VSLNEVLESSRPWIRQYVAANQGRETEGVQETSLAGGYRRAIELVSKGKGSTTTRSYI
                     LCADLTSESNYALTYVMGSLIGNGDTLYIVHWDNQHLSSAATALSENVASIKKHVMYM
                     FDCVGAVIEDLDVVVLSLQHPFPKQLLTEMIYALQPIALCCSLSMILSSLQNFVCSVP
                     TLVIRKKLKRSKKKGISE"
     gene            <366907..>368097
                     /locus_tag="HG536_0H02140"
                     /db_xref="GeneID:59328105"
     mRNA            <366907..>368097
                     /locus_tag="HG536_0H02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285617.1"
                     /db_xref="GeneID:59328105"
     CDS             366907..368097
                     /locus_tag="HG536_0H02140"
                     /inference="similar to AA sequence:RefSeq:NP_012113.1"
                     /note="ancestral locus Anc_5.709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141513.1"
                     /db_xref="GeneID:59328105"
                     /translation="MEAAPHVDIARTGFENPVKCIFDSQGVQEFQHSVAIERLKYFLV
                     KYAHMVNRQRIERGPCGIELVDRFVALLQGLSRLVDETPALPGPRRYGNLACRDWHQK
                     LQSNLSNLWQELLPKEYHGAVPELNYYLGNSFGSSTRLDYGTGHELSFLAVVGALDML
                     GLWTSEFSGREVLLIFDTYYQLVRKLITAYTLEPAGSHGVWGLDDHFHIAYIYGSSQW
                     SNDPNAPMLPRDITNRTMVEKFADTNLYCQAISFIYQVKSGPFAENSSMLYDIATTVH
                     TWSKVHSGLLKMYYVEVLNKFPVIQHFWFGTGLYPWINAKTGQKLPIYESAETKNEMF
                     APSVATGVAAISMCHLPGHSIPHAKLAHGRYSPVRGMMAPPSTVPTNSCSKMRNSTRN
                     ERHD"
     gene            complement(<368162..>369808)
                     /locus_tag="HG536_0H02150"
                     /db_xref="GeneID:59328106"
     mRNA            complement(<368162..>369808)
                     /locus_tag="HG536_0H02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285618.1"
                     /db_xref="GeneID:59328106"
     CDS             complement(368162..369808)
                     /locus_tag="HG536_0H02150"
                     /inference="similar to AA sequence:RefSeq:NP_013023.3"
                     /note="ancestral locus Anc_5.708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141514.1"
                     /db_xref="GeneID:59328106"
                     /translation="MSPSKMSQPITDAAQVEQKIRHELSLSNEVITIRRNAPAAILYE
                     DALGEKKTTISSSGALIAYSGEKTGRSPRDKRIIEEETSKNNIWWGPVNKPCSEKTWS
                     INRERAADYLRTRDHLYIVDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEEEL
                     AHFGEPDFTVWNAGQFPANLHTEGMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTV
                     MFYLMPVHHNVLTLHSSANQGIEKNDVSLFFGLSGTGKTTLSADPHRKLIGDDEHCWS
                     DHGVFNIEGGCYAKTIGLTAEKEPEIFDAIKFGAILENVVYDPKTRDVDYFDSSITEN
                     TRCAYPIDYIPSAKIPCLADAHPQNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTS
                     KMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAKKMSEHRANAWLINTGWTGSS
                     YVAGGNRCPLKYTRAILDAIHDGSLAKESYESLPIFNLQIPTKVSGVPSGLLNPSKNW
                     VGGEAKYLSAVKNLAQLFVENFKTYQDKATPEVLAAGPQV"
     gene            <370430..>371044
                     /locus_tag="HG536_0H02160"
                     /db_xref="GeneID:59328107"
     mRNA            <370430..>371044
                     /locus_tag="HG536_0H02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285619.1"
                     /db_xref="GeneID:59328107"
     CDS             370430..371044
                     /locus_tag="HG536_0H02160"
                     /inference="similar to AA sequence:RefSeq:NP_012114.1"
                     /note="ancestral locus Anc_5.707"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141515.1"
                     /db_xref="GeneID:59328107"
                     /translation="MRKRGFTIYSDNSGNGVVSKKAPLGTLATAWAAPATRKPLMATD
                     VNVSSIFCNDSKKVLSKDAVKVNGKSDGSITSMQSVLETAKTVPSYEATRCAGVTRVV
                     ARDSSSDLQRAVASGVARLNSRLRVSGNVGFDQLVEFQELMMLSAHELLVVVDESRSL
                     VLHSKSALSAQRVDRFASMKLALNSQCYYVLYNDVYWYMRWKFF"
     gene            complement(<371041..>374586)
                     /locus_tag="HG536_0H02170"
                     /db_xref="GeneID:59328108"
     mRNA            complement(<371041..>374586)
                     /locus_tag="HG536_0H02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285620.1"
                     /db_xref="GeneID:59328108"
     CDS             complement(371041..374586)
                     /locus_tag="HG536_0H02170"
                     /inference="similar to AA sequence:RefSeq:NP_012115.1"
                     /note="ancestral locus Anc_5.706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141516.1"
                     /db_xref="GeneID:59328108"
                     /translation="MLDSFSYRAKRLPTSSDFAGNPIGVLSNSSMGKRRSSGAARGDV
                     PAGAVRQKRHGSGTCNSNNSQYVKRRLGNHQDHLFPQYLDNNSIPSTPSKTQAMSRGQ
                     SVTKWPTDRTPRTSASYVGGNPASPCCCSLTGSSHQEETPSKAVYDNRQRLAGSRATI
                     QQPCQYLASSQANNSAYVDVSQTGFGNSQANPPREAESSEAFGNENDEGKNHGEEDSK
                     DNDNETRTEHNGSGSDSNSNNNNNNNEEDDPNKGNVPSVAVLNKKSSQALVQKLQDIY
                     KIIVKQEIELQERCSQLTNSQTTELKQLWAIYRVNSDLINNYIAFITSALLPSQSDQD
                     LVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHAFISISNMLAD
                     IPARYAIPWYQRLGDLSRMAIALYPSSFIDWKLSAEYWYTEAMKYTYGHGKLYYHMST
                     VQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNALLIEYL
                     KHSEVMLLPSFLQSADLHPVVLLYFREKFGLDTNEKNIFDTRRMFCQDQDQLTYFFRH
                     APAFAESHILQLIGFGDPKNPFALLFDLPKNLKERKDKKEKRRVKSSAVSESSSTMAI
                     DEDEGETFLQEMSEQDFFDNLDSLRSCQLFPPSLDIWIYSLKYLNKTSMNCSMIVLRK
                     FLEGPIVVALPHLLPWAYFIIAVALRVERISDSASREFWTEFINRIFPWNTIVNFLNV
                     LMAYMLDNAHNMIPISPIFKSPRTDLEQLVEHFNENEDLPEVWKCWGTLWFDVICNKD
                     RPQVDSYENVGIKDHMFLDAPIDGIGFDKEDERAEKFWKRAFRIIHLFKGISQRFNFR
                     IVTSSSAQVYCRHQELSANFLKSFCFKLNDARSSETDFSALHNAIERMEESSYSNADM
                     TATPPLSVIENESIFDYPGYRKPAFDYSSYDRSGDLVSSSIYTSNGCEEKQETRNEDK
                     TGPPTQALSERKLFEQSVQQSVTAGEFKLDFTSFRMNQRDTHFVLDATTWLRHFAHVY
                     KLASNDVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYAEGRILPLRFTG
                     NVATHIEEHLEFEEQITWRSHVDEFVFEAVRKAQERLSPTQPHDTSNLQQVVLVTDDA
                     NMRAKAQDHGITTFTTKFVFAITNAIGYNNKICTN"
     gene            complement(<375004..>375365)
                     /locus_tag="HG536_0H02180"
                     /db_xref="GeneID:59328109"
     mRNA            complement(join(<375004..375262,375346..>375365))
                     /locus_tag="HG536_0H02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285621.1"
                     /db_xref="GeneID:59328109"
     CDS             complement(join(375004..375262,375346..375365))
                     /locus_tag="HG536_0H02180"
                     /inference="similar to AA sequence:RefSeq:NP_878113.4"
                     /note="ancestral locus Anc_5.705"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141517.1"
                     /db_xref="GeneID:59328109"
                     /translation="MGLDHSLKLEIPFENARQATIAKEVLKPDPILKPQDFQVHYTTA
                     KNVLLVSFQSIDDRVLRVGVSSVIDSIKTIIETIDELDGPPISSSPTI"
     gene            <375469..>376641
                     /locus_tag="HG536_0H02190"
                     /db_xref="GeneID:59328110"
     mRNA            <375469..>376641
                     /locus_tag="HG536_0H02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285622.1"
                     /db_xref="GeneID:59328110"
     CDS             375469..376641
                     /locus_tag="HG536_0H02190"
                     /note="ancestral locus Anc_5.704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141518.1"
                     /db_xref="GeneID:59328110"
                     /translation="MRFENSRQASGRMESTKRTRLACIGDHEFYVVTRFVGPVRVSFE
                     LEAVPATTRSDVPPVATGELVVIDSTASGKGRTAQDDFYQIVIGPVFEKLNLHHTLIK
                     TTSRDSISSYARTLDTGRSYTVMLLSGDTSISELINNLPQRFCGSELSVLPFPLGSGN
                     AWASSLGFLDPAETLHSFLTGSLSSKHFPLYRAVFPNGYSIVFFIILSLGFHANMLHA
                     CEAPEYKRMGNERFREAGGRVLAQYDLDLGITAGGLTNSYSYFALINTPNLEPAYTPS
                     PQSNPLRHELHVLAYSSSLGKDQLLASIMKGYRLKKGEELPKEAGTTYLPMTTDFDVK
                     LNIDPEKAPRYKFEICCDGVLLNLLDLQSEDTVKNTIHIEFPHHYSGFNLKVLSPR"
     gene            complement(<376652..>378352)
                     /locus_tag="HG536_0H02200"
                     /db_xref="GeneID:59328111"
     mRNA            complement(<376652..>378352)
                     /locus_tag="HG536_0H02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285623.1"
                     /db_xref="GeneID:59328111"
     CDS             complement(376652..378352)
                     /locus_tag="HG536_0H02200"
                     /inference="similar to AA sequence:RefSeq:NP_012116.1"
                     /note="ancestral locus Anc_5.703"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141519.1"
                     /db_xref="GeneID:59328111"
                     /translation="MSDPREVGRDDPYEQVTSAEEEQLELEEQIEEIERQRQDLMKRL
                     EEKKAHIRRRDPNFVAIQVERSPIKKPVAPAKLKPSPTRRAISVENPNELKVERQLQI
                     PANSTSYFIDRFTSSKRDEQNRQQLHQKLLSDRVHTFRGADGKREHKAISTNELEEFS
                     DQWISQRFVPKEELQETLHEIKILRLNKLFAKVKPPKFSEPQYSNWAAVGIISGKGEI
                     KFTSAEKPRKYFKFTLTNFQHNLEVYIFGKKSVERYYSLRVGAIVAILNPEVLPWRPS
                     GKGNFIKSFNLRISHDFPCILEIGQSRDIGWCPGFNKSQQKACGAPINKAKETYCDYH
                     KETRLRSNHAKRIELNGSSALGAPTRIDAQPALYRSRSPSAQNSFKVIPDVRTRKIDK
                     KPDVRGIHFTNGNAAKAFFNDKFQNPDILNNLDNKRRKIEDRKKQKLLEKQLNLVNGK
                     SIDMKNHEDFENARQTTEATLQSGFIERLGFDPTHGRMADVLKRTNRGKINDHRFNEK
                     EREVSSLLSFRKEKVELKPSKEVLIDRKKGRERAWKETFGKKPEKDLSDSSESEIEII
                     "
     gene            <379073..>380350
                     /locus_tag="HG536_0H02210"
                     /db_xref="GeneID:59328112"
     mRNA            <379073..>380350
                     /locus_tag="HG536_0H02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285624.1"
                     /db_xref="GeneID:59328112"
     CDS             379073..380350
                     /locus_tag="HG536_0H02210"
                     /inference="similar to AA sequence:RefSeq:NP_010658.3"
                     /note="ancestral locus Anc_5.437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141520.1"
                     /db_xref="GeneID:59328112"
                     /translation="MTIEHPQQDDQGLKQNLEIRPKSSYLKPKLGMKERDCTTMPRQG
                     FTGQKKLDKKGPSIPFSKFKHSALNYYPDVMEEFFEDIVEVATYQNDRLFLAGDGKKP
                     IYPCLQIVAALIAGNRDPKAKIPYLGCNLYEDLEKFKPLSASELDSSIGCFKYIQRIE
                     KRKIKDFNKDKITIISPRHHVVDLVMALFHDEEVSIICTNLGKGKLLFSEDKSIAQES
                     GLYSKNPMTRKICYSGFALEDKLTTSHEGKTGPFYSIVEGKLNDRITLLLRCEMDAYN
                     PISEVYTELKCFAKLNVQENAHRRKLLKTWIQIGLIPHSDLIIGTRDTQVGQLNDLNW
                     YTKDTLCRKFNNPSIPQNDRYFNFNASIAVEWCYHCIESICELVMSNSGNSIDDPFPQ
                     IESFKITIDKLHNISVKKLTKVPKHVQVPGKYR"
     gene            complement(<380675..>386122)
                     /locus_tag="HG536_0H02220"
                     /db_xref="GeneID:59328113"
     mRNA            complement(<380675..>386122)
                     /locus_tag="HG536_0H02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285625.1"
                     /db_xref="GeneID:59328113"
     CDS             complement(380675..386122)
                     /locus_tag="HG536_0H02220"
                     /inference="similar to AA sequence:RefSeq:NP_012117.3"
                     /note="ancestral locus Anc_5.702"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141521.1"
                     /db_xref="GeneID:59328113"
                     /translation="MSEGTTAVNEMTETGPNAENEVSRILSGFLGVSKEELGSVTTDH
                     VMTECILARAREFNDLQSNNMKLHATIDEMKVLCSRKVETLQSKVEDLTKNEECGKEA
                     EIRLREQVSQLTAEKELATNKLNRAQRELQDVQSQKDGLIAGKQDIVKLLDEKIGELE
                     ASKKETNDLLKESKHLRQRLLEVENEIQDYKSKELSNKSEIEVMKQQVALLTKNNEWL
                     EKDIMTKTEQFIKYRKENDVELQASLRELASIKSEFQVEKTSREFLTAKNHELSKDLQ
                     AKLLEVKSLSDTLNTERQEFSREMSLKQKLIELLEEQVGSLQKEIRLAADNKASDIDN
                     ENELSLGKEGRENEVALLQQKLEASEHECLRLEAVVRDLLGEGNEEKDASPASRDLSS
                     SRIYGDLSVLKKQLIKERHQKENLQRQVESFIVELEYKIPFINSLKDRTSALEKELND
                     AALLLEHTSNEKEKATRELEVASGKIEQYETNINTLVRQRSDLARQVQFLLVNVSVHN
                     DSRGPLTDEETAFIRRLIENEDPGNDSDSQRIITERLVEFKDIVTLQQRNSELLKTVR
                     NLAAKLEEEELKASKKIDSLENETINEAKQAIVILQEYNAKMESQMEIITKERDAYKA
                     ILSDRESAKESSTARQFESLNKDKEDLIKDLEHRLSTLSAEASKNVQILNEEIQNLHK
                     IKTDLTVTLEKERSSRTLAEERLKLLQGTLEMAKQENAQLLKRFHDLENNMSSQEVKT
                     TETVNKFIACQSRLSVLESKAAYLEEEKSILMASNETMKNNLQKLMEEKNSLTIVITQ
                     LQTLQSERETLLKDTHASYKEKLNQMQQNLSNLTSTIESKEEKIRTIELSRDDQIVWY
                     QTKMDTMRDEEKQLQKEITEKQALIGQLRAHIEDITKRLEEKESNNSAEGPSEDVVGA
                     ESSELKVRHNLEKMSLQLKHAYSQVEQYKEMSSAVEESYQKLQSQYDCAKEEFDSEIK
                     KLLSEKSQQESEISRLKNNIDFLNNEYAAQRNKTEQEKHELSKRIFSLEGSKNALHNV
                     EMKIKQEIDQLKSDLKQQTVYANVAQSNYEEELQRHAEAAKVIRQLRAEVETERIETQ
                     KLKASEHQARELLESNEKNWFNQKAELERDLETYKERMEDLSNQNKLLFDQIQLFSNS
                     AENTGSESHAESRELLTNLRRERDILETKLTVSKREEKVLHQRLLSLEDELSEMRKKL
                     LKSQADDVDQTTLAKQHSEIMEQLNQMNLLRESNITLRNAANAAQEKNVELQKELANL
                     QDRILPLECEIENCRRCIEERDQEIEVLRDETERWKARSHDILRRQEKIDPEELKKLE
                     EQVASLQEQLKQRIKENTDLDDRFNRLKKQAHEKLNASKITQANLSAELNDLAGAKTK
                     LEEMLKEAQVKVTDLERMLSEKDRDSATINDLRNELETAVQKAKEIEATLQETTQNSE
                     GLVNQLNGEISNLKQQINALKEKESGTLEQGQEKDISTIVESMKKDFEEEKINFVHEL
                     RKEYGEKLEEEKAKLSSQLASSEEKEDLNELKRRWEETQEEAVLRRIKEAEENLKKRI
                     RMPTEERINKVLEKRKAELEEEFQRKLSQNTLQSNQESESLKENLREELQKEFETKYE
                     ELLGTVKKKAFEEGKQQAAMKSTLLERKISKLEAQLNKGMPSSTEPVAPAKNNGIPSK
                     IDERNGVNIGATQLPVSGEKVLKLLDKPSFQLQKPSSSNPFTSGPPANDNALEMKPAF
                     TIPLNHSNTKSDSDVGAAASDRQGKLESTSPQPGKEQQKENTSDGQIVNSKDLYQQTG
                     EASPLKRPADSLPNDGTRPKREKQESSQTDH"
     gene            <386713..>387227
                     /locus_tag="HG536_0H02230"
                     /db_xref="GeneID:59328114"
     mRNA            join(<386713..386720,386849..>387227)
                     /locus_tag="HG536_0H02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285626.1"
                     /db_xref="GeneID:59328114"
     CDS             join(386713..386720,386849..387227)
                     /locus_tag="HG536_0H02230"
                     /note="ancestral locus Anc_5.701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141522.1"
                     /db_xref="GeneID:59328114"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYAR
                     LPPRATNCRKRKCGHTNQLRPKKKLK"
     gene            complement(<387391..>390684)
                     /locus_tag="HG536_0H02240"
                     /db_xref="GeneID:59328115"
     mRNA            complement(<387391..>390684)
                     /locus_tag="HG536_0H02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285627.1"
                     /db_xref="GeneID:59328115"
     CDS             complement(387391..390684)
                     /locus_tag="HG536_0H02240"
                     /inference="similar to AA sequence:RefSeq:NP_012119.1"
                     /note="ancestral locus Anc_5.700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141523.1"
                     /db_xref="GeneID:59328115"
                     /translation="MRLTSLIKEKFSPPFRISIRTQLTALVSIVALVSLIILAVTTGV
                     YFTSTYKNLRSERLYIAAQLKSSQIDQSLNYLYFQCYWLSSRDTLQTALANYISGNKT
                     DANWVDAASAVQKFLTSSALFSVARVYDAGFHPVLNATNNGTGDALPGDILNRLMPLS
                     TDMALPSSLETDGILTDPVLNGSSYLMSMSLPIYANPSIILTEPRVYGYVTIIMSADS
                     LKSFFDDRTGLEKSNVAIISAVYDEVNHKITSYRFVFAPYGLPPTILDSTFPIPNDTF
                     LSASLRQGKAGSVQDAKFFYYKSSAIGYSPCTFALVNWVAIVSQSESVFSEPTTRLTK
                     IIIGVVVGIGVFICIVTFPLAHWAVQPIVRLQKATEIITEGRGLRPSTPGSSSLSRKS
                     SIVRRRYSGGSSFHSPSFGEEKDPLPPAGPAGNGIVSEVSSNRDHAMTPSSLSSVNEA
                     RSDRTKKLMTSSNLIEARVPVYRRFFSDEFSELTDTFNTMTDALDQHYALLEDRVRAR
                     TKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIGKIHNSLKL
                     IFRSGELLLHILTELLTFSKNVLQRTKLEKRDFNITDVALQIKSIFGKVAKDQRVRLS
                     ITLWPNDIRKMILYGDSNRIIQIVMNLVSNALKFTPVDGRVDVRIRLLGEYDSERSEK
                     AGHKVVYVVPGSEIRENEPEIFCEQTLKQDAIDKQEEEGSASDSEKTDMQEASQEVGR
                     QDSDEQKSFISMSTTSYDDAIFHSQFRKPTNSSDSEDGIALLQPKSWVIEIEVEDTGP
                     GIDPSLHESVFQPFVQGDQALSRQYGGTGLGLSICRQLASMMNGTMKLESALGVGSKF
                     TFTLPLTQTKERVFEEENPFEDEFNPLSKKNRRVKFKFAKSIKSRKSRSSLSTVAPRT
                     GDKGSEQLKSSDSEFSVGNMSLNRPFLQSTGTASSSRKIDTVPNLNKSCKILVAEDNH
                     VNQEVIKRMLVLEGLDTIELACDGQDAFNKVKALQETGEHYSLIFMDVQMPKVDGLLA
                     TKMIREDLHYEYPIVALTAFADDSNIKVCLEAGMDGFLSKPIKRPRLRTIIEEYCPKD
                     KNRDKDKDT"
     gene            complement(<391516..>393066)
                     /locus_tag="HG536_0H02250"
                     /db_xref="GeneID:59328116"
     mRNA            complement(<391516..>393066)
                     /locus_tag="HG536_0H02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285628.1"
                     /db_xref="GeneID:59328116"
     CDS             complement(391516..393066)
                     /locus_tag="HG536_0H02250"
                     /inference="similar to AA sequence:RefSeq:NP_012120.1"
                     /note="ancestral locus Anc_5.699"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141524.1"
                     /db_xref="GeneID:59328116"
                     /translation="MSCQYMASGGSRSREMDGSMFDVNRSSTSLAGGTLGGEAAGNDN
                     TETTAFERKSLLNPHLSVLELLQGNRDSSSGDERVLETSLGGKGGVSSDGSKSISDSW
                     QAIHRNEALISVVPERCSSQANAVGILSSSDTSEEEFDPAGSPNVAHHGQLHLPQQAP
                     AGPRSLPNLQSIKMEVPVVFPVVERAGRGDGEGEGDDETLTKSLSNSSNSFVMPKLSL
                     SQKSHKLRILILGRPGTKFYQSIPKRYQHFFELSQLQDPSEFRQFTGILIVFRELKEM
                     VSLLNRVCQCTPTRPIIPVCQTGQHQQVRNVLESLLKNKLISLLYPPVVISNHSDLNN
                     MFRFLQDLSRTISDNSDDEDEECEVTKQAKKSYQRKKKKLPSHDKSKPRRRKDRDERV
                     SKWVLWGISLTVGVGVGYCMSYFASSALVSMNVKSMPSIDGGGDNLVVFEHSSLSIGE
                     YDHDLENPFAHALYLFKQTLKQWNSMIKQFISKHLHFVEQMSFNNHKDWSVDDNSNRI
                     LALGYILL"
     gene            complement(<393504..>395231)
                     /locus_tag="HG536_0H02260"
                     /db_xref="GeneID:59328117"
     mRNA            complement(<393504..>395231)
                     /locus_tag="HG536_0H02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285629.1"
                     /db_xref="GeneID:59328117"
     CDS             complement(393504..395231)
                     /locus_tag="HG536_0H02260"
                     /inference="similar to AA sequence:RefSeq:NP_013019.1"
                     /note="ancestral locus Anc_5.698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141525.1"
                     /db_xref="GeneID:59328117"
                     /translation="MNSNRSSSTDELESLPQGIEQKAEIKVLTDKVCPEELSNDDLEL
                     ELCDDEPTEEEMRTLKHVGGTIPFRCWLIAVVELSERFAYYGLSAPFQNYMQNGPDDV
                     PAGLLNLKSQGATGLSYFFQFWCYLTPIWGGYLADTYIGKYSTICWGTVVYLVGILIL
                     FVTSIPSITTPHAALGGFVAAIILIGIATGMIKANLSVLIADQFPKRRPRIKIQKNGT
                     RVIEDPNITLQNVFMLFYLMVNIGSLSVIATTELEAHVGFWAAYLLPFCFFWTAVIVL
                     ALGKNQYVKPPVGDKVISKCFKVVGIAMKNKFNFQMAKPSVSPDKAYPWTDKFVDEII
                     RSLSACKVFLFYPIYWVCYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPIC
                     EFFLYPFIRRFTPFRPITKIFWGFMFGSAAMVWAAVLQHFIYSAGPWYEYPMGKNSPN
                     HIHVGWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKSFVMSLFLVTSAFGSALGCA
                     LSPVSEDPKYVWLYTGLGVSCFIAGWLFWICFKHYNYTEEAMNALDYDDDPAMLKSRK
                     DAIEVSSVA"
     gene            complement(<396375..>397355)
                     /locus_tag="HG536_0H02270"
                     /db_xref="GeneID:59328118"
     mRNA            complement(<396375..>397355)
                     /locus_tag="HG536_0H02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285630.1"
                     /db_xref="GeneID:59328118"
     CDS             complement(396375..397355)
                     /locus_tag="HG536_0H02270"
                     /inference="similar to AA sequence:RefSeq:NP_012121.2"
                     /note="ancestral locus Anc_5.697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141526.1"
                     /db_xref="GeneID:59328118"
                     /translation="MTLVLAYNKLIERFIALVKMYIKDCGMKVAHTVQEVRNWHRDAK
                     GSIGFVPTMGCLHAGHTSLFEQSMKDNDLTVVSIFVNPSQFGPNEDLDQYPRTLSEDI
                     KLLEELGVDMLFAPKASEIYPQGIPLNVDEQRGPFVSVLGVSEVLEGATRPNFFRGVA
                     TVVAKLLNIVAPDVAYFGQKDIQQFIVLDTMVRQLFFNVRLQMMPIKRDSNGLALSSR
                     NKYMSEETLQIASNIYKGLKRGSRKVLESNGIIGRDAVDAEIRQVWQPYVSSGDFEID
                     YLSIADFQTLKEVSSISPAEQQVVISCAIYVKDRRDKNVKVRLIDNILLG"
     gene            <397464..>399482
                     /locus_tag="HG536_0H02280"
                     /db_xref="GeneID:59328119"
     mRNA            <397464..>399482
                     /locus_tag="HG536_0H02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285631.1"
                     /db_xref="GeneID:59328119"
     CDS             397464..399482
                     /locus_tag="HG536_0H02280"
                     /inference="similar to AA sequence:RefSeq:NP_012122.3"
                     /note="ancestral locus Anc_5.696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141527.1"
                     /db_xref="GeneID:59328119"
                     /translation="MEQSNNEFRPNVLDALNPQKFTSQIPVPSQDRRRNTTNMGLTDI
                     INKSIERNSIASSKKRHRSTVAGEEPSMNSRLSQRYSSLPHTNNINTSFLTNAGSNMT
                     RNGPSNRDPRPLRDKNFQNAIQQEIFDYLSQNKFDIEMSHPISLKFLKLPTQKGFTLI
                     FKWLYLRLDPGYGFTKSIEHEVYQILKNLQYPYLESINKSQISAVGGSSWPRFLGMLH
                     WLVQLNLKLDASLNELDHNIMNENTQEMTILNHPLTTLDEQDQKQEKYELMVEKLFID
                     YVMESYKSFLRLEDNYEPYMKELEAGFMKFIHIIGTDIDRMGTRNDEILLKCQEMAKR
                     SKDLAMATQKCKALKNDLAKFQNYVNSVQHKSHEWPKKLERMKLESEHKRQEISNLED
                     EVKTLQKSLKTRGVSIEVIDEKSNRREQIVQDLEVINKHLDKLAAALKSDKLGRDNVV
                     KNMMDAIRQYNSAIDNLFDLRAKLGDNLDLSYFKVSISEDGLLDKTDAIAYEDLMPSK
                     QSIKNNIRQALLNLYENIQVNIEKCQKENASIEAELATLQSEIHEKTNLIEQRELLLS
                     DAKSIYELKMQESESDLLSQKIEIERLEKKISDFNRLAQEKISDAEQLVQATKLKHEE
                     LLLDLNRRKALLHAQIIEIIEYASNFKINIQTALEKTENRITQELELL"
     gene            complement(<400282..>402813)
                     /locus_tag="HG536_0H02290"
                     /db_xref="GeneID:59328120"
     mRNA            complement(<400282..>402813)
                     /locus_tag="HG536_0H02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285632.1"
                     /db_xref="GeneID:59328120"
     CDS             complement(400282..402813)
                     /locus_tag="HG536_0H02290"
                     /inference="similar to AA sequence:RefSeq:NP_012123.1"
                     /note="ancestral locus Anc_5.695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141528.1"
                     /db_xref="GeneID:59328120"
                     /translation="MTDIDGYQTRSKGKMFPEMSQSFFSDEDSAATDDNRSNYEEDGF
                     IDGDDDYGYGESRATTPAEVAPKPRRPSKKSKQEYSNNETANKLAAKDQNFLYGVTRD
                     MPSDFVPDAVSGLFKTHDFSYLKLRPDHAARPIWISPSDGRVILESFSPLAEQAQDFL
                     VTIAEPVSRPSHIHEYKITAYSLYAAVSVGLETDDIISVLDRLSKVPVAPSIVNFIES
                     ATVSYGKVKLVIKHNRYFVETTQADILQMLLKDPVIGGLRIDTGQQQQQQQQQQQQPN
                     EKANAQQNINPNDVEAIFTAVVGGDNELDEEDDIDAVHSFEIANESVEIVKKRCQEID
                     YPVLEEYDFRNDHRNPDLDIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGK
                     TLVGITAACTIKKSAIVLCTSSVSVMQWRQQFLQWCTLQPENVAVFTSDNKEMFQTES
                     GLVVSTYSMVANTRNRSHDSQKVMDFLTGREWGFIILDEVHVVPAAMFRRVVTTIAAH
                     AKLGLTATLVREDDKISDLNFLIGPKLYEANWMELSQKGHIANVQCAEVWCPMTAEFY
                     QEYLRESARKRMLLYIMNPTKFQACQFLIQYHESRGDKIIVFSDNVYALQEYALKLGK
                     PFIFGATPQQERMNILQNFQYNDQINTIFLSKVGDTSIDLPEATCLIQISSHYGSRRQ
                     EAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYSTKRQAFLVDQGYAFKVITHLH
                     GMENLPNLAYASARERRELLQEVLLKNEEAAGIEIGDDADNTIGRGVNAHKKTKSKAV
                     RGEGSLAGLAGGEDMAYMEYSTNKNKDLKEHHPLIRKMYYKNLKK"
     gene            <403963..>404997
                     /locus_tag="HG536_0H02300"
                     /db_xref="GeneID:59328121"
     mRNA            <403963..>404997
                     /locus_tag="HG536_0H02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285633.1"
                     /db_xref="GeneID:59328121"
     CDS             403963..404997
                     /locus_tag="HG536_0H02300"
                     /inference="similar to AA sequence:RefSeq:NP_013018.3"
                     /note="ancestral locus Anc_5.694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141529.1"
                     /db_xref="GeneID:59328121"
                     /translation="MASRKKENVKATNAKPPKLSEKARRKQVVDELSTSSSSSSSSSE
                     SATVKAKSSSSKSKGSRSSSSPSSSSSSSSSGSDNSSSSSDSEQSSSDETSSDSSSGS
                     SSSSSSSDDSSSDDSSSDDSSSSSSSSDPSSSSSDSSSSSSDSGSSSSSSSSDSSSSS
                     SDSSSSDSSSSSSDSSSSSSDSSSSESGDSESSSEETNEENQSKTSGKTAQKTRKRSL
                     EDDGDTKLTKKTKAQDENLESASTSRTESPAPLSTPKDAISAGEDMLRPGQRKHFSRI
                     ERSRISFEDRELTDNTYKGAAGNWGELANEKLSRVRGKDFTKNKNKMKRGSYRGGSIT
                     LSSGSYKFQD"
     gene            complement(<405159..>406298)
                     /locus_tag="HG536_0H02310"
                     /db_xref="GeneID:59328122"
     mRNA            complement(<405159..>406298)
                     /locus_tag="HG536_0H02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285634.1"
                     /db_xref="GeneID:59328122"
     CDS             complement(405159..406298)
                     /locus_tag="HG536_0H02310"
                     /inference="similar to AA sequence:RefSeq:NP_014727.1"
                     /note="ancestral locus Anc_5.693"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141530.1"
                     /db_xref="GeneID:59328122"
                     /translation="MMEGYINSHYKKETKVIDAVYPRSFDDSTLVPGKDVLSIVYDIY
                     TLVKETENHLVPKVNLLFLHGSGMSRCIWEYYVAHIVDHRPNWRINKIVLMDQVTHGD
                     SAVLNAKKLGVNFDWVDGARDACKLAQNEFFGEGSTYNVVIGHSMGGFQALSCGVLMP
                     NLFHLIITIEPVALMYVGKGTKGEYTVISRKLHRALLSKMKDRFQSELEYEAYMRTSS
                     FFAKVHPDILQRIIDFERVALSNGEVRTKMDQRQNILCYMTLFPAAKWLLGSLKFIRS
                     PVVNILGGVSKWTPKENQEVLERFILDYTQDTVPKGDHLLNIENPEETLSKIVCHISR
                     FMASQSTNDLGRDLTVNERRNLFNAEFNRFQAQRVDDRPMELAKF"
     gene            complement(<406830..>408011)
                     /locus_tag="HG536_0H02320"
                     /db_xref="GeneID:59328123"
     mRNA            complement(<406830..>408011)
                     /locus_tag="HG536_0H02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285635.1"
                     /db_xref="GeneID:59328123"
     CDS             complement(406830..408011)
                     /locus_tag="HG536_0H02320"
                     /inference="similar to AA sequence:RefSeq:NP_013017.2"
                     /note="ancestral locus Anc_5.692"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141531.1"
                     /db_xref="GeneID:59328123"
                     /translation="MVNNGNDVNTASTPRRYTKRSSAEYIRAMSSPGGSHEHEAASPE
                     TPSPPRQGRRSSTSLGFFTSPLHPRAEAAISRSGHPSSSDNGLLMPQSPNIRSRLLPP
                     TTPKSRNAEMFLSPSPNLKSPGTYRDNGKPIREISNGLKARLNYALVKLQNGWVEKTL
                     PELENELSNTGKRHKHEDDDEEDLLTAERLELARETVLKGSSYNNEFLRDSEESVDEQ
                     DNTVTEEDGDSNSAHIAFLKALSSPKKRIKQEGVSRSPLQWSEPKKTVTTEKEKDHPS
                     EVEAIETLMSLSSPQRSRSANQEFSLPVPPKVPKSSSPTTSTSSDSSSANESRQKRQL
                     ELSRQPKSGVVVPIMQKQSSESSSESLKESFQAEEKAELRYDRQQQTDVETDVELSDN
                     D"
     gene            complement(<408746..>410719)
                     /locus_tag="HG536_0H02330"
                     /db_xref="GeneID:59328124"
     mRNA            complement(<408746..>410719)
                     /locus_tag="HG536_0H02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285636.1"
                     /db_xref="GeneID:59328124"
     CDS             complement(408746..410719)
                     /locus_tag="HG536_0H02330"
                     /inference="similar to AA sequence:RefSeq:NP_013016.4"
                     /note="ancestral locus Anc_5.691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141532.1"
                     /db_xref="GeneID:59328124"
                     /translation="MNHIYGSPFPTLNPKVRYRTALERAGFEVNFGSLIPDNENNGEL
                     AERDQRKAVGPSLPSAEPWSSGQHRANSAGIRGQMATTAQNEPIPRYHYPAVRQSQPD
                     GGSRQFSSTKPTSNSRIPSSRFVQKMQSNSTPSLRSSTPSNAPLYAGKESSKSENELD
                     PIEKSFMKLTQNDASNGTGIVGYTKTTPSVASRESMADSVKRESMGHNTQIDASRGTV
                     YSTVESLNFEPSSELHTGLLSLQQDDNAQRFEGDSSLPALTVKTRFSEGLHMADKVSP
                     QLFGDKSAQPKYGMRVLDSDSGNVDRPQEKRPLSILSRDVETPQTATSSQVRELLAQL
                     DDVSYTKNAQLDTAILAGTAANSSAGSQLDVRSLSVDRSRSCSNTSSRFKKSSAYLSQ
                     SPGDNYDIIPQSLTLEEEGVNPYRTGDSPVIYKFRPAQNDGFGQLQDRPQIVIERSQL
                     SHKETIENSKDVTHPVPSKEPLGPDNLNEPLVDAAADTLSEEQPIHKFPPGEGPCRAC
                     GEEVHSRGIFSKRANELSGQWHRDCFRCLTCNVKFNKKMPCYILDDQPYCQQHYHERN
                     GSICQVCQGFIEGECLENDRTERFHVHCLTCFLCETRITSDYFIYNGELPLCSEHDIE
                     ALLRDGLTGEPQSSGQDNTVSKRRTRLITLGQA"
     gene            <411126..>413855
                     /locus_tag="HG536_0H02340"
                     /db_xref="GeneID:59328125"
     mRNA            <411126..>413855
                     /locus_tag="HG536_0H02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285637.1"
                     /db_xref="GeneID:59328125"
     CDS             411126..413855
                     /locus_tag="HG536_0H02340"
                     /inference="similar to AA sequence:RefSeq:NP_013015.1"
                     /note="ancestral locus Anc_5.690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141533.1"
                     /db_xref="GeneID:59328125"
                     /translation="MEGNLALQHRPLAVTQHLIEKYYEHIHNGTSAADRNKGRRRICD
                     GGDMVERRYELNRQGGKYLTDVQHKSGISFGAYDMEYEEAVSTDEELNDELDDEEEEV
                     EEEERVSFFPKCKAFIYSLFVGDYEKDLLIEKILATKQHAMSYEEWSYAGLRLDELTD
                     KTKWKQKVESNLYDYRLIRELTTKLREKRLAEDYSGLLYTIRTSWVRNLGNMGNVNLY
                     RHSHVGTKFLTDEYLNESRLAIDALLHQSELDDGYLLGILQQTRRNIGRTALVLSGGG
                     TFGLFHIGVLSTLFELDLLPRVISGSSAGAIVASILSVHHKDEIPQLLERVLDTEFNI
                     FKDDKQKSESENFLIKISRFLKNGTWFDNKNLVNTMVSFLGDLTFREAYNRTGKILNI
                     TVSPASLFEQPRLLNNLTAPNVLIWSAVCASCSLPGIFPSSPLYEKDPQTGEKREWSG
                     SASVKFVDGSVDNDLPISRLSEMFNVDHIIACQVNVHVFPFLKLSLSCVGGDIEDEFS
                     ARLKQNLTNVYNFMANEAIHILELACELGVAKNALTKMRSVLSQQYSGDITILPDMKM
                     LFRLNELLANPSREFLLRETTNGARATWPKVSIIQNHCGQEFALDKAITYLKGRIIGS
                     SSIRNPLQFVDMPVGLIKTQGPKDNVGDKEEGNIITSLDDNLFESESINSLLLLREDA
                     ADNKRDYTGKFSLPLYETPRSVRHQRRKSETNARSRQSSNSVSFPVSSSSTRIQRGTT
                     KAFPNPPRLSKKLSTGHIYLQMPPRGELKKLSDRRDSFVAINTNDAPPQSAPGGVDLR
                     AKNTSPRSVRQRSKRNRKRRSNILSTAGSEEEEASGIFAGSPNDQREKKAYAFRSRQN
                     SMNDNSLKRLSASSGGPSPKSHKVLTLKDDTTNKIELLDKSSTKTATPSSEEL"
     gene            complement(<413966..>416077)
                     /locus_tag="HG536_0H02350"
                     /db_xref="GeneID:59328126"
     mRNA            complement(<413966..>416077)
                     /locus_tag="HG536_0H02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285638.1"
                     /db_xref="GeneID:59328126"
     CDS             complement(413966..416077)
                     /locus_tag="HG536_0H02350"
                     /inference="similar to AA sequence:RefSeq:NP_014723.2"
                     /note="ancestral locus Anc_5.689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141534.1"
                     /db_xref="GeneID:59328126"
                     /translation="MEETVIDKALDLGTTYFRNESYEKAKELFRKALDLARSYDEKEL
                     IMLRERQGLARYTVPEPNKHCKVYHPMYVRLLDNLAATYEKLNDLKRALKCAQLMVDA
                     DPYNLKCYIRLGKILQKQSKDKEAYNVYVQGLRKAREAHERFAWQISKRLVDIAQQQK
                     NNVKTRLDPRKAGEKLQSSEKKHLIDPIEERKQHVKRSRTGTPEVASLTGSRNDLLYM
                     MPPELYPIIFDGFTAKELFRVTLVCKSWRKSLLEFPQLFQRFLLNSCSYQQLTTCCNF
                     MLRLYKILEQPSMGGSLETFKFSPKYAKEELKSVEAIFSRLSNFRFQRLILSVPNCTT
                     SHLAQLMRSNTDICRELKDLSLVLSFRAGKPYEIEMLSQCKNLRRLEVLVDSSVVPVD
                     SGLQRSTSFIEPRMLPTWAENLESFSLTCDQSKVRGFPFLTLVTHFPANQLSRLSITG
                     VTFSSEANQFDWLANFGHLREIWFENNKGASLMVFMRVLRDYPLSRRLEKLTFREDCI
                     SRRTDLEETSDGYFYRDNLQHLREVDLMGSSISGLGISRLLSHLQPNNIRIFNLGDCP
                     FIKLQRTQSSTDCCVLSPYHFLISVPYLESLLLPQLGALNDDTMKLFTEEVGNLENLK
                     NLDLSLNPSITGVSLFEFLTALKEIRSAPLEYLNIDGCPSISHITVKLLENKSLVQKV
                     DCIFERETWRRFGVNSLKYKS"
     gene            <416237..>417271
                     /locus_tag="HG536_0H02360"
                     /db_xref="GeneID:59328127"
     mRNA            <416237..>417271
                     /locus_tag="HG536_0H02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285639.1"
                     /db_xref="GeneID:59328127"
     CDS             416237..417271
                     /locus_tag="HG536_0H02360"
                     /inference="similar to AA sequence:RefSeq:NP_014722.1"
                     /note="ancestral locus Anc_5.688"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141535.1"
                     /db_xref="GeneID:59328127"
                     /translation="MAVGLVGVLLLASFLLVATFTIGWLPTQYVSRGVASSDQYIAIL
                     SRFGVGMLLGTSFTLVIPEGVDACLQHNGNVGINLLIGFMVVYILDRVVQMVMGASTG
                     FEVLQNGTPGLESFKDLLRNPKRVFLAVLKNNVVFALVIHGLSDGIALGTTVNNESLL
                     IVVLIAIIIHKIPAVLSLTSIMISKQRLPRWEVLSNLFIFALSTPLGYVVVSVFNLRH
                     SEAIDWIGGNLLLMSGGSLLYASFTAFTGGDSHDHMQLEESVEGGYLREGSAFVLVDA
                     NQPSASENATTNDTHKNNNLDTSAKNVTLMTPPPQTSKMAAEMSPSRELIYVLLGVAV
                     PTLISFTISD"
     gene            complement(<417351..>417998)
                     /locus_tag="HG536_0H02370"
                     /db_xref="GeneID:59328128"
     mRNA            complement(<417351..>417998)
                     /locus_tag="HG536_0H02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285640.1"
                     /db_xref="GeneID:59328128"
     CDS             complement(417351..417998)
                     /locus_tag="HG536_0H02370"
                     /inference="similar to AA sequence:RefSeq:NP_014721.1"
                     /note="ancestral locus Anc_5.687"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141536.1"
                     /db_xref="GeneID:59328128"
                     /translation="MSVSASKSRHVKFGDEDSDEVTKVVETRQTGMGQVSDSSDSEDD
                     EAPQEEGLASGMTKVEEQFKQREEALRREKQVLKEKRRKADAKFKEQQLTKGNRAKSG
                     SLQPDEESPEELPEDFFDKLEQEEAEKPIEQMPKHINFNEISDRQYTAEVKKQLEKKK
                     QKTLKKLRANTVKRGSFNVSLLSHQDSMSSMAPKKEASIMNSKDKWLRRKSIRRK"
     gene            complement(<418187..>419038)
                     /locus_tag="HG536_0H02380"
                     /db_xref="GeneID:59328129"
     mRNA            complement(<418187..>419038)
                     /locus_tag="HG536_0H02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285641.1"
                     /db_xref="GeneID:59328129"
     CDS             complement(418187..419038)
                     /locus_tag="HG536_0H02380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141537.1"
                     /db_xref="GeneID:59328129"
                     /translation="MGRTVATGLNTPQPEPKLAEHVLDMFSLRGKVASVTGASGGIGY
                     EVAIAFAQAGADVAMWYNSNPEIANEVEELSKKYGVTVRAYKCCLTNGKEVQETVERI
                     ERDFGGKVDIMVANAGVPWHKGALLDLAEKSAEECDSEWRKVLAIDVDGVYNVAKSIG
                     RVFKRQGHGSLILTSSMSAHIVNVPQCQVAYNAAKAAVLHMSKSLAVEWAGFARVNSV
                     SPGYVATPLTAGQTQEMVDTWCTLVPMGRLAIPKEMVGAYLYLASDASSYATGTDIIV
                     DGGYCCA"
     gene            <420121..>421086
                     /locus_tag="HG536_0H02390"
                     /db_xref="GeneID:59328130"
     mRNA            <420121..>421086
                     /locus_tag="HG536_0H02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285642.1"
                     /db_xref="GeneID:59328130"
     CDS             420121..421086
                     /locus_tag="HG536_0H02390"
                     /inference="similar to AA sequence:RefSeq:NP_013014.3"
                     /note="ancestral locus Anc_5.686"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141538.1"
                     /db_xref="GeneID:59328130"
                     /translation="MSEPYEARVSSINAEADDIDESFLADLSNFSDADDSREDENFLD
                     MYNLTPKERLLHTIRRSINGLSDQFYRLALWKRVLIGIFTACIAVLAILMLIFHNSIL
                     QKVVEMSDDLKDKRITPLVLVLLIFSVGFPPMIGFSLLSTCTGLIYGVSFQGWLILSL
                     GAVLGSIASFCLFKTLLQSQAQKLVHSNRRFEAFAAILQENNSYWVLALLRLCPFPYS
                     LTNGAIAAVYGISVRNFSIAQAITTPKLLIYLFIGSRIRSMGEDESAGSKLFDLMSII
                     IAVAAFTVTAWVLYAKTQRKFAEILRRERQLNSSSDLVFDPSFEV"
     gene            complement(<421101..>421829)
                     /locus_tag="HG536_0H02400"
                     /db_xref="GeneID:59328131"
     mRNA            complement(<421101..>421829)
                     /locus_tag="HG536_0H02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285643.1"
                     /db_xref="GeneID:59328131"
     CDS             complement(421101..421829)
                     /locus_tag="HG536_0H02400"
                     /inference="similar to AA sequence:RefSeq:NP_014720.1"
                     /note="ancestral locus Anc_5.685"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141539.1"
                     /db_xref="GeneID:59328131"
                     /translation="MGKAEFGTAKYLSNKMKARGLQKLKFYCQVCQKQCRDENGFKSH
                     IRSPFHMKNISKVSNTDIARYTEQFEQDFLRLLRLSHGEKQIGVNKFYNEFIQDKHHI
                     HMNATRFSSLTKFIQYLSKEGKVKVTGLDSLAEDEIDPSQLLISYIDKSQQNLLRKAE
                     LKELDENQESEQQMKSRLLQRQIELGQKEETAEDEIKSESATRSRLPQRAIHVNLKDT
                     MKKAGGSSKKTKTMRGKVHKNVFM"
     gene            <421933..>422985
                     /locus_tag="HG536_0H02410"
                     /db_xref="GeneID:59328132"
     mRNA            <421933..>422985
                     /locus_tag="HG536_0H02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285644.1"
                     /db_xref="GeneID:59328132"
     CDS             421933..422985
                     /locus_tag="HG536_0H02410"
                     /inference="similar to AA sequence:RefSeq:NP_013013.2"
                     /note="ancestral locus Anc_5.684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141540.1"
                     /db_xref="GeneID:59328132"
                     /translation="MNVQFREVNSRMAFKQLDMLRNLFRRFPNHSGHTRSYSQFTYKR
                     FNNGNGNTFRHLLFDPSSRKYLAIVFGGGSLFYLTHLEEAPISGRRRFIWIPPSLELM
                     IGKYTYKSVLRQTGNAILPQNDPTTRRVARVFERIVEAAHKDSTVDKSLLKDIDWKIH
                     VVNDPAAPPNAFVLPGGKVFVFSSMLGICQNDDGLATVLSHEFAHQLARHTGENLSKA
                     PAYTILSIFLYTLTGVDTFNNILLDGLVRMPASRQMETEADYIGLMIMSRACFNPEES
                     IRLWKRMADFESRNFGGAANFEFLSTHPASERRIQNMAQWLSRAHELYDEADCRSLRQ
                     HWQQWRSNTPIIFSGF"
     gene            complement(<423026..>426298)
                     /locus_tag="HG536_0H02420"
                     /db_xref="GeneID:59328133"
     mRNA            complement(<423026..>426298)
                     /locus_tag="HG536_0H02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285645.1"
                     /db_xref="GeneID:59328133"
     CDS             complement(423026..426298)
                     /locus_tag="HG536_0H02420"
                     /inference="similar to AA sequence:RefSeq:NP_013012.3"
                     /note="ancestral locus Anc_5.683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141541.1"
                     /db_xref="GeneID:59328133"
                     /translation="MEKEDEELCKWIQLNSQSKVTGNFLTTLRKLAKSCEGDADAFIA
                     GCKALGKFNQSEDFLPRLFVKIKGTTNNALSTARKPMKVSSSRFRSVLPLGTDDESDE
                     EMVVKPIRGLPQLKEVSFKRIERKEANRLKSYAEPEQPQKAPKEIHSPTKNVVEVPKL
                     QTYLDESSYHDRDPVLSGDHSESAEESDYLSSGSQVLVEEREWYNNDDDYGNPVPDEI
                     GPGQELDFKGTNRRSDRYVHRTDDILDASIQLYPLPLAERKQLIPQFLRRYGVMHGIS
                     ESVIVGSLLESSQQGIVSPFQNPESTFSINARRGSRLVALKRLQKDQKDKARETAQIA
                     GTVLGDVLGVRDKQTLSSQEHESFKDKSASREEIDKIRKSLPAYTVKAKLVQTIQENQ
                     VTIVIGETGSGKTTQLPQYLFDGGFCSGGKLIACTQPRRVAAMSVAKRVASEMGVKLG
                     EEVGYSIRFEDETSDKTLIKFMTDGILLREALLDPTLDRYGCIIIDEAHERSLNTEVM
                     LGLLKRLLARRRDLKVVVTSATMNAAKFANFFGNAPQFDIPGRTFPVQLIYSKYPVED
                     YVEAAVMQAVRIHASTETNSGDILIFMTGQEDVEVTAEVIRERLTDIYAKSKGIARFE
                     EIDDVKIFTVYSALPGDIQNEIFHSLSGNKRKIVVATNIAETSLTIDGVRHVIDCGYS
                     KLKVYNPRIGLDSLVVSPISLANANQRSGRAGRTAPGTAYRLYTEETAFEDMYAQAIP
                     EIQRTNLSNTVLLLKSLGVDEVTKFPFVDPPPIQTLLSSLNELFFIGALDKGGNLTTL
                     GSEMAKFPLQPSLCKILLSSAQNGCSQEMVTIVSMLSVPQIFYRPKERQKESDAARSR
                     FFVPESDHLTLLNVYSQWKSSRYSHRWCSKHFINFKSLQRAREIRRQLVKIMQKNHIT
                     LISTGTDWHTIRKCICSGYAHQAAKVAGLGKYTSLRTGMELQLHPTSALYGLGDLPPY
                     VVYHELLMTTKEYICCVTSVDPFWLMEYGTLLYDIKKVNIADIVRHPIEYNICEEDAK
                     DQEKDNEIDRKLQALRDAKDLMIRELNVDIAEPDGTPVNIQKKKRTNSVQVGFKRRRP
                     FP"
     gene            <426547..>427161
                     /locus_tag="HG536_0H02430"
                     /db_xref="GeneID:59328134"
     mRNA            <426547..>427161
                     /locus_tag="HG536_0H02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285646.1"
                     /db_xref="GeneID:59328134"
     CDS             426547..427161
                     /locus_tag="HG536_0H02430"
                     /inference="similar to AA sequence:RefSeq:NP_013011.1"
                     /note="ancestral locus Anc_5.682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141542.1"
                     /db_xref="GeneID:59328134"
                     /translation="MWSFTRNLHVSSMRAKGVAKFIDTSKNIPQLRSTPTIYNSKSSA
                     SNPKGYMKAKIPGGLYFQPAQSSPTGSINSETYPASFLPASDSRRSLIEELRAEDRLK
                     GDHAPPVLTSKSTMGDKTYHLKPADVAEIQRLRSENPEVYTRKALAQQFKVSPLFISL
                     VSDAPTQRKQEMASRLDQIKSQWHEKRRAARSDRIKRKQYWYRP"
     gene            complement(<427281..>427775)
                     /locus_tag="HG536_0H02440"
                     /db_xref="GeneID:59328135"
     mRNA            complement(<427281..>427775)
                     /locus_tag="HG536_0H02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285647.1"
                     /db_xref="GeneID:59328135"
     CDS             complement(427281..427775)
                     /locus_tag="HG536_0H02440"
                     /note="ancestral locus Anc_5.681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141543.1"
                     /db_xref="GeneID:59328135"
                     /translation="MSTVTASITDCGGSSATSKSKRTVKARTRQFTSAFLYNVPPSAL
                     TGEKSNNCKQCKLFQGTVFVEELLNVNEVGSVDHVPSYQFRFGWRPDKLFCETEIIDN
                     IHKMNEVIKTWGDCFRVMMQCSMNRYVLLELKFRDFDQERGFRDLVCRINDEFEILAE
                     LMWD"
     gene            <427963..>428307
                     /locus_tag="HG536_0H02450"
                     /db_xref="GeneID:59328136"
     mRNA            <427963..>428307
                     /locus_tag="HG536_0H02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285648.1"
                     /db_xref="GeneID:59328136"
     CDS             427963..428307
                     /locus_tag="HG536_0H02450"
                     /inference="similar to AA sequence:RefSeq:NP_013010.3"
                     /note="ancestral locus Anc_5.680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141544.1"
                     /db_xref="GeneID:59328136"
                     /translation="MPSYADDDDAIDYENEMPDFQDEAEFDDYLNDEEFDLMNELFPK
                     AKKEMQEYQGWDNLAVKLAIFDADFNLDEALTELRKAYKKKKKQPIAAAQPLNPPNGM
                     YFAWRFEHFIIA"
     gene            complement(<430744..>431730)
                     /locus_tag="HG536_0H02460"
                     /db_xref="GeneID:59328137"
     mRNA            complement(<430744..>431730)
                     /locus_tag="HG536_0H02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285649.1"
                     /db_xref="GeneID:59328137"
     CDS             complement(430744..431730)
                     /locus_tag="HG536_0H02460"
                     /inference="similar to AA sequence:RefSeq:NP_014718.1"
                     /note="ancestral locus Anc_5.679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141545.1"
                     /db_xref="GeneID:59328137"
                     /translation="MANLTSLFREYVKIIEENDDRQAVAPEHKVWRVKQYEIRDSFMK
                     ECFQLLQLLLELRKVLKIAEPQYMGDKDMTEEEKDDFDTEFRLQLHQYVQKFKLLEKY
                     EQQRQQLVAEKILEHNTHTFHLFKSGLDDDEMALYHASNNEFRSGVLRSLSMLLNVVS
                     SLFSSMQQERLATQRKFEAFDLNSRPDQLNEVVSISSVSQSKAVESAQEELKIYEDTL
                     SKLTQEQVQMLETEHEGLLAQKDEQLKKIEMINRTILDIVSLQSDISSNLQAQSQNIN
                     SILDSQDDIDINIKEGNKQLTRAKRSASRAARMTVVIAIILGVLILFLDYVG"
     gene            <432011..>432940
                     /locus_tag="HG536_0H02470"
                     /db_xref="GeneID:59328138"
     mRNA            <432011..>432940
                     /locus_tag="HG536_0H02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285650.1"
                     /db_xref="GeneID:59328138"
     CDS             432011..432940
                     /locus_tag="HG536_0H02470"
                     /inference="similar to AA sequence:RefSeq:NP_014717.2"
                     /note="ancestral locus Anc_5.678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141546.1"
                     /db_xref="GeneID:59328138"
                     /translation="MTAQETEKRGAAASNLEEQQYLGLCKKIIEEGEFRPDRTGTGTL
                     SLFAPPQLRFDLAGDVFPLLTTKKVFTKGIILELLWFISGCTDGKKLSEQGVRIWEGN
                     GSREYLDKLGLHDRREGDLGPVYGFQWRHFGADYKTCDDNYEGQGFDQLADLIKKLKT
                     NPYDRRIILSAWNPPDFPLMALPPCHVFSQFYASFPQDGGKPRLSCLLYQRSCDMGLG
                     VPFNIASYALLTRMIAHVCDMEPGEFIHTMGDAHVYKDHVDALKEQMGRTPNEFPKLR
                     IKRKVDNIDDFKYEDFEIVDYHPHGKIQMKMSV"
     gene            complement(<432990..>434792)
                     /locus_tag="HG536_0H02480"
                     /db_xref="GeneID:59328139"
     mRNA            complement(<432990..>434792)
                     /locus_tag="HG536_0H02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285651.1"
                     /db_xref="GeneID:59328139"
     CDS             complement(432990..434792)
                     /locus_tag="HG536_0H02480"
                     /inference="similar to AA sequence:RefSeq:NP_014716.1"
                     /note="ancestral locus Anc_5.677"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141547.1"
                     /db_xref="GeneID:59328139"
                     /translation="MARTLRRKTKDNGDGGKVEGAGEMTVAANNGESIPQIQELQNLM
                     DFQKNKVEAIKASYSQQNTQLARANSSLMVKLSEIENKISELVQENVTLRSKVSIGEM
                     NYKRRLSEQLDVLESGISHRVEEIFLMFDSVRAKEGLTCSDKSGQLRSILRKRRSLGS
                     SQGDNKSANSIQFLDAANQVIGAPELEASASNGDSAANQEENAARRKRRKSSRRESIF
                     LPEDFELPSQEPVSNPSEGGVDEENGENDHGGMELLSIIDGLNEQEAGQAILQPTNDI
                     ELPSEHNEQNAHADGSFSFTNSIIDYSIPEETAPSATTNTEQSSSSKIEVFRDEPESK
                     SSSQNGEDRKEQTFVPLSSQSKAKHSRRAPTARSRKSMVDEVMPTTNNGNAACDIEFT
                     RIRRTRGKAIDYKLPSLRAKMRRPTEKLVDATTFTNIHELQVTNARRSYKKSSNRKGA
                     SATTAAALKETVIAGDAWHKDARDQSRKDKEAGKLEQEHNCNQPSSKGPLPERVGVQR
                     EKATTECQPILKDITNRPKISKTRKLLKSAIINDICDNNVGMSDDTTDSLGSNGSSFR
                     LNEEDLSVFDLIGSDKAKPTNKTYRAKSRKLITK"
     gene            <435049..>435402
                     /locus_tag="HG536_0H02490"
                     /db_xref="GeneID:59328140"
     mRNA            <435049..>435402
                     /locus_tag="HG536_0H02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285652.1"
                     /db_xref="GeneID:59328140"
     CDS             435049..435402
                     /locus_tag="HG536_0H02490"
                     /inference="similar to AA sequence:RefSeq:NP_013009.1"
                     /note="ancestral locus Anc_5.676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141548.1"
                     /db_xref="GeneID:59328140"
                     /translation="MSMESQIALKKRELEALKRITSLTDEMKQQLDGLAGQVRQMESN
                     AETVSEVMRNWNSIMRSISQAGLSLLQYAEGDYEVGAWAPEARENDGSQSREPTRTTP
                     LPETLVRIRVDETEN"
     gene            complement(<435451..>438906)
                     /locus_tag="HG536_0H02500"
                     /db_xref="GeneID:59328141"
     mRNA            complement(<435451..>438906)
                     /locus_tag="HG536_0H02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285653.1"
                     /db_xref="GeneID:59328141"
     CDS             complement(435451..438906)
                     /locus_tag="HG536_0H02500"
                     /inference="similar to AA sequence:RefSeq:NP_013008.3"
                     /note="ancestral locus Anc_5.675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141549.1"
                     /db_xref="GeneID:59328141"
                     /translation="MSAGRPLFQLRKEIDTSAALPENDVEADDSTNSVLNNASTSGYY
                     SSLMESSNECHHSQGRFNNERILTENDKYVVKRLAPDLSSRPLEGDKIEGVVDTFLGK
                     ALVGDVNNLYIWDYHSTQKHVNVSRIPLHQEHEVLNVAPKCLFTRPSAIDESTQMLID
                     GSAGSSGGVCIIHRKNSEFIYYEDIESINNLHLQLSKNKAHSLNLHLKDGETVTIATN
                     CEPAGIVIATSFGRVLFATIRDSSGKPKVQLKQQLIKSQRGLLFRSFSRYKEVISVKN
                     GPIVGRGERLIYVVTKEGNFQTWHLSVGINCFRRVEVNVFQQILDSLQDLYPFAHGTL
                     QILDSHPLFADLASAHLILSSIQNDKETYYILTTILLDEKTKSFTIFSTYRLNTYVLP
                     FDDSHKPQLYVPSSLEAETRPTTTVFILFSDAVVLTQVSSNLDSTYSFRRKWEDIISF
                     RSDVKIIGSGFNSESLYLMDNQISVFEISLIDKGETANSDDIGFIKSHIDQAVYFSKV
                     YSSPIEFNLPKELTLENEEVEKDLRSSGNEIFFSTGKYIPPMLNTLGQHLRLRMELYD
                     NLLNFVSDNFNYKISPFTKLDLLERYEIMKCCYSLLEILERSSDLAGIWSYILSGCEN
                     GLKMEDLVRNHLDKFPHLFTEFLSEVATRSASLASDTFRVETALFLSNCFYDAVLDQG
                     ERVLRYGTLNLDPLELNRELPWFSNLRILKAVNSIFFDFKFSLTTVTEKEEQWLIVMI
                     KILYYCFHQANLWFNESENRKESPLYNEIQVLYESNHLSWAQVLCEYGLQEFSIQIAD
                     FYNDMGSLVETLETLDFSSSKDVYDKYFSKMGYEFAATLFNYYVEHNKLKELFTRFPE
                     QHTFLLRFLGSSEQYGDVAWIQDILDERYDQATNTLSQIAVGDAGLKESVGKRQFHLS
                     IAKLSALVQDNGQLNDTKINRIQEDLDIIDGQNDLFHRISEIGIKIASRFEHTELDSV
                     FALLAEKLKAKNCLKLELIVEMYSMLNDAEAPYCALKLLAFENNTLSHETKRFLISTV
                     WRRCVLTEHQWSNVTDATQTVLYRVLRRFFEEELYVSGCPLPSLELLTDRALLNKAYL
                     TELYQGLDVNLDKIHAILEKELESVQQHGHDFEDRIKSIIGTALEASGNKCPVNYESN
                     TVEYC"
     gene            <439214..>440275
                     /locus_tag="HG536_0H02510"
                     /db_xref="GeneID:59328142"
     mRNA            <439214..>440275
                     /locus_tag="HG536_0H02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285654.1"
                     /db_xref="GeneID:59328142"
     CDS             439214..440275
                     /locus_tag="HG536_0H02510"
                     /inference="similar to AA sequence:RefSeq:NP_013007.1"
                     /note="ancestral locus Anc_5.674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141550.1"
                     /db_xref="GeneID:59328142"
                     /translation="MIRTVKPKNARSKRALKERESKLVENVKQALFIPGQTSSKLLHD
                     VMVDLGALKKPDIKRFGKNNNIRPFEDHTPLEFFSEKNDCSLMVLATSSKKRKNNLTF
                     VRTFGYKVYDMIELLIAENYKLLSDFRKQTFAIGIKPMFSFQGSAFDTHPVYKHVKSL
                     FLDFFRGTVTDLQDVAGLQYVISVTIQGDFQDGEPLPNVLFRVYRLRSYKSEQGGRKL
                     PRVELEETGPRLDFKIGRIHSPSAEMEKEAFKKAKQLEMKTPKNVETDLMGDKLGRIH
                     MGKQDLGKLQTRKMKGLKSRFDQDDQDEMEDYINDNEEGLNHVKRDNDEVDDDTYGED
                     FVTAPDIEEDQPAAKKQKK"
     gene            complement(<440344..>441321)
                     /locus_tag="HG536_0H02520"
                     /db_xref="GeneID:59328143"
     mRNA            complement(<440344..>441321)
                     /locus_tag="HG536_0H02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285655.1"
                     /db_xref="GeneID:59328143"
     CDS             complement(440344..441321)
                     /locus_tag="HG536_0H02520"
                     /inference="similar to AA sequence:RefSeq:NP_013006.3"
                     /note="ancestral locus Anc_5.673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141551.1"
                     /db_xref="GeneID:59328143"
                     /translation="MSESDAVKPGATILASKVAKEYADEITKKVETMKDIRPQGPLLV
                     GFLANGDPAAEMYASWTKKTCESMGFRYELRRIDDKDFLEEAIIEANRDDSVDGIMVY
                     YPIFGNAQDQYLQQVVAREKDVEGLNHVYYQNMYHNVRFLDEEKQLKSILPCTPLAIV
                     KILEYLKIYNTLLPEGNRLYGKKCVVVNRSEIVGRPLAALLANDGAIVYSVDVNNVQK
                     FTRGESLKFTKHHVEDLGPYSDALLKECCSDADVIITGVPSEKYKFPTEYIPDGAVCI
                     NFSSSKNFDDSVKKKASLYVPMTGKVTISMLLRNMLRLIENTEKLKAKN"
     gene            <441775..>443589
                     /locus_tag="HG536_0H02530"
                     /db_xref="GeneID:59328144"
     mRNA            <441775..>443589
                     /locus_tag="HG536_0H02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285656.1"
                     /db_xref="GeneID:59328144"
     CDS             441775..443589
                     /locus_tag="HG536_0H02530"
                     /inference="similar to AA sequence:RefSeq:NP_014713.1"
                     /note="ancestral locus Anc_5.672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141552.1"
                     /db_xref="GeneID:59328144"
                     /translation="MGLRSSSKEMRQKEHGGDSGQLHRNNSGTNLVSTLMKSWKISSL
                     QSPSPQRNSVSSLDTSMGADGNFDAMSRQQMSARSNSNCSPLRYVSPGRSSGGGSGSR
                     SESPRTSRSHGSRLNHGSGNNGSGKKSVRYFKDLDEDWSAVIDDYNMPIPVIANGGVA
                     SPTTPKLTRASSMTSTPNNSSSNVATKNGRTSFSYPQLPQLQKSYSSELRSQLELENE
                     RDAQELSAIMQRIAKFDAILKNKHIINQQELRQISWNGIPKLHRSVVWKLLIGYLPAN
                     SKRQEPLLRRKRKEYRDGLAHTFSSQHSRDIPTWHQIEIDVPRTNPHIPLYQFESVQK
                     SLQCILYLWAIRHPTSGYVQGINDLVTPFYQTFLTEYMPKSQIDDVEKLDPESYMSPE
                     QLRDVEADTFWCLTKLLEQITDNYIHGQPGILRQVKNLQQLVKRIDRDLYDHFKKENV
                     EFIQFAFRWMNCLLMREFQMSAVVRMWDTYLSETSVETSGSSTDLMPPHTPTEPIRAT
                     FQSPVKEFASPTSSSGTAGDEVPKMRQSSLNEFHVFVCAAFLVKWSDQLLEMDFQEII
                     TFLQNPPTKDWKESDIEMLLGEAYIWQSLYKDATSHWQ"
     gene            <443980..>446436
                     /locus_tag="HG536_0H02540"
                     /db_xref="GeneID:59328145"
     mRNA            <443980..>446436
                     /locus_tag="HG536_0H02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285657.1"
                     /db_xref="GeneID:59328145"
     CDS             443980..446436
                     /locus_tag="HG536_0H02540"
                     /inference="similar to AA sequence:RefSeq:NP_013005.1"
                     /note="ancestral locus Anc_5.671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141553.1"
                     /db_xref="GeneID:59328145"
                     /translation="MYSLTPVTQPTADTKHPLLLLQSHHGDRYFFGMLAEGSQRSLTE
                     NRIRVSKLQNIFLAGRLDWSAIGGLPGMILTLADQGKDSLTLHYGSDILDYIVSTWRY
                     FVFRFGLSLRTNVMKDQQVYKDSLLSVKSIVIQGGDLGVNSKEGGLFTEEEKSVLQSI
                     VSNMFPKHAPTSRYDPSSDLHLNVELPNGFEMPQTTTSYEISFKPVRGRFKPEEAIRL
                     GVPKGPSFGKLASGQEVILPNGTIVKPEDVLEKERHFPKVLVLALPDDSFVQSFQERF
                     RNYPCEDLGLVYYFLGEDVTINEQIIRFMELFGESIQHVVSHPKVCPNSIAFKGAAMT
                     VLKLKAMQMDCYNLPRTETVLSKEFYECFDKKLEEGTTLHQVQETPVTSKIPTSQVHV
                     FTQNSEIQIESFTKGDEKMKIKLDQTPVKAWSWEYAFKKHVKPLNLCPASVEQAMQAK
                     GDYNNFNTAEKSQNVEIMTLGTGSALPSKYRNVISTLLKIPYAAAEGKMKNRMVLLDA
                     GENTIGTMRRNFSSTALQTIFKDLSLVYLSHLHADHHLGIISILKEWYKHNKHKDESL
                     LYIVTPWQYNKFVNEWLLLEEPDLLKRLKYISCEHLINDSYLRRETRPLSLDEYLDVF
                     RSKKQKRRKLEVNPNSSLRELPAIRSMLRDLNIASFQTCRAKHCNWAYSCSITFFVNS
                     FSRRVFKVSYSGDTRPNIEKFSKEIGYRSDLLIHEATLDNELVEDAIKKRHCTINEAI
                     QVSNEMEADKLILTHFSQRYPKVPQIDNNVTVKANEYCFAFDGMIVDFEKLGEQKAIF
                     SKLNKAFLEERKEEEQEQTL"
     gene            complement(<446507..>448456)
                     /locus_tag="HG536_0H02550"
                     /db_xref="GeneID:59328146"
     mRNA            complement(<446507..>448456)
                     /locus_tag="HG536_0H02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285658.1"
                     /db_xref="GeneID:59328146"
     CDS             complement(446507..448456)
                     /locus_tag="HG536_0H02550"
                     /inference="similar to AA sequence:RefSeq:NP_013004.3"
                     /note="ancestral locus Anc_5.670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141554.1"
                     /db_xref="GeneID:59328146"
                     /translation="MDYEEDLNAPVWDELGAKDEPAIAELGERFNSLSNKDQIQDTNN
                     ELPEAAKTVAEGAQAWNSTNQEKKENLLKKLAPEEDPLLDIQTTVKESNIDSPVKAKE
                     EPLFSGSTYIAFPELSDVSAQGDETNEAPSSGSHRSSTKPQVLFNSARIRRRPLSSHA
                     LDRNATTEAKISDPLGEIKKQEEFVDESLEEQQVPESAGSAKGTSILQQVNEPLFKLS
                     PRKPSGVKDNEETLESDVSGVTKKDEEESKLIEFNIEVKDPVKVGELTSMHVEYTVES
                     RSEVFEGSYAKVIRRYSDFRWLYRQLQNNHWGSIIPPPPEKQTVGRFKQDFIENRRCQ
                     MERMLRRIAGKASLQSDPDFLLFLKSEQFASDAKKREHITGSGASNDSNDLSEIYISE
                     IQLLGAEDAATVLKNGGLDAESQKRFMNISFSSPPKYVEVDDFFVEQRQNIDLLEEKL
                     SQLDKSLVSVDCQRNELASVTEEFARTIDSLATLEVTKKSSDLLTNFAQTHRRIKESL
                     ERTSLQEALTLGITLDEYLRLLSSLKAVFNQRAKLGQYLAIVEGDMTRKQSSLERLQK
                     NSGQSSLDKLSTNKNEYLVLKRRFEIIKKSWQDVGNRIKVEISSFDAEKVKDFRNSME
                     IFLESAIEGQKEAIELWETFYQNNL"
     gene            <448613..>450313
                     /locus_tag="HG536_0H02560"
                     /db_xref="GeneID:59328147"
     mRNA            <448613..>450313
                     /locus_tag="HG536_0H02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285659.1"
                     /db_xref="GeneID:59328147"
     CDS             448613..450313
                     /locus_tag="HG536_0H02560"
                     /inference="similar to AA sequence:RefSeq:NP_014710.1"
                     /note="ancestral locus Anc_5.669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141555.1"
                     /db_xref="GeneID:59328147"
                     /translation="MEGTALRDGKASEKREVERPVSVMNRRFSLWNFWIASLALKLLL
                     MPDYYSTDFDVHRNWLAITRNLPLKEWYYESTNQWTLDYPPFFAYFEWFLSLLVPGKV
                     RNDGCLDIVEVGEFGWPTVVFQRLTVIASEVLLFVVLQVYINTSSTSEKTRSFVVASS
                     IALSPGFLIIDHIHFQYNGFLFAILIASIVAAKHKRYMWCATFYAISLCFKHIFLYLA
                     PCYFVFLLRAYVLNFKDFQFKSYKDLIYIVQWRHLLKMGSAVIGVFLLCFGPFISDMP
                     QLLSRLFPFSRGLTHAYWAPNFWAVYSLLDRVLAFVMLKLPYVHKFATKFISPPLIPE
                     SLEELRQILLEKNSGTKGLVQEVSFTILPQITPKLTFILTVFYQALAVIPLLFDPSFK
                     RFIGSLTLCGLSSYLFGWHVHEKAIMLVIIPFSFLVVCDRRLLSSFMLVTAAGYVSLF
                     PLLYENQDFLLKCLYTIAWCIIYFYALRKTSQLTTSVERRVFFLDRLSTIYIFLLVVL
                     VFGVQFFEVMNWRYQSFQKFEFLGLMAYSVYCSLGVISSWIGLSWMFNFDEPLWMTNE
                     "
     gene            complement(<450493..>452115)
                     /locus_tag="HG536_0H02570"
                     /db_xref="GeneID:59328148"
     mRNA            complement(<450493..>452115)
                     /locus_tag="HG536_0H02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285660.1"
                     /db_xref="GeneID:59328148"
     CDS             complement(450493..452115)
                     /locus_tag="HG536_0H02570"
                     /inference="similar to AA sequence:RefSeq:NP_013003.1"
                     /note="ancestral locus Anc_5.668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141556.1"
                     /db_xref="GeneID:59328148"
                     /translation="MEKPARKRGRPPITKEYSNPLESPMAHSSIKVQKLGAQSFSRPM
                     MKVGQTTPSPRKRRRSSSYGVSCHNDSSRSATGSTAKRGRYRGVLLTTPTKKTSTNRS
                     ATASSTPSSTDSIFQSSSKMSLKSSPPVPIWSSHEEKGASDAFQQFKFALTIGENGRA
                     TIAGSSPNTSPGKAEVEHKVSEVSQSQKAQSGISATEKNRVLSLLRQMRNTTATTGKN
                     KSSDASNTFECVKKTARETNEKANMVDSPSTMLKSPQPPSTPRVSFAVKTGFTPNAGL
                     DQVLLDIVSTPKAGLFSGGDSNLTGLGQSTNIITFSPKNRTPIRGSSLLQHQRPRIGG
                     QNEEQRDKQEAQRQQYVFKFLSADPLLLTDDAEASWSEMNYSQSQPSHQQVCFNTPPS
                     WVNWGSPRAFTPQRQDSTGLSICQSRRVGSTAKERSTRQTSQEAEEPPPSIGHQGSVP
                     MIKKPTPAGNDTLPAIPTTPRSKGIPISAMIECTPLIQQTMNGSLTARFVPGLLTGEA
                     TTDTIKDSIKLATTSPEQEDARAALQKLIAEK"
     gene            complement(<452543..>453649)
                     /locus_tag="HG536_0H02580"
                     /db_xref="GeneID:59328149"
     mRNA            complement(<452543..>453649)
                     /locus_tag="HG536_0H02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285661.1"
                     /db_xref="GeneID:59328149"
     CDS             complement(452543..453649)
                     /locus_tag="HG536_0H02580"
                     /inference="similar to AA sequence:RefSeq:NP_013002.3"
                     /note="ancestral locus Anc_5.667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141557.1"
                     /db_xref="GeneID:59328149"
                     /translation="MSKKWADDESGAFKRQVSSFQETISASHPVFKPAKNRYWLYVSL
                     ACPWAHRTLITRCLKGLTSVIGVSVVHWHLDDKGWRLLPGDKAADSAKDPRFYQPAGG
                     INGASRDHSGPHGEILNESSRLFEDGSFDPINHFERLSQLYYKQDPNYSARFTVPVLW
                     DTETQKIVSNESAQIIRTLNSGVFDEFVDEKFRGVNLVPSELEAAIDEFNGWVYDNIN
                     NGVYKAGFAENPVVYEKEVTNVFKHLDRVEAILKEKYDNLVSQYGRDDLKSILAKYYT
                     VGNQLTEADVRLYTTIVRFDPVYVQHFKCNFTTIRDGYPHINLWLKNLYWNHDAFKLT
                     TDFDHIKLHYTRSHVRINPLGITPLGPKPDIGTL"
     gene            complement(<454046..>454954)
                     /locus_tag="HG536_0H02590"
                     /db_xref="GeneID:59328150"
     mRNA            complement(<454046..>454954)
                     /locus_tag="HG536_0H02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285662.1"
                     /db_xref="GeneID:59328150"
     CDS             complement(454046..454954)
                     /locus_tag="HG536_0H02590"
                     /inference="similar to AA sequence:RefSeq:NP_014708.1"
                     /note="ancestral locus Anc_5.666"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141558.1"
                     /db_xref="GeneID:59328150"
                     /translation="MFSQFSKRVAQRGFSTATGLKAGSSLSKKFLVGGAIVGGVGAST
                     MLYADSLTAEAMTAAEHGLHAPAYGWPQNGPFETFDHASIRRGYQVYREVCAACHSLD
                     RVAWRTLVGVSHTNNEVRDMAAEFEYDDEPDEQGNPKKRPGKLADYIPGPYPNEQAAR
                     AANQGALPPDLSLIVKARHGGADYIFSLLTGYPEEPPAGVVLPPGANYNPYFPGGSIA
                     MARVLFDDLVEYEDGTPATTSQMAKDVTTFLHWCAEPEHDERKRLGLKAIIILSSLYL
                     LSVWVKKFKWAAIKNRKFVFNPPTKK"
     gene            <456382..>456945
                     /locus_tag="HG536_0H02600"
                     /db_xref="GeneID:59328151"
     mRNA            <456382..>456945
                     /locus_tag="HG536_0H02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285663.1"
                     /db_xref="GeneID:59328151"
     CDS             456382..456945
                     /locus_tag="HG536_0H02600"
                     /inference="similar to AA sequence:RefSeq:NP_014707.1"
                     /note="ancestral locus Anc_5.665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141559.1"
                     /db_xref="GeneID:59328151"
                     /translation="MDVRYSFLNTLEHYPCELIRGLWTLQSLDLQRTDAGVSHERDRW
                     LAMHMQSQSELLERLADEQIRALKSHRSQLIELQGVRKRCEAARRRQRRQMQHKTDKL
                     TIKLSLNSSKKSKRNVAEAPKVQNVKSAEEEPEQTYCFCNNVSYGAMIACDNELCPRE
                     WFHYGCVGITKPPKGKWYCSAECRKQA"
     gene            complement(<456995..>458158)
                     /locus_tag="HG536_0H02610"
                     /db_xref="GeneID:59328152"
     mRNA            complement(<456995..>458158)
                     /locus_tag="HG536_0H02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285664.1"
                     /db_xref="GeneID:59328152"
     CDS             complement(456995..458158)
                     /locus_tag="HG536_0H02610"
                     /inference="similar to AA sequence:RefSeq:NP_014706.1"
                     /note="ancestral locus Anc_5.664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141560.1"
                     /db_xref="GeneID:59328152"
                     /translation="MSHRKYEAPRHGHLGFLPRKRATSIRGRVKSFPKDDKSKPVALT
                     SFLGYKAGMTTIVRDLDRPGSKFHKREIVEAVSVVDTPPIVVVGVVGYVETPRGLRSL
                     TTVWAEHLSDEIKRRFYKNWYKSKKKAFTKYSGKYAQDGALVERELARIKKYATVVRV
                     LAHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVSVDSVFEQNETIDVV
                     AVTKGHGFEGVTHRWGTKRLPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHHRT
                     SINHKIYRIGKGDDEANASTSFDRTKKTITPMGGFVHYGEVKNDFVMVKGSIPGTRKR
                     VVTLRKSLYTNTSRKAVEEVNLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL"
     gene            <458965..>459828
                     /locus_tag="HG536_0H02620"
                     /db_xref="GeneID:59328153"
     mRNA            <458965..>459828
                     /locus_tag="HG536_0H02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285665.1"
                     /db_xref="GeneID:59328153"
     CDS             458965..459828
                     /locus_tag="HG536_0H02620"
                     /inference="similar to AA sequence:RefSeq:NP_013001.1"
                     /note="ancestral locus Anc_5.663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141561.1"
                     /db_xref="GeneID:59328153"
                     /translation="MASLDDTIISRQNLMLLDNVTNYRKPALDYFHHQFNSDALEMPM
                     TWTLLLKMRKHKLLRLPSCAIENDADYNTYLMRLHHCLWRRWSMEHFKLEKLKIDPLS
                     INWNKETDITVLYGPDLTGVMDEEPETSEDTCSVKGTQVERQCSTDSEEEELIGGGAR
                     AYTYSSSVDSHASSIFDDNTCMKMHSNSSTKSLKFSNTVLRRDIDRHGAFQETHIQIN
                     DAPEMPRHLRRHRKSHRRHRSRSRRHHDDETYGNGIFADEFISHSAPLNDDELLLEMN
                     ICNLRDQELYI"
     gene            complement(<459949..>460968)
                     /locus_tag="HG536_0H02630"
                     /db_xref="GeneID:59328154"
     mRNA            complement(<459949..>460968)
                     /locus_tag="HG536_0H02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285666.1"
                     /db_xref="GeneID:59328154"
     CDS             complement(459949..460968)
                     /locus_tag="HG536_0H02630"
                     /inference="similar to AA sequence:RefSeq:NP_014704.1"
                     /note="ancestral locus Anc_5.662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141562.1"
                     /db_xref="GeneID:59328154"
                     /translation="MPLPPSSLNQKSSRVYSVARVYKDACEKRPQEYWDYEQGVTIEW
                     GKISNYEIVSKIGRGKYSEVFSGKSVLNNQPCVIKVLKPVKMKKIYRELKILTNLTGG
                     PNVIGLLDIVQDPGSKIPALIFEEVKNVDFRALYPTFKLSDIQYYFTQLLIALDYCHS
                     MGIMHRDVKPQNVMIDPSERKLRLIDWGLAEFYHPGVDYNVRVASRYHKGPELLVNLN
                     QYDYSLDLWSVGCMLAAIVFKKEPFFKGSTNADQLVKIAAVLGTKQLLGYLNKYGLKL
                     PSEYDNIMRDFTPKPWSHFITGETKLAVPEIVDLIDNLLRYDHQERLTAKEAMNHKFF
                     KAEFE"
     gene            <461202..>461939
                     /locus_tag="HG536_0H02640"
                     /db_xref="GeneID:59328155"
     mRNA            <461202..>461939
                     /locus_tag="HG536_0H02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285667.1"
                     /db_xref="GeneID:59328155"
     CDS             461202..461939
                     /locus_tag="HG536_0H02640"
                     /inference="similar to AA sequence:RefSeq:NP_014703.1"
                     /note="ancestral locus Anc_5.661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141563.1"
                     /db_xref="GeneID:59328155"
                     /translation="MLTQIATLRFTLGSNYDNIVIRDVQLWREGRSCDQPVRHLTGTL
                     LQYVDLDKLPVWVTGSGTVATCFTASSTAVAYFTSKLRRERRGIVVQTGDEFLILHRE
                     KDQVRCLEVDLVAKARIDSQINALEAAAAAPTAAKDDNIDVVLRQSQERKSFSNEKVL
                     KKLHASEKRSQFNQTLSKLILGGLRLRGIPNSQSGFQKLYKMTFSAAEFSHRKQLQAL
                     AGNTGAEIPFEELQATVETLLELFTRF"
     gene            <462114..>463454
                     /locus_tag="HG536_0H02650"
                     /db_xref="GeneID:59328156"
     mRNA            <462114..>463454
                     /locus_tag="HG536_0H02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285668.1"
                     /db_xref="GeneID:59328156"
     CDS             462114..463454
                     /locus_tag="HG536_0H02650"
                     /inference="similar to AA sequence:RefSeq:NP_014702.1"
                     /note="ancestral locus Anc_5.660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141564.1"
                     /db_xref="GeneID:59328156"
                     /translation="MGSGKHLVVFIHGLWGNYKHMNSLNTVFERVLEGKQEFVFLTPR
                     QNAMFKTFDGIEIVGYRTLLEICQFIGTFKDEPITKISIVGYSMGGLIARFVIGKMYG
                     EFGKVFRDIEPQIFLTMATPHLGVEFYNLQKSTLKGIFQAVIRSLGSSILGKTGREMF
                     ITNSSNDVLVKLTQGEFLDGLSKFKWRAVVANVKNDRTVAFYTSFITDCDPFLATNND
                     VKYIFEDKVPGSHYSRTTPRIISMDRLDPELKRPKPKRDFSRWFKVLPLIALFITLIL
                     PVMFCLNILATIYSSIVTWRYRKLLQEGKLPLLIHNKLGLNDALKEYATDIYGSLMNE
                     EDAEVNDDESQDDIYANGGEEHVPWKEFIDKYSRVWSNTEQFPKLPLDENRRTMLKNL
                     DTLDWIRVPIYIKSANAHGGIVARKGLDDDVPDTSVACLEFTAQLAQYLLAHCN"
     gene            complement(<463488..>463922)
                     /locus_tag="HG536_0H02660"
                     /db_xref="GeneID:59328157"
     mRNA            complement(<463488..>463922)
                     /locus_tag="HG536_0H02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285669.1"
                     /db_xref="GeneID:59328157"
     CDS             complement(463488..463922)
                     /locus_tag="HG536_0H02660"
                     /inference="similar to AA sequence:RefSeq:NP_013000.3"
                     /note="ancestral locus Anc_5.659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141565.1"
                     /db_xref="GeneID:59328157"
                     /translation="MVDCDIEEPLTSGSKPLTSSTLTIRVVKSFPYRNVKNMVLQNYD
                     LQSKTARDLLDDCLERINKEGAFRPFRNVNYNRLKIYTHAHGSKTVNLVINFDHDEDW
                     VLDLQNNDKKLCQYGIENETEITLFNLEDYLKFKANPEEKWL"
     gene            complement(464057..464151)
                     /locus_tag="HG536_0Htrna12K"
                     /db_xref="GeneID:59328395"
     tRNA            complement(join(464057..464093,464114..464151))
                     /locus_tag="HG536_0Htrna12K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:59328395"
     gene            <466470..>469160
                     /locus_tag="HG536_0H02670"
                     /db_xref="GeneID:59328158"
     mRNA            <466470..>469160
                     /locus_tag="HG536_0H02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285670.1"
                     /db_xref="GeneID:59328158"
     CDS             466470..469160
                     /locus_tag="HG536_0H02670"
                     /inference="similar to AA sequence:RefSeq:NP_116582.1"
                     /note="ancestral locus Anc_5.658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141566.1"
                     /db_xref="GeneID:59328158"
                     /translation="MVSISATPSSIDMMKISSYSNGSPLTTTATSTNTLGPLIATPTA
                     NERMDLVCDSKDCMKLTPVNLKCLASPIRQSCFEVEEYNAHRSLVAGDVYKENFSLIS
                     RQLEKLLENLDVIFKTIGYSNSEIINKEKMVFNTLSNSINEFFEEAERDMKVLTEENE
                     SSQEILNRILEIIHDPSGLQSIPDLYVRNAILVPESKNVPGSPRKPLSLLSKQKLLTS
                     AKTYVFEAYLPKLMRYLQGCIQLMTVFEAIKEPLPNLPMANVMYFVPSPDVSKRLRDA
                     LKRCHNDVDLISTFIKENKQELLFSGKFSDISSEMTQKIFQSAAIYEEEYKKRLNEIV
                     STKTALEDLFKVLHIDLKNDLDPQTIDILSYYSGIKSVERLDRYLPVHQQVRNHLQET
                     IKKFQDIHRVRTESKEKLLNKCQNLWLKLKVPATYVESFLSQTAGLSLDSIKKVSQEL
                     EKLESMKKRIIKTLVNESWQKIEELWKILQYDEQEKSQFLLTFDTLRKSSSTLQDDEK
                     LLEACEKEIQILEKKLAVYTPVLQLIKEFKQLQADKASLDESSKDSSRLLLRNSHKIL
                     LQEEKTRKRITRHFPRVIQELKEGLCKIQRLFGKPVFLGNEKLIDIVTQQEEEIISKY
                     PRSRLNLGARKPSRVQIKHSPSKVEKPQPVVKKERCNDTLRDIVVTSLSAFHQTPLTK
                     ITKREPEAKFAAETPECASQSNSILQLSRFSSPPRTLRKLLPPRIITRQESSKIPEVK
                     LKRSESSNLQSSPIFRPKALGTKRELVRPTRLFAVSPNKINQRSSQIPVLHKSVSAIA
                     EMIGRISDKENIVDSTPRFQRKPSNEGVTLSSPYREPENSVYKISMSPDGKCQLNVKQ
                     GDIDSAYDETSIIDAENDKDFQTWKNEQLLKINEHSKDIL"
     gene            complement(<469243..>470367)
                     /locus_tag="HG536_0H02680"
                     /db_xref="GeneID:59328159"
     mRNA            complement(<469243..>470367)
                     /locus_tag="HG536_0H02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285671.1"
                     /db_xref="GeneID:59328159"
     CDS             complement(469243..470367)
                     /locus_tag="HG536_0H02680"
                     /inference="similar to AA sequence:RefSeq:NP_014700.1"
                     /note="ancestral locus Anc_5.657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141567.1"
                     /db_xref="GeneID:59328159"
                     /translation="MPVDKDLKAAYSVLYDDRDPLKALQLYDKILTDYPGNLMGTVYK
                     AAALEKLYYGFSGWHNDQTLENARQLLEDALKLSQARGDRSKVGLVYFRHFVHYFNDK
                     DYDRASSFMGKCKEYGYKDDTLPMWEAELDRKLKKRAKKQVPRAEDIRELPVKEAQQP
                     SAIVESKPVQVEEKLRTDWYQTSNDIVISLFTSRLPQSDKDVTVHVQAADKRSAEISY
                     LIPGSSSEFQYAIKLAHEVMPEGVAAKLFTKKLEITFKKKQNLQWKTLEDESPAQAAP
                     HTSVSNNSSTDVPLSYPSSSKKQIDWSKLDLDDENDDDSTSADAFFQKLYADADPDTK
                     RAMMKSFIESNGTALNTNWEDVSKKRVETAPPEGMEAKSW"
     gene            <470786..>472063
                     /locus_tag="HG536_0H02690"
                     /db_xref="GeneID:59328160"
     mRNA            <470786..>472063
                     /locus_tag="HG536_0H02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285672.1"
                     /db_xref="GeneID:59328160"
     CDS             470786..472063
                     /locus_tag="HG536_0H02690"
                     /inference="similar to AA sequence:RefSeq:NP_014699.1"
                     /note="ancestral locus Anc_5.656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141568.1"
                     /db_xref="GeneID:59328160"
                     /translation="MSTDAVAHVRALVLDATPLITQPYTHYQHYAQSFYTCPTVFNEI
                     KDTNARKNLEIWESLGVLRLRHPARESIDRVSAFAKLTGDYSVLSANDIHILALTYEL
                     EAELNKGDWRLRRKPGDSLDHLDEEKADQSEAVAQAAESQQDKPKKNRRRGGKKQRAK
                     REAREAEASAAQDSAASGDDEDADDGEWITVDNLTEVMIRDSGEDTTGARGVEATEKE
                     RIIALNAPKNQVALATGDFAVQNVALQMNLNLMNFMSGLKIRRLRNYMMRCHACFKLF
                     PLPKDGNPTHFCPSCGGQGTLLRCAVSVDGQTGEVTPHLKANFQWINRGNRYSIASPL
                     SKNSQRKYGNRGTVHSKPHDSDLIVREDQKEYQKALKQDEWTKKHNEKILNDWIGGGS
                     ADNYMSPFAITGLKSHTVRVGRGRNANSTRKKR"
     gene            <472375..>474306
                     /locus_tag="HG536_0H02700"
                     /db_xref="GeneID:59328161"
     mRNA            <472375..>474306
                     /locus_tag="HG536_0H02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285673.1"
                     /db_xref="GeneID:59328161"
     CDS             472375..474306
                     /locus_tag="HG536_0H02700"
                     /inference="similar to AA sequence:RefSeq:NP_012998.1"
                     /note="ancestral locus Anc_5.655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141569.1"
                     /db_xref="GeneID:59328161"
                     /translation="MTVPMKDKKTHGVISPRFVSAASKPNPDGSFSSPSILQAHSTHS
                     GAGSGASNADSAVPRASVSPGSSQTKSIMNVSGTSGAVISNSPEPGLKRVATVTFSDS
                     KFTSGKQGTTEPEGEQVAGKSTLAGESGDKSGGAGVGPQSITAERHKPAKSSPLLATN
                     KQVSPAKPKSSETKATSLVPEQKKINGLIAQEISGGKRPPISPKVGSAEEPYKENEDH
                     PHFYVEDPLHIPSTRSRSNSTSPKPPLGLTGTVGEQEGPRVVRPVEPTTLEAVLEENT
                     GQKIAPNIPKRENVKNIDARLPQDDGKLHILFGATGSLAVFKIKLMIKKLEEIYGRDR
                     VSIQVILTQSAERFFTKRYTKKYRGFDGVQRIGSETSVDSRLNSGLVPTSSNLGNGQQ
                     STSQQAQQSSPQDQHHIAHQRISSNPLVAPGTPTQGACSAAAQVELPPHIQVWVDKDE
                     WDVWEQRTDPVLHIELRRWADILVVAPLTANTLSKIALGLCDNLLTSVIRAWNPMFPI
                     FLAPSMVSSTYNSTMTKKQLKIIKEDMPWITVFKPSEKVMGIHGDIGLGGMMDGNEIV
                     DKVVMKLGGYPKDDKEEEEEDDDEEDDEEDESQDADKTKVDDQDDDDEEDDDDDDDDD
                     DDDDDDDDDENDQKQASTT"
     gene            <474705..>475640
                     /locus_tag="HG536_0H02710"
                     /db_xref="GeneID:59328162"
     mRNA            <474705..>475640
                     /locus_tag="HG536_0H02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285674.1"
                     /db_xref="GeneID:59328162"
     CDS             474705..475640
                     /locus_tag="HG536_0H02710"
                     /inference="similar to AA sequence:RefSeq:NP_012997.3"
                     /note="ancestral locus Anc_5.654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141570.1"
                     /db_xref="GeneID:59328162"
                     /translation="MTEAELGLLLIHPAVTTEPELLAKALEEAAASGVQIADQFLITK
                     INDKSVAVEDEKYDVIYYLTPEKRDAIKFPATLIPVLADALKPNGKLYGLPDTYKLDA
                     LINGFTTASEGRYHWVKSAVPQDTATAVPLKARANGGGAAKKLPSFKRASSPVQVAQQ
                     DNDNVLEDEYDDDNVNTSGKAKFFADLHNPPAELIEEEELVADSRDPTGITMITCGKT
                     KTRRKKACKDCTCGMKEQEEQEVDQVRKNQDAVVKFSEDELTEIDFTIEGKKVGGCNS
                     CSLGDAFRCSGCPYLGLPAFKPGQKINIGSILDDI"
     gene            <475830..>476258
                     /locus_tag="HG536_0H02720"
                     /db_xref="GeneID:59328163"
     mRNA            <475830..>476258
                     /locus_tag="HG536_0H02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285675.1"
                     /db_xref="GeneID:59328163"
     CDS             475830..476258
                     /locus_tag="HG536_0H02720"
                     /inference="similar to AA sequence:RefSeq:NP_014695.1"
                     /note="ancestral locus Anc_5.653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141571.1"
                     /db_xref="GeneID:59328163"
                     /translation="MNTDQVRVAEKPQEAAGGMSKEDLASVEKLGKTGTDTSSSSYGQ
                     ESISPAIVPTRSNTGLNSSKVSKKTSKKKKNACYFDKCSSAASKFIGDCNFCKGHFCS
                     KHRLMENHACEGLTSCKEAMHKRNADKLAREQTRVPKIQI"
     gene            complement(<476312..>477376)
                     /locus_tag="HG536_0H02730"
                     /db_xref="GeneID:59328164"
     mRNA            complement(<476312..>477376)
                     /locus_tag="HG536_0H02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285676.1"
                     /db_xref="GeneID:59328164"
     CDS             complement(476312..477376)
                     /locus_tag="HG536_0H02730"
                     /inference="similar to AA sequence:RefSeq:NP_012996.1"
                     /note="ancestral locus Anc_5.652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141572.1"
                     /db_xref="GeneID:59328164"
                     /translation="MIFKRLFQSSSRNIAFAFDIDGVLLRGRAPIPGASEALQLLHNS
                     KVPFILLTNGGGQLEEQRANFISKALDVPISPLQVILSHSPYKGLVNKYERILAVGTP
                     SVRKVAESYGFKDVVHQTDILRYRRDIAPFSGLSTEQLLEYSKVIPDIDSKRFDAVLV
                     FNDPHDWGADIQIISDAINSSNGMLDTVRDEQSSKPSIPIYFSNRDLLWANSYELNRF
                     GQGAFRHLVRKLYSELNGGLALEDNTLGKPTKLTYDFAHHVLIDWRQKLLAGDTASQE
                     QTLPVLGQPPEQSPFHDVYMVGDNPASDIIGAQQYGWKSCLVRTGVYRDGVPLNHVKP
                     TMIVNDVYEAVTAVLDAGSK"
     gene            complement(<477524..>479281)
                     /locus_tag="HG536_0H02740"
                     /db_xref="GeneID:59328165"
     mRNA            complement(<477524..>479281)
                     /locus_tag="HG536_0H02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285677.1"
                     /db_xref="GeneID:59328165"
     CDS             complement(477524..479281)
                     /locus_tag="HG536_0H02740"
                     /inference="similar to AA sequence:RefSeq:NP_012995.3"
                     /note="ancestral locus Anc_5.651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141573.1"
                     /db_xref="GeneID:59328165"
                     /translation="MTVPLIIASGCENEIHLLIGTANVSICMKRIKAIHESGATPVVV
                     QVSGESELKQLAQISHGTGLQVIDRDFRMSDLTSLGRPVVAKVVDRVFVNLPMTEYPL
                     AREIYELCVKMRIPINTLQRPEYSTFHMISTYNDPKGSGLQIAVTTNGQGCILANRIK
                     REIVASLPVNISEVVSNMGRIRSQIINEDQKELLEAHYEPTAELAVVENNWYGLNDDG
                     WESHKLNGLVEEFHMTERQQKLRRTRWLSQLIEYYPLAKLADVDVDSLNTATAEGASA
                     AETPAESTTTVSDMKDSLDRKGTELTTLIDNRTSDGREKKGSISLVGSGPGSVSMLTL
                     GALNEIKTADLILADKLVPQSVLELVPGETEVFIARKFPGNAEKAQSELLERGLEGLL
                     QGKKVVRLKQGDPYIFGRGGEEYLFFKQHGYEPQVLPGLSSALASTVVAKIPATQRDV
                     ADQTLICTGTGKKGALPAIPEFVSTRTTVFLMALHRAETLVQALLKQDWDEDLPAAIV
                     ERASCKDQRITRTLLKYVPQVVEEIGSRPPGLLVLGKAVAALLPQEDTEFSDTRKYYV
                     EQGLAGTDIEISSLADIIT"
     gene            <479947..>481182
                     /locus_tag="HG536_0H02750"
                     /db_xref="GeneID:59328166"
     mRNA            <479947..>481182
                     /locus_tag="HG536_0H02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285678.1"
                     /db_xref="GeneID:59328166"
     CDS             479947..481182
                     /locus_tag="HG536_0H02750"
                     /inference="similar to AA sequence:RefSeq:NP_014694.1"
                     /note="ancestral locus Anc_5.650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141574.1"
                     /db_xref="GeneID:59328166"
                     /translation="MAKRALGVGQKNKEKKRRLETETAKDSKDVTPGADQISVELDDN
                     EDLDNEFSQLKGLWQTYFNSDRESDYVVNGVVHECDRLLRQSQEDAEIKKNLNDEFHA
                     IYALALSELTVFKAGEDEDDKKNRKVVSEFFENALERCELGLSVFKDSQLLKLVLAKI
                     VIQRIPLEYISRLKVNSKPGALGVDISEQLEKAKENFNVNKDYLELSFEVLQMFDDLL
                     DIVENFGHENDIDEGLDSDQDEELERVELSPKHPLYKLQQNLSENYQWLRDEMIRLLG
                     ATDDKKFEKLYRNIARSAGHLLLKAAEEPTSVFMHLQYGEGEQASKDGEKCKTAQQEA
                     LKNTKDALKYLEKAQVEDEPETWVEVAEAYIDLGNLYDYQSKDQENSYRIAEDILKKA
                     NKASHGKFQDILDNLLDKD"
     gene            <481486..>482079
                     /locus_tag="HG536_0H02760"
                     /db_xref="GeneID:59328167"
     mRNA            <481486..>482079
                     /locus_tag="HG536_0H02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285679.1"
                     /db_xref="GeneID:59328167"
     CDS             481486..482079
                     /locus_tag="HG536_0H02760"
                     /inference="similar to AA sequence:RefSeq:NP_012994.1"
                     /note="ancestral locus Anc_5.649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141575.1"
                     /db_xref="GeneID:59328167"
                     /translation="MSSTPSTSGHSKSLRLAGEDIWKNKTEKVNGELFTLMYGAIVSQ
                     LCKDYQRCFPKVNDQLYTMGYNIGVRLIEDFLARTALPRCENMVRTSEVISKCAFKIF
                     LNITPQVANWSADKIAFSLVLVENPLSDFVELPMDAMKQLWYSNVLCGVLKGALEMVQ
                     LDCDVWFISDVLKGDPQTEIRVKLNKVLKDEIPIGED"
     gene            complement(<482167..>484329)
                     /locus_tag="HG536_0H02770"
                     /db_xref="GeneID:59328168"
     mRNA            complement(<482167..>484329)
                     /locus_tag="HG536_0H02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285680.1"
                     /db_xref="GeneID:59328168"
     CDS             complement(482167..484329)
                     /locus_tag="HG536_0H02770"
                     /inference="similar to AA sequence:RefSeq:NP_012993.3"
                     /note="ancestral locus Anc_5.648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141576.1"
                     /db_xref="GeneID:59328168"
                     /translation="MVEEKGDTAAERKEAKPHIAHATVGYVNHYNGYTYSIRTWLFDC
                     SLFILNVIFTIFFREIKVRGGHNVPGTGTPTLMVCAPHANQFIDPSLVMVTTRKLLKD
                     SATRSRQVCFVTAESSLKQRFVSLFGRCTGAIPVPRAQDNLKPIDASVKIYCPDLENA
                     PEVIKGRVEGGGSPEFSRRFVAKSLIGLPNYLGNAQISEVLDDETLVLKAPFKFKSND
                     KIRKLLTEGTNFKYAAKIDNSKTFQNVFDHLHTNGCVGIFPEGGSHDRPSLLPIKAGV
                     AIMALGAAAADPNMRVHVVPCGLHYFHRDKFRSRAVLEYGEPIVVGPELGRKYAEDPR
                     GTVEDLLKTITNALYAVTENAPSFDVLMTIQAARRLYQPARGKVSLSNVVEINRRLLI
                     GYSKYKDDPRIIHLQQMVNKYNNALYSLGLKDHQVMELKTRKTEVLRSLFVLIERLIR
                     LSIFFVLSLPGSILFTPIFISCSIYAKKKAKEGLSKSVVKIKGTDLIASWKLMFALVF
                     APILYVTYSFILVFLYSRHNVWVSKLWVPFDSKLLQFCYFYALLVSATYSSLKTGEIG
                     MDLFKSLPPLFITFIYPGKKIKQLQSMRERLSLEITAVCNELGPKVFPNFDKIKTRFD
                     DHVEEVSSEADGELTEETLFSSRSRSASVHSETSMASNALSKINSRGSLTDVPIFSEG
                     KHPEDHSDDELEVSPEPDEGASKITALIRKKWQHEKAD"
     gene            <484968..>486068
                     /locus_tag="HG536_0H02780"
                     /db_xref="GeneID:59328169"
     mRNA            <484968..>486068
                     /locus_tag="HG536_0H02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285681.1"
                     /db_xref="GeneID:59328169"
     CDS             484968..486068
                     /locus_tag="HG536_0H02780"
                     /inference="similar to AA sequence:RefSeq:NP_014692.1"
                     /note="ancestral locus Anc_5.647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141577.1"
                     /db_xref="GeneID:59328169"
                     /translation="MDIATLLEVSKRDSVVVDGRSPVSLYSGMVPNLAFNVAMLAIWG
                     VLLSWHTLMIWYRQYWFSSAFVCAAILEVLGYVGRVWSHFDVYLVNPFLMQLVCLTIA
                     PVFTMGGVYYQLAKMIEIYGHRFSLLPSPMAYSYIFIAFDFISLVVQAAGGGVAGTES
                     TNGDSSDTGDNIFIAGLSLQVASMIIFMVLMGHLYYKVFVQTRLDHSGQTKLSLGLLK
                     ISRTEIDYLYRQKFSDLRVRPDRWVFHYFPLAMVVAVATVFVRCCYRLAELAAGWNGY
                     LIIHENYFIILDALMIALATVALSVFHPGFAFQGRHVSIPITHGRVDPETVEKPPFEP
                     EKEDSYIDSGEQVSGRGNVFMKPFQKMKNAFS"
     gene            complement(<486288..>487514)
                     /locus_tag="HG536_0H02790"
                     /db_xref="GeneID:59328170"
     mRNA            complement(<486288..>487514)
                     /locus_tag="HG536_0H02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285682.1"
                     /db_xref="GeneID:59328170"
     CDS             complement(486288..487514)
                     /locus_tag="HG536_0H02790"
                     /inference="similar to AA sequence:RefSeq:NP_012760.1"
                     /note="ancestral locus Anc_5.646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141578.1"
                     /db_xref="GeneID:59328170"
                     /translation="MRRFPGVVAQVRFKGSYPLIPIEQLRKGNGIHVGESGTLALRDY
                     YEWLNLPSIMKHETFFTKRGELLSDLPDNTERLTLYDPILTRSIARWLLVDYKLNHYP
                     YSDLNIINIYTDLPQSLRIAESMMGYFKQALSSNMFERIRYTMVPLHSHRQKLSGRLT
                     RNIPGEVQIISDAAVFTSESTSSSHPQQFVIEDPVYFLMLNDIFKNTSHDLVRYNKSV
                     GNWEQCYMDIHTSGGKSRRFDTDLDYWCDSCLSRALQKYDLGAAKQSAGFYIPTRLIQ
                     LFDLLKTVAPAHKLFAIDAPQRWHPSFLSMIRILAGYQPLRASKIVESHRSSIWRGRR
                     EDCGPRFTVDFTQIQQLYTSINESAKFCEVDDVPEFVNQWLDTGCEQSDKWAQDVLNS
                     QLEMIGASELAILHSC"
     gene            <487752..>490907
                     /locus_tag="HG536_0H02800"
                     /db_xref="GeneID:59328171"
     mRNA            <487752..>490907
                     /locus_tag="HG536_0H02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285683.1"
                     /db_xref="GeneID:59328171"
     CDS             487752..490907
                     /locus_tag="HG536_0H02800"
                     /inference="similar to AA sequence:RefSeq:NP_014691.1"
                     /note="ancestral locus Anc_5.645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141579.1"
                     /db_xref="GeneID:59328171"
                     /translation="MGVPSFFRWLSRKYPKIISPVLEEQPQVIDGVTLPIDYAAPNPN
                     GELDNLYLDMNGIVHPCSHPENKPPPETEDEMLLAVFEYTNRVLNMARPRKVLMIAVD
                     GVAPRAKMNQQRSRRFRSARDAQLENEAREQVMREREEIGEVIDESVKSKKTWDSNAI
                     TPGTPFMDKLAAALRYWTSFKLSTDPGWRNLQVIISDATVPGEGEHKIMNFVRSQRAD
                     PQYNPNTTHCIYGLDADLIFLGLATHEPHFKILREDVFAQNNRKRHNFKDTLDMTEEE
                     KQLIAKEDSEKPFLWLHISVLREYLAAELWVPKLSIPFDLERAIDDWVFMCFFCGNDF
                     LPHLPSLDVRENSIDILLDIWKVVLPGLKSYMTCDGELNLKSVETLLGHLGAREADIF
                     KTRHIQEVRKQESIQRRKLQRDVSKGQDRHPTKVNEQLQMYDTQGNLATGSWNLTTSD
                     MVNLKKEIMLANEGDAEAIAIVKAQSDKNDQIMKEISSTDMDKVVSEANKANYSVADL
                     MKKKLIAKKHKLEQEEAKQEREAKRAKAEEENIDVKQAAAERELDEEIRAEIINEVEE
                     EDADDDDEDNDADENEEPIESGQISFEDPKGGQSVPVVSSGGMRSGVFDSDAEVRLYE
                     PGYKERYYIAKFNIGEQEIEPLRKDLVKHYIEGVSWVLAYYYQGCASWDWFYPYHYAP
                     FAADFIGIADIKIEFEKGEPILPYEQLMSVLPAASGHTLPPIFRPLMSDPDSEIIDFY
                     PTEFPIDMNGKKMSWQGIALLPFIESKRLLRVVREQYRLLSDYEKSRNVRKDPVLIIS
                     NKNVNYEKFAKRLFKETSEETDLKFQHFKSGLSGIVSTDVEGFQLNSKMQCPIQTGSL
                     PELSTNLFLKMAFKLQPLPGRNKSVTLNGFIPSEPVLSPYDLDAIYYRYNNSQNGNRS
                     GRWNFENDMRQNKVPVGPSGTTQYKPRVGGFRSFYYFGQMNNTANYSNEYNGRNYQQA
                     EQYAGQRRYPGADNYRGNSGGAKNQYNTHQSRYSDSYGTGAGRSYNVRDRQYSGNGTA
                     IGRRYQGSNRPAYKSGYTPRR"
     gene            491420..491491
                     /locus_tag="HG536_0Htrna8E"
                     /db_xref="GeneID:59328408"
     tRNA            491420..491491
                     /locus_tag="HG536_0Htrna8E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAG"
                     /db_xref="GeneID:59328408"
     gene            <492183..>493550
                     /locus_tag="HG536_0H02810"
                     /db_xref="GeneID:59328172"
     mRNA            <492183..>493550
                     /locus_tag="HG536_0H02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285684.1"
                     /db_xref="GeneID:59328172"
     CDS             492183..493550
                     /locus_tag="HG536_0H02810"
                     /inference="similar to AA sequence:RefSeq:NP_010563.3"
                     /note="ancestral locus Anc_5.644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141580.1"
                     /db_xref="GeneID:59328172"
                     /translation="MFVSPPPASTTGRGLSKRQGGTSNHRHKANSGFLQSIPEGSSAV
                     SYAPSMGSSQSLEGSLYQTDSQPQIPMKKDTANFVNAPPEYADRARDEIRKRLLPSGN
                     RTHRYSRADSEVSSRRSSDNRSVFSYNTSSDQSSIFSQPSTVFTHSTVDSSPFLPPPK
                     IVTHVSLQDALPKTFYDMYAPEILMSDPSNILCNGRPKFTERALLDWELNDIRSLLIV
                     EKCRPEWGNQLPEIVTDAPNLPHFRFQLLPLNSSDAFIIETLVSSDLYMEANLDDQFK
                     LTSARYTVAAARKRHEQMTGRVEPIMELSKPEWRNIVENYLLNIAVEAQCRFDFKHRC
                     SEYKKFKFQQSNLKRPHMPPPKLIPNTDRGNFMENSDRSANGSSLLKKALLKNLQLKS
                     FNKNNAGDTNSNINDNNARSAGSIHQNEGKISLTKEEKAMLWSQCQAQVYQRLGLDWQ
                     PDKVS"
     gene            <493713..>495125
                     /locus_tag="HG536_0H02820"
                     /db_xref="GeneID:59328173"
     mRNA            <493713..>495125
                     /locus_tag="HG536_0H02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285685.1"
                     /db_xref="GeneID:59328173"
     CDS             493713..495125
                     /locus_tag="HG536_0H02820"
                     /inference="similar to AA sequence:RefSeq:NP_014689.1"
                     /note="ancestral locus Anc_5.643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141581.1"
                     /db_xref="GeneID:59328173"
                     /translation="MSEKKEDAAALLASLKIDSKKEAETPKTETTEKKDDAKSVSNDR
                     KEVAAGSNLLKSEYEVKVKLADLQADPNSPLYSVKSFEELGLAPELLKGIYAMKFQKP
                     SKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVDVALGDVTQAICLAPSR
                     ELARQTLEVIQEMGKFTKITSQLIVPDSFAKNQPIKAHIVVGTPGTVLDLMRRKLINL
                     PQVKIFVLDEADNMLDKQGLGDQCIRVKKFLPKTAQLVLFSATFDESVRTYAKKVVPD
                     ANTLELQRNEVNVEAIKQLYMDCNNEDHKYEVLCELYGLLTIGSSIIFVSTKKTANQL
                     YARLKHEGHQVSILHGDLQSQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVN
                     YDLPTLPNRQPDPSTYIHRIGRTGRFGRKGVAISFVHDKKSYTVLSSIQKYFGDIEMT
                     RVPTDDWDEVEKIVKKTLKD"
     gene            <495374..>495541
                     /locus_tag="HG536_0H02830"
                     /db_xref="GeneID:59328174"
     mRNA            <495374..>495541
                     /locus_tag="HG536_0H02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285686.1"
                     /db_xref="GeneID:59328174"
     CDS             495374..495541
                     /locus_tag="HG536_0H02830"
                     /inference="similar to AA sequence:RefSeq:NP_010562.1"
                     /note="ancestral locus Anc_5.642"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141582.1"
                     /db_xref="GeneID:59328174"
                     /translation="MDSSKIVSIILAIFLPPLSVFLSCGFGTEFIVDVVLTILAFFPG
                     MLYALYLAFKA"
     gene            complement(<495663..>495854)
                     /locus_tag="HG536_0H02840"
                     /db_xref="GeneID:59328175"
     mRNA            complement(<495663..>495854)
                     /locus_tag="HG536_0H02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285687.1"
                     /db_xref="GeneID:59328175"
     CDS             complement(495663..495854)
                     /locus_tag="HG536_0H02840"
                     /inference="similar to AA sequence:RefSeq:NP_014688.1"
                     /note="ancestral locus Anc_5.641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141583.1"
                     /db_xref="GeneID:59328175"
                     /translation="MSAMFGMPGVGAPGASAIPQPPKSRFQKFMESPLYTIVVNGTLF
                     VAGVAFIQSPLMEMMAPQL"
     gene            complement(<496145..>496738)
                     /locus_tag="HG536_0H02850"
                     /db_xref="GeneID:59328176"
     mRNA            complement(<496145..>496738)
                     /locus_tag="HG536_0H02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285688.1"
                     /db_xref="GeneID:59328176"
     CDS             complement(496145..496738)
                     /locus_tag="HG536_0H02850"
                     /inference="similar to AA sequence:RefSeq:NP_014687.1"
                     /note="ancestral locus Anc_5.640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141584.1"
                     /db_xref="GeneID:59328176"
                     /translation="MVAMPGLDTVWTIAKVLFRVYQWTCYFFVFILLLPVITLYFFDL
                     VLYLCRLVSFSCRWQAYHIKNHSGLSVSFISGRNGRILNSEPVGAEEEVPKSSTSAGD
                     GEGCGSSGVSILSGCDSGSEHSLSDTPYSPNYCLTSLPHDFHARKGASSRRSTIAGSG
                     DRLKCASLVPEHLGELIRANPQFTELRRTKSSEIALH"
     gene            complement(<497033..>498511)
                     /locus_tag="HG536_0H02860"
                     /db_xref="GeneID:59328177"
     mRNA            complement(<497033..>498511)
                     /locus_tag="HG536_0H02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285689.1"
                     /db_xref="GeneID:59328177"
     CDS             complement(497033..498511)
                     /locus_tag="HG536_0H02860"
                     /inference="similar to AA sequence:RefSeq:NP_014686.1"
                     /note="ancestral locus Anc_5.639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141585.1"
                     /db_xref="GeneID:59328177"
                     /translation="MENVITQVSQNNGAASNFLLKEQQHGQGYTDNGDEDNANSLIHL
                     NIQENHYYITRDQLMSLPESLLLCLFPSGVFLDRQGQVISNLMPNDEVYVSNFPPDCF
                     EYIMEVYSKAYEDLINFPVHKLNDRASARKDGGLSSAARGFFSFGGSASPGSGSSTEN
                     EILHEKPTIIVLREDLDYYCVPQSDFEFDSDESSDDLLYHVMAQVKAAAGSYLTAKAS
                     IFQGLYSSNRLKKQKDGKNNSNSKERTLGPAEQHLLDMLCSSGFAKDSRWENRTQEPG
                     KTVISSLSLCRIVNETTEEFRQKYHAARAKWEQEVKAAQENTITPVGSSVSLNSLSRT
                     TSRNNQAINALLPTKSASQTSIASHGRPVVEKRKSRLSTLADNVRSRSSSAQRSSSKT
                     RHPEPPRLYDLVPRPDINPKLLLFWRKPARKCWWGEEKINLEVQVYGSWATNKDNPDK
                     KVRTLSLKTPKDPEDGLNKISIPVRLHIRRVWTLELSAVGVE"
     gene            complement(<499376..>500632)
                     /locus_tag="HG536_0H02870"
                     /db_xref="GeneID:59328178"
     mRNA            complement(<499376..>500632)
                     /locus_tag="HG536_0H02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285690.1"
                     /db_xref="GeneID:59328178"
     CDS             complement(499376..500632)
                     /locus_tag="HG536_0H02870"
                     /inference="similar to AA sequence:RefSeq:NP_010559.3"
                     /note="ancestral locus Anc_5.638"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141586.1"
                     /db_xref="GeneID:59328178"
                     /translation="MPEDSTTIPQKTGTGDDAKIMEPVKEDITEKPTTSEPEAEQDTV
                     TETVDPKVDNDEEELPPALPQRKAKSASSETHDGSADRNPIFEQLKEAFPNMESKFIK
                     AVIIASQGALDPAFNALLYLSDPESGKDIELPKEPIAVGTPQLPARRQQSQLEQDEIL
                     ARQLDEQYNRTQQRTHRSRGSDAERQAHRQRLRDRQRRKNHPLSPEEQRELEAADEDS
                     WTQFMEKDLPVLRERANRSIQDTATKLNGWISGIRRNLVGEGSQEAQNPHQAGDYYDD
                     PYSQQRDEEFFDEKTPKKPERRRFNSFGAQIQDDSLESHGITLQSDDLNDDADEEDDI
                     PPQLGSPKIQKDSAGHKTGAEEKVVAQTTYIDTPDNATRKKWQPVPPEPLNETPTKTA
                     PERDQPKKATKNADEDEFLINSEDEM"
     gene            complement(<500831..>501676)
                     /locus_tag="HG536_0H02880"
                     /db_xref="GeneID:59328179"
     mRNA            complement(<500831..>501676)
                     /locus_tag="HG536_0H02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285691.1"
                     /db_xref="GeneID:59328179"
     CDS             complement(500831..501676)
                     /locus_tag="HG536_0H02880"
                     /inference="similar to AA sequence:RefSeq:NP_010558.3"
                     /note="ancestral locus Anc_5.637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141587.1"
                     /db_xref="GeneID:59328179"
                     /translation="MILRQTRKMHIKPIKMRWLTGGVNYSYLLSTQDGSKSWLIDPAE
                     AGEVLAELNKSQLASVEAIVNTHHHYDHAGGNVAMLAALKKEGHSVEVIAGSKTSPAA
                     TKIPDHSQRFKLGELEITCIRTPCHTQDSICYHVKDVSTNEQAIFTGDTLFTAGCGRF
                     FEGTASEMDAALNDRILNAVQEPNWSSTRVFPGHEYTKGNVNFIRKAIYRHVGENNAF
                     DALEKFTNQYEISTGHFTLSDELRFNPFMRLDDPIVRKMVGDDKGSWSRSQVMNQLRK
                     MKNAS"
     gene            <502331..>504118
                     /locus_tag="HG536_0H02890"
                     /db_xref="GeneID:59328180"
     mRNA            join(<502331..503896,503978..>504118)
                     /locus_tag="HG536_0H02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285692.1"
                     /db_xref="GeneID:59328180"
     CDS             join(502331..503896,503978..504118)
                     /locus_tag="HG536_0H02890"
                     /inference="similar to AA sequence:RefSeq:NP_009745.2"
                     /note="ancestral locus Anc_8.558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141588.1"
                     /db_xref="GeneID:59328180"
                     /translation="MSYIVDASLRSYSVQVVQAALREEYRSRSNGGKGGDGGQMVAEK
                     MAIFYNLLRNVIRKKLTKFAASQLEDLTMNSSTFLGEGHGSIEICEPPTEAQERIIKS
                     LVKVVFHQLQTCGQSDKFADVDEGHANLFLSLFVKSIHCEYFEETSLLNSDPELDVQD
                     CIRRIFDGTGAENTRLSETQKKTTFHHAASFTVHLYCSLGHVSHGSGLLEEFDKIDLE
                     TDLCPGEEQSEGPTLASLSYNSESLSELPISKQTLNLTRIALLPSDNLEGLWECLHFD
                     DGIKRRLYSYATVALKVASLSSQKPAEAAQSSFGNNKLILVHGPPGTGKTTVCKSLCQ
                     KLSIRREFSREIDPLDATHKGMIVELSCSQIFSRWFGESSKNLATIFGDVENLLIANQ
                     QTGSFVCLLIDEVEAIAFSRSDLLQKNESTDGVRVVSTLLTQLDRLKKYNNLIILATS
                     NLLESLDPAFIDRTDGVFYVGNPSRNGIAKILSSGMKDMITNGVITSMGDLSNVLNSL
                     KYKKIMDLIAEKCLLAGTSGRTLSKLPLISLSEHFRTVPVSLDRFLIALAISIRQLSE
                     QA"
     gene            <504356..>505129
                     /locus_tag="HG536_0H02900"
                     /db_xref="GeneID:59328181"
     mRNA            <504356..>505129
                     /locus_tag="HG536_0H02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285693.1"
                     /db_xref="GeneID:59328181"
     CDS             504356..505129
                     /locus_tag="HG536_0H02900"
                     /inference="similar to AA sequence:RefSeq:NP_009746.1"
                     /note="ancestral locus Anc_8.557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141589.1"
                     /db_xref="GeneID:59328181"
                     /translation="MMNAPAGPDQAEHPMSSFLMAVSMIGVSEIGDKTFLIAALMAMR
                     HPRLLVFSSAASSLTIMTVLSGLVGHSFVTLISERYTHFFAGILFLIFGYKLTIEGLE
                     MRKDAGVEEELAEVEEEIAVTDLNANMQSAETGGVSDNGFYKSTKGLKRILSKVGDAA
                     SLVLSPLWVQIFAMIFLGEFGDRSQISIVAMASSRYYWYIICGAVVGHLVCTGLAVLG
                     GKLLATKISMRTVTLGGALSFFIFAIFYIYEAFTAEDLA"
     gene            complement(<506062..>511707)
                     /locus_tag="HG536_0H02910"
                     /db_xref="GeneID:59328182"
     mRNA            complement(<506062..>511707)
                     /locus_tag="HG536_0H02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285694.1"
                     /db_xref="GeneID:59328182"
     CDS             complement(506062..511707)
                     /locus_tag="HG536_0H02910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141590.1"
                     /db_xref="GeneID:59328182"
                     /translation="MSSQVSRLDRQVVLLETGSTQFIRNMAADQLGDLARQHPEDILS
                     LLSRVYSFLMAKKWETRVTAARAIGGIVAHAPLWDPNAEDDEEGGEKGVADSAPVETA
                     KVKMEQEIQLKLEEVSQNDGDEFLQDEQRLFSLSQWNLHELLKSNKVLLASSINGYNE
                     GWDEDTKVRKQQRKTGYDNDNDFNDGNVKVESKETAVGVVKKQESPRPSMPLASSKKS
                     ARMLAMAKRKKKMQAKSSSTKPVDLSESNISKSLMNQPDNSSSFSPTTLNNPKLDITE
                     SSEANKIMVESTVAPILEKHERVAGLVWQFQGVYELLIDNLMNEAWEVRHGAALGLRE
                     LLKQHAFGVSRVKGRGRAENDLRNKKSLEDCATRLLTIFALDRFGDYVYDTVVAPVRE
                     SAAQTLAALLIHLDDDLCVKIFNSLEQLVLQDPQTVSLPTKIWEATHGGLLGVRYFVS
                     IKTDFLLSKSLLGDVVKIVLYGLNQPDDDVQSVAAAILSPITSDFVKLDTPIVDLVLS
                     TIWSSLTHLDDDLSSSVGSVMNLLAKLCKHTEVLDIFKNKALQYPSEWSFKFLVPKLY
                     LFLRHSISSVRKAVLNLLDAFLSIKEDTTKSWLNGKAFRLLFQNILLEQNEDILNLSF
                     QVYCSLLKNYKSKHTEKTLDHVLSKHLQPILHLLNTPIGVNGKSYNMESQYILKPSQH
                     YQINPDKKRSISEASYETDIPPPKHNERVNIDAPMIAGDIILLGVEVIKNTRVMGARA
                     FGITLAMFQDSTLKSFFENVLVRCLDLSYATPRMLAAIILTEFCKTRLEGKYGTSGIP
                     SFVAEVLGPTINNQLSNPETLPIFREFTPSLKALRTQCQNLLNTFVDVGMLPQHKLPN
                     VPVVCQGETDAGPEAFSIELAERVYKDYYDKMFKSMSNCYKLLAKKPLEDAKHRVLLA
                     IEDSQASRREYNCSILANYASATLRFSGLPKKLNPIIRALMDSIKEEKNEILQRLSGD
                     SIEYLVKKLVDDGKTNVSDKIVKNLCGFLCVDITEVPEFAVNATLKDSILTLVKENNY
                     LTVQDDPHLRKLAEEASIKRKGALYTLGKLLKLFGEEALGKVPQLKKSILEPLHKFDE
                     LKSEPFSNEVGQEIVDSLGVVRALFPFMHPKLQNKEVISRFSLLLKFLRSDYSVFRYS
                     VARTFSDLAKTATIPVMTYVIREILPLLNNAGSTIDRQGATELIYHLSVTLEADILPY
                     VIFLIVPLLGRMSDSDTDVRSLATTTFASIIKLVPLEEGIAHPEGLPEDLMAGRERER
                     EFMQQMMDPSKAEPFKMPVAVKATLRKYQQDGLNWLAFLNKYHLHGILCDDMGLGKTL
                     QTICIIASDQHLRKEDYLKTKSLKSRPLPSLIICPPSLTGHWESEFEQYSPSLKVVVY
                     AGGPSTRFPLRDQLSQADVIVTSYDVARNDLNVMTKLDYNYCVLDEGHIIKNSQSKLA
                     KAVKQFSSNHRLILTGTPIQNNVLELWSLFDFLMPGFLGTEKMFQERFAKPIGASRNS
                     KSQSKDQEKGALALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYK
                     DFSKKQKNVVEKDLENNADVEGKQHIFQALQYMRKLCNHPALVLSPDHPQLRQVEDYL
                     KQTHLDLHDIANAPKLGALRNLLLECGIGEQDMDGKASGTQLPSSENVISQHRALIFC
                     QLKDMLDMVENDLLKKYMPSVTYMRLDGSVEPRDRQKVVRKFTDDPSIDCLLLTTKVG
                     GLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGL
                     QKFKMNIASTVVNQQNNGLANMDTHQLLDLFDSDNVPSQESDEKQTHGANGSGMEDIA
                     NETGLSGKAKEALGELKELWDPSQYEEEYNLDNFIKTLR"
     gene            <512346..>513527
                     /locus_tag="HG536_0H02920"
                     /db_xref="GeneID:59328183"
     mRNA            <512346..>513527
                     /locus_tag="HG536_0H02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285695.1"
                     /db_xref="GeneID:59328183"
     CDS             512346..513527
                     /locus_tag="HG536_0H02920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141591.1"
                     /db_xref="GeneID:59328183"
                     /translation="MSVNSNPYAPNVADLVSNVTRFQIIESTLREGEQFANAFFSTEK
                     KIEIAKALDEFGIDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAKVAV
                     ETGVDGVDVVIGTSQFLRQYSHGKDMNYIAKSAVEVIEFVKSKGLEIRFSSEDSFRSD
                     VVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRSLKSVVSCDIECHFHDDTGC
                     AIGNAYSALEAGAKLIDTCVLGIGERNGIVPLGGLMARMIVSAPDYVKSKYNLKKLRD
                     LETLVAEAVEVNLPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPADFGISRYIH
                     FANRLTGWNAIKSRVEQLNLQLTDDQIKEVTAKIKQMGDIRPLGIDDVDSVIKDYHAE
                     L"
     gene            <513786..>514687
                     /locus_tag="HG536_0H02930"
                     /db_xref="GeneID:59328184"
     mRNA            join(<513786..513792,514113..>514687)
                     /locus_tag="HG536_0H02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285696.1"
                     /db_xref="GeneID:59328184"
     CDS             join(513786..513792,514113..514687)
                     /locus_tag="HG536_0H02930"
                     /inference="similar to AA sequence:RefSeq:NP_009748.3"
                     /note="ancestral locus Anc_8.554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141592.1"
                     /db_xref="GeneID:59328184"
                     /translation="MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYR
                     ITFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKIE
                     DFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNVPSFMVRLDSEKHIDFAP
                     TSPFGGGRPGRVARKNAANKSEGGDDAGAEDEE"
     gene            <515360..>516059
                     /locus_tag="HG536_0H02940"
                     /db_xref="GeneID:59328185"
     mRNA            join(<515360..515370,515588..>516059)
                     /locus_tag="HG536_0H02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285697.1"
                     /db_xref="GeneID:59328185"
     CDS             join(515360..515370,515588..516059)
                     /locus_tag="HG536_0H02940"
                     /inference="similar to AA sequence:RefSeq:NP_009750.1"
                     /note="ancestral locus Anc_8.553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141593.1"
                     /db_xref="GeneID:59328185"
                     /translation="MGKSHGYRSRTRYMFQRDFRRHGTIPLSTYLKIYKVGDIVDIKA
                     NGSIQKGMPHKYYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHVKHSKCR
                     AEFLQRVKDNAAKRAEAKAQGVAVQLKRQPAQPREARVVSTENNVPQTLAPVPYETFI
                     "
     gene            complement(<516270..>517703)
                     /locus_tag="HG536_0H02950"
                     /db_xref="GeneID:59328186"
     mRNA            complement(<516270..>517703)
                     /locus_tag="HG536_0H02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285698.1"
                     /db_xref="GeneID:59328186"
     CDS             complement(516270..517703)
                     /locus_tag="HG536_0H02950"
                     /inference="similar to AA sequence:RefSeq:NP_010070.1"
                     /note="ancestral locus Anc_2.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141594.1"
                     /db_xref="GeneID:59328186"
                     /translation="MAFNSSSTWAGSVGSSSGWSLETSWWPSDSTSGRSTLASRDGGS
                     LMVTSSSGPTIVTPSSSQLYSSSEIDSASLGQVVSSQSPQLSRLWSRSSSAVVPLSTL
                     ESSSASGVSSSSTSASESELSSVRSESSSSSGLERSSASSASSSWASRSSSSSPSSSS
                     DSDTSVIDLSTSSSSSESVIPSTSVLEPQSTPFSSSSATSAWTSTSAPSYTVSQDSRS
                     IYYIYTQLYHITGSTTTFDTGLPTTTARAKTVTSSFSVPTSTQTRGIQFYENWLDGGL
                     GEASSPSSPTKNKIIGGVVGGVAGALLCGIVLWLMFFRRRKKTTKAPRGFTSKIGRRA
                     GYPLPSQASDHDQEKVSPPATGSGQTALLSRIKSKAMAQISRNKGETDPRNDSGNPFQ
                     DEFNFQARRPPPIPPSRNITGIYASADPEVPVDHRFSYVSSLTDSSYISSTQGNYSSM
                     SSSSIRLAPDAERNPSESARGFLREVI"
     gene            <518156..>519037
                     /locus_tag="HG536_0H02960"
                     /db_xref="GeneID:59328187"
     mRNA            <518156..>519037
                     /locus_tag="HG536_0H02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285699.1"
                     /db_xref="GeneID:59328187"
     CDS             518156..519037
                     /locus_tag="HG536_0H02960"
                     /inference="similar to AA sequence:RefSeq:NP_011102.3"
                     /note="ancestral locus Anc_8.241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141595.1"
                     /db_xref="GeneID:59328187"
                     /translation="MSTFSESDFDAERYDRSRPSYPDRFYAALDKYHQGPRRCVVDVG
                     CGPGTATFQMAALLSGFEQVVGTDISPTMIEKARSASGSDERVSFEVSSGNEFSFLGA
                     AKANRQTLDMVTAVECVHWFDFASFQSSVAANLRRGGTFAIWGYADAAFIDYPELDAV
                     LNDVSYGRDQLGPFWQQPGRNVLRGMLENWVFDSRYFADEQSAEVRVADLRAPQHLHA
                     QQRPLILSKEMTVSDYANYVRTFSAYHTWKTKHGDSEEDIAERLVETICTVQPELTPD
                     SKVQVAWNTFYKFARRV"
     gene            <519284..>520009
                     /locus_tag="HG536_0H02970"
                     /db_xref="GeneID:59328188"
     mRNA            <519284..>520009
                     /locus_tag="HG536_0H02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285700.1"
                     /db_xref="GeneID:59328188"
     CDS             519284..520009
                     /locus_tag="HG536_0H02970"
                     /inference="similar to AA sequence:RefSeq:NP_010383.4"
                     /note="ancestral locus Anc_8.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141596.1"
                     /db_xref="GeneID:59328188"
                     /translation="MPVVEIKDQDKFTNLVTAEAADRLTALYFYAPWAEPCKYMGEVF
                     KALSDEPSNKDVLFLSINADDNSEIAESFEVSAVPCLIIVRKGTILTELSGANPKQFV
                     KALNDHKASLQGTPEPQQRSITDEEDEDEDEETEEELNERLTKLTQAAPIMLFMKGSP
                     SEPKCGFSRQMAVGILREHQVRFGFFDILKDSSVREGLKKFSDWPTFPQLYVKGEFQG
                     GLDITKESLEEDPEFFEHALQSS"
     gene            complement(<520085..>522031)
                     /locus_tag="HG536_0H02980"
                     /db_xref="GeneID:59328189"
     mRNA            complement(<520085..>522031)
                     /locus_tag="HG536_0H02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285701.1"
                     /db_xref="GeneID:59328189"
     CDS             complement(520085..522031)
                     /locus_tag="HG536_0H02980"
                     /inference="similar to AA sequence:RefSeq:NP_011100.1"
                     /note="ancestral locus Anc_8.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141597.1"
                     /db_xref="GeneID:59328189"
                     /translation="MDRKKRNVPDLKRSLSSLTSQITHWSASRSCSPSRKKGNKCSSV
                     DVRDLQGHNLSADLTTGGFNTIPWYEKYSPKNVNEVSIHKKKSKEVRDELEAMMQGRS
                     EKRVLLLTGPSGCCKSTIVNMLAKELVPKYRAAGGRGENVIRYENDMAPNGASHIGSF
                     GQFLGEAKYRVVSNLSLILVEDIPNVFHAETRSAFRRQLLEWLYMPKRSLPPLVICLT
                     ECELENDNGSFIAYGVDYSWTAESILGKEILSHACLKRIKFNPVNATLMRKTLVNICN
                     DNKAELMLREKWDDKDRVIEGVIQSTGDLRSGIAMLQFWATSTGCTATFARDSSTSYF
                     HAIGKVLHGSRDVADDSKMINELLLNSMGHLSHDNFSLGLLENYASFNKGKFSILEAC
                     KLTDSLSESNTMDMTPESLEFCLRKVRHIFGEMGQGSHSHGRAKFPREWKISQAQSEF
                     LIQCEDYTNVSVYKYGEPRLFRNIALQFGFYDPEIKSIRFYKEKALKHYRAKLSNDAV
                     FEVKKQRIQSLEVDPTLDITARIGGDINLIDGHDTEISEDDHQSGAKEALDRLRRTRD
                     AKLQKLLELYGTDSELKAGTETDDEQFEEDPIIDSDQDVGAVANNTLDDEDSIYEALS
                     QKPRNLNGEKPVSESLSDSDLEDL"
     gene            <522295..>528777
                     /locus_tag="HG536_0H02990"
                     /db_xref="GeneID:59328190"
     mRNA            <522295..>528777
                     /locus_tag="HG536_0H02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285702.1"
                     /db_xref="GeneID:59328190"
     CDS             522295..528777
                     /locus_tag="HG536_0H02990"
                     /inference="similar to AA sequence:RefSeq:NP_011099.1"
                     /note="ancestral locus Anc_8.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141598.1"
                     /db_xref="GeneID:59328190"
                     /translation="MSEDGEKDRKQQIREIYRYDEMSNKVLRVDKRLQTIKSDPQRDA
                     ELCQPKSMEGRISVKEMGMSARREIDNEDREQARKSLERGQARSKKTSERPVSSMRSV
                     LDYDNSALKYYPTDQTNKALYEEILRWITEVVGMDIPHDIIASTADLLISALKDDEDE
                     ADGVLDKKRVFIEKELELPIQPARFKDLVQLVRQITDYKDGSVEEDEKAVPVLLEDAP
                     EEGYAEEEDSTLLNELEQEDGEDEVSDSINRKKAALADDAGLGLAHDEDKIFLAGKNL
                     DIIEEVSINEVDEFFVRRRLNESRVDLDASSVQHLSDQILEVLERNDSNSKSLEVELL
                     NLLGAEQLQFVKYIVKNSDALLWGIRLARTEESLRPKVLQDMRQNGVRALADQYDEGT
                     RLNSKRTAANALDSISTKEGDAKRLRASDRGPVPPLLDLESLAFNEGANLMTVSKVSL
                     PQGSYKKVNQHYEEIHIPAPKRPDIDYPLIQTSSLPVWARNAFPARETESLNPIQSRV
                     FPAAFHNDMNLLLCAPTGAGKTNVAMLCVLRAVSTFINPDTNSLRSKQFKIVYLAPLK
                     ALVQEQVREFRRRLAYLDIKVEELTGDSALSRHQIAETQILVSTPEKWDVITRKAADT
                     SSYINLVNLLIIDEVHLLHDQRGPVLECIVARSLQSPVARRAPRIVGLSATLPNYQDV
                     AKFLRVPTDGLFYFDSSFRPCPLSQQFCGITEKNSIKRLHAADEACYDKTLEAVTNGH
                     QVIIFVHSRRETARLARHLIQKFRDQGSIESLQKADPASKQILQTEAEKIQNPHLAQT
                     LKQGVGIHHAGLSREDRSLSEDLFADGLLQVLVSTATLAWGVNLPAHTVIIKGTDVYS
                     AEKGRWDRLPPQDLLQMLGRAGRPRYDTHGEGIVITNQTDVQYFLAILNQQLPIESQF
                     VSMAVDALNAEVVSGSIRSRKDAVNWLSYTYLYVRALVSPQLYNVTDSEGDDSLLRFR
                     DSLAHSAFSVLQDEKLISYNAEEGTVQSTELGRIASYFYVKHKSMQTYNRGLNERSSQ
                     MDLFRLIAMSGEFEYLSVRPEERKELKELLERAPVPVKEDADDCLAKINILLQSYISR
                     MKFEGFALSSDMTFIKQNAGRISRALFELSLKKGYSQTSKRLLDICKMIERRAWVANS
                     PLRQIKDCPKELIKKTEASTLSWQDYMELESPAQVGQAVRSEKYGKMVYDLLRRFPKL
                     ILKCSIQPLTASLLRLELEILPDWIWESKFHGFGEQFLVLVEDTDGEKILYSDTILIK
                     RNDLYETRILEITIQLSAAQQKRLPPNFFISAISERWLNCETQLVVDMQQVRLPRKFP
                     APTPLLDTKLVPTSEVNVEEFSEVFGFTAFNKFQSQVFHSVYNSNANVFIGAAKGTGK
                     TVLAEIALLNHWRQNKGRAIYINPRQEKIDYLIQNWTKRFSGLAGGKDIDKLGLETTL
                     NLRIIAQSHLILATPEQFEVVSRSWRQKKNLQNIDLLIYDDVHEMSNGLDGATYEILI
                     SRMSFISNQLDNKTRIVALASCIANGRDLGEWLGVSKGNIYNFSPQEKAAPVEIQLNS
                     FDQPPNVAYNLSMVKSAFEFAHANATSTSIIYLPTRTSCFKVAADMAKYGVDRDWNMS
                     KLEEHGPPHLSIHATQDPLLESPLRMRIGILYQNMTSKDRKLVLQLYSHNELSVLLVT
                     RDCCFYAPNSKSVIILGTQYYEGKEHRYVNYTANEILEMAGTAQDKHSGGTSKALILT
                     NKNSKDYYKKFLLESVPVESSLYFSIHDLLIAEISSSVIRSKQDCVDWLAYTYFYRRL
                     HANPSFYGVKDVSSYGISAYLTELVEGTLTDLQNSSVIEIEDNEGLEDAGAQEVEEMI
                     APLTGCLVSAHYNISFLSLNMLLTSLSGGATQQDILKILSKASEFDSIPLREDEMSVV
                     QKLNQLVPFKVDDISGANLLNSKVYLLLQAHFSRLKLTPELSFDLEVVLGKSVSLISA
                     IVDILSGDGRLNAMTAMDISQMITQGMWDTDSPLKQIPFFSGEILAKCANKNVETVYD
                     IMALEDEEREGIMPSDESEVFEIANFVNNYPNIELEYRIEQTGTFKAGERTTINVTLT
                     RDEMPETLVVNSKKLPFERLESWWVVVGEVATKQLHAIKKVSLRRDVQTFDLEFTPEK
                     GDHRLTVWCVCNSYLDADKEVSFSLNVE"
     gene            complement(<528835..>531162)
                     /locus_tag="HG536_0H03000"
                     /db_xref="GeneID:59328191"
     mRNA            complement(<528835..>531162)
                     /locus_tag="HG536_0H03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285703.1"
                     /db_xref="GeneID:59328191"
     CDS             complement(528835..531162)
                     /locus_tag="HG536_0H03000"
                     /inference="similar to AA sequence:RefSeq:NP_011098.3"
                     /note="ancestral locus Anc_8.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141599.1"
                     /db_xref="GeneID:59328191"
                     /translation="MKFYIDDLPVLFPYPKIYPEQYKYMCDIKRTLDAGGNSILEMPS
                     GTGKTVSLLSLTIAYQMHYPEHRKIIYCSRTMSEIEKALIELENLMDYRTRELGFRED
                     FRGLGLTSRKNLCLHPIVSKERKGTVVDEKCRRMTNGQAKRQLENDPESKVELCDYHE
                     NLYNLEVEDYLPKGVFSFERLIKYCEERTLCPYFIVRRMISLCNIIIYSYHYLLDPKI
                     AERVSKEVSKDGIVIFDEAHNIDNVCIESLSLDLTNDVLKRATKGANALENRIQEVRR
                     VDAKKLQDEYDKLVKGLHTAEILEPGEEAALETPVLSEDLLTEAIPGNIRRAEHFVSF
                     LKRLIEYLKTRMKVLHVISETPKSFLQHLKQLTFIDRKPLRFCSERLSLLVRTLEVSE
                     IEDFMALKDIATFATLISTYETGFLLIIEPYEIENAAVPNPIMRFTCLDASIAIKPVF
                     ERFSSVIITSGTISPLDMYPRMLNFNTVLQRSYAMTLAKKSFLPMIVTKGSDQVAISS
                     RFEIRNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESIISMWQTMGILDEVWKH
                     KLILVETPDAQETSLALETYRKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIG
                     IPFQYTESRILKARLEFLRENYQIRENDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLA
                     DRRFSRKRNQLPKWISQGLSDADLNLSTDMAIANAKQFLRTMAQPTDPKDQEGVSVWR
                     YEELLQYQQEEKSKRKQQNGDGTIQDEAPVDVEME"
     gene            complement(<531361..>532053)
                     /locus_tag="HG536_0H03010"
                     /db_xref="GeneID:59328192"
     mRNA            complement(<531361..>532053)
                     /locus_tag="HG536_0H03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285704.1"
                     /db_xref="GeneID:59328192"
     CDS             complement(531361..532053)
                     /locus_tag="HG536_0H03010"
                     /inference="similar to AA sequence:RefSeq:NP_011097.3"
                     /note="ancestral locus Anc_8.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141600.1"
                     /db_xref="GeneID:59328192"
                     /translation="MSTQLMKPVRLLILGAPGSGKGTQTARLLTKFPQLNSISSGDLL
                     RQQIQKKTPLGSLAASYIFEGKLLPDEVVTRLIKGHLQQAGWLSREATWLLDGFPRTL
                     EQGKMLRAALSKYDTGLTLVVELDVPESVILERIENRYVHVPSGRVYNLQYKPPKIPG
                     IDDITGEPLSKRPDDTAEVFKRRLDEYHRTASPLKEFYAQRGLLETVSGDTSDIITPK
                     LFELIEKHRSEH"
     gene            <533084..>536773
                     /locus_tag="HG536_0H03020"
                     /db_xref="GeneID:59328193"
     mRNA            <533084..>536773
                     /locus_tag="HG536_0H03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285705.1"
                     /db_xref="GeneID:59328193"
     CDS             533084..536773
                     /locus_tag="HG536_0H03020"
                     /inference="similar to AA sequence:RefSeq:NP_010382.3"
                     /note="ancestral locus Anc_8.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141601.1"
                     /db_xref="GeneID:59328193"
                     /translation="MTTKTTGSGQKRMKQSSLLSFFSKQPHSPSPAARKPVRKLKNGT
                     ETLPNGFSKELKKPANKLLFVGMDEDESDASGFVTANDSINVPDVVQKLAEEKAEAEK
                     SSSISKQHDLEEDGEKTLSNADSPKNKGDSSIAAEGGESTLSSSGRRMKENVSYAEAS
                     DESDTEQTPNVPRKRRRMQTEVVDDEDEYVPDKKESEDDVVMDDDDDDGDLLELAETS
                     SPKVVKRAAKLTPSRLPRNLVSRSNVDRVSSPPKHQKFNKQNEERYHWLVELRDASGR
                     PVTDPQYDPRTLYVPQSAWSKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAIL
                     GNHLFDLKIAGGGRANMQLAGIPEMSFDYWASQFIQHGYKVAKVDQRESMLAKEMREG
                     SKGIVKRELQCVLTSGTLTEGNMLQSDLATYCLAVREEPGNFYAMQEESKPIAGTAKR
                     LFGVSFIDAATGELNMIEFEDDDECTKLDTIMSQVNPKEVIMEKDNLSNLAHKIVKFN
                     AAPQAIFNYIKPDTEFYGYERTYDELTSSDSKYFADITQWPAVLRKYYEQGKRIGFSA
                     FGGLLYYLQWLKLDESLLTMGNMKEYNPTRFKNSLIMDGVTLQNLEIFSNSFDGTDKG
                     TLFKLFNRAITPMGKRMMKNWLMHPLLQKDKINERLDTVEALLSDSNLRDVLETAFAK
                     LPDLERLLSRVHSRNLKVKDFDKTIQGFETITELLETLSSHNLNGSLLNYVSTIPKSL
                     IADVQSWSNAFDRTKAVDEGVLIPQRGVEQDFDESLDKILQLEEQLEDVLNTYKKQFK
                     CSTLQYKDCGKEIYTIEVPVSIANKIPSSWVQMAANKTAKRYYSDEVRALARSVAEAR
                     ELHKVLEEQLKDRLCKKFDMHYGTSWMPTVQIIASIDCLLALVRTSESLGQLSCRPQL
                     VDEIDGKTGAPLNGFLKFKSLRHPCFNLGTTSAKDFIPNDVELGKDYPQLGLLTGANA
                     AGKSTVLRMTCIAVIMAQMGCYVPCESAILTPVDRIMTRLGANDNIMQGKSTFFVELS
                     ETKKILDLATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATHYASLG
                     QCFTGHPQVRPLKMSILVDEKAKNVTFLYKLIEGQSEGSFGMHVASMCGISKEIVENA
                     QKAAENMEHTSNLVKQKIAALNSHHDNVTSLSLGVESDFVRLVFGDGLKNTRLGTGEN
                     VQIYDNNIKRNVLTSLFSIIESLDG"
     gene            complement(<536886..>539411)
                     /locus_tag="HG536_0H03030"
                     /db_xref="GeneID:59328194"
     mRNA            complement(<536886..>539411)
                     /locus_tag="HG536_0H03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285706.1"
                     /db_xref="GeneID:59328194"
     CDS             complement(536886..539411)
                     /locus_tag="HG536_0H03030"
                     /inference="similar to AA sequence:RefSeq:NP_010381.1"
                     /note="ancestral locus Anc_8.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141602.1"
                     /db_xref="GeneID:59328194"
                     /translation="MSGCEVAEVVDGVPVFRPSFEQFQDFYSFVRSINEYGMRSGIVK
                     IVPPQEWLDMVDFPPKREILQGIKIRKPIQQHIAGAQGVFMVQNVEKSKVYNIIQWKD
                     LSRDYTLPDSPGNGNGEGRLPSPPVKSSRIKLRNPDNFSAENFEEFRDHFNADNLREF
                     DDAQRLESLESYYWKTLNFTAPMYGADTLGSVFPQDLKIWNVAKLPNLLDQMEQKLPG
                     VNNSYLYAGLWKASYAWHLEDQDLYSINYIHFGAPKQWYAIPQEDRDKFYRFMKDQFP
                     MDAAKCPEFLRHKMFLVSPKLLRKNGIRCNKIVHRQREFIITFPYGYHAGFNYGYNLA
                     ESVNFALQEWLPIGKKAGKCLCVDDAVGIDVDKLADKWNATKKEELKPQLHVPDTADQ
                     ENRLKSFGELLNHSSQELQQLEENKTMPMLGSGINRPQSSSIRSTTPNSSQYLNMNQT
                     ISRISSPLLSRMMDLSNIVEPTLEDPTLRFKKKLVPSQLQSTGIHSNSGSPNASMRMT
                     LPTNDTNNNGNGLTMPSMGVGASNPPSALLDDNDDNMLALSLASMANSGASSPRLTLP
                     SLNSPIEHANPPSGANANSTVQEQDSTQNNSIVSPKPSYSHNPLSYYSAATAKPVTSS
                     GGLAPLSPTTSNLPFIKKLKSPNIVTLNISRESSRSPVSFANDYRTPLAPNNPLAYSS
                     SVSSTLNQVHNFNSTSTSSSVAEGSPSPKPPEAKRPKLESKVFSPTSATKRKQDLINT
                     SSSQPPKFSSSEIVMSENGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGK
                     KFKRRDHVLQHLNKKIPCTQEGEGLSTAPKRENGGRVEQSGTV"
     gene            <540023..>541657
                     /locus_tag="HG536_0H03040"
                     /db_xref="GeneID:59328195"
     mRNA            <540023..>541657
                     /locus_tag="HG536_0H03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285707.1"
                     /db_xref="GeneID:59328195"
     CDS             540023..541657
                     /locus_tag="HG536_0H03040"
                     /inference="similar to AA sequence:RefSeq:NP_011095.1"
                     /note="ancestral locus Anc_8.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141603.1"
                     /db_xref="GeneID:59328195"
                     /translation="MWSTRRLWKWNLDRVMSSVDSCAVGMGLPSFRLDKVERGICGLL
                     NDFTREYNERNKLKEPLTLRISGGWVRDKILGRESHDLDISINVMSGEQFATQLSRFL
                     TENFDKYGVKPHSVHKIGINPAKSKHLETATTKLFGVEVDFVNLRSEEYSDHSRIPVT
                     KFGTAREDALRRDATLNALFYNIQLNRVEDFTGTGLQDLKNGILRTPLPPRQTFLDDP
                     LRVLRLIRFASRYNFRIEDSVLKEMQDPEINAAFSTKVSNERIGTEVEKILEGPNPLL
                     GLALIQKTHIENVVFSWHHDVDLINFNKQHCKDLPVIDRLYDDGVLNAHLCKVVENFE
                     SFVSDLGTLSSLMAGSAEWKRSFILSACLMPMEGLKIIWTTRKTMNNTMPAVESILKD
                     GLKIGKNGAAQVSRVVDSLTSYEQMIKKFSEDRAQLSRSDIGIFLRSLKGDWQITHFV
                     SLFKQYPGCEKRQLVQVMEQYASFYDYVYAEQLENCHDMKPLINGKEMVSLLKMKGGP
                     WLGKINDRAIMWQLDHPSGTSEELLDYVKSILPEYT"
     gene            complement(<541806..>544244)
                     /locus_tag="HG536_0H03050"
                     /db_xref="GeneID:59328196"
     mRNA            complement(<541806..>544244)
                     /locus_tag="HG536_0H03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285708.1"
                     /db_xref="GeneID:59328196"
     CDS             complement(541806..544244)
                     /locus_tag="HG536_0H03050"
                     /inference="similar to AA sequence:RefSeq:NP_011094.3"
                     /note="ancestral locus Anc_8.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141604.1"
                     /db_xref="GeneID:59328196"
                     /translation="MSKQSPRISSSGAESVNKWKIPHYYRRSSAASSLQSNGSDSANG
                     STPSTPGVNIMSSPKKVLMEDPKKGTKRPVYRSRKSKKKNGEMVFVNYTVQDSASEDS
                     VTSVHTPELPTAGASPVLNSKKKSSRSRMLKIFGSSKAPPAVIGGSNLVSCAENEVMS
                     DPYAVSTTSAPAKRSYGSFLKYGKFHGSSAHNRGNEPVPGLLSEEVVPKSVYSPNLVK
                     PAPIGRFVGDSPRKVGYLGGGNPNVESVESPMEYRYLGTNHASSAAELGAYPYSKASF
                     SESVIGAKKHADENDASIAFSKMFSRKRANTGGSESSLLSLSHNAQEQLQSTMVPALR
                     KNMSASSISSISYRSPIRTASPARPRSGTRGSYTHAVSSHSRADSQDAGSFIGAESFL
                     DSQMANRSGSAAKHRRKQESISESHRLYNSSATNSTVVNSSGNQSVVTPSSSSLVTPP
                     PFTSGYSVPSNTSASSTPSAMDLTLASQTGSFGNLVNSISSINPAGNHSTLNVSQPVL
                     DRDSSSELLFEESDIPTPVDNLPALRSMTKALETKVEDSIGQIVPSQGAHRGFNTNDR
                     ETKRSHQNIDVLDAFLPHEGSTSSSQGGSILTKSTSSVSDNIVIGHWQDQGCYSLIDA
                     GPGGAGIREKTIPASAFNLSGGTTAVESLEYEAFESQIFLGHNYQQDEQSHQVDMEFD
                     FVNSGNFLNKQKEISPGGSNSSGQVEAVEGTSANGQNSAVTSIANFSPGTNATVSVEE
                     VGNSGVYHRNFDRLGAHANSLSHAGPKAGQPLPLYSMGQWKAINSDLEAITDSLGIGG
                     EMNDTPYMYQPNRG"
     gene            complement(<544803..>549611)
                     /locus_tag="HG536_0H03060"
                     /db_xref="GeneID:59328197"
     mRNA            complement(<544803..>549611)
                     /locus_tag="HG536_0H03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285709.1"
                     /db_xref="GeneID:59328197"
     CDS             complement(544803..549611)
                     /locus_tag="HG536_0H03060"
                     /inference="similar to AA sequence:RefSeq:NP_010378.1"
                     /note="ancestral locus Anc_8.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141605.1"
                     /db_xref="GeneID:59328197"
                     /translation="MSNLPDSPFNDEPPMSPFDDKFEFEEQQNGKANTRRKGSILKKH
                     GTHKNPKTTGLGVAFQEDKLPEFEEAARPFDEEEDDDAHSFKATPKMGGPAAMFEDVT
                     LDDPSSSDKSDRKHHGGMKRLRMGTQRNKKGRPNVGRARTLKWAKKNFHNPFEEFLKE
                     EMDDEGLQNRASELRTLYYNLPLPEDMLDEDGKPIINYPRNKIRTTKYTPLNFLPKNI
                     LLQFRNIANIYFLVMIILGAFEIFGVTNPALNAVPLIVIVTITAIKDAIEDSRRTVLD
                     LQVNNTRTHILQGIDNQNVSADNVSWWRKFKKANTRLLLRFVAFCKSHLTEEGKRKRL
                     QQKRRKMQAKRNSMGDMPRNSLDSIGSYRMSADFARPSGDYGRPSMDYDNMGHLVGRD
                     DDVNLIDRTMPPIPDCRFAKDYWKNVKVGDIIRIHNNDEIPADVVLLSTSDADGACYV
                     ETKNLDGETNLKVRQSLKCSFRIRNSRDITRTKFWLESEGPHANLYSYQGNLKWIDPN
                     NNEMRNEPVTINNTLLRGCTLRNTKWAMGLVVFTGDDTKIMINSGVTPTKKSRISRDL
                     NFSILINFGLLFVLCFISGVVNGVYYREKNVSRDYFEFGTPAGNPATNGFVSFWVALI
                     LYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIF
                     SDKTGTLTQNVMEFKKATINGVSYGRVYTEALAGLRKRQGVDVEAEGQREREEIARDR
                     DVVINELKAMANNSQFNPDDLTFVSKEFVRDLQGQNGKLQQNCCEHFMLALALCHSVL
                     VEPHKSDPNRLELKAQSPDEAALVGTARDMGYSFVAKTHKGLIIEIQGVQKEFEILNI
                     LEFNSSRKRMSCIVKIPAMSAEEKPKALLICKGADSVIYSRLKRSSDANDESLLEKTA
                     LHLEEYATEGLRTLCIAQRELSWAEYSEWNERYDIAAAALSDREQQLDEVADSIEREL
                     VLLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELL
                     VIKHSGNDVEEFGDDPFSVVQNLILKYLRERFGMSGSEEELAEARKEHGFPKGNFAVI
                     IDGDALKLALSSDEIKRQFLLLCKNCKAVLCCRVSPAQKAAVVNLVKKSLDVMTLAIG
                     DGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEM
                     IPQFFYKNVIFALALFWYGIYNNSDGSYLFEYTYLMFYNLAFTSLPVIFLGIMDQDVN
                     DTISLIVPQLYRVGILRTEWNQTKFLWYMFDGVYQSTICFFFPYLIYHKTMYVTQNGY
                     GLEHRYYLGIMVTAIAVVACNLYVLLHQYRWDWFTGLFIGLSCIIVFGWTGIWSSSLR
                     SNEIWKAGARIYNTPAFWAVFFVAVLFCLLPRFTLDCFNRMINPKDVEIVREMWKRGD
                     FDQYPTGYDPTDPNRPKISKNRSFGAQVLTLGDGGKLQSSLNENYSRDTVLTEEIPMT
                     ILQTQNGSSRQIVRGEPWMSSPRETQNLLHSPRLQEQEEQSKRMNSALRPSLDARRGR
                     TSLDRTREQMRASNELDARYSLDRARTSLDLPGVTNAEELMRRTSKDYVN"
     gene            complement(<550012..>550571)
                     /locus_tag="HG536_0H03070"
                     /db_xref="GeneID:59328198"
     mRNA            complement(join(<550012..550455,550542..>550571))
                     /locus_tag="HG536_0H03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285710.1"
                     /db_xref="GeneID:59328198"
     CDS             complement(join(550012..550455,550542..550571))
                     /locus_tag="HG536_0H03070"
                     /inference="similar to AA sequence:RefSeq:NP_010377.3"
                     /note="ancestral locus Anc_8.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141606.1"
                     /db_xref="GeneID:59328198"
                     /translation="MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFEVTIEGPQQ
                     SPYEHGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDKLGRICLDVLKTNWSPALQIR
                     TVLLSIQALLASPNPNDPLANDVAEDWIKDEEGAIRKAREWTELYAKKKDSSDGS"
     gene            complement(<550949..>552721)
                     /locus_tag="HG536_0H03080"
                     /db_xref="GeneID:59328199"
     mRNA            complement(<550949..>552721)
                     /locus_tag="HG536_0H03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285711.1"
                     /db_xref="GeneID:59328199"
     CDS             complement(550949..552721)
                     /locus_tag="HG536_0H03080"
                     /inference="similar to AA sequence:RefSeq:NP_011092.1"
                     /note="ancestral locus Anc_8.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141607.1"
                     /db_xref="GeneID:59328199"
                     /translation="MADITDKTVQQLEKLNIQDDQQTAPSASESETSKVETSSASLYV
                     GELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKAAIEKLN
                     YAPIKGVPCRIMWSQRDPSMRKKGSGNIFIKNLHPDIDNKALHDTFSVFGNILSCKIA
                     TDEAGNSKGFGFVHFEDEEAAKEAIDAINGMLLNGQEVYVAQHVSRKDRQSKMEEAKA
                     NFTNVYVKNINPETTMEEFEEFFSKVGPITSAHLEKDNEGKLRGFGFVNYESHADAAK
                     AVEELNETEFKGYTLHVGRAQKKHERLQELKKQYEAFRMEKLEKYQGVNLFVKNLDDS
                     IDDQKLEEEFAPYGTITSAKVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK
                     PLYVAIAQRKDVRRSQLAQQIQARNQMRYQQVTAAAAAAAAGMRGQFMPPMFYGVMPP
                     RGMPFNAPNPQQMAAMGGMPKNGVPPQQFRNGPVYGVPPQGAPQQGNFMRNGAGANQF
                     YQQKQRQVLGEQLYKKVFAKTSDEEAAGKITGMILDLPSQEVVPLLESDELFDQHFKE
                     AFAAYESFKQEQEQQQQQQQQQQN"
     gene            complement(<553216..>557601)
                     /locus_tag="HG536_0H03090"
                     /db_xref="GeneID:59328200"
     mRNA            complement(<553216..>557601)
                     /locus_tag="HG536_0H03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285712.1"
                     /db_xref="GeneID:59328200"
     CDS             complement(553216..557601)
                     /locus_tag="HG536_0H03090"
                     /inference="similar to AA sequence:RefSeq:NP_011091.1"
                     /note="ancestral locus Anc_8.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141608.1"
                     /db_xref="GeneID:59328200"
                     /translation="MTSSKAFSDEVMENPELYGLRRSHRSTAQNQASYYSNDSDSDED
                     VVSSSRRRRKAYDEDAEIDEIEEDEDEDEFTADEGDSDFHGSPVKGKVARDRKRLPFV
                     KKTKQKEEKIPTRFSSRNNKNINYNVDYSDDDLLESPAEDEEDLESGAEDAEEYEYEY
                     SATPQPEEDHGVDFVVTHRLKEGTNEAVLKSVPSLDDCREKFEFLIKWSDQSHLHNTW
                     ESYESLSNVRGTKRVDNYCKQFIIEDLQIRLDPYVTAEDLEVMDMDRERKLDEFKEFQ
                     QPERIIDSSRVTLEDGSSQLQYLVKWRRLNYDEATWEKATEIAELAPEQVKHYQGRAN
                     SKILPQYSSSYTSQRPRFEKLSTQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILAD
                     EMGLGKTVQTVAFISWLVYARRQNGPHLIVVPLSTMPAWQETFEKWAPDLDCICYMGN
                     QKSRETIREYEFYTNPQAKGKKNTKFNVLMTTYEYILKDRSELSSIKWQFLAVDEAHR
                     LKNAESSLYESLNSLKVSNRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQ
                     DDEQEEYIRNLHERLQPFILRRLKKDVETSLPGKTERILRVELSDVQTEYYKNILTKN
                     YSALAAGAKGGHFSLLNVMSELKKASNHPYLFDNAEERVLEKFGDGSRSRGNILRGLI
                     MSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRILDILGDYLQIKGLNFQRLDGTVPSTQ
                     RRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHR
                     IGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGKKYTKKNEPSAGEL
                     SEILKFGAGNMFAARDNQKKLEDLNLDDVLNHAEDHITTPELGKSHLGGEEFLKQFEV
                     TDYKADVDWDDIIPEEELKKLQDEDQKRKDEEYVQEQLQLMNRRSNALKKIKDSVNGD
                     GESRYSDDDEDTKSSRKRAKANNLDLIDEREIRALYKAILKYGVLTDQFETMIADGSL
                     PLKSIERYEEVYADLIASAKEHLQKEETKRNQIFESLEKEAQAYKAKLKNGSIKANDQ
                     PKENPLTKLAAKRKEKRAVLFEYENVKNLNAESLLNRIEDLTLLKTYINENFKDDPSK
                     FQFNRPLKAVQNWNCDWTKDNDDKLMVGIYKYGYGSWAQIRDDPFLGLTNKIFLNEPQ
                     AVSSNKGKKAEESPAGENVSEKRGKGIAGSSKKVPGAIHLGRRVDYLISVLREEINGS
                     TPAAHSPSGANTPTVDSSSERLPTGPAKKKQRKNPATTSKAGSPDPTKSETSSSTSAR
                     RMKPLPKGPAAMTNGRPPPQASKPPHIARPPSSPTSNKHEKEYDSMDDEECMHSMGDM
                     RASLKRLRRGGKGLDRKEWARILKTELTAIGDHIEKQKSSSRKTDAAKFKKHLWSYTA
                     NFWPAQVKSAKLMAMYDKITGSINT"
     gene            <559021..>560844
                     /locus_tag="HG536_0H03100"
                     /db_xref="GeneID:59328201"
     mRNA            <559021..>560844
                     /locus_tag="HG536_0H03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285713.1"
                     /db_xref="GeneID:59328201"
     CDS             559021..560844
                     /locus_tag="HG536_0H03100"
                     /inference="similar to AA sequence:RefSeq:NP_010376.3"
                     /note="ancestral locus Anc_8.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141609.1"
                     /db_xref="GeneID:59328201"
                     /translation="MSDKNTRLAVVNADKCKPKKCRQECKRSCPVVKTGKLCIEVTPT
                     SKIAFISEVLCIGCGICVKACPFDAITIINLPTNLNSHVTHRYSANSFKLHRLPTPRP
                     GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML
                     EDNIKAVIKPQYVDNIPRAIKGPIQKVGEILKLRMEKPQDLVDYYIKVLDLQNVMNRE
                     IANLSGGELQRFAIAMSCIQDADVYMFDEPSSYLDVKQRLHAAQIIRSLLDPTKYVIS
                     VEHDLSVLDYLSDFVCILYGVPSAYGVVTLPTSVREGINIFLDGHIPAENLRFRTEAL
                     QFRMSDANDDLRDDSTREFSYPAMKRTQGDFVLNVEKGEFSDSEILVMMGENGTGKTT
                     LIKLLAGVIAADDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDV
                     VKPLRIDDIIDQEVQHLSGGELQRLAIVLSLGVPADIYLIDEPSAYLDSEQRIICSKV
                     IRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGVPSKDAHSGSPEPLLTGCNRFLKN
                     LNVTFRRDPQSFRPRINKLDSQLDKEQKASGNFFFLDSASV"
     gene            <561330..>562337
                     /locus_tag="HG536_0H03110"
                     /db_xref="GeneID:59328202"
     mRNA            <561330..>562337
                     /locus_tag="HG536_0H03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285714.1"
                     /db_xref="GeneID:59328202"
     CDS             561330..562337
                     /locus_tag="HG536_0H03110"
                     /inference="similar to AA sequence:RefSeq:NP_011088.1"
                     /note="ancestral locus Anc_8.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141610.1"
                     /db_xref="GeneID:59328202"
                     /translation="MSFLSKISNLRKSLPATAPKEKPKTDRKVENDEYSILPKNYIRE
                     EDPAVKRLKELRRQELLKSGELSKKARSQSKSNVHRKKTETDDGYSAGTRFKKKIGAS
                     AAAPGVPSMPRTSEPIKKLSFEELMQQAENNAQKTGSDEGKSQSEVTADQKAKGQLPS
                     RNYDKKISFKKRIDGNSRPATSSRPQRRGTEPQKKQPEAVRVRAVGAGLAQPNEKIRR
                     QLEQRKRQSRQQRKEIEYESDLDDFIEDDTSETYGRGSSRDEGQYDRDEIWALFNRGK
                     RRSDLMFDDYEDDDMEANEMEILEEEEKAGMMARLEDKREEEWLKKHEQEKKRRKRMK
                     G"
     gene            complement(<562768..>565197)
                     /locus_tag="HG536_0H03120"
                     /db_xref="GeneID:59328203"
     mRNA            complement(<562768..>565197)
                     /locus_tag="HG536_0H03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285715.1"
                     /db_xref="GeneID:59328203"
     CDS             complement(562768..565197)
                     /locus_tag="HG536_0H03120"
                     /inference="similar to AA sequence:RefSeq:NP_010374.1"
                     /note="ancestral locus Anc_8.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141611.1"
                     /db_xref="GeneID:59328203"
                     /translation="MKFGTKILNKSVPEWKLHNIDYEKLKKAIKRATVTSADGNDREN
                     LENCTQLFKEQFGSINVFTSLKVKEISSRLVAIEASIINFKKRFSDAEDNRKLRSRQI
                     KLISTHLDNCSSELQRLSRYLILQKIAVGKLFKKLIKHYPGGAQQARAYIQEIRELPE
                     LVDGYGGISFTKVDLDPYLLEVSLIVNVLHHLRLGLSEAVATSAKGNIDSSLAFDTQF
                     CGRFASLQKFLISAENLEEFKFMILHHGFHVVADEIISTSRSIREASGSLNTMETRSI
                     RSARSFKALQQVVTCQQPANLSGSPASMLQEQEIHVGKPVSSGTLFHSTSPRLCLSIL
                     DSKDKPSLLEDDTINQHPNLVMISGNGENHCVVMCHVGGLRDHLETADLSYREVAQIW
                     DGETIDLESQEMQERPPMAKLAIEWIQSRRLKPVEPKIYFKRVRFICNEDDKTYLIAL
                     DEEITIDNLGTLPHAFVEIRKLPAPLASDDFDDKLVDLCEALIENKTQAYPLSSNMTL
                     WRLCFELRHSKELQADLFDTILKEEFDLEDESPTSEDFFLLGKSSTLQKCSDKFRSNF
                     ESEDMNKRRSTIHVTPKEQQSIEKPRVRYWNEFDDDPEFYNDNGFYIDGTHGSADGEG
                     VNPNSGCGFILFNKQFIENTYRLCQRVSGWFDLRDTKLVPVDASRYGSIGESTSSASA
                     NSINDVEAYLAEEDDESGQVYEYKHDQVITFMYLSSLLAACVTSGISFGIVLGLFHKK
                     ETDDDLEVADFLISMISLSLIISLVLICSSLLLLFSRYRLAPAWHYISCFVLFLLVIL
                     TVCYGFIEVFF"
     gene            565669..565741
                     /locus_tag="HG536_0Htrna11R"
                     /db_xref="GeneID:59328393"
     tRNA            565669..565741
                     /locus_tag="HG536_0Htrna11R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGU"
                     /db_xref="GeneID:59328393"
     gene            <565850..>566857
                     /locus_tag="HG536_0H03130"
                     /db_xref="GeneID:59328204"
     mRNA            <565850..>566857
                     /locus_tag="HG536_0H03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285716.1"
                     /db_xref="GeneID:59328204"
     CDS             565850..566857
                     /locus_tag="HG536_0H03130"
                     /inference="similar to AA sequence:RefSeq:NP_010373.3"
                     /note="ancestral locus Anc_8.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141612.1"
                     /db_xref="GeneID:59328204"
                     /translation="MGKDSTSENVHIPRYIKNQPWFYQDTKKDERLTGKDDYLVHHRQ
                     LKKGGALDIDNNSEPKLGLGIRDEFEKVQVVRTSKRGGNRCGNCGSLGHSRRDCLERA
                     RKVPRLDGDTGAVISVRKEAAGSSDWDARKDRWFGYTGKEYDEVLKKWENRRQTATQA
                     DEDWWDTDEEVELTKLGLYKDTGGILRAEEFGNTKLQRASVRLREDRAAYLNDLNAEE
                     IKYDPKSRLYKTESLGSVDEESKMFRRHLTGEGKALDELNRFTRAHARREGIRDEIES
                     DAKVKHVLIANPTKYERMLRQEQSKQPPRVGKITDLEARKSSGTAQSAKTKQDLKELY
                     G"
     gene            <566951..>567826
                     /locus_tag="HG536_0H03140"
                     /db_xref="GeneID:59328205"
     mRNA            <566951..>567826
                     /locus_tag="HG536_0H03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285717.1"
                     /db_xref="GeneID:59328205"
     CDS             566951..567826
                     /locus_tag="HG536_0H03140"
                     /inference="similar to AA sequence:RefSeq:NP_010372.3"
                     /note="ancestral locus Anc_8.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141613.1"
                     /db_xref="GeneID:59328205"
                     /translation="MVHSTGGPGSSTMDTNAFVKQLASNNRKVRENALETLQKYLNTK
                     QFKDATQMQFNKLWKGLYFAMWFSDRPRPQQRLANELSELHMIYFDQRDNKTASEQLS
                     LNDGAFIKFSRAFWKIICMEWFNIDRYRIDKYLMLVRRVLFNQLKYLKARQWDERLVD
                     TYIERVLKWLPLSASAKVYNGVPLHIMDIILDEWERVVKSDLDEQEDEIPGSDVANLI
                     EETPLVQFLEIFREINADVNNSKVLRNKIKSELLVDPRLAQWGVAAAANEPEPEASHD
                     DDDSDGEDAEEWHGF"
     gene            <568033..>568263
                     /locus_tag="HG536_0H03150"
                     /db_xref="GeneID:59328206"
     mRNA            <568033..>568263
                     /locus_tag="HG536_0H03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285718.1"
                     /db_xref="GeneID:59328206"
     CDS             568033..568263
                     /locus_tag="HG536_0H03150"
                     /inference="similar to AA sequence:RefSeq:NP_010371.1"
                     /note="ancestral locus Anc_8.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141614.1"
                     /db_xref="GeneID:59328206"
                     /translation="MAKGNEKKEAGSQIEKLADAPMEFVKDGRQFLSKCKKPDVKEYT
                     KIVRAVGIGFVAVGIIGYAIKLVHIPIRYLIV"
     gene            <568386..>568832
                     /locus_tag="HG536_0H03160"
                     /db_xref="GeneID:59328207"
     mRNA            <568386..>568832
                     /locus_tag="HG536_0H03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285719.1"
                     /db_xref="GeneID:59328207"
     CDS             568386..568832
                     /locus_tag="HG536_0H03160"
                     /inference="similar to AA sequence:RefSeq:NP_011086.3"
                     /note="ancestral locus Anc_8.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141615.1"
                     /db_xref="GeneID:59328207"
                     /translation="MLITLHTPRSPHRRDSTSGNEMDDAVLKEEPASAPEPATVSLTE
                     LQEVFDKIKTHFPPAKVKKIMQTDEDIGKVSQATPVIAGRSLEFFIALLVKRSSEVAR
                     QIGCKRISGEVMKETILNDEKFDFLRENVCGEAQEQESAQDSPADE"
     gene            <569101..>570771
                     /locus_tag="HG536_0H03170"
                     /db_xref="GeneID:59328208"
     mRNA            <569101..>570771
                     /locus_tag="HG536_0H03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285720.1"
                     /db_xref="GeneID:59328208"
     CDS             569101..570771
                     /locus_tag="HG536_0H03170"
                     /note="ancestral locus Anc_8.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141616.1"
                     /db_xref="GeneID:59328208"
                     /translation="MGSLSFDASHGIIWPTYAVMLIGSSVLAYWRHDSKKFLNANGTQ
                     KAVPLAFNFVASGLGCGVLSAYPQMANIDGLHGLLVYALASGLPMFVFALLGPMIRKR
                     TPNGFVLTEWVFHRFGLLTGWYLGACTILTVFLFMVSEIASLKFAVETIAGIKALPVI
                     IVECVVTTIYTSIGGFDISFLTDTVQVSVVFVLLIIVACAMGKYVEIDTSKIGPSGLL
                     KANKLGWQLVYILTLAIFTNDFFMSGFWLRTFASRSNKDLLIGCSIACFILVTFVTAV
                     GVTGFIAVWAGLIERADHENSASAFFILLAQLPSWVMGFALVFVAVLSTCTLDSLQSA
                     LVSSISNDVFRNSIPTLYVRGIAVAVMVPVVIVGLFAEDVLNIYLVVDLLSSSVVPVL
                     VLGLLNKLDGYWTGWEVVGGGLGGIVAVWIFGTDYYDSGKEGARLLLISNGLYVDDWG
                     TFGAFVAAPFGGLAVGGIIMLIRLTCAKAYRKENSLFHRASKRIGSITGIAALHRSYK
                     RLEARLVPAYTLSLSVADEDTESTLLQETATLNKKKSGNTYQTTSYAD"
     gene            <571118..>573193
                     /locus_tag="HG536_0H03180"
                     /db_xref="GeneID:59328209"
     mRNA            <571118..>573193
                     /locus_tag="HG536_0H03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285721.1"
                     /db_xref="GeneID:59328209"
     CDS             571118..573193
                     /locus_tag="HG536_0H03180"
                     /inference="similar to AA sequence:RefSeq:NP_010370.1"
                     /note="ancestral locus Anc_8.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141617.1"
                     /db_xref="GeneID:59328209"
                     /translation="MYSTVSGNCKDNSSVYSGSSTNTSNSAAAFGRNRRIIPRSNSTS
                     DLYEIPATTGLGSRRKKQLYASNVPEGSPAMVGSRMTRQTQPWTSRNRSQPSLQASNR
                     AGMDQCLSSGLYRSQSRSNSCYSLEQKSLLKSIPERRQPNYVLTPYQLQRKQMKDPFQ
                     FPNGESFTPRSRLGNNVPRSSSSTTLSSAGGAVPQSLSRSQSMNSLPLKPVRYQKPLA
                     AIPSSSTSPVGSGSSDSSCNSMRDHSSSGSTNLSSDPSAHSSNTALPLAAVEKSQFIL
                     VAKLAASGDAKRPLLPGAEKSNSLASTCSKSNGEESPSVVLISAPYNEKLEAKKDVKK
                     ECQKEKDLLLKRQPESGTKLGAFFKKIFSLSSSGSRSPSSSASSSSTSLVSLSQLSPL
                     NLTRRKKRRRVDADISGSPVSSPRSDGRSVPSRPKLEASQAKAESYDKVQAAGRSTEN
                     VDVHLSTVDDENDEDCDDILMDTDLVFDSLLLKADMGRPSYQQKQIELRQKLNRPPHS
                     DSSSVIGAVDARRKQTFKEAESNIDYELISEFSRLGTFIEDSSKADHANLPPRSARRP
                     KLPDKELARSFYHPVYGEADSAHYLIKRLYQDWKVVHLDETLHKGDGKAVLGEKRLRF
                     ADEIYVNDTWSQYDYQRSDKRFIKNRRRMMQLEKGGFIQAIKVELNEFKRNEMVVHQE
                     SVRFTHLFL"
     gene            573539..573610
                     /locus_tag="HG536_0Htrna9E"
                     /db_xref="GeneID:59328409"
     tRNA            573539..573610
                     /locus_tag="HG536_0Htrna9E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:59328409"
     gene            <573856..>574443
                     /locus_tag="HG536_0H03190"
                     /db_xref="GeneID:59328210"
     mRNA            <573856..>574443
                     /locus_tag="HG536_0H03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285722.1"
                     /db_xref="GeneID:59328210"
     CDS             573856..574443
                     /locus_tag="HG536_0H03190"
                     /inference="similar to AA sequence:RefSeq:NP_010369.3"
                     /note="ancestral locus Anc_8.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141618.1"
                     /db_xref="GeneID:59328210"
                     /translation="MEHARTFYETILKSSHPLMLSFHLGAKAAPVIFYMVGSLFLNFT
                     AQFIVVVLLLTGDFYFTKNISGRKLVQLRWWYDPTTENAQTFRFESYKQYPPGPPINP
                     IDAKLFWWSMYLTPAIWTVFALLCVLRLKIFYFLLVAVGMALTGWNAYGFRTCDKWDP
                     NGTSTVESWFQMPAIPGLQNLSRVTAVQSFFQGRS"
     gene            complement(<574496..>575707)
                     /locus_tag="HG536_0H03200"
                     /db_xref="GeneID:59328211"
     mRNA            complement(<574496..>575707)
                     /locus_tag="HG536_0H03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285723.1"
                     /db_xref="GeneID:59328211"
     CDS             complement(574496..575707)
                     /locus_tag="HG536_0H03200"
                     /inference="similar to AA sequence:RefSeq:NP_010368.5"
                     /note="ancestral locus Anc_8.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141619.1"
                     /db_xref="GeneID:59328211"
                     /translation="MSLFQVDGWDLKTDKVAFFDANAAKTEEKKKNKKAKKDKLKKDR
                     QSRKSQVINQEIDEPSDSELDGQALSVNDSRPRTAESKNIKEKSKGNKRLSDNQIQST
                     VPEKKQNVSQSVGSSKKSLTPLQQKMMAKLTGSRFRWINEQLYTISSDKALEMLQNQP
                     QLFDEYHEGFRSQVTSWPENPVNVFVEQIQQRAKKPVNAPGGLPGLQDSKKIVIADMG
                     CGEAQLALEVNNFFKKFNKNAKKHKQRTHEVHSFDLKKANERITVADIRNVPLPDNSC
                     TIVIFCLALMGTNFLDFIKEAYRILAPRGELWIAEIKSRFADETGDEFVNALKLMGFF
                     HKKTDNENKMFARFEFFKPPQDIIEERKAKLERRHKFIEVETEKEQLENKRVKVSEGK
                     WLLKPCIYKRR"
     gene            complement(<575920..>577326)
                     /locus_tag="HG536_0H03210"
                     /db_xref="GeneID:59328212"
     mRNA            complement(<575920..>577326)
                     /locus_tag="HG536_0H03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285724.1"
                     /db_xref="GeneID:59328212"
     CDS             complement(575920..577326)
                     /locus_tag="HG536_0H03210"
                     /inference="similar to AA sequence:RefSeq:NP_010367.1"
                     /note="ancestral locus Anc_8.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141620.1"
                     /db_xref="GeneID:59328212"
                     /translation="MGSYDHVAHQEGDLIFFVPPLFLHSRYYRGEVVRLLIGDLWQCI
                     EKSRNVCVEYYQYNASCLFWKNHPIRRLCVLGTVMGFKWKWIDGEDYVFLFVDDFTSR
                     PDDQSKFLACRCRKDLLLSYCLSIEQLTGKRLRLSGKIDVHSGELSVDDIEMCYDLMA
                     EIEHWELCLMQRRDLNRPWELSRQICENTLTQDSWGQVGGNEDITAFATPLKPRNKQD
                     FVEALLIEDYKQELEIVSPYRDASQREDETSDVCLNPKRLNFVIESSVPQTSEPSLLK
                     PESSQGNPERNRTDKSIFTCSESEARVQVLKYLLSRPDRAIPVVELYQASQINDIVSD
                     ISTIIFNRQNLVLVKPFELLKSETFFEIIRKLVASGLVKYSSQNVIDSTPLKSLYKYF
                     TDRLQGLLKLQLYSGVVEIRQIREKPSLLGVSHKAILEVLKEALRVLVNKNPDAIAGW
                     WIETKEKESIHIHLEYSQ"
     gene            <577542..>578006
                     /locus_tag="HG536_0H03220"
                     /db_xref="GeneID:59328213"
     mRNA            <577542..>578006
                     /locus_tag="HG536_0H03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285725.1"
                     /db_xref="GeneID:59328213"
     CDS             577542..578006
                     /locus_tag="HG536_0H03220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141621.1"
                     /db_xref="GeneID:59328213"
                     /translation="MSERPPVTCHVLDTATGKPAANVVCSVYKIDLVEEASSTGIGLL
                     REASTLEPFAMARTDADGRVPRWTFDPTPSKRQQLEEVGVVQDTTGDRLHWEKLPPGT
                     YKIRFHAGQYYKSLGQTNFHPFADVIFTVEDSRHYHIPLLLSNYGYTTYRGS"
     gene            <578475..>580880
                     /locus_tag="HG536_0H03230"
                     /db_xref="GeneID:59328214"
     mRNA            <578475..>580880
                     /locus_tag="HG536_0H03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285726.1"
                     /db_xref="GeneID:59328214"
     CDS             578475..580880
                     /locus_tag="HG536_0H03230"
                     /inference="similar to AA sequence:RefSeq:NP_010366.1"
                     /note="ancestral locus Anc_8.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141622.1"
                     /db_xref="GeneID:59328214"
                     /translation="MLSIEQRYNICLMAERHPKWTQLELARWAYETFQLPKIPSQGTI
                     SRLLAKRDVYMNCKDNEKAANRVRKPNNVLVRLILQEWVSQSIWNGIPINSPIIQDTA
                     QSVWYRIPAEHREGNGSFSYKWINNFLAKMDINISNLDEELPKPPKIWTFEERNALKQ
                     IFATIPSQDIFTLDETFLAYNLPLDYAQYEASQIQRVIEVATVMLCSNVEGTEKLKPV
                     VVGKYNSYRSFRNYFPEEPSDPISQSLLGEKMARRFGISYHSNRKSWLTSNLFHDWLA
                     RWDKRLAADNRNIWIILDDSCSHRIINPHLKNIKLVYTSANSRFLPFNWGVLDEFKTR
                     YRIQQYQALIDLQSTLEKKTNKKLYITFEQSQLTMSNAFKFIKKAWMGIPVETIRANW
                     KSSGILPPEMIRLDETVSMAFKKNEALEAELNSLCDKFYCKKKWDHDMLLDLNIENKN
                     TNFLSTEELVESAIVDLVEPDPNISKRSATPTLNQITDYSNFDLLNDRNLNLSLNQAG
                     NTADLESESDEDLSRENIVSNTSNDPHNIAMLQNPHERGNVENSYDMNLDKILDGNYT
                     QENTDKIYNVSTLIDKPNLFTGENGVLDLRVVGIDASIVPSDYFDDMFPPAVSGSAAS
                     NIANNTTGGLNTQPRQAESSYTNTAVPVNSTAANTAPIVPFGDPALNHLLDSAVASNK
                     EVTPPSVPDFPLESNPGATLQSNINIAKSLGNILKHTETRELSFSDAAIAEIKFNYDS
                     LLKKIKKVRKQKHNMKTRRGQVQLDRYLGGSPSSPNSTNFSSSGNLHDSVDLQLPGNS
                     SFF"
     gene            complement(<580950..>583607)
                     /locus_tag="HG536_0H03240"
                     /db_xref="GeneID:59328215"
     mRNA            complement(<580950..>583607)
                     /locus_tag="HG536_0H03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285727.1"
                     /db_xref="GeneID:59328215"
     CDS             complement(580950..583607)
                     /locus_tag="HG536_0H03240"
                     /inference="similar to AA sequence:RefSeq:NP_010365.3"
                     /note="ancestral locus Anc_8.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141623.1"
                     /db_xref="GeneID:59328215"
                     /translation="MEDNHGYNGVSSMPIEHKPSEIELERRGAADTGKEIIEYSDEIT
                     EKPARSNEEQPSGPEEDSESDSDEEETPPLLKYTRLNKLPTNFFNRDSISACLFQEEF
                     FAFGTHSGLLHLTLPDFTPIQTLKLHRSSILSIHSDNIYFATGSIDGTVAIGLLEDPS
                     NITSFDFRRPIQAVVLSEDYATHKTFVSGGMAGEVILSQRNWLGNRVDTTLVKGEGPI
                     MGIFTIGDIILWMNDAGITFCSIHSKTQLLNVKFPNDGSDEVRPALYKPHVHFPESDR
                     ILVGWGRHIWMFKVSLKSSIDYGKNLGSILSSAASSLRAIPDKKVELEHYFQLRLQIA
                     GVASFKDDQILCLGFDIESKENSNIPELQVIDAVSGLDVYSDEVISKNYKNLSLNDYH
                     LGKHINQTLPEYFLISAKDSIRIQVFSLNDHYNWYLTKGNYLKAWEIGKYAVSPDERL
                     TTGFKYVYQLLDDEQWECAVSFITSLIASNAKEGQQMDRLLEESRKVFMIFIDNGKVD
                     SLTECIPTEPRLDKSIYDAILNYYLEERKLEKFMNCIHKWPLNVYSFQGLQDRLEEKI
                     EKHDTFENIYRDAIIHMYLIQKLYVKAVPHMIKRKDIRVLDILLTHNLASQITLSILD
                     LVLLPYDDSIKSLNKLSITDAQKIFQKPINLLVSNRHSFQTSKVVDTLSNPKELGLIL
                     FLYLSRLSVIDPDLTAKYENDLIGLYAEFQKGQLLEFLKRRSNYDLEKAIEFCSNRHG
                     FHNELIYLWGKIGENKKALSLIIDELNDPNLAIEFVKNWGDADLWVFMVSYSMDKPKF
                     IKALLDSPDQFGKTYLEVIRAMPPDLHVSGLKSTVVRISRDNALTLQVSRNVFKIIDD
                     ETREYGLEYLKYMTMGKVFHVEEKNRWKS"
     gene            <584213..>584431
                     /locus_tag="HG536_0H03250"
                     /db_xref="GeneID:59328216"
     mRNA            <584213..>584431
                     /locus_tag="HG536_0H03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285728.1"
                     /db_xref="GeneID:59328216"
     CDS             584213..584431
                     /locus_tag="HG536_0H03250"
                     /inference="similar to AA sequence:RefSeq:NP_076886.3"
                     /note="ancestral locus Anc_8.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141624.1"
                     /db_xref="GeneID:59328216"
                     /translation="MARARRGSLIQCDPSIKALIMQIDAERSDIILEELDDTHLLVDP
                     SKVEFIKRELNRLLSKNIYNPMDEDENS"
     gene            complement(<584529..>586841)
                     /locus_tag="HG536_0H03260"
                     /db_xref="GeneID:59328217"
     mRNA            complement(<584529..>586841)
                     /locus_tag="HG536_0H03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285729.1"
                     /db_xref="GeneID:59328217"
     CDS             complement(584529..586841)
                     /locus_tag="HG536_0H03260"
                     /inference="similar to AA sequence:RefSeq:NP_011084.1"
                     /note="ancestral locus Anc_8.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141625.1"
                     /db_xref="GeneID:59328217"
                     /translation="MVSCQTYSVDSVLMNRTRRSSIVSSIASRTGGLDYQELPQLLDD
                     SYLLNKLEKLALVTEGGPREYKLTQSSEESATLDRYDRYNRYLQELNVKVEKYDTILR
                     QVSKVQDHLEEAIDTFGQISSSSSDFIGRTRDTYVEYEQLSKLHRDIPRIMGYFTALD
                     PIMRRLNYASSPNLVRKNSFNKMLDTIDQSLFFLEDHQDLAEAEIYSIRFKRCLIKAC
                     ELIANYLSGMLRQTCSGINERLKSASSSSQISREALVYNKFEQLSQEYYTRIAELISR
                     VHSVKHTKYHDELGAILNDCFENYFQTRTSLLTPIIRHYLDETFDGDKMNLVYFIQNS
                     KTYFERLCSDEFALFTKFHGKEYTRERATQWLCQLCDPLYDSVRAKILRETDISMLCD
                     SVTLFRQYYQFEDGSEEYRAQFPDVQFEKIFEPIVQKLQARLILRVQIYIQQHIVGYM
                     PSKDSFIISRRRSRPNEEANVRETKTDPIVQAYLSNVTQHCADSDKASVVDKLELYYP
                     PLITSLALLSKIYEMLNAAVFDDLAHHIVHDCILSLRKAYNTVKTSSGGSNNLDIKLS
                     YLSNLLLLRQEIQNFNIQYTVNETYLDFSGVEAFFKTGGQSLRGQESSVIGMAKALVP
                     RVVNNMVDARSELISELRTIIRDFTETASAQLFGAALDVDNCDSRSIVDNNYTLRSQL
                     EEKLPRIHAQISTFIEDRDVVASLMDAIQEVAAQHYSEFFEKVSEEADKGVLNKSAIS
                     ELMYDDVFIGFVNDIIGRLTRRRVEDNEGL"
     gene            complement(<587075..>587404)
                     /locus_tag="HG536_0H03270"
                     /db_xref="GeneID:59328218"
     mRNA            complement(<587075..>587404)
                     /locus_tag="HG536_0H03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285730.1"
                     /db_xref="GeneID:59328218"
     CDS             complement(587075..587404)
                     /locus_tag="HG536_0H03270"
                     /inference="similar to AA sequence:RefSeq:NP_010364.1"
                     /note="ancestral locus Anc_8.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141626.1"
                     /db_xref="GeneID:59328218"
                     /translation="MKFPFKYTRSQLEIFRFSFCLLAPVAVMYYIGTDTDKKLNVPGF
                     YPDPETLNKIPKEPYEIKAELARMKKERLEKRLRLEKKLEEELGIDIQAEKAKIREEL
                     ALANKST"
     gene            <587766..>588770
                     /locus_tag="HG536_0H03280"
                     /db_xref="GeneID:59328219"
     mRNA            <587766..>588770
                     /locus_tag="HG536_0H03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285731.1"
                     /db_xref="GeneID:59328219"
     CDS             587766..588770
                     /locus_tag="HG536_0H03280"
                     /inference="similar to AA sequence:RefSeq:NP_011083.3"
                     /note="ancestral locus Anc_8.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141627.1"
                     /db_xref="GeneID:59328219"
                     /translation="MSNFKRLKVDKMVGQICTHSGSFHADEALAVYMLKLLPRYNDAK
                     VVRSRTPADWDQSDIVVDVSGKYDGVKFFDHHQREFFETFDDNHKTKLSSAGLVYKHF
                     GREIIKTVLSDVSDGDLGILYLKVYKQFIEALDANDNGISKFDAEEHSIKPKFSDSAI
                     TIPGIISNMNPNWNDDCSPEKYDEQFFKASAFIGGVFVDLVNGYGKSWLPAKSLVQKA
                     LESRMDVDKSGKIIVLDQFCPWKEHLFEVEKQMGIVDEIQFVLFEDSSKTWRVSTIPI
                     SANSYKFRKGLPEPLRGLRDQELSEKSGIPECVFIHAAGFIGGTKTKEGALKMAKMSL
                     "
     gene            <589650..>595847
                     /locus_tag="HG536_0H03290"
                     /db_xref="GeneID:59328220"
     mRNA            <589650..>595847
                     /locus_tag="HG536_0H03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285732.1"
                     /db_xref="GeneID:59328220"
     CDS             589650..595847
                     /locus_tag="HG536_0H03290"
                     /inference="similar to AA sequence:RefSeq:NP_011082.3"
                     /note="ancestral locus Anc_8.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141628.1"
                     /db_xref="GeneID:59328220"
                     /translation="MKGLIWPSKNKKHSGQGSTSPSVSSSLSRSKNTSSTRSLSPSTS
                     TLQSKRNNASGSSHGPLEKNASGNEHQEAYNNRRKSSATLSLRNHSNPSNNRSSGSVY
                     LLDSNSKSMKSIASSGHRFEETSMFSSGSITRGSSSETDVNTNANGSEVNLNRNQSSA
                     RDDPPSTEQSNYARDQNSKQDEEKNIRSSANTAISTEYRVSLNKDNYDSIVFKSGWLN
                     RSNHMSASISTHHLRSAGHSSHTNRESRFYHDAPEPHNNIPEYRVHRAQLKGPVLNFY
                     KSGLPSNVKYFDPAAGGSREDATLPSTSSSSGTITEKQPEEQSCAIEYLSDQYPHPKA
                     KLDSGGKIVAGNVESLCHTVLFAHSKGTTNDIKNQRSIINLILILPLIDYFSKFLRMF
                     TCFGLTFTKHPSKVSNSSNQYCNISPQVDNLMTERLGLVVKTILEMFPSFLLDDETFQ
                     EVIKLLDTISLHNDEISNYLKIAVADKHNELSNITAFNRMGVSQGNSNKELENRRAKL
                     LRDLMTVEDFLIMDLDKLAMEVHEINLKFDAVWAPRFDYSLLYDCKYINGDIVALNPL
                     TFNNQKNVHFLGRLLTCHLLSNDRKANRNAKLGAKILTKWVEFGGKFEALGDMVSWLA
                     VATIVCSIPILRLKSLWTHVPENILRTIFKDWIPTIAQLDRRHLSSKSTTSVFILAPP
                     NLDNPFIKSNVISYFGDLMIHADDLPSDTKFKYLERKVNRTKNAFFKWQERLQKIKPG
                     SGEVNSKTKDFNPDESNICQFWRYHLSQTCLNIDDIMKLSLAYEPPQIDQESYSNVGV
                     QRSPLSSGSFLPILFNEVCPSYSLFPQDSLIGAAGASDSQDPSNDRSGPSESSFNSAG
                     QFSTDCLSSSSPNNSNRIVWAEKHITGLEQIDAPLMKELSSKQSNRQHMLKCIRDAFN
                     VDSDIFHVADDLIFKSLNDFDVNSRPSSVVIETPKRFSQQSLNNGNHVSQRDIEDTPS
                     RLSRTLENMDFFSNIGKVSETLKESVIEVVLKSGSLERLYDLLVLTASVFSKLIDTKD
                     LEKYYQHKRHRSQLGANRSSFMEADSIGLLDYAFVKLTMDMDVYTETFFNSYKSFATT
                     TSVIENLARRYVGAKSCAFSISQCLNATSGSKVQQFENIQNGKKFPVWDTKVGNDDSV
                     SALIWVKIQVGAAEALLNLVEHHYADFTDDMKSNATLLDFLKVMEQDVTSEWPKRIRK
                     VKESDHVDELSEIESLVSSLHDLFNAVRSCYQKQLYRPLGIDRTFRKVTGLLNSFHKM
                     SLTDYNKYLSSNDFDDPMITSFRQLKFDQYESIINWIYSMDYFIFKKFQFATKQDWFA
                     TFQKLEATSCESLTSLYCLPLHSVSYNLITSGSARLDDLEVSNVFAWISNLDGNPADG
                     TQPVLNKLPEAIQLLIKLHMSLTVFFMIEVTDLEKSVEDRINTCAVVLQILKYVRWKN
                     SSLDLFKADGEGSVSPHIPSFIETAIINATVSPESRYYEHAWSSAYELLSSSRHRSPG
                     KISTLLIEINDENIKSFSDFDEAHMLKPKNLCPCPGWIVQRLLEISQFVPNMSIMNSK
                     LINFDKRRFVNNFVSNILDLTASLEEDITSHGNIPFSISLFQSFIDPAKAFKRSARNL
                     AMAEGKLLKYQEKGLFNEILAQEIDKTKRDHKKIEILSAQERDIKRSAILQQMIQRKQ
                     RSSVIIPSLQRNDVASPPLSKIPSSAASSSLSNTSRDKRSSAASYGSRNSVISTSGHN
                     HMGKKIGGFFKRPFSIGGFNSSASSSSLSSILIPGIQDDGSVSPDNLPALDPSTMQDQ
                     KPVFSIKTFEIKSIIEVVNHQRDPAHLSSFKILMHDGHEHMFQAPNRRDLVEWIEMIK
                     ASKRYAFHSKKYRGQTHNKLFGVPLEDVCEREGTNIPTIIVKLLEEIEIRGLEEVGLY
                     RIPGSVGSVNALKNAFDQEGAVGNSFTLEDDRWFEINAIAGCFKMYLRELPDCLFSNE
                     RIDDFVQLAFQLKTSEITEEAYRTRMIALLQELPSCYYHTLKLIFFHLNKVHQHMHKN
                     RMDASNLAIVFSMSFINQDDLTNSMGSTLGAVQSILQCFIKSPGDYFSV"
     gene            complement(<596090..>597079)
                     /locus_tag="HG536_0H03300"
                     /db_xref="GeneID:59328221"
     mRNA            complement(<596090..>597079)
                     /locus_tag="HG536_0H03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285733.1"
                     /db_xref="GeneID:59328221"
     CDS             complement(596090..597079)
                     /locus_tag="HG536_0H03300"
                     /inference="similar to AA sequence:RefSeq:NP_011081.1"
                     /note="ancestral locus Anc_8.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141629.1"
                     /db_xref="GeneID:59328221"
                     /translation="MDELNNVTSSISEQASQVIGEASSHIGYLQSIGLAKSWWWPPDL
                     VQHMLETVHVYTGLPWWGTICTVTIAVRLLMFPLYVKSSDTIARNSHIKPELDAINSK
                     LMSSTELSEGQKYALQRKKLLSDHGIKNRWLAAPMLQVPVALGFFSGLRAMANHPVDG
                     FVNQGVAWFTDLSQADPYLGLQVITAAVLISFTRLGGETGAQQFSPAMKRFFTILPLV
                     SIPATMNLSAAVVLYFAVNGMFSVLQTLTLRNKWVRKKLNIADVVKHPQTSDGPPKGI
                     IETFRENMAKAREQAQRRQAMQDKEKELQELSKELKKNSKIKIVHKSDFNRSN"
     gene            <597534..>598424
                     /locus_tag="HG536_0H03310"
                     /db_xref="GeneID:59328222"
     mRNA            <597534..>598424
                     /locus_tag="HG536_0H03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285734.1"
                     /db_xref="GeneID:59328222"
     CDS             597534..598424
                     /locus_tag="HG536_0H03310"
                     /inference="similar to AA sequence:RefSeq:NP_011080.1"
                     /note="ancestral locus Anc_8.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141630.1"
                     /db_xref="GeneID:59328222"
                     /translation="MNKSPLARKCLSQATRNALYLDCLNRKFDKVLKTVRSIPPKDMD
                     YAFLQTYLARSCHWGHMASVSYIWYRYVLRSNVLIIKASLLCDIGNLSLNEGNHFIPA
                     QLHEYFSRIYGKSLPIEERQSLDYELSRIKVESFAKGTINKTNFREKWKVFLEDIDHR
                     FPSNMTFRARDFPNLGRSLRHEENDLLMVLLFGQNKIAIHNASTGPLLLNLILMYSPQ
                     NASFKISLFEKFYNAHRLLNYDDTVTILLQLCKGDPYNLEKIKKFAADNLVPSLSSMA
                     SKTPTNEITADTSKDFVKSR"
     gene            <598439..>599953
                     /locus_tag="HG536_0H03320"
                     /db_xref="GeneID:59328223"
     mRNA            <598439..>599953
                     /locus_tag="HG536_0H03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285735.1"
                     /db_xref="GeneID:59328223"
     CDS             598439..599953
                     /locus_tag="HG536_0H03320"
                     /inference="similar to AA sequence:RefSeq:NP_011079.3"
                     /note="ancestral locus Anc_8.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141631.1"
                     /db_xref="GeneID:59328223"
                     /translation="MPKQWLMKIDAKKSFSSLVFSLRLLSLIATVFNRVTLRGFQLPI
                     HGKHVKEGEEMSMDQPIAINLFKGHPSFRLLPNKLVSEAAAELLGSDSRDYDDDTENR
                     HPLTYGSDEGALWVREAITRFNNDETFRLAPDDRARSKPEFLNLNSGASYGMLSILLQ
                     TTLAHTGVTRQAFVVTPTYFLINDCFADAGFSSKVTAIDEDSDGMINLGLLEQKLKYF
                     EKGTTGDDDEEKLKVIVNPERSIPKKVYKYVIYCIPTYSNPSGASYSTEMKMKLIEIA
                     RKYDMLIIADDVYDMLDFTPPFSSLPHPQKRFVHLDRETLDDPDSYGNTISNATFSKL
                     IAPGLRFGYHETATSKLAQQLSKGGANVSGGTPSQLTSMIVGTMLINGSAAKVLRELR
                     STYAERAAVLTDAVRLYMPRGTKFDKPAGGYFSWLTLPQGYNAKEIGRILQEKYGVLV
                     ANGSNFEVIGDVRNWGESSMRLSVSFLEPDDIENAIKYMGQACSEYAKSKSFEF"
     gene            <600041..>600799
                     /locus_tag="HG536_0H03330"
                     /db_xref="GeneID:59328224"
     mRNA            <600041..>600799
                     /locus_tag="HG536_0H03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285736.1"
                     /db_xref="GeneID:59328224"
     CDS             600041..600799
                     /locus_tag="HG536_0H03330"
                     /inference="similar to AA sequence:RefSeq:NP_010363.1"
                     /note="ancestral locus Anc_8.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141632.1"
                     /db_xref="GeneID:59328224"
                     /translation="MKSDRTINYSRLFSQLIGRDGQMDDTIASFLYYLFPRELFVRAL
                     SLIESCDMFIYLLDTNQCEKNRGHTSSVSTEADSPSKPSSEGNFDPADAAIGQRSNAT
                     NKKETDPLVSMAYESGPDYLHRLIVKSDTDGKAPIFVDLQNWFCSCDEYTDLFAKETA
                     AQPDDYVSRLVRDVDDVQDFSDDRFAQLDAHSLCKQRYFRHDKVMCAHLLAYSILLRS
                     SKNVLRYFTTVKPQVPMISVSNMDEWLKLHINLV"
     gene            <601038..>603419
                     /locus_tag="HG536_0H03340"
                     /db_xref="GeneID:59328225"
     mRNA            <601038..>603419
                     /locus_tag="HG536_0H03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285737.1"
                     /db_xref="GeneID:59328225"
     CDS             601038..603419
                     /locus_tag="HG536_0H03340"
                     /inference="similar to AA sequence:RefSeq:NP_011078.3"
                     /note="ancestral locus Anc_8.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141633.1"
                     /db_xref="GeneID:59328225"
                     /translation="MSAVNSRDGGDESYSMYPKSSSPPLPAQGTMHFPTYQPPVPIYA
                     YPQMPYMYAGQTPGYPFNMMNQSQMLYQGNSSMPQGSGGGSKKKWNNSSSGGSGLPNG
                     SVSSAKTHNYHHHQGSATFHPLNSSNGGSPAANTVNLASRADQYKFEISKLDGSPAGS
                     ERKYPLLFNSTEEEYAVASNRRNGLRMKALGICNFASTQKGDVKAVEVEDIDAASSPV
                     HINGTKTPVESDVVAQVAGETSEASGASTPDLRPTAAAPATVKTTPKSWSAIASGAIS
                     KSKSSAGSATRQDASKPLVQQPASALAPQKKDKKYIPPSTKGIEPLGSVALRMCLDPD
                     YIDYTLKNTIFEKSLLVKSIAPRGIINRANICFMSSVLQVLLYCKPFINILNVVSARK
                     LSPKAGLSQCTLLDACVNFYKQFDRETFEQEKSSASKGKQQSPNSVASLADAIKPDEF
                     YSALSTIPKFKDLKWGHQEDAEEFLTHLLDQLHEEFICSIDSLTDNEIQNLLQSLNDE
                     DLKIFFIRNLPRYKKAEFIKNPSSALKEMVAKYGTINEDNDEDGNGWHEVSGTSKKGK
                     KNKTAAKRTVEMEPSPMSCLFGGQFRSVLDIPNNKESQSITLDPFQTIQLDISESSVN
                     DLETAFKKFSEFELLPFKSSSGTDVQAKKQTFIDKLPQVLLIQLKRFQFISNPDKDNG
                     MVNYNAYNGRIEKICKKINYGHELIIPIESISCKNAQRVEDKQYSLSGIIYHHGSSPD
                     GGHYTADVYHDETDKWYRIDDVNITEVQKDDVLKGGEEGPGSRTAYILMYQKK"
     gene            complement(603517..603590)
                     /locus_tag="HG536_0Htrna11V"
                     /db_xref="GeneID:59328394"
     tRNA            complement(603517..603590)
                     /locus_tag="HG536_0Htrna11V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59328394"
     gene            <604277..>606055
                     /locus_tag="HG536_0H03350"
                     /db_xref="GeneID:59328226"
     mRNA            <604277..>606055
                     /locus_tag="HG536_0H03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285738.1"
                     /db_xref="GeneID:59328226"
     CDS             604277..606055
                     /locus_tag="HG536_0H03350"
                     /inference="similar to AA sequence:RefSeq:NP_011405.1"
                     /note="ancestral locus Anc_6.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141634.1"
                     /db_xref="GeneID:59328226"
                     /translation="MYRRKPVEINGDVAEISLPVVKFPPFKLRALLIEKDPVVWLHCL
                     ETYVKYMDYLLLENNIEKVDEITYNNICHFVKSYLHEMAEEKAKVLSLGMNSDVTEVL
                     NILKDRILNLLQRCGLLHLQVHGDSLWDLVKVYVDQKSSVVRALLDGSCKPSINTQKA
                     SLSRISQVQKGLKHLVESGGFTRVDLRAFEDLLSDTPLKTTPFAKRFLTASWLETLEV
                     LWAKGRGRFSTFAKQLAIITLFSVSAEDISRTTKDMGLATLDTAELYPLLGSLLLSEN
                     LRQMKPALVSSLPQFNVNIEEIASPLDESALAAIAELFPHLTKHQLSYLLRQFEGSVE
                     MATNAIFEDPSIIDAIPKQAPSETDHADENQTSEELAIHSSKKSYSSENASYGTVNQE
                     VPDELRNRTLTRAMRLIYQADEDERDDTYDEAEVSRSVGKISIDDENENDSASNSSKT
                     TVSEADRIEGFLWELLKEERSLFDRSTRGSKVRKWMKKETNWSDEQIEGWARMLEKSP
                     QRARILEEKFMFRGNVKTGKTAYVKNRNDNEINNIRNDEEVQKVPKKSSTTPADKKRQ
                     HARNERKKSSKANHNRKAAHDKKLSR"
     gene            complement(<606116..>607480)
                     /locus_tag="HG536_0H03360"
                     /db_xref="GeneID:59328227"
     mRNA            complement(<606116..>607480)
                     /locus_tag="HG536_0H03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285739.1"
                     /db_xref="GeneID:59328227"
     CDS             complement(606116..607480)
                     /locus_tag="HG536_0H03360"
                     /inference="similar to AA sequence:RefSeq:NP_011404.1"
                     /note="ancestral locus Anc_6.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141635.1"
                     /db_xref="GeneID:59328227"
                     /translation="MRLIAGCSDNGSLKEVICDAGTDTSKKTALQPLSVKSSLLQGLK
                     CSIDRICVISSRRMILGRNNGVLELVSIERTKHIDGEQENAEHGSKEGTTGAFEISKF
                     EVIDSIAGMLDNSRLAPFYEKSKKRVRLSDGFVSICPLPGSNNEYFVATRSGLISIIQ
                     LGDNLKKLTKIGTLEVKAPLDFAQLCDTEPNEAGDYVFGYGGEENLVKLVRMKRDGSS
                     LSQFWEAKNVKNDRLDLRVPVWPIGLKFLSAYSPSDADPSKPDYQFVVVTHWSHLAHY
                     RTQHGRKPLAYKDLLPNREPLTALELIGEDITELGNLKVADFANFSFVTADLKHNVYK
                     FDIDGKPIMKFGKSDITGASSFLGIYKQKYLLQGGLDRYIRIFDLATGSRLVKVYTGS
                     KINSLVMLDSEEIGQIDDSGPKLAKRKSVVQDEETLIAQDDELWERLENNGGSVKKVK
                     KARR"
     gene            <607742..>608884
                     /locus_tag="HG536_0H03370"
                     /db_xref="GeneID:59328228"
     mRNA            <607742..>608884
                     /locus_tag="HG536_0H03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285740.1"
                     /db_xref="GeneID:59328228"
     CDS             607742..608884
                     /locus_tag="HG536_0H03370"
                     /inference="similar to AA sequence:RefSeq:NP_009793.1"
                     /note="ancestral locus Anc_6.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141636.1"
                     /db_xref="GeneID:59328228"
                     /translation="MSVSHGKRSVLSAFKLVKAPIYSHCYSSDKSLLAITCDTNCFVY
                     KLGGDGSSPKLVATLPDHDKTVTAVDISVHGRIVTCSQDRNAYVWEPLSDGSYKPTLV
                     LLRINRAATSVCWAPNGYKFAVGSSARIIAVCYYEQENNWWVSKHIKKPIRSTINCLC
                     WHANGILLGSGGTDGYVRVFSGFIKGLDSKDIMNGSPWGEKFPFGSLVKEWYQGSYIH
                     DVQWRSGAEKIAYVSHDGLLNVADSVGQVETAQAPEGLPFRSLLWINDHEVLCGGYSC
                     HPVMFTESSDGWKFSKNLDKPSRSSQAPTSPVDSGEDGDEQPSFGMSALRKFKELDLK
                     GKVSSDEQESAHDNTIVQLRVYAESGGQVTQVSSCGLDGKIVLYAV"
     gene            complement(<608956..>609213)
                     /locus_tag="HG536_0H03380"
                     /db_xref="GeneID:59328229"
     mRNA            complement(<608956..>609213)
                     /locus_tag="HG536_0H03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285741.1"
                     /db_xref="GeneID:59328229"
     CDS             complement(608956..609213)
                     /locus_tag="HG536_0H03380"
                     /inference="similar to AA sequence:RefSeq:NP_631876.1"
                     /note="ancestral locus Anc_6.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141637.1"
                     /db_xref="GeneID:59328229"
                     /translation="MREELSLLQQNVLERYQKLAEVLHSLDSTVKQFNDSSSENVSSE
                     VVLQQIREIEVKIGLVGTLLKGSVYSLVLQRRQELERTLNS"
     gene            <609394..>610914
                     /locus_tag="HG536_0H03390"
                     /db_xref="GeneID:59328230"
     mRNA            <609394..>610914
                     /locus_tag="HG536_0H03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285742.1"
                     /db_xref="GeneID:59328230"
     CDS             609394..610914
                     /locus_tag="HG536_0H03390"
                     /inference="similar to AA sequence:RefSeq:NP_011403.1"
                     /note="ancestral locus Anc_6.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141638.1"
                     /db_xref="GeneID:59328230"
                     /translation="MSNQQQSYTIWSPQDTVKDVADSLGIENTSEDVLKALAMDVEYR
                     ILEIIEQAVKFKRHSKREVLTTDDISKALRVLNVEPLYGYHDGSAVGSNVSFKKVNAV
                     GGQTIYYLDDEEVDFDKLINEPLPQVPRVPTFTTHWLAVEGVQPAIIQNPNLNDIRIS
                     QPPIVRGAIVTALNDDSLQTSPAAAISLNEEKHSQHLSTVKPGQNIDVKPLVKHVLSK
                     ELQVYFNKVIAALTSKNDADENAQHMKSAALTSLRTDSGLHQLVPYFIQFIAEQITHN
                     LSDLELLTTILEMIYSLLSNESIFLDPYIHSLMPSILTLLLAKKLGGTPTSDSPEEVS
                     TMLEKTNALRDFAASLLDYVLKKFPQVYKSLKPRVTRTLLKTFLDTNRVFGTYYGCLR
                     GVSVLESESIRFFLGNLNNWARLVFNEQGMTLDTIDENKSIKFSPQEKDLLVDTVINA
                     LVVLKGDLHDMYDGKDKEITAEDRKKLADRCGITIASRILKRDDARELIDAIFFGE"
     gene            complement(<611013..>612938)
                     /locus_tag="HG536_0H03400"
                     /db_xref="GeneID:59328231"
     mRNA            complement(<611013..>612938)
                     /locus_tag="HG536_0H03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285743.1"
                     /db_xref="GeneID:59328231"
     CDS             complement(611013..612938)
                     /locus_tag="HG536_0H03400"
                     /inference="similar to AA sequence:RefSeq:NP_011402.3"
                     /note="ancestral locus Anc_6.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141639.1"
                     /db_xref="GeneID:59328231"
                     /translation="MDGWQLLESIQRIPRTTSIDLTQPKAVQSSELAPDLLRKIGEYG
                     TTFKHFFRDQTGNIYLLERYGTKYCVYWPANGFNFDDIQQESSQLRKTNNNIASKGWN
                     TLQFEDMLELWREDQEKRSVDVPIKLNMQVTGTSAHHAKSYQNISLKDYLETKYYESL
                     FFVHVPLAYFLKSNLERLKSMCRLASVQDSSKAYRECVRDMILENKHFDRRHEEDNIV
                     KNHLSSSIAETKRNACLEKFEIVVQGETNRQDKNDLCLILRVREIKLQIILLLESIHI
                     ENLDMAFKDFDAKYSGRLKARSLNLTKLIPRRSRKKRSILSEKQKTEEGPDFCEQLDL
                     YVDKLCILDVLLASEPVDTNTVANPIHELKRNMLSKNKEASSLGFVNYVLIPHFTSKT
                     PYAIRFIIRKLKGPNLRNRKPSQRKDTTLEISGSSAGQTTKAPCTPLLRPQANSNTSS
                     PRSSIGLRHQRSLIAEPTDLRSNSSMEELLEVNAAARRNLASLSRTTSDLTMNHLQKR
                     QLSVTELSLQRAVSSSKDSANLMNDPFNPAFPSQQSFRRVGKRKELHQISRSASTAAS
                     DGEVNLVQVMGTPLKKDETPIKKRAKLHNIVESPINLQKSDANVETAPEQRHTSDKTS
                     ARRGPTNRRVRRKLFAP"
     gene            complement(<613212..>614483)
                     /locus_tag="HG536_0H03410"
                     /db_xref="GeneID:59328232"
     mRNA            complement(<613212..>614483)
                     /locus_tag="HG536_0H03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285744.1"
                     /db_xref="GeneID:59328232"
     CDS             complement(613212..614483)
                     /locus_tag="HG536_0H03410"
                     /inference="similar to AA sequence:RefSeq:NP_009792.3"
                     /note="ancestral locus Anc_6.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141640.1"
                     /db_xref="GeneID:59328232"
                     /translation="MSSVDGHGVTSPNMLKRKKEDCAEEQLEAEIKRVALEDDTELAV
                     LEKDNGATEAIDGKEAELSSVDEKEDRESVSRHVHLRMLCLVKQASMIVGHKGENISN
                     IKAATSTRINVSDNVRGVPERVVYVRGTCENVARAFGMIVRSISDRHGDAMFDENKVL
                     HTVNLLISHHLMGCVIGKHGSRLREIEVLSAARLSASPQQLIMSNDRILSIVGVADAV
                     HIATYYVGQTIMNSSESFKAKKAIFYQPSPVYSVLVNGASHVGFVHQKHHQYHPTDKY
                     TSSRNNKRVSRSSPMTTPQSLPSTGSGSPAIYTAAAANATAFTPKFTIPNVRIVDESV
                     ATATAHMMTIMEQEIYIDENFVGNIIGKDGKHINSIKEATGCSIYIADPVSGSPERRL
                     TVKGTPMGSQAAIMLISNKIEIDKVNKERKK"
     gene            <614665..>615564
                     /locus_tag="HG536_0H03420"
                     /db_xref="GeneID:59328233"
     mRNA            <614665..>615564
                     /locus_tag="HG536_0H03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285745.1"
                     /db_xref="GeneID:59328233"
     CDS             614665..615564
                     /locus_tag="HG536_0H03420"
                     /inference="similar to AA sequence:RefSeq:NP_009790.3"
                     /note="ancestral locus Anc_6.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141641.1"
                     /db_xref="GeneID:59328233"
                     /translation="MAVQADSSQKGQDVLDEEQYNEEEDEDFSPGLSKQSEQEDEDEE
                     EAYQLEQEESGSVKKGTDGYDYSHIESESGGLIRTRRGRLLEEQLNAKRKYEGLQAGT
                     ISESVNDIWEELQQITHKRLKDRAFCGSVLADGGDMGRGSQQEEQILIKRDYKFAGEV
                     FHEEKMVPISSSEAQEYLKSKSAEKDAEERLKAEANEQSRGLPDNEKDRRRLRRPLKR
                     PPYLEQIIAGSLKPKLTTLEKSSLDWAAYVNKEGLTDELTLYNKDGYLAKQDFLNRVE
                     MAKDDKYRELRQKQLAAQLQEQQ"
     gene            complement(<615606..>617771)
                     /locus_tag="HG536_0H03430"
                     /db_xref="GeneID:59328234"
     mRNA            complement(<615606..>617771)
                     /locus_tag="HG536_0H03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285746.1"
                     /db_xref="GeneID:59328234"
     CDS             complement(615606..617771)
                     /locus_tag="HG536_0H03430"
                     /inference="similar to AA sequence:RefSeq:NP_011401.1"
                     /note="ancestral locus Anc_6.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141642.1"
                     /db_xref="GeneID:59328234"
                     /translation="MSEVLSVDDEDDQQFPSPVAWNEKPDIKQITLRATFIGLLIGSL
                     VLISNFQFGLQTGWVSMMSMPSALLACAFFKKIWPIMYPNDLPFTDVETVYVQSIAVA
                     VGTGPLAYGFVGVIPAIEKFVTKDESGGTREQGELFSLYQLLAWSCALAFFGVFFAVP
                     LRKQVIVREKLPFPSGSATAVLIAVLSDSEILQEVSRRELLAMRTRRLDECSELLLAD
                     ESSLPVARNSGGYGLLEGENQTRGESNTYNKNISILSKTFIASSIYTVGSYFLPIVRS
                     IPLFGTYLSKTYLWNIQPSPAYIGQGIIMGLPTVSYMLFGCVLGWAILAPMARYAGWV
                     HPDASVDDWEKGVHGWILWCSLSIMVVDSVVGFIVVTVKSIVKFWLVDDKAALLADVW
                     EDSFQSMLLEEERMINSRRNTETSKPRNTVKLVYADQDHEVASKHLVKYTTVISGLIF
                     SSILCIVLVIYLFGVEVIPVYAMVSALFIALFLSILGIRALGETDLNPVSGIGKLSQL
                     FFAVITPRNQAGSVLLNLVAGGVAEAGAQQAGDLMQDLKTGHLLGASPKAQFVAQLLG
                     ASWSVVMSSIMYICYNKVYHIPDKQFRIPTAIVWVDCARLVTGRGLPDRALECSIALG
                     FVFGIFSLIKNCYRDSGHKWLLYIPSGVAVGVGIYNTPSFTIARFVGGLLSSVWLHKH
                     RGDVGAKTKMTVFSSGLILGEGVCSIFDMLFTNMNVPHF"
     gene            complement(<618121..>619089)
                     /locus_tag="HG536_0H03440"
                     /db_xref="GeneID:59328235"
     mRNA            complement(<618121..>619089)
                     /locus_tag="HG536_0H03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285747.1"
                     /db_xref="GeneID:59328235"
     CDS             complement(618121..619089)
                     /locus_tag="HG536_0H03440"
                     /inference="similar to AA sequence:RefSeq:NP_011400.1"
                     /note="ancestral locus Anc_6.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141643.1"
                     /db_xref="GeneID:59328235"
                     /translation="MSSESSEREKVIAEQKLAVESIRAFLKSKTSYDVLPVSYRLIVL
                     DTSLLVKKSLNVLLQNNIVSAPLWDAKTSRFAGLLTSSDFINVIQYYFSNPDKFELVD
                     KLQLDGLKDIERAIGVEPPDTASIHPSRPLYEACIRMMDSTSRRIPLIDQDEDTHREI
                     VVSVLTQYRILKFVALNCRETHYLRRPIGELNIITKSNVASCRMTTPVIDVIQLLSQG
                     NVASIPIVDHEGTLVNVYEAVDVLGLIKGGIYNDLSLSVGEALMRRSDDFEGVYTCTE
                     RDKLSTIMDNIRKSRVHRFFVTDDSGKLVGVLTLSDLLKYILLGEN"
     gene            complement(<620229..>622046)
                     /locus_tag="HG536_0H03450"
                     /db_xref="GeneID:59328236"
     mRNA            complement(<620229..>622046)
                     /locus_tag="HG536_0H03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285748.1"
                     /db_xref="GeneID:59328236"
     CDS             complement(620229..622046)
                     /locus_tag="HG536_0H03450"
                     /inference="similar to AA sequence:RefSeq:NP_011399.1"
                     /note="ancestral locus Anc_6.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141644.1"
                     /db_xref="GeneID:59328236"
                     /translation="MVDTANKSTLANNANRSVLSLTSPAKLNIISSDWSRSEGKIGKK
                     PLRRTNSLNSRGLTNVPSLNGGNSMYSRPQISLPAPPLIRRSSSFFKDDLDRNDVSKG
                     RAQSSSAACGAPQPSAIPEAEVITTDRFIPTLQSNQQSKVDPSAFNEDLPPANASPTA
                     HLRAQTKLVFKQTVAKACGLDMNQRILQYMPQPPVASFKRQTYSMRKRSHYNYQQEPE
                     PELVKLRKINSNPERILDAPGYQDDFYLNLLSWSSKNVLAIALETALYLWNGSSGDVT
                     MMVDYETTKITSVIWSDDDCHISIGKEDGNTEIWDVETLSLVRTMRSGLGVRIGAQSW
                     LETLVAIGCRSGEIQINDVRIKQHVVSTWEEHSGEVCGLSYRNDGLQLASGGNDNTVM
                     IWDTRVSMPQWIKRNHTAAVKALSWCPFIPNLLASGGGQTDKHIHFWNTATGANVGTI
                     STGSQVSSLHWGQSYSGSSGSMNREIVATGGSPTNAISIFNYDTKYKVAEIMHAHESR
                     ICCSQLSPDGTTLATVGGDENLKFYKVFEPRRRTRRKTKAVDGEVLSLFGHSTSKFSA
                     MDDDYDYLKSSQEEADDCKGIDDSAVNTSKRKSSAFLIR"
     gene            complement(<622502..>623371)
                     /locus_tag="HG536_0H03460"
                     /db_xref="GeneID:59328237"
     mRNA            complement(<622502..>623371)
                     /locus_tag="HG536_0H03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285749.1"
                     /db_xref="GeneID:59328237"
     CDS             complement(622502..623371)
                     /locus_tag="HG536_0H03460"
                     /inference="similar to AA sequence:RefSeq:NP_011398.3"
                     /note="ancestral locus Anc_6.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141645.1"
                     /db_xref="GeneID:59328237"
                     /translation="MTGSVDIEGLARAFDEMIKDRKIPSPKNQAIFNEICKTIVTSQL
                     KPLLEFVDILLEKFMYPRTESDSLATLLSSQHADTLQRSRSGSFEVFDLGHPRVLEII
                     MVRQKIVELRKTGKQGWKITEYGSKVLRKLNQIYLLLVHLLQVLSDHIEAPLNALFYR
                     NIIIQSISHFQIAFETFKSLDFIIHALLRNLQKSGTTDSIIFSVDDSLLLKIKDFSAN
                     SLVWYESLMIESTALREYLLVETKIFETGDEQDLSKKGIDSYALKVIYDSKFESFLER
                     RKARLNISNRRIF"
     gene            624403..624503
                     /locus_tag="HG536_0Htrna3W"
                     /db_xref="GeneID:59328399"
     tRNA            join(624403..624439,624467..624503)
                     /locus_tag="HG536_0Htrna3W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:59328399"
     gene            complement(<624733..>626494)
                     /locus_tag="HG536_0H03480"
                     /db_xref="GeneID:59328238"
     mRNA            complement(join(<624733..626094,626204..>626494))
                     /locus_tag="HG536_0H03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285750.1"
                     /db_xref="GeneID:59328238"
     CDS             complement(join(624733..626094,626204..626494))
                     /locus_tag="HG536_0H03480"
                     /inference="similar to AA sequence:RefSeq:NP_011396.1"
                     /note="ancestral locus Anc_6.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141646.1"
                     /db_xref="GeneID:59328238"
                     /translation="MSNRRSLYHAFCLVSSARQVLKGSASIAKESLAQWVNTSRITRP
                     ILMQYQCYYDPQWEDAKRLSEQVKAKARQPPRKGKKSTSTRHYSTSSRHSNDEQVGEV
                     EEISEKRKQELQSSRVPSSRISRLFHYGSLAAGVGINAASDGFSQMARGQSPSWKSLI
                     YSDSNIDRIAKKFSQMRGAALKIGQMMSFQDDKVLPKELYEIISRVQNSAHYMPHRQL
                     ERVLKRELGSDWQDKFCSFDRVPIAAASIGQVHNAVLKNGDKVVVKIQYPGVKDSIDS
                     DLNNLLMLLVASRLLPKGLFLDKTVANARTELKWECDYVRESQALKKFGKLLEDDPVF
                     VVPHVYSDLTTTNIITMARMEGTEIMKLPKTTSQDVKDFISENIMRLCLEEIATFQYM
                     QTDPNWANFLYNEKTKKIELLDFGASRPYPADFVMRYRKLLTLATLKDREGVCKVSQE
                     LGYLTGLESQAMIDAHVNSVMTLGEPFCGPPEQVFSFKDQTVSDRIRSNIGLMLNERL
                     CPPPEETYSLHRKFSGIFLLCARMSASVHCAKLFRDILAVEK"
     gene            <626740..>629058
                     /locus_tag="HG536_0H03490"
                     /db_xref="GeneID:59328239"
     mRNA            <626740..>629058
                     /locus_tag="HG536_0H03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285751.1"
                     /db_xref="GeneID:59328239"
     CDS             626740..629058
                     /locus_tag="HG536_0H03490"
                     /inference="similar to AA sequence:RefSeq:NP_011395.1"
                     /note="ancestral locus Anc_6.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141647.1"
                     /db_xref="GeneID:59328239"
                     /translation="MGSKRRLSEKTEHFDPVTTSVPELAAEIAEERTKTHPIPPEEPL
                     EHHDAGEFSGLTRHQTTTEQAAKLEDAKINPFTGQEFTPRYFDILKIRRELPVHAQRA
                     EFLKIYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLQNTQVACTQPRRVAAMSVAQ
                     RVAEEMDVKLGEEVGYSIRFENKTSNRTILKYMTDGMLLREAMEDHELKRYSCIILDE
                     AHERTLATDILMGLLKQVVLKRPDLKIIVMSATLDAEKFQRYFHNAPLLAVPGRTFPV
                     EIYYTPEFQRDYLDSAIRTVLQIHATEESGDILLFLTGEDEIEDAVRKISLEGDQLVR
                     EEGCGPLSVYPLYGSLPPHLQQRIFEPAPESHNGRPGRKVVVSTNIAETSLTIDGIVY
                     VVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFKKE
                     LIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDD
                     EGNLTALGRLASQFPLDPMLAVMLIGSFEFNCSEEILTIVAMLSVPNVFMRPSKDKKR
                     ADDTKNYFAHSDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHFLNYRSLAAADNIRSQ
                     LERLMIRYNLELNTTDFESPKYFDNIRKALASGFFMQVAKKRSGGKGYITVKDNQDVL
                     IHPSTVLGHDAEWVIYNEFVLTTKNYIRTVTSVRPEWLIEIAPAYYDLENFQKGDVKL
                     SLERIHERVHTMKQLKTEKHKKKSKKDKHNGK"
     gene            <629277..>629660
                     /locus_tag="HG536_0H03500"
                     /db_xref="GeneID:59328240"
     mRNA            <629277..>629660
                     /locus_tag="HG536_0H03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285752.1"
                     /db_xref="GeneID:59328240"
     CDS             629277..629660
                     /locus_tag="HG536_0H03500"
                     /inference="similar to AA sequence:RefSeq:NP_011394.1"
                     /note="ancestral locus Anc_6.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141648.1"
                     /db_xref="GeneID:59328240"
                     /translation="MSQRKLTLFIEDWQEPLYNGANDSDLSKLLIYTSAQKAMLDAIN
                     ELHALTDEVISYRTTGSVSSGIPSLMSHAMQTRERAKGLYRSALRSRVSDGSWDLEEL
                     FKELDEELLRSTGVLRLYQRRGSYY"
     gene            <630092..>631591
                     /locus_tag="HG536_0H03510"
                     /db_xref="GeneID:59328241"
     mRNA            <630092..>631591
                     /locus_tag="HG536_0H03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285753.1"
                     /db_xref="GeneID:59328241"
     CDS             630092..631591
                     /locus_tag="HG536_0H03510"
                     /inference="similar to AA sequence:RefSeq:NP_011393.3"
                     /note="ancestral locus Anc_6.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141649.1"
                     /db_xref="GeneID:59328241"
                     /translation="MSQEQLTESLKVIVAEKLGTLPNFHEDIKYVAEYIVLLMVNGGT
                     VESVVQELSTLFDSVSPAALTDVVQTAFFALEALQQGETVEGIVSKIRGATAGPEIQQ
                     PEQEQPPQQEPQPQPSAAAPAESLSAFANFVPKQPVVQDDSSNFPGGQSQYSQKVGAV
                     GKQRGTRGSRGSTRGASRGHNRGQNARFNPLARALGMDEGNGNIKLVHQKKEGRCKLF
                     PRCPLGRSCPHAHPTKVCNDYPNCPKPPGTCEYLHPNEDEELMREIEKTREEFQQRKA
                     AIIAARTKPIQTGIVLCKFGALCSNPMCPFGHPTPANEDAKVLELVWCAANLECADPK
                     CKKAHSSLSKIKEVAPLGHKKFKPTAPLAARPVEKSLEQCKFGSHCTNKRCKFRHARS
                     HIMCREGANCTRIDCLFGHPINEDCKFGIECRNAYCLFRHPEGRVIPQKGETNNNTQP
                     GFNNNGVSSMSQRPFALPDGAHIENAAPQNTLQSIHAIQQQPDNDTDMS"
     gene            complement(<631869..>632636)
                     /locus_tag="HG536_0H03520"
                     /db_xref="GeneID:59328242"
     mRNA            complement(<631869..>632636)
                     /locus_tag="HG536_0H03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285754.1"
                     /db_xref="GeneID:59328242"
     CDS             complement(631869..632636)
                     /locus_tag="HG536_0H03520"
                     /inference="similar to AA sequence:RefSeq:NP_011392.1"
                     /note="ancestral locus Anc_6.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141650.1"
                     /db_xref="GeneID:59328242"
                     /translation="MSAPAPEQAPRRGGFGGRNRGRQGRRGGRNVEEKGWVPVTKLGR
                     LVKAGKITSIEEIFLHSLPVKEFQIIDTLLPNLSDEVMNIKPVQKQTRAGQRTRFKAV
                     VVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGSNLGQPHSLATKTS
                     GKCGSVTVRLIPAPRGSGIVASPAVKKLLQLAGLEDCYTQSNGSTRTLENTLKAAFVA
                     IGNTYGFLTPNLWAEQALPLSPMDVYADEAAIEKKRF"
     gene            <633252..>633796
                     /locus_tag="HG536_0H03530"
                     /db_xref="GeneID:59328243"
     mRNA            join(<633252..633259,633352..>633796)
                     /locus_tag="HG536_0H03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285755.1"
                     /db_xref="GeneID:59328243"
     CDS             join(633252..633259,633352..633796)
                     /locus_tag="HG536_0H03530"
                     /inference="similar to AA sequence:RefSeq:NP_009789.1"
                     /note="ancestral locus Anc_6.128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141651.1"
                     /db_xref="GeneID:59328243"
                     /translation="MSEHHAEHSKRAEKHAERAGEELKKAAEEVKKDEPYYREKAHQC
                     SSYIWTKFYEAANYVYGTGQSSMQYARSAACRAMTELKNPVILLNVLAGSGVIGALLT
                     GYAKYDARYLKNKSDGDILCLVGSATALLAIDTVLSVKYYSKYDKKKP"
     gene            <634038..>635777
                     /locus_tag="HG536_0H03540"
                     /db_xref="GeneID:59328244"
     mRNA            <634038..>635777
                     /locus_tag="HG536_0H03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285756.1"
                     /db_xref="GeneID:59328244"
     CDS             634038..635777
                     /locus_tag="HG536_0H03540"
                     /inference="similar to AA sequence:RefSeq:NP_011391.2"
                     /note="ancestral locus Anc_6.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141652.1"
                     /db_xref="GeneID:59328244"
                     /translation="MNTVDEQYIDGSCSADLNRFRPAAAPKTSSFGPLNGVVSEPTTS
                     ITLDQSTFQASVPSPPSVVPGENQDTDDEGLLESLSQSLYSNDYSILGSSSWNHPIVS
                     MDVPTVFASRNPVSDLENQEISSWDKNFFILTSAGKPIYSMHGCDEQVTSLMGIINTV
                     MSYFQLQNSSDIRTISCGKAKLAFLDRSPIFLAAYSDRGETSNELINQLDFLHSYLLS
                     SLSQRQLTRFFSRRENFDLRNFMEATDFENLDEICSLICERLYPDVLLGALQCLSLKK
                     THRAQIHEAMLQCLLKESDLPRGTLLYGLIVAPDNKLGSVLRPRGHTLHTTDLNLLFC
                     LIYHHFRNLQDQQEMWVPICFPKFNSSGFLYCYIKLLPDSTKACAEASAGKRPVLVLI
                     SAQKDAFFPLKTLGGNLIKNLLANSLIDHIYRAKDIKISDIPAPLVHHFIYKSKKHVQ
                     YIMPELQFVLQAGNERQTQEYEKKIITYYQLIHNSVFRDDGSAHSKSTLNFVQWEEAE
                     AVGERSTDQAVFQREKISMMGLAWTTRKFELYLICNNGTSDKNIVLKSAKRIIKWCAR
                     HEQRLFVSDGAVF"
     gene            complement(<635841..>637106)
                     /locus_tag="HG536_0H03550"
                     /db_xref="GeneID:59328245"
     mRNA            complement(<635841..>637106)
                     /locus_tag="HG536_0H03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285757.1"
                     /db_xref="GeneID:59328245"
     CDS             complement(635841..637106)
                     /locus_tag="HG536_0H03550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141653.1"
                     /db_xref="GeneID:59328245"
                     /translation="MKNDTTSRSSTVGICSEDGARVSYDYYFSLDSRNKLTKTASQQR
                     RGRLVQSFPPPPPPPPPTRESSVPPAERLTTSSATSSVICKTPYLRLDGVPRNLPDLR
                     SYSVLAGSTTFIRSSGIRGTLPRIRKLEVRKQCHMPLADVLVSSGGPTSGSQHGSTSV
                     KRASEVDSHEQDAATALLVLKQCSLKVADMTRSWSHLNTVPLCDFIVAQKNCQRMLDN
                     IETLKDVRIQVREATAVEDVNQNDELTRHAIEKRKRKNLYKSRSRAFPSRSSSVISVV
                     NVIKKERENETRSQSTSSECTTTKSPTEMACDISRQEPHSSYNEPSRQSSSSSSSDYA
                     KRVLGKIGKTSKSGKNRNTHMKCLQCSATDTPEWRKGPVGPTTLCNACGLFYKKLLKR
                     FGGDTADVIMKMRQIKNPQDRKVPRSASS"
     gene            <637582..>640344
                     /locus_tag="HG536_0H03560"
                     /db_xref="GeneID:59328246"
     mRNA            <637582..>640344
                     /locus_tag="HG536_0H03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285758.1"
                     /db_xref="GeneID:59328246"
     CDS             637582..640344
                     /locus_tag="HG536_0H03560"
                     /inference="similar to AA sequence:RefSeq:NP_009788.3"
                     /note="ancestral locus Anc_6.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141654.1"
                     /db_xref="GeneID:59328246"
                     /translation="MYPNRVVLLLFCLVTRFQLVFGFTDYLLKTCAQSGFCHRNRAYG
                     SSISESGSKYYSIDLQSVNFDEDDNVMRASIIKRVERPDGNHASVSLPFSLAILSNNS
                     IRFTVDENRPTIENLPQSLSSRRYNETSKWAFDCAETHGAKRPRIKRGWLQSDVYTIA
                     SPDKTVKLELHTKSFLMKVFHRGQQALVVNERSFLNFEHYRSKEDNYRHLAPEESSFN
                     MFGDDFQYSQADSLPFGPESVALDITFKHYSNVFGIPEHADSLRLRDTTDRDPYRLFN
                     VDVFEYNLNSTFPTYGSIPLMIASKPESSIGVFWVNAADTWVDIKYDDHDTKTHWMSE
                     SGIIDVVLFFGDEPSEITEKYTFLTGRPFLPSLSSLGYHQCRWNYNDELDVLTVDSEM
                     DRAHIPYDNIWLDIEYTDERKFFTWKSDSFPNPSRLLKRLAKLGRQLTVLIDPHLKED
                     YEVSDSIVRDNVAVKDCKGQTFVGHCWPGQSIWIDTFDPAGQSLWTQFFMRFSKGIAN
                     LNIWNDMNEPSIFSGPETTAPKDLLHYNGFEERSVHNLYGLTVHETTYKSMKAISPEE
                     NTRPFVLTRSFFSGSQRTAATWTGDNVANWDYLRISIPMCLSNNIAGMPFIGADIAGF
                     SGNPEEELIARWYQAGLWYPFFRAHAHIDTLRREPYLFEEPLKSIVRNAIQLRYTLLP
                     TFYSTFHRASKDGSPILKPMFYQKPQFPELYDVDDQFYVGDSGLLVKPVLERGQRSIH
                     ISLAPGIYYHYPSLESLVAQTNIEIKQLDAPLDKIPVLLEGGHIIFSKERYRRSAKLY
                     RNDPYTLTVAPDLLENAAGKIYVDDGETFNFQSGEFLETQVVLQKGKILKNIPLNVPS
                     SHIFIGNRYIEKIILPVGRMTVKELVKVQKGHEIYEVAATREGLNSIAILNPLVRLDE
                     EWVIMF"
     gene            complement(<640348..>641289)
                     /locus_tag="HG536_0H03570"
                     /db_xref="GeneID:59328247"
     mRNA            complement(<640348..>641289)
                     /locus_tag="HG536_0H03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285759.1"
                     /db_xref="GeneID:59328247"
     CDS             complement(640348..641289)
                     /locus_tag="HG536_0H03570"
                     /inference="similar to AA sequence:RefSeq:NP_009787.3"
                     /note="ancestral locus Anc_6.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141655.1"
                     /db_xref="GeneID:59328247"
                     /translation="MASPPVNNTQHSKIPDFYCCYLLQSICKSQSFYIGSTPNPVRRL
                     RQHNGILTRGGACRTKRAGTRPWQMILVVHGFPSKVAALQFEHAWQHSYKTHYIEDVS
                     RVVKNKTGGRSIHHKLATVRLLLGHVYFQHMGLTVEFFNHQTRQIWNQNKFRAQEASS
                     HNVSTVPNALDIPDVSSSESIDLFANANLALVETFYGGHVKIYQTKCKIYKERLTFGQ
                     IACEICDTTFDYTSDDLEKKPLVGFCPSESCNFVSHLRCLHRYFTDDVQLLTNRQILV
                     PRTGKCPNCSTVISWKDVVTYSTAMKASYGSNSEMAA"
     gene            <641447..>642961
                     /locus_tag="HG536_0H03580"
                     /db_xref="GeneID:59328248"
     mRNA            <641447..>642961
                     /locus_tag="HG536_0H03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285760.1"
                     /db_xref="GeneID:59328248"
     CDS             641447..642961
                     /locus_tag="HG536_0H03580"
                     /inference="similar to AA sequence:RefSeq:NP_009786.1"
                     /note="ancestral locus Anc_6.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141656.1"
                     /db_xref="GeneID:59328248"
                     /translation="MLRFYARGILKRYGSTAGYAHGAAATKKLAKNRVQDIPSPKILK
                     SYLDEYVIGQETGKKVLSVAVYNHYLRNLDKKRKAELQEQKRILEEESLRDDEEPLYS
                     SSSESSVGLKNLQQQYDSISARSDDDLELGKSNILVIGPSGSGKTLLASTLARFLDVP
                     IAITDCTQMTQAGYIGEDVQVCIERLLVNAEFDVAKAENGIIVLDEIDKLAKPAASIG
                     TKDVSGEGVQQSLLKIIEGHKVEINVKRPLKAGTDNKNNQTTAKKDETFIIDTSNILF
                     MIMGAFVGLDKHVVKRIKGLRQSKEEQEDDVQKLRFSNTIEEIDLGNGKKVSALSLVT
                     PTDLVSFGLIPELIGRVPIVTALEPLQQKDLYQILKEPKNAILDQYEYIFEQFNVKLS
                     VTRKALEKVAQLALKEGTGARGLRGIMERLLLDVNYHCPGSGISYVLIDEETVKSLQQ
                     TEHSLATHVNAKYYSRGQLDDFILDAGREDVELAQELDEEFGRLSTRKKEGCIK"
     gene            complement(<643058..>645439)
                     /locus_tag="HG536_0H03590"
                     /db_xref="GeneID:59328249"
     mRNA            complement(<643058..>645439)
                     /locus_tag="HG536_0H03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285761.1"
                     /db_xref="GeneID:59328249"
     CDS             complement(643058..645439)
                     /locus_tag="HG536_0H03590"
                     /inference="similar to AA sequence:RefSeq:NP_009784.1"
                     /note="ancestral locus Anc_6.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141657.1"
                     /db_xref="GeneID:59328249"
                     /translation="METDGSQSQRMTVGSSSHRDKSPNEYQNETDGDPEKSRLLEEIE
                     HIKKEQFTEPIIIKDEKSADGSESTPARLAIEAESPRAQKLAGKQPLAEANQLPSFGL
                     TVEKPSGRSPSVAARGPKSFSGMAAAINGHNYFGSGHDFEISNEKIQLAPTTGIHGNT
                     SKVVATQHRRKVWDWNCLPKVGSSVLVQTHSFNVISVPIDGEIKQILYTPLYNKNFKR
                     MNIFLSFNMDTKPWDALVHSRKRIVSFVNYIKQYLKSRAYAYQCYPFFLQGLSEEDIK
                     TQNYISYNTSYDYTEIESIISLWFIQAQRLLFSTNSIFFSPDVVQGLLQRRTSTRSLT
                     TIQSSVFLQQSEGEVVTSRPVAVEPLEEIDILLLRSLPDDEFGWQLAYDEPNLNIVDY
                     CLDTTPWTAREEAANNVSKTQESSETFQGAKIVSKQEDIERIDSENVAYCLFDCMDRR
                     ISDLTEDLAASAASAAPKTTSGDPGKSWQAGLNESSKKKGSHNKLGKRSGLASLFKRR
                     HAHSIPQSTQSEVPAPSSPEGKLGGRAQSIQNAWLEDYFSKCLGNYKRVRMPTQYFLP
                     QEANSSESERSEEDKKLEARKAFLYNKECLQIVLPFADNVIPSIYAPWLWSDLGYTKW
                     KSLLREMIRCLVPGGFALASVYDLRLSNTFTAPTEESMQEFPTTMEREKTFDAMALEA
                     MNHGIYVHPTKHLVQAFKEIGFTNIKYSILSLKTGDFSTDMGCLNELFSQITWDLLLR
                     KQMPDPSKPPKDTDPPTLFQRYTTEHLDKVDDNAGCMRALLIVAQKPRKIACQ"
     gene            complement(<646102..>647901)
                     /locus_tag="HG536_0H03600"
                     /db_xref="GeneID:59328250"
     mRNA            complement(<646102..>647901)
                     /locus_tag="HG536_0H03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285762.1"
                     /db_xref="GeneID:59328250"
     CDS             complement(646102..647901)
                     /locus_tag="HG536_0H03600"
                     /inference="similar to AA sequence:RefSeq:NP_011390.2"
                     /note="ancestral locus Anc_6.122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141658.1"
                     /db_xref="GeneID:59328250"
                     /translation="MKITEKLQKQREKSSKPTFSYEYFVPKTTQGVQNLYDRMDRMYE
                     SSLPQFIDITWNAGGGVLSRLSTDLVSTAQSVLGLETCMHLTCTNMPVSRIDEALQSA
                     YDSGCQNILALRGDPPVNSEWTQVQGGFKYAKDLVKYIRAKYRDHFDIGVAGYPEGHP
                     GDDTDDSELIDYLKQKVDAGASFVITQMFYDADIFIKWCKKVREAGIDIPIIPGIMPI
                     TTYAAFLRRAQWCDIHIPDEFMKQLEPIKDDDQQVRETGTSLVVDMCQRILDSGYVTH
                     LHLYTMNLEKAPLMILERMNLLPDQEELDGENTLAMLPWRKSLNPQRRNEEVRPIFWK
                     RRPYSYVARTSQWAVDEFPNGRFGDSSSPAFGDLDLCGSSLIRQSGKKSLELWSTPKT
                     AEDVAQLVVDFLERKVSCLPWSDMPLNHEVDAILDDLIQLNKKQIITINSQTQLNGVK
                     SSDPVFGWGPKDGYVYQKQYLEFLLPRSKAQRLHDALKDDVILTYFAVDDEGNLSTNH
                     PDGCRANSVTWGIFPGREVLQPTIVEKVSFLAWKEEFFHILKEWRLNFQNHQIGDSAD
                     LLTHLISDYVLVNIVDNDFISQDNKIFALLNTI"
     gene            <648394..>650094
                     /locus_tag="HG536_0H03610"
                     /db_xref="GeneID:59328251"
     mRNA            <648394..>650094
                     /locus_tag="HG536_0H03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285763.1"
                     /db_xref="GeneID:59328251"
     CDS             648394..650094
                     /locus_tag="HG536_0H03610"
                     /inference="similar to AA sequence:RefSeq:NP_009782.3"
                     /note="ancestral locus Anc_6.121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141659.1"
                     /db_xref="GeneID:59328251"
                     /translation="MPQIVSVPSSQESQVKGCLKTNVVLGEIGRLEMEISECRRAVAE
                     RWSKVEYRQTQIKSDTAECNDDSAVSTDVEGYSDERVLKKVKREVIDLTASDEEIETP
                     ISSDFKLVRSEVLDSNVASSHFISFDQIFGDKTLKKSILFSYQYELDFLLARFHGKVE
                     EIILVAQTGTIRPSSAPAAIALTDRLSIIEFNMPQFTCHHSKMVINFYDDGSCRIFMP
                     SNNFTYAEANYPQQVCWCSPRLERARDAYVRGFSAFQDSLLDYLGTYKLRKISERVVS
                     SIKTVDFSPLQDVTFVFSSPSNEIASGLQSLAKIISGGARDEAGGRAYHYLCQSSTIG
                     AAVSKKTHANLFTHVFIPILHGIISPKSKLLSTEALLNEFKVRHIVPHLVYPTVEEIR
                     TSPLGWLCSGWFHFNYNRDMAHYNMLSKQFSVFRKQDSRRVSQNRRTTPSHSKFYMKF
                     TTELEAELGTSMGLDWCLYTSSNLSRTAWGTGTARPRNYEVGVLLKAGARELICRSFT
                     DVTYRDSSNFKLKPNSQLVLVPFTLPVIPYDAKQADEAFCMSKDYDLNDIDGMPYPHN
                     "
     gene            <650333..>651955
                     /locus_tag="HG536_0H03620"
                     /db_xref="GeneID:59328252"
     mRNA            <650333..>651955
                     /locus_tag="HG536_0H03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285764.1"
                     /db_xref="GeneID:59328252"
     CDS             650333..651955
                     /locus_tag="HG536_0H03620"
                     /inference="similar to AA sequence:RefSeq:NP_009781.3"
                     /note="ancestral locus Anc_6.120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141660.1"
                     /db_xref="GeneID:59328252"
                     /translation="MALTASFNDTFRVSDNIAVVVPETGVEITYRDLSHQVGHFQTLF
                     QDPQSPLYDFALRQSTVAISMTNGLEFIVAFLGATMDSKIGAPLNPNYKSEEFNFYLN
                     DLQTKIVVVPRGTVGREKDAEILKSARKFGCYIVELHFNKERFRVEYDVYSPDDNYRA
                     NKFSSLNNAVFVNHDSVRFPGFARSSDVALILHTSGTTSKPKTVPLLHLNIVRSTYNI
                     ARTYKLADTDRSYVVMPLFHVHGLIGVLLSTFLSQGSVIVPKRFSAKKFWDEFITYKA
                     NWFSCVPTISMIMLNMPRPSKMPSIRFIRSCSAALAPATFHKLESEFNAPVLEAYAMT
                     EASHQMTSNNLPPGKRKPGTVGQPQGVEVVILDDKDNVLAPGQIGEVSIRGENVTLGY
                     AHNEKANKENFTKRLNYFRTGDQGFFDPEGFLVLTGRIKELINRGGEKISPIELDGIM
                     LLHPKVDEAVAFGVQDKTYGQVVQAAVVLKKGEKLSYEELAKFIADRAAKFKVPSKIY
                     FVEKLPKTATGKIQRRIIASAFAGSQTPGSKL"
     gene            <652279..>653358
                     /locus_tag="HG536_0H03630"
                     /db_xref="GeneID:59328253"
     mRNA            <652279..>653358
                     /locus_tag="HG536_0H03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285765.1"
                     /db_xref="GeneID:59328253"
     CDS             652279..653358
                     /locus_tag="HG536_0H03630"
                     /inference="similar to AA sequence:RefSeq:NP_009780.1"
                     /note="ancestral locus Anc_6.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141661.1"
                     /db_xref="GeneID:59328253"
                     /translation="MNFRLSVPMAKRMAATTPFRLQTMRFASNKTMTVREALNSAMAE
                     EMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEYGLCGLAVGAALKG
                     LKPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQRCPIVFRGPNGAAVGVGAQHSQD
                     FSAWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGEKFEVSEECLSP
                     DFTLPYKSKIEREGTDISIITYTRNVQFSLEAAEILDKKYGVSAEVINLRSIRPLDVE
                     AIIKTVKKTNHLITVESTFPQFGVGSEIIAQIMESEAFDYLDAPVQRVTGADVPTPYA
                     KELEDFAFPDPDTIVRAAKETLSIE"
     gene            <655221..>656873
                     /locus_tag="HG536_0H03640"
                     /db_xref="GeneID:59328254"
     mRNA            <655221..>656873
                     /locus_tag="HG536_0H03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285766.1"
                     /db_xref="GeneID:59328254"
     CDS             655221..656873
                     /locus_tag="HG536_0H03640"
                     /inference="similar to AA sequence:RefSeq:NP_009779.3"
                     /note="ancestral locus Anc_6.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141662.1"
                     /db_xref="GeneID:59328254"
                     /translation="MQGLATQGSLAPHDLPQFYLLVALYFVQGIPVGLAFGTIPFLLK
                     SMAKETSFTTLGIFSIATYPYSLKILWSPIVDSIYSDKIGRRRSWIIPIQLVSGVLLF
                     ALGFAISRGLVFTGVDDAFHGRSDGIHDLSILALTFYFGTLVFLCATQDIAVDGWALT
                     ILSKQSLTYASTAQTVGMNIGYFLSFTIFLSLNSNDFANKYIRSVPKEYGLLSLGGYM
                     KFSGAIYVLLTFYVIFYTKERPLQDILPMNYTTKKDDEPKVLVEYGDGDAIGTENTSS
                     LIYTYKCFARILKLPTVRTLAVIHMISKLAFQCNEAATNLKLLEQGFKREDLAVTVLI
                     DVPFEIIFGYYVAKWSSDANNSPHFSQNNGWSRWLVGDPGVLTPWLWGFLGRLASAIL
                     GSIVVKTFPKDGEIGKLYFLVVIVQHLLGSFMSTVQFVGISAFHTRIADPAVGGTYMT
                     LLNTLSNFGGTWPRLVIMSMINYFSVYECYIPASKEKLRYHGKGMDVCTKDLNGDVSI
                     LRDGYYITNAICVTIGILLYFGFLKRKALQLQSMPITAWRCQ"
     gene            complement(<656851..>657966)
                     /locus_tag="HG536_0H03650"
                     /db_xref="GeneID:59328255"
     mRNA            complement(<656851..>657966)
                     /locus_tag="HG536_0H03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285767.1"
                     /db_xref="GeneID:59328255"
     CDS             complement(656851..657966)
                     /locus_tag="HG536_0H03650"
                     /inference="similar to AA sequence:RefSeq:NP_011389.3"
                     /note="ancestral locus Anc_6.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141663.1"
                     /db_xref="GeneID:59328255"
                     /translation="MRVSYYKLFTLLLCPATLLVGHFLSYSSWSEGLEVQTRKDGWLN
                     AFFVKRGWFWTSLVGWWCAIRYNSFGRQQRHSLVRYLVLTVWWYVFTQGLWFGIAPIM
                     DLIFTLTGGSCRFDVFDDSGNLSSLFHDSMSRRVSSLKRIYGLLKGKGVEETPLLAHS
                     LNSIRCALNATDCQDRNSSAVPIEPTELNQFIRDSLYANGPLNTSATCRALGGHWVGG
                     HDPSGHIFLITLMIMYLLGEFKVFGKKALSRIARGKKYAAKSFIDLFDNGALWNVVNN
                     KPRNTVHFVQLTVVLPPLVFVKALCRFCAQIISFAILENPIILLVVLLMMWWWSFLVT
                     SVVFHTLTEQISGLIFAYLVAGAIYWNDHWFIDSAMR"
     gene            <658128..>658499
                     /locus_tag="HG536_0H03660"
                     /db_xref="GeneID:59328256"
     mRNA            <658128..>658499
                     /locus_tag="HG536_0H03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285768.1"
                     /db_xref="GeneID:59328256"
     CDS             658128..658499
                     /locus_tag="HG536_0H03660"
                     /inference="similar to AA sequence:RefSeq:NP_011388.1"
                     /note="ancestral locus Anc_6.116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141664.1"
                     /db_xref="GeneID:59328256"
                     /translation="MATNDPEELILPTRFEVELEFVQSLANIPYLTYLLSQQQQTWKD
                     PKFKNYLKYLEYWTRPPYVQCIVYPNCLFMLKLLNGFMDKATINDDGLLEGLDDLPKI
                     IQLHGAQWMNEMVDRWASREP"
     gene            <658918..>662451
                     /locus_tag="HG536_0H03670"
                     /db_xref="GeneID:59328257"
     mRNA            <658918..>662451
                     /locus_tag="HG536_0H03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285769.1"
                     /db_xref="GeneID:59328257"
     CDS             658918..662451
                     /locus_tag="HG536_0H03670"
                     /inference="similar to AA sequence:RefSeq:NP_009777.1"
                     /note="ancestral locus Anc_6.115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141665.1"
                     /db_xref="GeneID:59328257"
                     /translation="MSNKKLSGLRDNFSLLGEKNKLLVANRGEIPIRIFRSAHELSMR
                     TVAIYSHEDRLSMHRLKSDEAYVIGEEGKYTPVGAYLAIDEIINIAKQHNVDFIHPGY
                     GFLSENAEFASKVAASGITWIGPPAEVIDAVGDKVSARNLALAANVPTVPGTPGPIDS
                     VEEAQAFVEKYGYPVIIKAAFGGGGRGMRVVREGDDIAGAFQRATSEARTAFGNGTCF
                     IERFLVKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPVEVRNAIL
                     TDAVKLAHTAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQ
                     IAAGASLEQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLD
                     GGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLL
                     THPVFVNGDYWTTFIDDTPQLFQMISSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLK
                     THPTIPRLHNADGEIINVSTTAPPDGWRQVLLKYGPEEFARRVRGFKGTLIMDTTWRD
                     AHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGATFDVAMRFLHEDPWERLRTL
                     RKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLKV
                     GVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTGKIVEMGTHILGIKDMAGTL
                     KPSAAKLLVGSIRAKYPDLPIHVHTHDSAGTAVASMAACALAGADVVDVATNSMSGLT
                     SQPSMNALLASLDGQIETNIDVKKTRELDAYWAEIRLLYSCFEADLKGPDPEVYEHEI
                     PGGQLTNLLFQAQQLGLGEKWAETKRAYKEANYLLGDLVKVTPTSKVVGDLAQFMVSN
                     KLTSDDVKRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDILRNKRRKLTVRPGLE
                     LAPFDLEKIKEDLQDRFGDIDECDVASYNMYPKVYEDFHKIKEKYGDLSVLPTKNFLS
                     PPQIGEEIEVTIEQGKTLIIKHQAVGDLNKETGIREVYFELNGELRKIPVADRSQKVE
                     TISKPKADGHDPLQIGAPMAGVIVEIKVHKGSLVKKGEPVAVLSAMKMEMVISAQSNG
                     QVKEVYVNDGENVDASDLLVVLEEAVPPAKE"
     gene            complement(<662944..>663654)
                     /locus_tag="HG536_0H03680"
                     /db_xref="GeneID:59328258"
     mRNA            complement(<662944..>663654)
                     /locus_tag="HG536_0H03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285770.1"
                     /db_xref="GeneID:59328258"
     CDS             complement(662944..663654)
                     /locus_tag="HG536_0H03680"
                     /inference="similar to AA sequence:RefSeq:NP_011454.1"
                     /note="ancestral locus Anc_6.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141666.1"
                     /db_xref="GeneID:59328258"
                     /translation="MSQDNVPDGQPDNGRDNHRMDNSVNRLIPQMFDQMRSNLGMNSF
                     DQVKGKDYQTASHNSLVNTQSMLRELETLDKLIPMFESVNNSLQKAVPSHLRRIHEIC
                     KSTNAMLDSWVNIQSQAGYVNKLMDSEEYLKYSEAQLRKDDSVTVETVISEKMREIEA
                     LKQQVANEKAKKTFTEQSTSGGQTSGGLRPGSGGRLAKSGSNKAITNSRMRRPSAIPK
                     VTSRLTRPTASSSRKMFR"
     gene            complement(<663805..>664497)
                     /locus_tag="HG536_0H03690"
                     /db_xref="GeneID:59328259"
     mRNA            complement(<663805..>664497)
                     /locus_tag="HG536_0H03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285771.1"
                     /db_xref="GeneID:59328259"
     CDS             complement(663805..664497)
                     /locus_tag="HG536_0H03690"
                     /inference="similar to AA sequence:RefSeq:NP_009776.1"
                     /note="ancestral locus Anc_6.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141667.1"
                     /db_xref="GeneID:59328259"
                     /translation="MSILQHIYTQRKLAAVRSHMSRILESESDNDESGQSSLSSSANV
                     GAHPQQEASQDSHSNNTSNMMQRKLEHFSRRLSMLGLVAAEGENKEGTEKQANLIDSE
                     GSELLQREVPMTTSLLLNKLPKATSEALEKYQAEESDTGGPRQTKVQIKFQPIGSIPQ
                     VKPSVCRISAAQPFALVTKFLSKSLKVDQVYCYINNSFAPNPQQIVGDLWSQFKVDNE
                     LIVSYCGTVAFG"
     gene            <664478..>666565
                     /locus_tag="HG536_0H03700"
                     /db_xref="GeneID:59328260"
     mRNA            <664478..>666565
                     /locus_tag="HG536_0H03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285772.1"
                     /db_xref="GeneID:59328260"
     CDS             664478..666565
                     /locus_tag="HG536_0H03700"
                     /inference="similar to AA sequence:RefSeq:NP_009775.3"
                     /note="ancestral locus Anc_6.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141668.1"
                     /db_xref="GeneID:59328260"
                     /translation="MCCRIDIIRSVFHLTILLTNINIKRKLRDWTLCDAMESIDTICD
                     NLEAAFADQKDDPLSLVTIIEMYSDQVESEGKEEEKEKYLEKLSELLVAHPDVVAQIG
                     WDLPKGLLNFYVSPNLFPYRRLRSNKIVVGVMNCFQEIAVQGNPKECLLTGCQLLSEL
                     TMEHISQELVEIEKRDSAHKEVLESFKDFTSPAELILGLKSHVLFELIQTVLRRIETL
                     YPSKFLGMAVSVICKFLRSNMDEVDNTAFFLRRIFAFCRNYAPKEVSDDAADLKELGS
                     KEVDKIKEDEAILQGKLLRNLCTFAVGFCMKRKHLRHDVQYYGSFSDVKTEKHPYYEE
                     LFEACSRFYQLAYSFDIDLREEFLSVIKGSRDIYKSLPPDSEISSDEARRGIGQVVYQ
                     LSHTYHLQKMAKATELELDPFGIVVLSGLNYLVTGKHLYPEIKLQDAIYLYIRFATPS
                     LFTDLYFNEAAEEISRYWLWVAITNSGYKELKGQLVEMPSYINAVLLQMLLLRNCEQA
                     NEQSRMVTFTLLTRLLCLMPEETTFSFSLDTLLTCPYVKPKICMLGIMKDLMLRSCQC
                     KRDLAAQLMDLKLKDNDSVTDSQKIASQGSPPPLPQRAFLSLNEDRMACIHSVALMAV
                     DKASKEERQKEDLLLLLNYLNFFNALRNKWDKNLLKSIHLEIAAHFNDGTEEKLPEIG
                     FIKVANDTLGNNL"
     gene            complement(<666629..>667897)
                     /locus_tag="HG536_0H03710"
                     /db_xref="GeneID:59328261"
     mRNA            complement(<666629..>667897)
                     /locus_tag="HG536_0H03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285773.1"
                     /db_xref="GeneID:59328261"
     CDS             complement(666629..667897)
                     /locus_tag="HG536_0H03710"
                     /inference="similar to AA sequence:RefSeq:NP_009774.4"
                     /note="ancestral locus Anc_6.111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141669.1"
                     /db_xref="GeneID:59328261"
                     /translation="MEQLRISSLLSPSIEPERDLSASKSQNVPQSPTQQARQGSNPPK
                     VILPTQKAGGNALAKNDSPDAPGVLVARISSPVNLSGEKASGQTKKPAVAATSSAGGK
                     VAEKEKKVSLTATVPSKPKANTRTAGEGRKVSKTVKKDATAPATSKSGSEKSTASKGQ
                     SENENGGKQNSEKTTAKKEGKKTASKVSDKKEGGVPSKAGDTKKKAAVKKEQSSSTKG
                     KTPKKLVAAPAIKSPSLLDLFERGKVTKEIQDPTIVLDVPLYSSKTNEYLDENGQVSF
                     NFYKLVHDKFHATQSESNITDVKVAKRNLLTQLNTTNTVGNAEDEEGEDLVEVDDEGD
                     DDEEDEGDEEKIMASPKKKSHPNKGKSLIGKYDIEDPFIDDSELLWEEQRAATKDGFF
                     VYFGPLIEKGHYGSLERTDGTMKRGGVKNK"
     gene            <669008..>670471
                     /locus_tag="HG536_0H03720"
                     /db_xref="GeneID:59328262"
     mRNA            <669008..>670471
                     /locus_tag="HG536_0H03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285774.1"
                     /db_xref="GeneID:59328262"
     CDS             669008..670471
                     /locus_tag="HG536_0H03720"
                     /inference="similar to AA sequence:RefSeq:NP_011456.5"
                     /note="ancestral locus Anc_6.110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141670.1"
                     /db_xref="GeneID:59328262"
                     /translation="MKKLLRRSIRWKHSVHTPDISQTPNFTKYSPIRPINEELAPYVL
                     ETMRAFPTGSRHVNQQHYYHNRTVLIEDYLRKKPHPVSLMQLAQYYDDSAQLTKQKII
                     NSGKFVKEELAIRMAHKLHSLQQLPFHVVNNFHFVQAYESYYNIFERFRKYPTIRTIE
                     DNEKFAAFLRRILQDFNSLNLPHLVMGALECTILDLYPQDKMDELLSSLLRARISRRL
                     IVEEHISITSNYSSGKKENTLVLGDIFQECSAKEYILQASKTCEKFIKDMYYESMALP
                     ELFIDGEVDLKFYFLPTHLKYLLGEILRNTYEATVKDYIRQGLDKPQPICITIVKNDE
                     SFLFRISDRAGGIPINDKNIWSFGKSKERASESLENFHRLPGLQTVSLYDHLYQTNNA
                     ISVDKANRPYRHTSLEPMSHTNLTGAKFKFETPLIKLMQRSYRYKLGIGLAMCKVYAE
                     YWNGDLTLHSLPGYGTDTVLKLGNLIHSAKKLQLDKV"
     gene            <670817..>671272
                     /locus_tag="HG536_0H03730"
                     /db_xref="GeneID:59328263"
     mRNA            <670817..>671272
                     /locus_tag="HG536_0H03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285775.1"
                     /db_xref="GeneID:59328263"
     CDS             670817..671272
                     /locus_tag="HG536_0H03730"
                     /inference="similar to AA sequence:RefSeq:NP_011457.1"
                     /note="ancestral locus Anc_6.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141671.1"
                     /db_xref="GeneID:59328263"
                     /translation="MKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEF
                     DEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPN
                     PASPANVEAATLFKDHKSQYVKRVKETVEKSWEDDMDDMDDDDEEEDDE"
     gene            complement(<671361..>672101)
                     /locus_tag="HG536_0H03740"
                     /db_xref="GeneID:59328264"
     mRNA            complement(<671361..>672101)
                     /locus_tag="HG536_0H03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285776.1"
                     /db_xref="GeneID:59328264"
     CDS             complement(671361..672101)
                     /locus_tag="HG536_0H03740"
                     /inference="similar to AA sequence:RefSeq:NP_011458.1"
                     /note="ancestral locus Anc_6.108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141672.1"
                     /db_xref="GeneID:59328264"
                     /translation="MLRLIRHQSTRIPPKSLIIKQNKRLNQKPTGNSNLIISSLRDVG
                     SLFQATSHTQEDDDLEQLTNSTLLLERLNSGELESLLKKKFDFDESTGLLSTNEMVKS
                     FPLLKEDELELLKKASDVENEKPWSSVPNFIKQAQFYLSFGSHGPRDGMSFTVSERPS
                     DFTFLRRARSASDPRIPCRKLKKSEMVNLYAATPARQAFFDERTIDPISRLFVWSAVA
                     VSIAVGWKEYQVRKSGESFATVVDKNPV"
     gene            complement(<672252..>673772)
                     /locus_tag="HG536_0H03750"
                     /db_xref="GeneID:59328265"
     mRNA            complement(<672252..>673772)
                     /locus_tag="HG536_0H03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285777.1"
                     /db_xref="GeneID:59328265"
     CDS             complement(672252..673772)
                     /locus_tag="HG536_0H03750"
                     /inference="similar to AA sequence:RefSeq:NP_009773.1"
                     /note="ancestral locus Anc_6.107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141673.1"
                     /db_xref="GeneID:59328265"
                     /translation="MSGTSGSNGPSGSSCSPNLTASRHASIVEMLSTPPHLPHHHQRQ
                     PQHEQQKGEGAEGLARTTSIGSSHSSVSSISGSSRDHETQTGSECESVGMGPTASQCL
                     YTVHHQEWQHIRLSELVEQNKLVTVPGSMSVEEAFNTMIRHHLTSLPVEQYPGDMNCL
                     TFDYNDLNSYLLVVLNKIRVNDRAIQQDCQNGKPVPVGEIVKLTPKNPFYKLAETENL
                     STVMGILGSGVHRVAITNVEMSQIKGVLSQRRLIRYLWDNARTFPSLEPLFNTSLQDL
                     KIGVLNSHAKPTSRQSRVISIQGDEPLIMALYKMYQERISSIAVVDRQANLIGNISVT
                     DVKHVTRTSQYPLLHKSCRHFISVILNVRGLEMGKDSFPIFHVYPTSSLARTLAKLVA
                     TKSHRLWIVQPPESASSSTSLESLSQGSYASPSAAAGPNTTNTSQSPIISAMEDPPSP
                     HSSAVASNLFEKEYRTGKLIGVVSLTDILGLLARSQTEHKQVDPQSARRQRGSVIS"
     gene            <674286..>675740
                     /locus_tag="HG536_0H03760"
                     /db_xref="GeneID:59328266"
     mRNA            <674286..>675740
                     /locus_tag="HG536_0H03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285778.1"
                     /db_xref="GeneID:59328266"
     CDS             674286..675740
                     /locus_tag="HG536_0H03760"
                     /inference="similar to AA sequence:RefSeq:NP_011460.3"
                     /note="ancestral locus Anc_6.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141674.1"
                     /db_xref="GeneID:59328266"
                     /translation="MSKMDEVDLVQANILASGCNKKSVRVVNGFGSMMGSKDMVSVDY
                     EKDSNMDHLLRRDQEEKEKYAKNKHISEQPWTLNNWHKHLNWLNMILVVVLPSIGWYF
                     ALSGKARLQWQTLAFSIAYYVVGGASITAGYHRLWSHRSYNARWPLRLWYAFFGAASV
                     EGSIKWWGHSHRLHHRYTDTVRDPYDARRGLWFSHMGWMLLKPNPKYKARADIEDLTD
                     DWIVRFQHRHYLLIVLLSAFILPTLVCGYFFNDYLGGFIYGGLIRVFCIQQATFCINS
                     LAHYLGDQPFDDRRTPRDNWVTALVTFGEGYHNFHHEFPTDYRNAIKWYQYDPTKIII
                     YMSSLCGLAYDLKKFSHNAIQQALVQQQQKKLDRQRSKLNWGPQLTDLPVWDKQDFLR
                     EMEKRKGLVVISGIVHDVSGYISEHPGGETLLQAALGKDATKAFNGGVYRHSNAAHNV
                     LATMRVAVVKEGEDAAIKFAARRGEIYAKTAKAE"
     gene            complement(<675839..>676657)
                     /locus_tag="HG536_0H03770"
                     /db_xref="GeneID:59328267"
     mRNA            complement(<675839..>676657)
                     /locus_tag="HG536_0H03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285779.1"
                     /db_xref="GeneID:59328267"
     CDS             complement(675839..676657)
                     /locus_tag="HG536_0H03770"
                     /inference="similar to AA sequence:RefSeq:NP_009772.1"
                     /note="ancestral locus Anc_6.105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141675.1"
                     /db_xref="GeneID:59328267"
                     /translation="MPGQSLLLAHRLEGKNVLLVGGGEVALTRLKKLIPTGSRVTLIA
                     PEVHPAVWEKYCSFIGPDEANSRVDFTDKDWRAKNGIYRVIKEGFKFDYLDLYRKDND
                     SGWSLILTCIPDKPLSEEIYHESKRRFGSQQTVNVADNPPLCDVYFGAELNFGAGDDS
                     RMQLMISSNGMGPRFVALVRDEIRRMLEGIDFESSLDNLGALRQAVRGIASNDSRDTK
                     YRMNWMKRCTETFGIKNCENLNVEELTKLFEKMYNDDQNMQFPREEEMFEKYLQ"
     gene            complement(<676801..>678678)
                     /locus_tag="HG536_0H03780"
                     /db_xref="GeneID:59328268"
     mRNA            complement(<676801..>678678)
                     /locus_tag="HG536_0H03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285780.1"
                     /db_xref="GeneID:59328268"
     CDS             complement(676801..678678)
                     /locus_tag="HG536_0H03780"
                     /inference="similar to AA sequence:RefSeq:NP_009771.3"
                     /note="ancestral locus Anc_6.104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141676.1"
                     /db_xref="GeneID:59328268"
                     /translation="MSDEQPQLRQAGGNGLNAAIPLPPSATIETSDEPPRTLWMGDLD
                     PSFDEVTIQEIWQQLGRRVFVKLIRAKKNLLIPCSSTAATSSTNAEAPATGENVAREG
                     SPTSNEGELPGGLENAQKININGVSFIDPATTPLHHAGYCFVEFESQQDAQFALSLNS
                     TPLPNFLSKSTNLPTNPTGQRNFRLNWASGATLQSSIPSRPEFSLFVGDLSPTATEAD
                     LLSLFQQKFRSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALVEMNGAWCQGRCLR
                     VAYATPRNNMMWHVQAQQQQSSSLQQQQATPLLVKTANNMMTSNQGALGGASNLLSMP
                     MSQKSSILPISSGAGLNVADFSSSQAYTTDPNNTTVFIGGLTPKINEAQLQALFSPFG
                     SIVTVKIPQGKNCGFVKYENRIDAEAAIQGMQGFIVGGNPIRLSWGRSTVGSGPSGPA
                     NASNNGNHHNNRKNEKPTEFQQITGHQYINQQHYGNEYQYMPMRHTASELTKVAPGLD
                     RNQNVSTPLMMPSQQLFTQVRQQMWNNDTQWNNVPVEVYSETPVPNQQNMNSMLPQQQ
                     QYQRLQQSQNPMMTVPNVGPGPVGGTFNMNIAPNAGGISLPNARGNSNDVPPIHPSVL
                     R"
     gene            <679248..>680159
                     /locus_tag="HG536_0H03790"
                     /db_xref="GeneID:59328269"
     mRNA            <679248..>680159
                     /locus_tag="HG536_0H03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285781.1"
                     /db_xref="GeneID:59328269"
     CDS             679248..680159
                     /locus_tag="HG536_0H03790"
                     /inference="similar to AA sequence:RefSeq:NP_009770.3"
                     /note="ancestral locus Anc_6.103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141677.1"
                     /db_xref="GeneID:59328269"
                     /translation="MNADLTDRGIKLLYRQRGSRSRHVAQVSDGSWPVIRAPEVTPEP
                     ENDDDELAGEPILQDGPLDPPLGLDPLQEPEPEPAVDAPRDDLDEYAPGYNEVEVEED
                     ELYQYNFQNMPLRQLSSSITSITSIDVLISMLSNLFENDLIPQATREFEASQDKHSKM
                     MYKLDVRIFESVLQQLVKDFKDILDINMSNNELCYQLKQLVMAREDLNEELVQVRKET
                     QELKCGGEWYQLQQEQSDLNERVGLNEQLNQLTATLAGERPVPSQPAPLVTNEGVDEF
                     CGIVNPYSGVLAQIESINVKLRQEPFT"
     gene            complement(<680209..>680619)
                     /locus_tag="HG536_0H03800"
                     /db_xref="GeneID:59328270"
     mRNA            complement(<680209..>680619)
                     /locus_tag="HG536_0H03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285782.1"
                     /db_xref="GeneID:59328270"
     CDS             complement(680209..680619)
                     /locus_tag="HG536_0H03800"
                     /inference="similar to AA sequence:RefSeq:NP_009769.1"
                     /note="ancestral locus Anc_6.102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141678.1"
                     /db_xref="GeneID:59328270"
                     /translation="MGAWLFILAVVVNCINLFGQVHFTILYADLEADYINPIELCSKV
                     NSLITPEAALHGLLTTLFLLNGYWFVFLLNLPILAYNVNKIYNKVQLLDATEIFRTLG
                     KHKRESFLKLGFYLLMFFFYLYRMIMALISESDD"
     gene            complement(680908..680979)
                     /locus_tag="HG536_0Htrna10E"
                     /db_xref="GeneID:59328391"
     tRNA            complement(680908..680979)
                     /locus_tag="HG536_0Htrna10E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:59328391"
     gene            complement(<681247..>681990)
                     /locus_tag="HG536_0H03810"
                     /db_xref="GeneID:59328271"
     mRNA            complement(<681247..>681990)
                     /locus_tag="HG536_0H03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285783.1"
                     /db_xref="GeneID:59328271"
     CDS             complement(681247..681990)
                     /locus_tag="HG536_0H03810"
                     /inference="similar to AA sequence:RefSeq:NP_013404.1"
                     /note="ancestral locus Anc_6.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141679.1"
                     /db_xref="GeneID:59328271"
                     /translation="MPDLLKRVAFQVGLVPNERAFALSSVSNDGHYISLRPFVKPQGP
                     SEEAFPFEWAFAGTNKHVTVTQVKPNVVNQDFNFWFDVNVYLDAPNTHRGVIKTTWET
                     WESGCLAETGSVFPEGFNNEGVAFFELWQPLDPTKEELVIKSEKNEASADSAKSVVFK
                     TAEGSGYDGLLIVTGKWAQGFLSKQNVGKIEGLNFIRAQETQTSSVADVIFQYGQECN
                     KFPRKFNGVKLGDVIDANGLKWDVIESYQ"
     gene            complement(<682257..>685946)
                     /locus_tag="HG536_0H03820"
                     /db_xref="GeneID:59328272"
     mRNA            complement(<682257..>685946)
                     /locus_tag="HG536_0H03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285784.1"
                     /db_xref="GeneID:59328272"
     CDS             complement(682257..685946)
                     /locus_tag="HG536_0H03820"
                     /inference="similar to AA sequence:RefSeq:NP_014834.1"
                     /note="ancestral locus Anc_6.100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141680.1"
                     /db_xref="GeneID:59328272"
                     /translation="MEVADVPTIDLTLDDVDAGSKKSAIAASSQRLPSLKDSPKIRHD
                     FSSPLKSSMQAAPAGSKRQVEHLELDDEPNKRPNPGREVITLIDDEKGNNEMDPQSKE
                     IFFRDSSKSLQANSAIFKSLQANSAILQKKLVKREEEFSDAKRKWSLLDKSINNGGEQ
                     LSRTQQILLEEARLSMERLDRKRQVTRSKLEDVKRRMHDFANKWNAFVSSHSVELNQT
                     RVDGEEGEIYVKERQNLLAQKERIGNMAKSGSIDHASYLKMSLELDKKLNALKLERLS
                     REGSPRISMPATEKKDLFAASLETAKQLLAENTSRTELTKRTLYQQLDLIRRYRDHFQ
                     MGKTSNISMRNTCRDAAEMLFQNGVKMPLVYDTLQDFGIQFRNRNILKVDRRAQFYKS
                     LEVARELVKNSNRNFSIKSRIIDSLNLLQDLRQFVDSGMPPSTAFKQKVAATVVELKE
                     QGLRMDKLYENLKNYGIVTTRSELDLLPKLQHDKEEAFIDAQETVDAYAIMEPQSYSR
                     SSNFQVANVYSADDQEQIRSLLENIKQDEDEIEGETLTPEELTVNLLKHQRIGLKWLL
                     NVENSRKKGGILADDMGLGKTVQAIALMLAHRSKNEACKTSLIVAPVSVLRSWQGEIE
                     TKIKKTANFKSYIYGGAGGNKSNDWNTLAKYDAILVSYQTLAIEFKRHWPLQLSEIGK
                     DYPTIENIEAMNSLKQRNEYWSPFFRNESTFYRVILDEGQNIKNKNTKAAKACCTVSS
                     KYRWILSGTPIQNNMSELYSLIRFLRIPPYHREERFNADIGRPLSNNRNNDYDSEDRK
                     RTMKKVRVLLKAIMLRRSKTDKIDGKGILELPAKDVEIEEAHLEGEEQAFYSNLEQKN
                     QKIAKRILEKKARGGYSSVLTLLLRLRQACCHPELVIAGEKKAEDTKVANGKSFENDW
                     LRLYRRIRAMSKDQQEVVINSMDLMTCFWCLEQLEPESSSVLTGCGHLLCEACVEPFV
                     DEAAGLPNALHTEKGILRLPCKKCQNRTLETEIVSYRLYDQVINQSFTEQMLFAEYQG
                     EMMRQKSKARNVYFPDLKTLKPSTKMRQCIDVIQKVMEKSDMEKILVFSQFTTFFDLF
                     EHFLTELKVPFLRYTGDMNAQQRSDVINRFYREKDKRVLLISMKAGNSGLTLTCANHV
                     VIVDPFWNPYVEEQAQDRCHRISQTKEVHVHKLFIKNSVEDRIAELQKRKREMVDAAM
                     DASNMDSVNRLGARELGFLFGLNTL"
     gene            complement(<686151..>687482)
                     /locus_tag="HG536_0H03830"
                     /db_xref="GeneID:59328273"
     mRNA            complement(<686151..>687482)
                     /locus_tag="HG536_0H03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285785.1"
                     /db_xref="GeneID:59328273"
     CDS             complement(686151..687482)
                     /locus_tag="HG536_0H03830"
                     /inference="similar to AA sequence:RefSeq:NP_013403.1"
                     /note="ancestral locus Anc_6.99"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141681.1"
                     /db_xref="GeneID:59328273"
                     /translation="MLLQSLLLSVVSLGLVLGSPIPAKSPHSVQFLTDRNEKRFFDYG
                     AIQYSEPIRGVNIGGWLVLEPYITPSLFETFRTNANSDEGIPVDEYHFAQALGKEVAS
                     SRLEAHWSSFYTETDFQNIANLGFNLVRIPIGYWAYELLDSDPYVKGSQAEYLDKAIG
                     WASKYGLKVWVDLHGAAGSQNGFDNSGLRDSWAFLEDSNLAVTTKVVNYLLEKYSQDE
                     YLDTVIGVELINEPLGPVLDMQKLKQNFYTPAYNYLRNTLQRNQIIVIHDAFQPFNYW
                     DNFLTADSGAWGVVVDHHHYQVFSSGELQRSIDEHVAVACSWGQGALTEAHWTVCGEF
                     AAALTDCTKWINGVGYGARYDGSFNKGNEHSSYIGSCQNNEDISSWSDQRKQNTRRYV
                     EAQLDAFEKRGGWIIWCYKTESTIEWDLQRLTYHGLFPQPLTDRKYPGQCK"
     gene            complement(<687961..>688245)
                     /locus_tag="HG536_0H03840"
                     /db_xref="GeneID:59328274"
     mRNA            complement(<687961..>688245)
                     /locus_tag="HG536_0H03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285786.1"
                     /db_xref="GeneID:59328274"
     CDS             complement(687961..688245)
                     /locus_tag="HG536_0H03840"
                     /inference="similar to AA sequence:RefSeq:NP_014832.1"
                     /note="ancestral locus Anc_6.98"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141682.1"
                     /db_xref="GeneID:59328274"
                     /translation="MSQSATTNTTTNNSQPSASPENKNKTTTAAGKDEAKKKTFSTKP
                     VIPWDHEPHSVNVKSFVGYDIQFTGWTRRDIRAKRCEEAAAADARDAENE"
     gene            complement(<688351..>691599)
                     /locus_tag="HG536_0H03850"
                     /db_xref="GeneID:59328275"
     mRNA            complement(<688351..>691599)
                     /locus_tag="HG536_0H03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285787.1"
                     /db_xref="GeneID:59328275"
     CDS             complement(688351..691599)
                     /locus_tag="HG536_0H03850"
                     /inference="similar to AA sequence:RefSeq:NP_014831.3"
                     /note="ancestral locus Anc_6.97"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141683.1"
                     /db_xref="GeneID:59328275"
                     /translation="MGITNATASKPLPTPPPEANLNKEPSSSSPKRNDNAEPARPSMN
                     LRKGHGDEDYQEDEEFEFFQSFDREKVKDVIHAITAGLKDKGADVEYLMIPFRPQQTN
                     EKLLRLLNSLFPMGNGQPVAEKQRIRIVQKTEPLTLFQGLTYLWCRLPDGEVIGWKAY
                     LQFKAREKEKNYPTRGFLELMPQCLSSPSHASIVYDFFDLIVSLASNSRVNKMSARKI
                     SKMCAIWAFGKPLEATGNSLDYDFTNTSESPNNSFQDGLNDWIPATDAMFHLLLAFLK
                     SFVPQDLESAQLPSTLKSLLFNNEYPPKGSTAYSSQTVLTIPLVTLHTDRFSRKPWEL
                     LERCGELLDFSKYDAFQAREDYALLKSLFKKSNQVEGISRKMSQESRRLMKLMSTKHS
                     TFQAGWSKRKCLPNEAKLPESIEVKRVDIDDFFIWAWLSTLSYEQTSSKRNLFGRSLI
                     LEFEFDGFKKWVLFQECDITLESRKHQRQRDIEGLVPHSELPKEQLPQKDQRKVTPVY
                     ESFQKRVPSAGSQSSDSPSSDGYHTIISKESLGKNGSKHNVNLHAIEQKIAKWNPLSK
                     AKRKTSGNDTLPSKEERTAAPQVKKDSILIDPHRSIYELPPIERDVDGFKDIFADHGF
                     DDDEDAELESRRTNMTRERSAPVASMTQTKNRSDEAMEELKGMMDQMITEDMANFSGC
                     DDLPSTAGNSTRETFDSLTKFDQYKPAQAYTDTPTSSASAVPSLKLNGSVPSLQPLDS
                     QEDVQVRADSRHPSPLEKQLPEIRINNGSGATSPIRPDVAVQGQVLPTTPASLPGQND
                     AIGSVARSPPPPASQEAGAPPAVRNVPRAQSPPRPRAPEYPQTAAYTARSQSPPRAPL
                     PPPAAQPPVYPQADSYYTRSQSPARQPAPRPQLPQTAEYTARSQAAGPLGYPQTSDYT
                     ARSQSPPRQPAAAAPPSKLPANIYPPRAQITQYPGSGYPPYTRPQDQFPAQPPVAYGH
                     RSPELRGGPYQAPAETPYAVDHPPRAHHYQLPPPNGDYARYQQPPHPRQHQYPTGPTR
                     SPQTQARTQFYGHVDPSTTSRIPGAKLHGGHINRQQDRKKLHNNIRNGDFGI"
     gene            complement(<691789..>693687)
                     /locus_tag="HG536_0H03860"
                     /db_xref="GeneID:59328276"
     mRNA            complement(<691789..>693687)
                     /locus_tag="HG536_0H03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285788.1"
                     /db_xref="GeneID:59328276"
     CDS             complement(691789..693687)
                     /locus_tag="HG536_0H03860"
                     /inference="similar to AA sequence:RefSeq:NP_013402.1"
                     /note="ancestral locus Anc_6.96"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141684.1"
                     /db_xref="GeneID:59328276"
                     /translation="MQSPSSGGKFLHRRIAAVILSLISILSVAQSHPVTNFVPVRPDF
                     GSFEKLDSGHNIEIDPLRREPTLNPDKDLLKIGRHGGISSDLQLCSNLTIEKVLQKFP
                     GSNAADAAVTQALCIGMINFFNSGVGGGGYAVFSGKQEKDHLFVDFREQAPAGSHKQM
                     FDECPDCSKVGGLAVGVPGELKGLYELHKSRGSGQVAWADLVTPVAELGYEGWEIGAA
                     LGASLEKYEPLLLQMTEDWSFVINSTGNGVKKAGDWIQRPALSDTLMELAKNGSAEPF
                     YDPNHWVARSIVKSIGKHGGILTKEDLANYTVSAGKPLSLKIRSGYQYAPNNDLTVLT
                     SSGSSSGAALISALSIMDQMETVEGGDYMPLTSFQLIEAMKWMGSARSRLGDYDGDEI
                     PAHIKEVLGKEWIDNAAGKIKQNCLRSEPKTFENWTWYNPAYEINEPHGTAHFSIVDG
                     LGNAVSLTTTINLLFGSLVHDPVTGVIFNNEMDDFSQPHRSNSFGLAASIYNYPSPGR
                     RPLSSAVPSIILNELGIPDLVVGASGGSTITTSVLQAIVRSYWYNMPLLETIAYPRVH
                     HQLLPDVLEVENYSMVGKSAVGSFNKMGYSTQERGPRSVVNAIRYFNGDWHAVSDYWR
                     KRGVSSVY"
     gene            complement(<693987..>695282)
                     /locus_tag="HG536_0H03870"
                     /db_xref="GeneID:59328277"
     mRNA            complement(<693987..>695282)
                     /locus_tag="HG536_0H03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285789.1"
                     /db_xref="GeneID:59328277"
     CDS             complement(693987..695282)
                     /locus_tag="HG536_0H03870"
                     /inference="similar to AA sequence:RefSeq:NP_014830.1"
                     /note="ancestral locus Anc_6.95"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141685.1"
                     /db_xref="GeneID:59328277"
                     /translation="MLVSKLSSRLVPGSFFRPACLARSFATSLRVSAAAFDRKKPHLN
                     IGTIGHVDHGKTTLTAAITKTLAKHGGADFLDYAAIDKAPEERARGITISTAHVEYET
                     KNRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQH
                     IVVFVNKVDTMDDPEMLELVEMEMRELLTQYGFDGDNVPVIMGSALCALEDRQPEIGE
                     QAIMKLLDSVDEYIPTPKRDLDKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEEIE
                     IVGHNSAPLKTTVTGIEMFRKELDQAMAGDNAGILLRGVRRDQLKRGMVLAKPGTVKA
                     HTKFLASLYILSKEEGGRHSGFGENYRPQMFIRTADVTVVLKFPEAVEDHSMQVMPGD
                     NVEMECELIHPTPVEVGQRFNIREGGKTVGTGLITRLLE"
     gene            <695483..>696127
                     /locus_tag="HG536_0H03880"
                     /db_xref="GeneID:59328278"
     mRNA            <695483..>696127
                     /locus_tag="HG536_0H03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285790.1"
                     /db_xref="GeneID:59328278"
     CDS             695483..696127
                     /locus_tag="HG536_0H03880"
                     /inference="similar to AA sequence:RefSeq:NP_013401.1"
                     /note="ancestral locus Anc_6.94"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141686.1"
                     /db_xref="GeneID:59328278"
                     /translation="MARYYCEYCHSYLTHDTLSVRKSHVIGKNHLRIVGNYYRNKAKQ
                     EETERVQPRKRQNRNPKTTKNAGIKQPIHCPTNREKRRLNRIARYHRKELQTVGEESL
                     LQKVYDGSPGYSKIFIDGNRLDIGDLVRTSRLPQRANASEPQNNAPTRTRNEVFTPSR
                     QSFTLEPPRILTQWQSTVPKQSLYHEERLLNTVIDESRKRMQTPVISHARKRKN"
     gene            <697558..>698934
                     /locus_tag="HG536_0H03890"
                     /db_xref="GeneID:59328279"
     mRNA            <697558..>698934
                     /locus_tag="HG536_0H03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285791.1"
                     /db_xref="GeneID:59328279"
     CDS             697558..698934
                     /locus_tag="HG536_0H03890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141687.1"
                     /db_xref="GeneID:59328279"
                     /translation="MGKKKSLEEFVEECRKVHDDKYNYSITNYTRWDCKIEYICPIHG
                     VQSQRADDHRHGRGCKLCGRERTRKTFALTTEKFIETCKKKHNNRYSYPNTVYVDYES
                     AVKIECARHGEFVQIAGYHLTGSGCQKCAVFNKSSGPALKPADYDEFVGLSIKVHGDV
                     YDYSQVNYKKHYVTVDIVCTDHGPFRCTPTTHLKGKGCATCQNFDAFVQKAKSIHGDK
                     FDYDKSTYIRSKTKMRILCREHGEFWQIPVDHARVTRKGGFHCPSCFLENKRLTIDEV
                     KERSRNIHGLAYKFDKLVLGKSLQEEAIFYCIKCAKYFSQKPINHLQGKGCSWCCESK
                     HEKKIENWLQTTDYQFESQKRFPDLRYKKSLRCDFYLEQFNLIIEFDGIQHFKPVEAW
                     GGFEEFLRVQARDRAKDDYCTEKRINLLRMKDGQDVIQGVQDLIELIKANETGHVLHM
                     IYGKLATF"
     gene            <700558..>700911
                     /locus_tag="HG536_0H03900"
                     /db_xref="GeneID:59328280"
     mRNA            <700558..>700911
                     /locus_tag="HG536_0H03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285792.1"
                     /db_xref="GeneID:59328280"
     CDS             700558..700911
                     /locus_tag="HG536_0H03900"
                     /inference="similar to AA sequence:RefSeq:NP_013398.1"
                     /note="ancestral locus Anc_6.92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141688.1"
                     /db_xref="GeneID:59328280"
                     /translation="MFAVRSTSRLLLLKRVPLARQICQTRINHNVVQDLYLRELKNVK
                     LNPITAKDAEGNVKQWVDPVKPKQPELEGQGADALKAYSAEAVETKTGVMEEESNVEE
                     DWLVLDDAEEDSHGH"
     gene            <701752..>702420
                     /locus_tag="HG536_0H03910"
                     /db_xref="GeneID:59328281"
     mRNA            <701752..>702420
                     /locus_tag="HG536_0H03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285793.1"
                     /db_xref="GeneID:59328281"
     CDS             701752..702420
                     /locus_tag="HG536_0H03910"
                     /inference="similar to AA sequence:RefSeq:NP_013396.1"
                     /note="ancestral locus Anc_6.90"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141689.1"
                     /db_xref="GeneID:59328281"
                     /translation="MSAPAAGNAQGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKY
                     IATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRIT
                     YKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNY
                     NFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDED
                     DADL"
     gene            <702576..>703157
                     /locus_tag="HG536_0H03920"
                     /db_xref="GeneID:59328282"
     mRNA            <702576..>703157
                     /locus_tag="HG536_0H03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285794.1"
                     /db_xref="GeneID:59328282"
     CDS             702576..703157
                     /locus_tag="HG536_0H03920"
                     /inference="similar to AA sequence:RefSeq:NP_013395.1"
                     /note="ancestral locus Anc_6.89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141690.1"
                     /db_xref="GeneID:59328282"
                     /translation="MTEILYDVNSKRLKCTDEADENLQTNVDQVNSLTAALIPETNPN
                     FTPQPHEDISKLVKNLFDSGLKNAKQNKFPEALKNVSLAIEMAQRKRAPWEAFAVQLQ
                     ELQFMLRHKIDLLLVLGKYLDALQDLDMLLNTGLVQPEVFIRKTDALLKLGRLDQARI
                     ECERGLSLQPQNTKLKALNLECARRLADFNGDL"
     gene            <703313..>704476
                     /locus_tag="HG536_0H03930"
                     /db_xref="GeneID:59328283"
     mRNA            <703313..>704476
                     /locus_tag="HG536_0H03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285795.1"
                     /db_xref="GeneID:59328283"
     CDS             703313..704476
                     /locus_tag="HG536_0H03930"
                     /inference="similar to AA sequence:RefSeq:NP_013394.1"
                     /note="ancestral locus Anc_6.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141691.1"
                     /db_xref="GeneID:59328283"
                     /translation="MPSSTTVSAASSANFDVNVSIEHFIARLKRKQIDNSYAMALETL
                     QILKRFISAARWSHVTELIEQIRQLADRLEKAQPAAFCCGNVIRRVLAVIRDEFEEDM
                     RSTVVSTAATTNTVAEPMISSMFNLLQKPEHQLQQQQQQQQQQKSQKGTKTKTDFRQV
                     AIQGIKDLIDEITNIDDGIQQIAIDLIHDQEILLTPTPESKTVLKFLIKSKERSNRTF
                     TVLVTEGFPNNTAKAHEFAKKLAQHNIETIVVPDSAVFALMSRVGKVIIGTKAVFING
                     GSMASASGVSSVCECAREFKTPVFAVAGLYKLSPLYPFDVERLVEFGGSQKVLPHMDP
                     HNRLDIINPVTAYVPPENIDIYITNIGGFAPSFIYRVAWDNYKQVDVNIGQAL"
     gene            <704875..>705702
                     /locus_tag="HG536_0H03940"
                     /db_xref="GeneID:59328284"
     mRNA            <704875..>705702
                     /locus_tag="HG536_0H03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285796.1"
                     /db_xref="GeneID:59328284"
     CDS             704875..705702
                     /locus_tag="HG536_0H03940"
                     /inference="similar to AA sequence:RefSeq:NP_013393.1"
                     /note="ancestral locus Anc_6.87"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141692.1"
                     /db_xref="GeneID:59328284"
                     /translation="MVSKLLVFGGNGFLGKRICQEAVNNGFQVMSLSRSGRPPRPQSP
                     QDKDWIGEVQWEAADVFDPLSYNRHLRDATDVVHSLGILLEDESYKVKVRNPLNKSFD
                     FKSLMPSFGSNPLDKKNPNFTYERMNKESALILAQAFRQTLSSHEAKRRDMPTFTYIS
                     ADKGFPLIPKGYINSKRQAEAELMHYEGLFRPILVRPGFMFDEYKTTADARSYVHNGL
                     ELLNCGNRVLLRNKLRFVNELIRPTISTQQVSRNIISKIKDPSFSGIVSLESMLSMN"
     gene            complement(<705756..>707690)
                     /locus_tag="HG536_0H03950"
                     /db_xref="GeneID:59328285"
     mRNA            complement(<705756..>707690)
                     /locus_tag="HG536_0H03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285797.1"
                     /db_xref="GeneID:59328285"
     CDS             complement(705756..707690)
                     /locus_tag="HG536_0H03950"
                     /inference="similar to AA sequence:RefSeq:NP_013392.1"
                     /note="ancestral locus Anc_6.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141693.1"
                     /db_xref="GeneID:59328285"
                     /translation="MLSIGRSRFLLHRSWRPLIRRNHQQVNASKLKSIQDRIERIPIE
                     DYRNFSIVAHVDHGKSTLSDRLLEITGVIKPGENKQVLDKLEVERERGITIKAQTCTM
                     FYHDKRYGKDYLLHLVDTPGHVDFRGEVSRSYASCGGALLLVDASQGVQAQTVANFYL
                     AYSMNLKLIPVINKVDLDIADIAQAEDQIENTFELSKDDIIKVSAKTGLNISKDLLPA
                     IIDRVPPPTGFKDKPFRALLVDSWYDSYVGVVLLVHVVDGSVRKGDRISSAQTSKKYE
                     VKEIGIMYPDRTPTNSLSTGQVGYIVPGMKASQDAKVGDTLMHVGREQETETLPGFEE
                     TKPMVFVGAFPADGTEFKALDDDISRLVLNDRSVSLQRETSNALGQGWRLGFLGSLHA
                     SVFRERLEKEYGSKLIITQPTVPYQIQFNDGTQRVITNPDDFPDLALRRSKIESFKEP
                     FVEAIMTLPQEYLGNVIKLCDGNRGQQIEITYLNMTGQVLLKYHLPLAHLVDDFFGKL
                     KSVSRGYASLDYEDIGYKDSDVIKLELLVNGKSVDALAQVMHRSQVERVGREWVKKFK
                     EFIKAQLYEVVIQARANNKIIARETIKARRKDVLAKLHASDVSRRKKLLVRQKEGKKQ
                     LRSIGNVQVSQEAYQAFLKR"
     gene            <707820..>709058
                     /locus_tag="HG536_0H03960"
                     /db_xref="GeneID:59328286"
     mRNA            <707820..>709058
                     /locus_tag="HG536_0H03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285798.1"
                     /db_xref="GeneID:59328286"
     CDS             707820..709058
                     /locus_tag="HG536_0H03960"
                     /inference="similar to AA sequence:RefSeq:NP_013391.1"
                     /note="ancestral locus Anc_6.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141694.1"
                     /db_xref="GeneID:59328286"
                     /translation="MKLKLIVNGYESQDDYKLLRTTLSTVASLRKTAVLRFTSERLVI
                     ISTPRSSGSSNSTVLYGDTGQIWCTIPRDLFKLYTVTSARELNTITMEYNCDSLVTVF
                     KRYDRAMSQGCSSDMTIKLQSMPEWNAGGGLASNSSSSRVNPVCALGITFEEILHAPA
                     CSGADYESGSMGDSAKVGYMSDKTVLHSFRIPVRLLFKAQDARIQEPMINYSNLMMCK
                     LPPHSGEFGAGFSNFIKRVERYTSIRHIKLSGSRKEGGSTSQDPQLKIVVNQLDWHLE
                     LCWNGPLDAIVQQEIPNEVQETPQRVPDDDSMAVEDSEGNKTNDGVDVELVDVSAMVE
                     RAERESSLVNEVFMRCKDWKVCHKLYGAFEEVVLAISHDESCVLHCSLDRGSRGDDGT
                     SGEPKERGQIIYYIARSKPL"
     gene            complement(<709076..>710263)
                     /locus_tag="HG536_0H03970"
                     /db_xref="GeneID:59328287"
     mRNA            complement(<709076..>710263)
                     /locus_tag="HG536_0H03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285799.1"
                     /db_xref="GeneID:59328287"
     CDS             complement(709076..710263)
                     /locus_tag="HG536_0H03970"
                     /inference="similar to AA sequence:RefSeq:NP_014827.3"
                     /note="ancestral locus Anc_6.84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141695.1"
                     /db_xref="GeneID:59328287"
                     /translation="MSLEREEPHHFGAGPAQLPTQVLQQAARDLLNFNNLGLGVGEIS
                     HRSKDAKKVIEDAKAHLKELMNIPDTHEVFFLQGGGTTGFSCTASNLAAAYVAKTGEI
                     APAGYLVTGSWSQKAYEEARRLHVPAEVIFNSKDFNDKKYGSIPSESEWSDRIKGKKF
                     SYVYLCENETVHGVEWPKLPECITADENIELVADLSSDILSREIDVSRYAMILAGAQK
                     NIGLAGLTVYIIKKTILDEISKVHDDELYKLGLPITPIAFHFPTVVKNDSAYNTIPIF
                     TLHVMDLVFQNLLSKGGVPAQQRENERKAKILYDVLDQYSNFYNLPVEKSCRSKMNVV
                     FTLKKEGLDGKFLQEAEQRGLTGLKGHRSVGGFRASIYNSLSLESVQKLVTFIKDFAE
                     SNA"
     gene            <710824..>711107
                     /locus_tag="HG536_0H03980"
                     /db_xref="GeneID:59328288"
     mRNA            join(<710824..710826,710919..>711107)
                     /locus_tag="HG536_0H03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285800.1"
                     /db_xref="GeneID:59328288"
     CDS             join(710824..710826,710919..711107)
                     /locus_tag="HG536_0H03980"
                     /inference="similar to AA sequence:RefSeq:NP_014825.3"
                     /note="ancestral locus Anc_6.83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141696.1"
                     /db_xref="GeneID:59328288"
                     /translation="MGKVHGSLARAGKVKSQTPKVEKQEKPKKPKGRAYKRMLYTRRF
                     VNVTLTNGKRRMNPGPSSQ"
     gene            <711247..>712290
                     /locus_tag="HG536_0H03990"
                     /db_xref="GeneID:59328289"
     mRNA            <711247..>712290
                     /locus_tag="HG536_0H03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285801.1"
                     /db_xref="GeneID:59328289"
     CDS             711247..712290
                     /locus_tag="HG536_0H03990"
                     /inference="similar to AA sequence:RefSeq:NP_013389.1"
                     /note="ancestral locus Anc_6.82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141697.1"
                     /db_xref="GeneID:59328289"
                     /translation="MSEEVIDQQKVTELVASIRDQFVLPYRDAAALKEIKSSTSFKDS
                     DPLTEIGKLSQIIKAHSTKIGIICQPSKFFGNYPAVFKEFQSFANALFYLLSVLPLIH
                     DGDMWAMYLVQKLDSTVINLLNGVSQLCDGIDKMINEGKGDDEDRLACIGILWTACES
                     LEEIAKKGNFQLLADNIRNSCGLVDDVLQDVDSWLQDPHFGADLLIDDDFSDNEDRES
                     DKEGSDDEVALEKMAEFLKLWQTRLKMIKLLLSSFAKSMATNVYNAKNTKASILDKLN
                     ALQSLIVEQLDELFSDIFLSDASFSEDDFASSVSSLNDSLRHMVKVITKLNTSDAKKL
                     KWIQVWETKYFPN"
     gene            complement(<712324..>714156)
                     /locus_tag="HG536_0H04000"
                     /db_xref="GeneID:59328290"
     mRNA            complement(<712324..>714156)
                     /locus_tag="HG536_0H04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285802.1"
                     /db_xref="GeneID:59328290"
     CDS             complement(712324..714156)
                     /locus_tag="HG536_0H04000"
                     /inference="similar to AA sequence:RefSeq:NP_014824.1"
                     /note="ancestral locus Anc_6.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141698.1"
                     /db_xref="GeneID:59328290"
                     /translation="MGLLSSTDKELIKRALPKSSNKIIDVAIARLYVAYPDPNEWQYT
                     GLSGVIVLVDDLVGHTFFLKLVDIKGHRGVLWDHELYAKFEYYQDRTFFHTFEIEDCY
                     AGLLFEDLNEASHFLKRIQKREKYASKKTLSNKNAIALTKKVNQERASQVVNGPRGES
                     LYGQQRERYDYEKAESIPQTKHKAPPPPPPVAASSTAGSSDFEDDGESRSDWTVSAPT
                     TPAPAAPAPEIPAAPVPQARMKHPVPPLPASVAPPAPSDTSLPGSGPTAPAPAPQSPT
                     LPRRDNNPFPIPTSTNVPNPFPVPLPNTAPQQANNPFPFPVPQQSAQNNSFSAPARPV
                     PAPPARNNRPVPVPPRKTTRNAPPVPASRHGPPPPLPPHRNVTPQAATQNMVPTHQTG
                     RPPAPPPPRRGPAPPPPPRANASQAFPQHSTVPPVQTSFPSQNGYQSPPPPPTPPTTF
                     NSIPPAAQASSAVHATSAPPPPPPPPMAPAQTTSAPPPPPPSFLTQPQNASALPPPPL
                     PPVTTPASNGGFAETTGDVGRDALLASIRGAGGIGSLRKVDKSQLDRPSVLLQEAQGK
                     PVAPNSPSGPPPSGGGSLADALAAALSQRKAKVGSGDYDNGDDW"
     gene            <715149..>716651
                     /locus_tag="HG536_0H04010"
                     /db_xref="GeneID:59328291"
     mRNA            <715149..>716651
                     /locus_tag="HG536_0H04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285803.1"
                     /db_xref="GeneID:59328291"
     CDS             715149..716651
                     /locus_tag="HG536_0H04010"
                     /inference="similar to AA sequence:RefSeq:NP_013388.1"
                     /note="ancestral locus Anc_6.80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141699.1"
                     /db_xref="GeneID:59328291"
                     /translation="MINSFLFQISLFFFTHLAFGFDLQSKQNVALYWGQNSAGSQQSL
                     GSYCESTDADIYLLSFLYQFPTIGLDFSNACTTSFSDGVLHCSQIAQDIQKCQSLGKK
                     VLLSLGGASGAYGFSDENSAKAFAHTLWNTFGEGTGATERPFDSSIVDGFDFDIENNN
                     AVGYAALVKELRSLFATSTKQYYISAAPQCPYPDASVGDMLENADVDFAFIQFYNNYC
                     NVGKSFNWDTWQNYAQSVSPNKNIKLYLGLPGSATAASTGYISDLSLLEDTISKVSGS
                     GNFGGVAMWDASQAFSNKIDGQSYVSHVKSILSKCLGGSSTTTLSPSSSTASFFTTPS
                     STISSSTTSSSATVLTTATTSDAVRGLTTKFLTSATASSTASVSTTHTDARTTVLSNN
                     PLTTTLSTSSTVERTTLQTSAQPTTTGSAAYAKAVSLNALYASGKYNGEETCTNGDIA
                     CSANGEFAICNFGTWVNMVCASGTTCFASESSDILTIGCNFASQKEKYIN"
     gene            complement(<716797..>717597)
                     /locus_tag="HG536_0H04020"
                     /db_xref="GeneID:59328292"
     mRNA            complement(<716797..>717597)
                     /locus_tag="HG536_0H04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285804.1"
                     /db_xref="GeneID:59328292"
     CDS             complement(716797..717597)
                     /locus_tag="HG536_0H04020"
                     /inference="similar to AA sequence:RefSeq:NP_013387.1"
                     /note="ancestral locus Anc_6.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141700.1"
                     /db_xref="GeneID:59328292"
                     /translation="MVSDTESIGEGFGLFEEPEDFRPAPPEAHFAQYERDQISPDSES
                     QIKQLQLRLVGSSPLWGHLLWNAGIYTAKHLDDNVPLVKNKTVLELGAAAGLPSLVSS
                     LVGAKKVVCTDYPDADLLQNIQFNVDNVIFRGEEVAEGSRLQRNIVVEGYIWGNDYLP
                     LQKHIGGENSKFDLIILSDLVFNHTEHHKLLRTTKDLLADGGKALVVFSPHRPKLLDD
                     DLRFFETAKEYGLLSTFIEMVNWKPMFEEDEETSEIRSRVYSYYLTHA"
     gene            <717829..>718653
                     /locus_tag="HG536_0H04030"
                     /db_xref="GeneID:59328293"
     mRNA            <717829..>718653
                     /locus_tag="HG536_0H04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285805.1"
                     /db_xref="GeneID:59328293"
     CDS             717829..718653
                     /locus_tag="HG536_0H04030"
                     /inference="similar to AA sequence:RefSeq:NP_013386.1"
                     /note="ancestral locus Anc_6.78"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141701.1"
                     /db_xref="GeneID:59328293"
                     /translation="MAGDNSSERIKYFVDGPFFVIRLCDPGSLNALNGNDYLYLAELL
                     EKSERNSDVYFTVLQSSGRFFSSGADFQSISKAQETKTSEPELNKWLAYFVSRNVYVT
                     DMFARHSKILICCMNGPAIGLSAALCALCDIVYSMNDKVYLLFPFSSIGLVTEGATSV
                     TLPMKLGSSWTFESLLFSSPIRFDKLDGTIVAKNYEMDNVEKFNDAVLEELKSKIKPL
                     YLPTLPDIKKLLRERYSQELSRANSVEVNDAIKYWVRGIPQRSFKQLSQKQRKHKL"
     gene            complement(<718648..>719439)
                     /locus_tag="HG536_0H04040"
                     /db_xref="GeneID:59328294"
     mRNA            complement(<718648..>719439)
                     /locus_tag="HG536_0H04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285806.1"
                     /db_xref="GeneID:59328294"
     CDS             complement(718648..719439)
                     /locus_tag="HG536_0H04040"
                     /inference="similar to AA sequence:RefSeq:NP_013385.1"
                     /note="ancestral locus Anc_6.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141702.1"
                     /db_xref="GeneID:59328294"
                     /translation="MLRYVTRCSRSAITRSLRRYSTPTVKSSIEDNAPNKSGTGTGTS
                     SDNFMNKLPEQLISQGNGMKPTRAECQIDTLACYNRLREQGFTSQQTELIIDLLLETL
                     NKEFFSRYNTVFLQNMELENQSHLFHAAETELKYAIQTSRDTQLNDQHLQLLKLIRDL
                     DSLHDEINEMIINLLQKDSKVDFNNQKIENTLLHRKINLQLNECTNKIATKLLGSARS
                     DIERLRWQTTRSGLLAILVLVFVIMGGASFARKVNAPTEEAEPKS"
     gene            <719503..>719991
                     /locus_tag="HG536_0H04050"
                     /db_xref="GeneID:59328295"
     mRNA            <719503..>719991
                     /locus_tag="HG536_0H04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285807.1"
                     /db_xref="GeneID:59328295"
     CDS             719503..719991
                     /locus_tag="HG536_0H04050"
                     /inference="similar to AA sequence:RefSeq:NP_013383.1"
                     /note="ancestral locus Anc_6.76"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141703.1"
                     /db_xref="GeneID:59328295"
                     /translation="MIHTRASEIAVMNVRWLCSTTLRLVKKNKLPPRPKFTKEMEAQC
                     EEKFLHGGRGPGGQKINKCNSKVQLKHLETGIVVTCQETRSRESNRKIAREKMALEIA
                     RYLNPDSSTDARTEALQRWVVQGKRAKEKKSKLKYAKHEEERQSKQQESLRRDAAIIE
                     SL"
     gene            <720101..>720904
                     /locus_tag="HG536_0H04060"
                     /db_xref="GeneID:59328296"
     mRNA            <720101..>720904
                     /locus_tag="HG536_0H04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285808.1"
                     /db_xref="GeneID:59328296"
     CDS             720101..720904
                     /locus_tag="HG536_0H04060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141704.1"
                     /db_xref="GeneID:59328296"
                     /translation="MIEHEKLSGGLFTITINEPSKLNSLTLSDFTRIAKLIQQADADD
                     EIIAVFLQSTGRFFSSGAQFDYFGEFEGMEPEKKEQRLRSEIATMNVYVADVFAQHSK
                     PLVCCLNGPAIGLAASLVLLCDIVYAMNDQVYLLFPFSSLGFAAELGCSVTAPLKLGI
                     NRTNEHFVFSTKIQYKDMLQARLIAKDFHLRPGKTAEFNSQVHTLVQESLEGKNRHAM
                     LNIQQLLSQKDALVRAQGRETSVTLPFWLHGEPLKRFKQLQTRQRKHRL"
     gene            <721414..>724464
                     /locus_tag="HG536_0H04070"
                     /db_xref="GeneID:59328297"
     mRNA            <721414..>724464
                     /locus_tag="HG536_0H04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285809.1"
                     /db_xref="GeneID:59328297"
     CDS             721414..724464
                     /locus_tag="HG536_0H04070"
                     /inference="similar to AA sequence:RefSeq:NP_013380.1"
                     /note="ancestral locus Anc_6.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141705.1"
                     /db_xref="GeneID:59328297"
                     /translation="MGRPKKLVSQENIKKFQQELEMAGDNAAMLLRDKKGRSRSCLLC
                     RRRKQRCDRKQPSCSNCLKAKVKCVQPARYNPSNLMDGTSPSPLPSFDEATPKYFRPN
                     VAPTRLPNEQYTQYLEDRVHALERMLNKSKTPMQLPIPNGNENALASGSNVFPSGDNG
                     RARLFKNASPFPSGAPTQMESSSLPALASDSLESVDFSKCIFANYNLKEFMNYDPVFE
                     FDGMLSRSFLDTFFTRLQFKYPLLDEQEIYDFHAHYISNDIHSYSETGFHFACGRMWL
                     VFSISACLYMTTGKYKGLPPVRYFSTAVRHIARCGQSLNNVQRVELLTLLVLYMLRTD
                     RDSSVLYEIIKDVVFICKEKLHLNNMQPNDPYANEKLRIFWCVYLLERMICVAVGRPY
                     TISEKEINLPLFSEESFNNASNKHADKSTNGRGVHFINQSLKLRRIESQFVEHLQILP
                     LKHNKKEVLRSQLPMVKKFFQDLEVWRAGCSKDDIKNFENETLKLYYYRSVRLLLQPY
                     LEFMRPEDKLFRECQAAAGQICQLYKIFHQKTLTGHSTPAIHTVFIAGVTLIYCMWLA
                     RNNDDERRKKLGDESKHTRPLVSASLFSTMDDLRACSVCLYVMTERSNFARTFRDTFD
                     QLMNATVGNLIERCGPDSSELIYLSSQKDKSMDHLEDQPTKDKATNDSESGMPPATDR
                     TFGKRQAQEHEGFVEISQVDIEEQKEFKRRQGVLEKMSVPKSLSHLLIKVEDDKEEES
                     VNQDKKDQRSEGSRDKYIVKKPTNSTEFDWKSFQQQALVQQHIARENLKAYLSSLNYL
                     NGTKSVAFNPGAHIYSPPEMQPPNLSINNRASTENAPLQVRPINTDEKAGMNRPQNVA
                     PQTAAARTRIISHITSGPTTGSNSPSSMPNMGLLYNNGTHDMINDISTWTNDSVMQLM
                     DNESLATTNFYSQENFSFLPHEEERFLPQIKHATSPQQSSDTNGSQPALSTNANGKGF
                     HSTAIDAIQVRTDFDKLRRHPSATGHNSMVEKFWTVNDDYGFLT"
     gene            <724975..>727293
                     /locus_tag="HG536_0H04080"
                     /db_xref="GeneID:59328298"
     mRNA            <724975..>727293
                     /locus_tag="HG536_0H04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285810.1"
                     /db_xref="GeneID:59328298"
     CDS             724975..727293
                     /locus_tag="HG536_0H04080"
                     /inference="similar to AA sequence:RefSeq:NP_013379.1"
                     /note="ancestral locus Anc_6.74"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141706.1"
                     /db_xref="GeneID:59328298"
                     /translation="METSGKNSLRFFALGGGNEVGRSCHILQFKGKTIMLDAGVHPAY
                     QGYASLPFYDEFDLSTIDVLLISHFHVDHAASLPYVMQKTNFQGRVFMTHPTKAIYRW
                     LLRDFVRVTSIGSSSGGQDDNLYTDEDLADSFDKIETIDYHSTVDINGIKFTAFHAGH
                     VLGAAMFQIEIAGVRVLFTGDYSRELDRHLNSAEVPPLPSDVLIVESTFGTATHEPRA
                     NRERKLTQLIHSTVSRGGRVLLPVFALGRAQEIMLILDEYWSQHAEELGGGQVPIYYA
                     SNLAKRCMSVFQTYVNMMNDDIRRKFRDSQTNPFIFKNISYLKNIDEFQDFGPSVMLA
                     SPGMLQSGLSRDVLERWCPEAKNLVLITGYSVEGTMAKFLMLEPDTIPSISNTEATIP
                     RRCQIEEISFAAHVDFQENLEFIEKISAPNIILVHGESNPMGRLKSALLSNFASLKGT
                     EGEVHVFNPRNCVDVILEFKGVKIAKAVGNIVDAIRKEEEVGVKEEKKNNTEQHTEKE
                     VVEAEEKEFPSEDEKEIIVSGILVSDEKNFDLNLVSLTDLREHHTELTTTVLRERQTV
                     HVDCKKELIYWHICQMFGDVEVIADEDDVTNRIKKDDVKMEFADGGSGRLVLKIMNDI
                     TLTIVDNLATLEWNQGLISDTVADSIVAILMSVDSSPASVRMSSKACDHHHNHESPNN
                     FLEQQNSVWKVKQIAKLFKEQFGDTFTLLLQKSEDHKNGDGDIYGVITIGKSTARINF
                     SQMKIEECNSNPLKGRIERILDMGADLTAPLC"
     gene            <727581..>729389
                     /locus_tag="HG536_0H04090"
                     /db_xref="GeneID:59328299"
     mRNA            <727581..>729389
                     /locus_tag="HG536_0H04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285811.1"
                     /db_xref="GeneID:59328299"
     CDS             727581..729389
                     /locus_tag="HG536_0H04090"
                     /inference="similar to AA sequence:RefSeq:NP_013378.1"
                     /note="ancestral locus Anc_6.73"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141707.1"
                     /db_xref="GeneID:59328299"
                     /translation="MGAKKAEFASDAYLDDSTSFEAFGLDSRLLQAIQRSGYRHPTLI
                     QSHAISLALQEKKDIIAKAATGSGKTLAYLIPVIQTILDYKKNEGNDELSTSKTMGII
                     LVPTKELSSQVSTVLEQMTLYCSKEIRCLNVSSDMSNAVLSSLLSESPEVLVATPAKL
                     LGLLENNINSVSLENLRFLVIDEVDLVLSFGYQTDLVKIAQYLPLQKNLQTFLMSATL
                     NDDIQELKKQFCRSPAILKFNDDEIAKGETKLVQYYVMVSEFDKFLLCYVIFKLGLIK
                     GKTLIFVANIDRGYRLKLVLEQFGIKSCILNSELPANSRQHIVDQFNKNVYQLLIATD
                     DTEYIKEEDELADEEGLLGQEEKQETQNSQQADESDKKAESKKSKKKVPVKKDKEYGV
                     SRGVDFKNVACVLNFDLPTTAKSYVHRVGRTARAGKSGTAISFVVPLKEFGKHKPSTC
                     PTAKKDEKILARIIKQQSKLGLEVQPYIFDNKQVEGFRYRMEDGFRAVTQVAVREARI
                     KELKQELLASEKLKRHFEENPQELQSLRHDKELHPARIQQHLKRVPDYLLPESAKQGK
                     SKKIGFVPFHNPKKNKKKGKINKRRGGKSDPLKNFK"
     gene            complement(<729472..>729861)
                     /locus_tag="HG536_0H04100"
                     /db_xref="GeneID:59328300"
     mRNA            complement(<729472..>729861)
                     /locus_tag="HG536_0H04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285812.1"
                     /db_xref="GeneID:59328300"
     CDS             complement(729472..729861)
                     /locus_tag="HG536_0H04100"
                     /inference="similar to AA sequence:RefSeq:NP_013377.1"
                     /note="ancestral locus Anc_6.72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141708.1"
                     /db_xref="GeneID:59328300"
                     /translation="MMYVIFNRHDYHFEIDLLTFDSELSDRPKAELTKDELDQLEEYE
                     FKHGPLSLINDSMKTKTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTERRGNK
                     AENKERFISKLFLRGDSVIVVLKAPMQ"
     gene            complement(<730036..>732324)
                     /locus_tag="HG536_0H04110"
                     /db_xref="GeneID:59328301"
     mRNA            complement(<730036..>732324)
                     /locus_tag="HG536_0H04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285813.1"
                     /db_xref="GeneID:59328301"
     CDS             complement(730036..732324)
                     /locus_tag="HG536_0H04110"
                     /inference="similar to AA sequence:RefSeq:NP_013376.1"
                     /note="ancestral locus Anc_6.71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141709.1"
                     /db_xref="GeneID:59328301"
                     /translation="MSFDRPEIYSAPVLQGEAPNDDDNTEIIKSFKNFILEFRLDSHF
                     LYRDQLRNNLLVKRYSLTVDMEHLIGYNEDLYKRLSDEPSDVAPLFESAITQVAKRIA
                     MLTKTPREERGGGGAEGEDDLDLGAFPTFQLVLNSKVNETLLRQLDSEHVSRMVRISG
                     IIISASVLSSRATYLSLMCRNCRHTTSLRINNFNSIGGGSVRLPHSCLSNLSSGMNEN
                     GLMGSTDDEGRKNCGPDPYIIIHESSQFIDQQFLKLQEVPEMVPVGEMPRNIVMTCDR
                     YLTNRVVPGTRVTIVGIYSIYQSKKKAAGGSGGVAIRNPYIKILGIQTDLETAGMWNS
                     MTMFSEEEEEEFLQLSRRPDLYELFANSIAPSIYGSKDIKKAIVCLLMGGSKKLLPDG
                     MRLRGDINVLLLGDPGTAKSQLLKFVEKVSPISVYTSGKGSSAAGLTASVQRDPMTRE
                     FYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSV
                     LAAANPIYGRYDDLKSPGENIDFQTTILSRFDMIFIVKDDHNEERDISIANHVMNIHT
                     GRSTQTEGELENAGMEISMEKMRRYITYCRLKCAPRLSAQAAEKLSSQFVNIRKQLLI
                     NELESTERSSIPITIRQLEAIIRITESLAKLELSPVAHERHVDEAIRLFQASTMDAAS
                     QDPTGGLNGTNLMAEIRRIEQELKRRLPIGWSTSYQTLRREFVDTNRFSQSALDKAIY
                     ALEKHEIIQLRYQGQNIYRCGV"
     gene            <733414..>735582
                     /locus_tag="HG536_0H04120"
                     /db_xref="GeneID:59328302"
     mRNA            <733414..>735582
                     /locus_tag="HG536_0H04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285814.1"
                     /db_xref="GeneID:59328302"
     CDS             733414..735582
                     /locus_tag="HG536_0H04120"
                     /inference="similar to AA sequence:RefSeq:NP_013375.1"
                     /note="ancestral locus Anc_6.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141710.1"
                     /db_xref="GeneID:59328302"
                     /translation="MVIARGYVDTKINSVEQSPAVLKLPTRSPMIRRLKSSMKLSKSH
                     STPSVTTTSSSSSSQKNVRFAAELTTVKKFDSSAEPISISNENSPKFYPISDSDLQYN
                     LGYPETLYGNADDCCVAEDGFWFNESSLVPTLRGLNDVKRLKRINRKSLAGSKFQLDY
                     DSDSGIDDDDEFDDDVFEETHEWPRQVTGNGLSSDSKLEVIDWRLTKTNISPMRPVWN
                     PFLLASNQKAGENDLESQIFDYLQGSNIRLHSLKQSTTEFGKIIGLIYVNNLNFEKFI
                     EIKLTFNRWKDMHYIPANFSRSITDKIDEFRFVIDLNSLKYSLQVKNLIYAMPDSTTS
                     VCRLNVELCCRYDVNNETFYDNNNYENYQIQLAATVRNTAAQVTPSTVKENPSSNIHD
                     TNPSQTNSFARDFLVSTTLTHNPNLKKSSIGSRQFSEDTDYYNTSPLKHLYHNDTSLI
                     KPVRMNQVLMNPELSTDEEDYATPDINEISSKGLILSSKPIESHNSSSSFSSSSSGGY
                     SPLEDFASMASSDYRPYPSIDSMSSIEMANYNYHLPVFNTLHSYSENHDDGQSIVTDI
                     PGDHNNTINNNSNSNNSTDTLINPDAIPRPLSSVSAEPVSFTNSHQYEGSDIIASSDS
                     KSNTLEATSGLKDQDYQAFLSSYCFHTSPTSKGLDPRFENPLGSKTFFAAQMSQPVPV
                     PPSDQMSCERDTNDHTMGLETLSTPPPVLSQASFEGVSRS"
     gene            736132..736205
                     /locus_tag="HG536_0Htrna12V"
                     /db_xref="GeneID:59328397"
     tRNA            736132..736205
                     /locus_tag="HG536_0Htrna12V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59328397"
     gene            <736461..>739946
                     /locus_tag="HG536_0H04130"
                     /db_xref="GeneID:59328303"
     mRNA            <736461..>739946
                     /locus_tag="HG536_0H04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285815.1"
                     /db_xref="GeneID:59328303"
     CDS             736461..739946
                     /locus_tag="HG536_0H04130"
                     /inference="similar to AA sequence:RefSeq:NP_013374.1"
                     /note="ancestral locus Anc_6.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141711.1"
                     /db_xref="GeneID:59328303"
                     /translation="MSDFNLADQISRLQNSDKRSFPAVERPSDELNSVIDRLAVSPEQ
                     IDADGETLESLIDLCHGFPHLPVKLQSQLCYLVASSVGNLAHDIGANLNGANQNGGDT
                     MDLLPQYRRHLEEYGYLIHVLLSFLQEDVHIAASQATTLGRGGAKKVKTTGPAAELFK
                     RSCNQIESMFEAVLKVLEINLSKLFQTTPEKDLYVKLFTKPLFSLLEVEAAVKVNSLR
                     LFTQKVLAICVKYQNQSSSVQNAIMTNLTYFLHLSNFNAELLKLLNDEYDYPQLTEEI
                     LREISSRVFNAKDTTGPKAISNFLIKLSEVSPQVMLRQMSLVVRLLNNSSITLRCSVV
                     ETCGNIVRRLAQDEQMLDHYKQQIAVLIELLEERFQDSNPYVRTKAIQGCLKICELES
                     KFSKNKPEFARLATRSLQDKSSLVRRNAVKLLSKVLLNHPFKAIHGSNLELRQWEKHL
                     ETSTAKLNELKEKHESPSDLENIIDNSLREEACEAEEVQGYLDENNQITRLERESEAV
                     NTISTEAILKLKLMVVYYTDAVKFIRTIHGSLRLAAGLLFSRNRNEVLETMDYLVLAD
                     AFGLEPSQIGIKKMLHLVWMKGTNDEGTSISAHLISCYTQLFLTAPESFNFREKAGYI
                     AQNLIQLTCGASIADLASLEQLLCMMYREKLIDENVINVLWAIYNSVSRDEEMCEHFE
                     KQQVHGSIIILGMLSLANHEVTLRGLDALLNVGLGIPGDEDMLLCQYSCLALERMVPR
                     DHSRFSSIISESREEEVIRKLYSKIIGVTNDLGWYPVCEQALNALFTISSKADLVATE
                     LVREKTMMTFGKSEDEDSEFLQHTSRVTSLSQLLFIVGQIAIKALVYLEKCEAEFKRA
                     RSEVEYRKVKEKKKQAGEGDGAADEGKEKELEMIGGTNEDDFADAITFIKDKELLFGE
                     NSILSKFCPIAEEICSNTSRFNDPILQRTAALCLEKFMCVSSKYCEKRLSLLITMMEK
                     SKDPIIRSNAVLGLGDMAVCFNNLVDENTDYLYRRLRDKNLMVQRTCLMTVTFLILAG
                     QVKVKGQLGEMAKCLENPDPGIRDMCRLFFTELATKDNAVYNSFIDIFSNLSADEGLH
                     KDSFKRIMKFLLSFIEKEKHQKQLAEKLLGRLLKCDSQKQWNDVAFVLNNIPYKDERA
                     AESLEKGFKMASARN"
     gene            complement(<740085..>741272)
                     /locus_tag="HG536_0H04140"
                     /db_xref="GeneID:59328304"
     mRNA            complement(<740085..>741272)
                     /locus_tag="HG536_0H04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285816.1"
                     /db_xref="GeneID:59328304"
     CDS             complement(740085..741272)
                     /locus_tag="HG536_0H04140"
                     /inference="similar to AA sequence:RefSeq:NP_014819.3"
                     /note="ancestral locus Anc_6.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141712.1"
                     /db_xref="GeneID:59328304"
                     /translation="MLAGFRVGRELFPKTLSSMAGNRVSVMPGRARSLSDARSPTGIV
                     FMNMGGPSTIAETYDFLFELFSDNDLIPISKNYQRSIAKWIAKFRSPKIEKQYEEIGG
                     GSPIRKWSEYQAKRVCEILDETCPETAPHKPYVAFRYAKPLTHAAYEQLLKDGVRRAV
                     AFTQYPQFSYSTTGSSLNELWRKIKELDPERKISWSTIDRWPTNDGLTSGFAENIQKK
                     LLEFPSEVRNNVTLLFSAHSLPMDVINTGDAYPAEVAATVNKVMQKLGFSNPYRLVWQ
                     SQVGPKPWLGAQTAKIAEFLAPETDGLLLIPIAFTSDHIETLFEIDQELIAESPYKDR
                     MKRCESLNGNETFINGMAQLVEQHLKSGELYSKQLPLDFTLGKSNDPIKDLSLVFGDH
                     SKK"
     gene            <741654..>743519
                     /locus_tag="HG536_0H04150"
                     /db_xref="GeneID:59328305"
     mRNA            <741654..>743519
                     /locus_tag="HG536_0H04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285817.1"
                     /db_xref="GeneID:59328305"
     CDS             741654..743519
                     /locus_tag="HG536_0H04150"
                     /inference="similar to AA sequence:RefSeq:NP_014818.1"
                     /note="ancestral locus Anc_6.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141713.1"
                     /db_xref="GeneID:59328305"
                     /translation="MKIYNPIDTTLRWISQKYGINDFMLRYALCLLGSFPFNAILKRL
                     PDRRVSLKCCYITGVSMLYLFGVLNLYKGFQTLFISTMFTYVITRFYRSSFMPHLNFI
                     FLMGHLAFNHLHAQFINASNSDTVDITGSQMVLVMKLTAFAWSYYDGSCEKDKNSLTD
                     YQKSRAIEKHPSLLEFLAYAYFYPSLLTGPSFDFADFDSWLNCEMFHDLPEKRKPRRR
                     LHPGQRRQIPKNGRLALWKVIQGLGWMYLSAVAPKYISVDYMLDFEKFNQRSFFYRIN
                     YMYFLGMTFRFKYYAAWTIAEASCILCGLGYNGYDPKTQTIKWNRVQNIDIYSVEMAQ
                     STREMLEAWNMNTNKWLKNYVYLRVAKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTF
                     ATGALYQTCGKIYRRNFRPMFMAEDGKTPLPYKWIYDAICFYVIKVAFGFMVQPFIIL
                     DLKKSLQAWSSVYFYIHIGIAITFFLFKGPYAKQVIKFCKSKQPKERSIIKQKKLEQE
                     IATSSASLGGILSEKLAYEKKHPKEVEMNLGIPAIDSYEMSDAKEAWEEFRNDYNDWR
                     EKNGLEIEEENLAIAFNRFKEELRSASADPTTGVKRRMSFSEYLPKPTPETEDHN"
     gene            complement(<743594..>744403)
                     /locus_tag="HG536_0H04160"
                     /db_xref="GeneID:59328306"
     mRNA            complement(<743594..>744403)
                     /locus_tag="HG536_0H04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285818.1"
                     /db_xref="GeneID:59328306"
     CDS             complement(743594..744403)
                     /locus_tag="HG536_0H04160"
                     /inference="similar to AA sequence:RefSeq:NP_014817.3"
                     /note="ancestral locus Anc_6.65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141714.1"
                     /db_xref="GeneID:59328306"
                     /translation="MSEFPTSSHSMSHMRSSSTSLMDATVNLGNEDELSKVKIYSDLT
                     QYEEVLAELVASVDNFKPDVKIAKRLIQVDKDLYESVKAFTQYDQIDRELRRLEKESN
                     DLDQRTRNILETLNDCYNNLNALPTLEQVEFERQTILEQRKKINSSVLLEYGTKLSKF
                     TKIPPTLDRGATGPNNFIWPAEDALRRGMLALASLHSKEITRIPGEPEDVSEASQPVT
                     QEEPIQQESPEQSQAVHLQKRNSYVHSEDTATEQNDDEMDLDLDIFNPDEF"
     gene            complement(<744567..>745310)
                     /locus_tag="HG536_0H04170"
                     /db_xref="GeneID:59328307"
     mRNA            complement(<744567..>745310)
                     /locus_tag="HG536_0H04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285819.1"
                     /db_xref="GeneID:59328307"
     CDS             complement(744567..745310)
                     /locus_tag="HG536_0H04170"
                     /inference="similar to AA sequence:RefSeq:NP_013373.1"
                     /note="ancestral locus Anc_6.64"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141715.1"
                     /db_xref="GeneID:59328307"
                     /translation="MKRTRSPQGDDGGAVDSCDSVDHHQGEEGAQEEESEKGSKRIRR
                     SPSSIQRILKPNETEGRPAGNTDSDSVSKRVRETQNLQEKLFTWERMQRIAFELTKDI
                     ELYTPGQDPRDFNVLWRSYVRQLNQVYEKIPSSVEPYSSHDEETSLSEADDSHENVDV
                     PIISDESVKVVPQREESSVPEVESLPEYDGEDEELDLFMETSIDERIMRLNVFLRSEL
                     YFCYYCKVQYKSEQDMFERCPGITEDDHR"
     gene            complement(<745447..>746502)
                     /locus_tag="HG536_0H04180"
                     /db_xref="GeneID:59328308"
     mRNA            complement(<745447..>746502)
                     /locus_tag="HG536_0H04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285820.1"
                     /db_xref="GeneID:59328308"
     CDS             complement(745447..746502)
                     /locus_tag="HG536_0H04180"
                     /inference="similar to AA sequence:RefSeq:NP_013372.1"
                     /note="ancestral locus Anc_6.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141716.1"
                     /db_xref="GeneID:59328308"
                     /translation="MVANIGALISKFEYERVLDSNPQTKVVSLLGTIDNKAAIVTAEK
                     THFSVDETIKKPGPNGRRTPIFFQCENEYSCVNSIEELKEIASNDIYYWGLAVLKQDM
                     EHNPTAKLNLIWPATPVHIRKYEQQNLHLVRESPELYLQVVEPYIQEFFDQGRLKWVN
                     NILYGGAEADRVVYKDFSEDKKDDGFIILPDMKWDGVNLDALYLVAIVYRADIRSMRD
                     LRPNDREWLIKLNNKIRTIVPACYNYAVHADELRIFVHYQPSYYHFHIHIVNIRHAGL
                     GDGVAAGKAFLLEDIIESLGYLGPNGFMNRTLTYVIGDNHELWNRGLKDAVALQLEKD
                     GIPKLPKVVNKFNQVVD"
     gene            complement(<747174..>747713)
                     /locus_tag="HG536_0H04190"
                     /db_xref="GeneID:59328309"
     mRNA            complement(<747174..>747713)
                     /locus_tag="HG536_0H04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285821.1"
                     /db_xref="GeneID:59328309"
     CDS             complement(747174..747713)
                     /locus_tag="HG536_0H04190"
                     /inference="similar to AA sequence:RefSeq:NP_013370.1"
                     /note="ancestral locus Anc_6.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141717.1"
                     /db_xref="GeneID:59328309"
                     /translation="MVISRMTPQSADEATLESGNYEIHYLKLSVVVYFVICEKGYPRN
                     LAFSYLNDVAQEFEHSYGLESTKPTVRPYAFVSFDNFLQKTRKTYSDKKVQDNLDQLN
                     QELHGVKQIMSKNIEDLLYRGDSLDKMSDLSASLKESSKKYRKSAQKINFDLLISQYA
                     PIAIVALFFVFLIWWIFLR"
     gene            complement(<750080..>752152)
                     /locus_tag="HG536_0H04200"
                     /db_xref="GeneID:59328310"
     mRNA            complement(<750080..>752152)
                     /locus_tag="HG536_0H04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285822.1"
                     /db_xref="GeneID:59328310"
     CDS             complement(750080..752152)
                     /locus_tag="HG536_0H04200"
                     /inference="similar to AA sequence:RefSeq:NP_013368.1"
                     /note="ancestral locus Anc_6.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141718.1"
                     /db_xref="GeneID:59328310"
                     /translation="MSEAPRAVKRRRKVVKSCTFCRKRKLKCDHGKPMCNQCLERKLP
                     NCLYTDHFNFQLTTDELFSDSPNVELIRRINELEEKLKDFEGGAVSDGTHSSSTPSSG
                     RSSISTGPRNNPLWAYRTFIQMDGQCIVFGPTSWRTTVVAQGDRFVAEYKKLWDMIMP
                     ERCKWMSSSWKTQKMPITPEEECATGALCKELPGYQELRKSVIKYFDDEYHVMFKVLD
                     KEKTLNDLERCFIRSPDDQDRVIDIIAPDGDGNLCKAALILMILCLTKLEGAPPPLFS
                     KFFTSLTALNLSTKLSFVERSQFLLLRFFNNVYYSYVCEEAPQVGGMVAELCECSMNL
                     GLAEANTYYKGKESEVGPLYTLNNAWLWTLYADVLVAFEFGRPLLISDDHFDPETLKL
                     YEQTEEECGGLLRRRRLMLMKFIQVSRYCIMEINSRSSSGNIDVAIEQLIAYIQDNLL
                     PIRCYTSQETIPTVDFFDVTVLAPSLGMLLNFHNIQRTWLNSPLTTVKNGLVKFGLLS
                     LSLSVNTILGILERDAGKDGHRALHFALLLVNPLLMRVLSEMYSAFFYKLSLFEDGLI
                     KSIDWGTCAVELHNLDVPTSEYYSFVGAINMFREMIDELFEPSKAHLQALFFKSHAIA
                     TTLALEKVSRTLFDRARESRTKAENYCSFTDEGTISQETLNEMTDIFWSTYDQQSQDL
                     WSMKPQDF"
     gene            <752939..>754435
                     /locus_tag="HG536_0H04210"
                     /db_xref="GeneID:59328311"
     mRNA            <752939..>754435
                     /locus_tag="HG536_0H04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285823.1"
                     /db_xref="GeneID:59328311"
     CDS             752939..754435
                     /locus_tag="HG536_0H04210"
                     /inference="similar to AA sequence:RefSeq:NP_013369.1"
                     /note="ancestral locus Anc_6.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141719.1"
                     /db_xref="GeneID:59328311"
                     /translation="MNGLLSNLIPLEIWTLVLDKLENDSVETCQSMTDLIYFFKALEG
                     SNIPPCFQCRLKDRWQFLNYTKHAEWSEVLKISPSLKVLADDANLLAERADCGNDFRP
                     IFIVDERTDAGQLDYRGTKNVDIIFCGDTSVIGDFIVSLSSHCSGSSVALIVDCEPGI
                     YSGKKLFGILNADLFASGWSFDKVCVSFPWVKVLECNYMALDTFIYHALSGRETSKHG
                     CELFNRFLHSFKLNFPLLEQIKFVTQTTTRDETCNFIDLSSLMLNKFKDGKIPLMNLF
                     KVHSLENWSLPHVSEFSGHRFKFDETTMTGSPERRTLSLRENLNLLREMAINETIDAT
                     PYYRLSLFPRSVKHTRIVNWIPLQSTPIMILKSKSLESLSLKLVAFENAPATVVQGLF
                     LPSLRCLNLEQMAEQQIAFVPPTDRRGSTDMRSHPAIIEAEPCASSMNPVVFSSWNQL
                     TSLHIIQINMKFSHYIFDIQNLKKSLPSINLKKSFETFFDEQQRFIVV"
     gene            <754485..>755063
                     /locus_tag="HG536_0H04220"
                     /db_xref="GeneID:59328312"
     mRNA            <754485..>755063
                     /locus_tag="HG536_0H04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285824.1"
                     /db_xref="GeneID:59328312"
     CDS             754485..755063
                     /locus_tag="HG536_0H04220"
                     /inference="similar to AA sequence:RefSeq:NP_014806.1"
                     /note="ancestral locus Anc_6.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141720.1"
                     /db_xref="GeneID:59328312"
                     /translation="MDRKTHRASAMIEADKVERTEVSRVGRENQVYSKQTGARIVAGC
                     VCLSKDRKHVLMISSSANRNRWIFPKGGVEIDEPDYKLAARRETWEEAGCIGNIVASL
                     GVIEDMRPPKEWNNDIASFTDSNEEVIAHPPRSEFHFYEMEVTELPDRYPECGKRDRK
                     WFDYREAKELLLLAKRPELLTALDRSSVLKDI"
     gene            complement(<755114..>756034)
                     /locus_tag="HG536_0H04230"
                     /db_xref="GeneID:59328313"
     mRNA            complement(<755114..>756034)
                     /locus_tag="HG536_0H04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285825.1"
                     /db_xref="GeneID:59328313"
     CDS             complement(755114..756034)
                     /locus_tag="HG536_0H04230"
                     /inference="similar to AA sequence:RefSeq:NP_014807.3"
                     /note="ancestral locus Anc_6.57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141721.1"
                     /db_xref="GeneID:59328313"
                     /translation="MSGVNAKLAKTLQRFEAKIKAGDYYEAHQTLRTIANRYVRSKSY
                     QDAIELISHGAQAFLTAKQGGSGTDLVFYLLEVYDIAEIEVTDVSVSRLVQLLVAIDP
                     QEPNVKDVVTGMNNWSVKYGEYKFGDPYLHNAIGSVLIEGGYTYEAERYLIFGTHDSV
                     NKYINLLWDWFCQEDDVENVADFFSRPILNYLFISNVSYAYEARDKFLQLLIEKHSPK
                     VDIIDKNGFKMFYFHDYSDLNFLQLLLLTCQTKNVDLFTNLKEHYAGSTSKYANELEF
                     LGQEYFGIVARRQTNFLQDMMAGFLGGGAK"
     gene            <756220..>758559
                     /locus_tag="HG536_0H04240"
                     /db_xref="GeneID:59328314"
     mRNA            <756220..>758559
                     /locus_tag="HG536_0H04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285826.1"
                     /db_xref="GeneID:59328314"
     CDS             756220..758559
                     /locus_tag="HG536_0H04240"
                     /inference="similar to AA sequence:RefSeq:NP_014808.1"
                     /note="ancestral locus Anc_6.56"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141722.1"
                     /db_xref="GeneID:59328314"
                     /translation="MGESDGTQQAIQLIDEQKRFHADVLAHFKEWIGHRDVGLNYHVI
                     AVFGSQSSGKSTLLNTLFNTSFDTMDAQFRRQQTTKGIWLAHTNHVNTVTESTAKGSD
                     LFVLDVEGSDGAERGEDQDFERKAALFAIAVSEVLIVNMWEQQIGLYQGNNMALLKTV
                     FEVNLSLFGKNRNGHKVLLLFVIRDHVGLTPMSSLSESLVSELEKIWSELSKPTECSE
                     ALLTDFFDLEFVGLAHKLLQPKEFENDVRALGDHFVFENRSSYYFKPAYHHRLPLEGW
                     TIYSQNCWEQIENNKDLDLPTQQILVSRFKTEEIADEALKNFSANYHESIEPMIDDKD
                     KLIRAMKKLRESCLDEYDRQASRYLETEYLEKRQGLQKNMVSKFTATVGEFLTNFSNS
                     LLKATRAAIEDKNSNKSFAERSEASQLSTKEKFAGVVEEFSKEEFISSPGELTCDFEN
                     DLLKEVEELREKEITAIMTRAKKTITLTIKDTTISLLSHPELDVWDKVMEMFESTIKE
                     SIHKFMEDNGEYNFRVGLSSEQNDKLVRQIYHTGWHLLNVTVHDYLKEDTVVGILRDR
                     FESKFRYDDSGSPRLWKSEEEIDQAFRVAKGHALEVLGVLSLAATSDNVEIIAKFDDC
                     EDEEDEFYKDDVGIYHSKRFAHILNEIQKEKVLQQFRRQINVTVLDSKRSILKSTTSI
                     PVWIYVIIVILGWNEFMMIIRNPLFVTLTLILAVGFYFVNKFGLWGPVYSVAQSAVGE
                     TRNTIKEKLRSLVLDEHERKPVAVAESLEMKDMSKNNEL"
     gene            <758706..>759698
                     /locus_tag="HG536_0H04250"
                     /db_xref="GeneID:59328315"
     mRNA            <758706..>759698
                     /locus_tag="HG536_0H04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285827.1"
                     /db_xref="GeneID:59328315"
     CDS             758706..759698
                     /locus_tag="HG536_0H04250"
                     /inference="similar to AA sequence:RefSeq:NP_013367.1"
                     /note="ancestral locus Anc_6.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141723.1"
                     /db_xref="GeneID:59328315"
                     /translation="MELEALRPLLLAKDVNLDWLRSKVNNQDCLYCRLIIPSDTLLFC
                     FVPLLDKQPYVALLRAQDLEEQSRNQGFLESSIDQILAALREQAFNPPSALSFRKDDG
                     MMEISINLSTALKLSLKATIVDNDPSLSSIILRRLLDDILAGSYLLERLLSSRTKLLD
                     SKDRAIEFLKENLEELGDKQTLNRWAPEGSMNYQSLQKYDEDEVKYATFARINETASD
                     EGPSEDAETADLVLTLRREMKQYKMSWSKRSTKKTAAKMPSDFAPPLQLDAEQVKSDW
                     EKGEASVKLEEPPSLVKEESPVAGESASSGRESSKSPSKKRKFRRVKITKQSSV"
     gene            complement(<759702..>760991)
                     /locus_tag="HG536_0H04260"
                     /db_xref="GeneID:59328316"
     mRNA            complement(<759702..>760991)
                     /locus_tag="HG536_0H04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285828.1"
                     /db_xref="GeneID:59328316"
     CDS             complement(759702..760991)
                     /locus_tag="HG536_0H04260"
                     /inference="similar to AA sequence:RefSeq:NP_014809.3"
                     /note="ancestral locus Anc_6.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141724.1"
                     /db_xref="GeneID:59328316"
                     /translation="MGLPSIYANDEDKVSVKGGANGRIIPKISKSIKEIANRPNNGKY
                     TVSDIENLMLSRTNEFGRGDEDFPMLEMEDEDEIQLVSNILSQRRRSTSEDADSSVTR
                     DALDLEIPAMMPTKVKSIFVADTNFLISHLSTLEALRQLASSFHHQIVIPNAAIRELD
                     GLKNSSKMMKVDDNTEAIGFLARLANDWIYSHFANMDSGVMGQKLRQTINPNSIKDDA
                     ILDCCLFFKEKLNCFVVLLSNDKNLCMKALTEEILTVSFRNGMTAQLIASMTLNENLS
                     LYGACPALDEQMIGTEEPGINSTDVAAKIYREITAAVIEAVCHVLANEYGDDIDLIGF
                     QPGTLLDLKSVTKCIDRFWVSVFAEYFEGCKIKKNDWRNFPTALTASPTDIGCLKNFF
                     KSWEEILNILYLKRNQADVANMHNMVQQWTGLIHGYH"
     gene            complement(<761979..>762182)
                     /locus_tag="HG536_0H04270"
                     /db_xref="GeneID:59328317"
     mRNA            complement(<761979..>762182)
                     /locus_tag="HG536_0H04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285829.1"
                     /db_xref="GeneID:59328317"
     CDS             complement(761979..762182)
                     /locus_tag="HG536_0H04270"
                     /inference="similar to AA sequence:RefSeq:NP_013366.1"
                     /note="ancestral locus Anc_6.53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141725.1"
                     /db_xref="GeneID:59328317"
                     /translation="MDSKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLDDTSRTIVRNV
                     KGPVRENDVLVLMESEREARRLR"
     gene            complement(<762403..>764598)
                     /locus_tag="HG536_0H04280"
                     /db_xref="GeneID:59328318"
     mRNA            complement(<762403..>764598)
                     /locus_tag="HG536_0H04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285830.1"
                     /db_xref="GeneID:59328318"
     CDS             complement(762403..764598)
                     /locus_tag="HG536_0H04280"
                     /inference="similar to AA sequence:RefSeq:NP_013365.1"
                     /note="ancestral locus Anc_6.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141726.1"
                     /db_xref="GeneID:59328318"
                     /translation="MPRTRVSSDCGLLKYLLRNGLRVDDRDSWKYLALLMEVCYGVPK
                     AKQAVVKLMRSTFAGEVGHLLDNIRDFQQANFIVELLSNCFPRKSTHEVGVVMPPILW
                     REGRQNDSFFNSTLYPFRGRHGDAQVINFLLDVFQPRMRDVMLVGSVTYHSSGASGNE
                     KLLRSGRANGNSKHFYLQASHDCIYLWDGNGMFLEINRRLIKISMTGIRSVKIAVVGK
                     PLNCFRSANETWLQQFSRAEWLLLDADDQSSYEEFCKTIGSVKKVSEVQTYLVLNHTD
                     EDHSDRVDCTVGEGAQLPDYSSNHEPLRSDSSRAERDSRPAKKDQLVTPEQSDARICS
                     DEWDFKPSSEEQAANSSAMQVAKRNTPSGGDDLDDVDLPGDDGSPLVLAQKRKKIREA
                     TKTLEILKNDFALVSNPPSSKADDCKILQRSPSLLITKYQTKKGSLKDPMEGNSKVTD
                     PSGNVTKSIAPRDLNILDSIFRKPELSTRKKVKGQRTLKNYRPVIEVPSQNVPTLKTR
                     NQKKKVYADCSKDAAVTTPDSRRSKKQTKNNEAASVDSNLSVDKAQSAVATKRPSEGI
                     TGEVKSTKKSKPRGSRASNAQFDDGMANIEKIDNPTLDNTDIMDSTTILGNISYATPL
                     PVPTGNVFTDRLQEQIFSSISHFSNEMVRKMTIINNELNNTIVKELSGKYQKLFQQLQ
                     KSFQEDTEEMLQFVAEIKDMMKLPENELLIQIKSRKSKAVNLRTEPSAK"
     gene            <765160..>767589
                     /locus_tag="HG536_0H04290"
                     /db_xref="GeneID:59328319"
     mRNA            <765160..>767589
                     /locus_tag="HG536_0H04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285831.1"
                     /db_xref="GeneID:59328319"
     CDS             765160..767589
                     /locus_tag="HG536_0H04290"
                     /inference="similar to AA sequence:RefSeq:NP_014811.3"
                     /note="ancestral locus Anc_6.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141727.1"
                     /db_xref="GeneID:59328319"
                     /translation="MSEVESLTKLFSEVGFEEAKIKEIVKNKKVADTLSALVQEAPAD
                     YNWDKSSRALVHNLASLIKGSQFANSALIVNGIVKGNLKTNLQVEAAYKYVKEHGNEV
                     DEEEMNKNSGVGVEITEDQVRKSVIQYIENNKETILAERYKLVPGIFANIKNLPELRW
                     ADPRSFKPIIDQEILKVLGPKDERDLVKKKKKGGDSAKAGADSKQKNDKASPLGTTQR
                     NMFTEGFLGDLHKVEDNPQATPELLEEHLKAVNGKVRTRFPPEPNGYLHIGHSKAIMV
                     NFGYAKYHGGECNLRFDDTNPEAEAPEYFESIKRMVSWLGFKPTRVTYSSDHFDTLYN
                     LAEVLIKNGKAYVCHCTPEQVKAGRGIKEDGTPGGERFACKDRERSVEETLDEFRKMR
                     DGFYKPGEATLRMKQDLTSPSPQMWDLVAYRVLNAEHPRTGNKWKIYPTYDFTHCLVD
                     SFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGRLNITGTLLSKRKIAKLVD
                     GKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTTNIQVIRFESAVRKYLE
                     DSTPRLMFVLDPIEVVLDNLPDDYEELVTIPFRPGSPEFGERTVPFTKRLFIERSDFS
                     DKTDDKEFFRLTPNQPVGLIKVPYTISFKSAESDEAGNIVKIHAHYDSSPADGKPSKP
                     KTYIQWVPVSAKYSSPVKVAETRVYNQLFSSENPSAHPEGYLKDINPESELVYTNSVI
                     EPNFNKVIENSPWVVESVKKSEFYVPEEEGRKEVCRFQAMRVGYFTLDKESKEDRIIL
                     NRIVSLKESTK"
     gene            <767941..>768135
                     /locus_tag="HG536_0H04300"
                     /db_xref="GeneID:59328320"
     mRNA            <767941..>768135
                     /locus_tag="HG536_0H04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285832.1"
                     /db_xref="GeneID:59328320"
     CDS             767941..768135
                     /locus_tag="HG536_0H04300"
                     /inference="similar to AA sequence:RefSeq:NP_013364.1"
                     /note="ancestral locus Anc_6.50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141728.1"
                     /db_xref="GeneID:59328320"
                     /translation="MSGRQGGKAKPLKQKKKQQQELDPEDMAFKEKQKQDAAAKKAFM
                     ANVKSGKPLIGGGIKKSGKK"
     gene            <768619..>769284
                     /locus_tag="HG536_0H04310"
                     /db_xref="GeneID:59328321"
     mRNA            <768619..>769284
                     /locus_tag="HG536_0H04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285833.1"
                     /db_xref="GeneID:59328321"
     CDS             768619..769284
                     /locus_tag="HG536_0H04310"
                     /inference="similar to AA sequence:RefSeq:NP_013363.1"
                     /note="ancestral locus Anc_6.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141729.1"
                     /db_xref="GeneID:59328321"
                     /translation="MSGGRSGKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQAT
                     IGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKKRSFEF
                     IDKWIEDVKNERGEENVILCIVGNKSDLSDERQVSTEEGETKAKLLGAKIFMETSTKA
                     GYNVKNLFKKVAKSLPEFQDSHSGGSELDGSNEAGKSEANKPGIIDITTADQQAQEGG
                     CQC"
     gene            complement(<769389..>771554)
                     /locus_tag="HG536_0H04320"
                     /db_xref="GeneID:59328322"
     mRNA            complement(<769389..>771554)
                     /locus_tag="HG536_0H04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285834.1"
                     /db_xref="GeneID:59328322"
     CDS             complement(769389..771554)
                     /locus_tag="HG536_0H04320"
                     /inference="similar to AA sequence:RefSeq:NP_013361.1"
                     /note="ancestral locus Anc_6.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141730.1"
                     /db_xref="GeneID:59328322"
                     /translation="MTLRSNSTKLKRGLLLPLAPSSSTSSTEPSFDNSDSDFHKKPDR
                     SVSFIDSRTLAGTDNELHTNPLASTTTKNIHVSMNLPSSLKSLRSIAVRDFNEATLTD
                     DGIMITSQGISLASRASDNEAFLDSRNNSTSDSSFFETESLVSCVTCLSDSYSTEQRN
                     HLNLSSPSKSVGGGLNNLGDHDASYSSVTGQMLANTVIPYGRILHAKYLENPKDYLDN
                     TDTSKASDASSSPSSSNLNDSDNQVNTAAAGHDDRFLAVGGTKSGINTKGKTKKCSKR
                     GSGEPKFVEITFAKPRRHDIVPKRLILSISFPSSSANMDIVEEILKRSYKNARRERSI
                     LVIINPFGGKRKAKKLFMSKCKPILLASKCSIDTAYTKYFGHAVDIAREVDIDKYDTI
                     ACASGDGIPYEVINGLFQRPDRAEAFNKLAVTQLPCGSGNAMSVSCHWTNNPSYAALC
                     LVKSVEARIDLMCCSQQSYYKEFPRLSFLSQTYGVIAESDINTEFIRWMGPARFELGV
                     AFNVLQRKKYPCEIYVKYAAKLKNDLKVHYLEHKNRASLRFESELERNQDHEGLDGDS
                     NSRDADRITEKDFKVKYPLDNAVPADWERIDPDLTDNLGIFYTGKMPYIAADTKFFPA
                     ALPADGSMDLVITDARTPVTRMAPILLGLDKGSHVLQPEVIHSKILAYRLVPKITNSL
                     FSVDGEKFPLEPLQVEVMPRLCKTLLRNGSYVDTDFDSM"
     gene            <772309..>774033
                     /locus_tag="HG536_0H04330"
                     /db_xref="GeneID:59328323"
     mRNA            <772309..>774033
                     /locus_tag="HG536_0H04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285835.1"
                     /db_xref="GeneID:59328323"
     CDS             772309..774033
                     /locus_tag="HG536_0H04330"
                     /inference="similar to AA sequence:RefSeq:NP_013360.1"
                     /note="ancestral locus Anc_6.47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141731.1"
                     /db_xref="GeneID:59328323"
                     /translation="MLRSITVRSRIPSLRSANVLRRCYSSHKELKFGVEGRAALLRGV
                     ETLADAVQATLGPKGRNVLIEQPFGAPKITKDGVTVAKSIVLEDKFENMGAKLLQEVA
                     SKTNEAAGDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGSQAAVEKVIEFLSSNKK
                     EITTSEEIAQVATISANGDAHVGRLLASAMEKVGKEGVITIREGRTLEDELEVTEGMR
                     FDRGFISPYFITDAKSGKVEFEKPLLLISEKKISSIQDILPALEISNQSRRPLVIIAE
                     DVDGEALAACILNKLRGQVKVCAVKAPGFGDNRKNTLGDIAILTGGTVFTEELDLKPE
                     QCTVDQLGSCDSITITKEDTVVLNGDGSKDAIETRIEQIKNSIDLTTTNSYEKEKLQE
                     RLAKLSGGVAVIRVGGSSEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALVKASRV
                     LDEVKVDNFDQKLGVDIIRKAISRPARQIIENAGEEGSVIVGKLIDEYGNDFAKGYDA
                     AKGEFTDMLAAGIIDPFKVVRSGLVDASGVASLLATTEVAIVDAPQPPAPAGGGMPGG
                     MPGMPGMM"
     gene            complement(774214..774323)
                     /locus_tag="HG536_0Htrna6P"
                     /db_xref="GeneID:59328403"
     tRNA            complement(join(774214..774250,774287..774323))
                     /locus_tag="HG536_0Htrna6P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:59328403"
     gene            <774812..>776173
                     /locus_tag="HG536_0H04340"
                     /db_xref="GeneID:59328324"
     mRNA            <774812..>776173
                     /locus_tag="HG536_0H04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285836.1"
                     /db_xref="GeneID:59328324"
     CDS             774812..776173
                     /locus_tag="HG536_0H04340"
                     /inference="similar to AA sequence:RefSeq:NP_013669.1"
                     /note="ancestral locus Anc_6.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141732.1"
                     /db_xref="GeneID:59328324"
                     /translation="MFEFPIALSSKRVRNSRKLRYQYVNNLYQKYNKIEGITPNGLPT
                     PENSAAESSENECALERKRNRIRRRLKSIAGESYSDFESDEELNDAAGEALEDDEEEN
                     QERSYFKKYEKPQESFEKWQTDAKKRAPIRRTKISFTKYQRMCKSAKRKMANALELAS
                     RRSRIYLQTVSEGFEMVEPIDVKPETYQMKHISVLNSLLHVQLCRGNWDAAYNCFALL
                     IRIPGVDIRNVWGIGNQVLHAKESPKYLEFLEWMSNIYSSRTTYPEDVNFRTAPVFTK
                     GSRTHVPKFVSTWLWESLIQYTRESFEISGDSERDTDKLQELIDKISEMILAPPHMED
                     SEIWFIYSLCHMVKADILSTRFDGHLVGSARDIASNQVIQHIQRTKSCLQTCIAKGDF
                     AYPKRHIERQLETFEKRLHIDDTDSKSMEQYAEEMNEELDTQSILSENASQGYLSGHS
                     SST"
     gene            complement(<776219..>777844)
                     /locus_tag="HG536_0H04350"
                     /db_xref="GeneID:59328325"
     mRNA            complement(<776219..>777844)
                     /locus_tag="HG536_0H04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285837.1"
                     /db_xref="GeneID:59328325"
     CDS             complement(776219..777844)
                     /locus_tag="HG536_0H04350"
                     /inference="similar to AA sequence:RefSeq:NP_014630.1"
                     /note="ancestral locus Anc_6.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141733.1"
                     /db_xref="GeneID:59328325"
                     /translation="MAISETRKRQFIAFSVVVYGLTFYSVYDAVRTSVSFLQTIIKLR
                     QGFNVIILTVFAILNSVLLWKLSTSLLLGDLRLIEYEHIFERLPFTIINTMLMSSMFN
                     EHDFFTVAVLGLLLLYMKVFHWILRDRLEALLQTIQDSTTLRDLILTRFIFNLLLLAV
                     ADYNIISHCVTNSLANSFGASASVHLMMGMEFAMLLIDLANISLHTLLNFYEFYKSHS
                     HGTQRRRNIVDDGDGEMDDNQFMGLEGKFIYERIIDIATRFLKTVLHALLLIPFKMPM
                     MLIKDVLWDFLTLQQNAKTLWKTWRNNKQLDYKLPTVTQEQMGDVDNMCIICMDELFT
                     GQDGSSHRNKPKKLPCGHVLHLCCLKNWMERSQTCPICRLAVFDENGNVAQSTSSPSP
                     TTTETEGQPSGTSGEPAAFTMQASDAETQEPGASAVQHGNEDTDGNPNRGTRNTWYTF
                     PIEESSNDSVCFTMKSANGDQLIPARLRFEKKTDIESSNNGLNDDNDSNEVEVIVIPD
                     DAISDQQNIEGLKRRISELESQVEDLTKRVRKD"
     gene            complement(<778031..>778429)
                     /locus_tag="HG536_0H04360"
                     /db_xref="GeneID:59328326"
     mRNA            complement(<778031..>778429)
                     /locus_tag="HG536_0H04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285838.1"
                     /db_xref="GeneID:59328326"
     CDS             complement(778031..778429)
                     /locus_tag="HG536_0H04360"
                     /inference="similar to AA sequence:RefSeq:NP_014631.1"
                     /note="ancestral locus Anc_6.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141734.1"
                     /db_xref="GeneID:59328326"
                     /translation="MSGKVHGGKGKSGAKDGSGNLRSQSSSSRAGLQFPVGRIKRYLK
                     KNASGKIRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDE
                     LDTLIRATIASGGVLPHINKALLLKVEKRK"
     gene            <779175..>781127
                     /locus_tag="HG536_0H04370"
                     /db_xref="GeneID:59328327"
     mRNA            <779175..>781127
                     /locus_tag="HG536_0H04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285839.1"
                     /db_xref="GeneID:59328327"
     CDS             779175..781127
                     /locus_tag="HG536_0H04370"
                     /inference="similar to AA sequence:RefSeq:NP_013721.1"
                     /note="ancestral locus Anc_6.42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141735.1"
                     /db_xref="GeneID:59328327"
                     /translation="MFSINWLSLAIAVFFVDHWAHAWSPTDGYTPGNVTCGEDIKLVR
                     AATGLSQNETDWLEKRDAYTREALKTFLERATSNFTNSSLVSTLFGNDSNVPKVAVAC
                     SGGGYRAMLCGAGMLAAMDNRTDGANEHGLGGLLQSATYLAGLSGGNWLTGTLAYNNW
                     TSVQDIVNNMTTEGSIWDISNSIINPGGINVLTTAERWDHISDAVEGKQDAGFNVTLT
                     DIWGRALSYNFFPSLYRGGVGYTWSTLRDSEVFQNGEMPFPISVACGRYPGTKIINLN
                     ATVFEFNPFEMGSWDPTLNAFSDVKYLGTNVSDGVPVKKGQCVAGFDNTGFVMGTSSS
                     LFNQFLLRINDTSLPSFIKDLATHFLNDLSTDEDDIAVYGPNPFKDSMHMPSNYSTSI
                     SKSEDLFLVDGGEDNQNVPLVPLLQNERGVDVIFALDNSADTDENWPDGASLVATYER
                     QFGIQGLNMSFPYVPDVNTFVNLGLNKNPVFFGCDAHNLTDLTYTPPLVVYIPNARHS
                     YNSNTSTFKLSYSDDERLSIIKNGFEAATRGNLTEDSNFLGCVACAVMRRKQQSLNET
                     LPDECSQCFTNYCWNGTIDNNKVAGLNNSDYSSTVASTAYSAFATGSSSSSSTTKKSK
                     NDAINPVSPSPLLSFMALLGAVAGFL"
     gene            <781704..>783683
                     /locus_tag="HG536_0H04380"
                     /db_xref="GeneID:59328328"
     mRNA            <781704..>783683
                     /locus_tag="HG536_0H04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285840.1"
                     /db_xref="GeneID:59328328"
     CDS             781704..783683
                     /locus_tag="HG536_0H04380"
                     /inference="similar to AA sequence:RefSeq:NP_013719.1"
                     /note="ancestral locus Anc_6.41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141736.1"
                     /db_xref="GeneID:59328328"
                     /translation="MTLARLSALAYILSVCAATAATLQSSPYAPVEVSCDTSIQLVRK
                     ADGLSQNETEWLGKRDNHTKEALKTFLEGATSSYSNNSLIARLFSDDSNVPRVAVACS
                     GGGYRAMLSGAGMLAAMDDRTEGANEHGLGGLLQATTYLAGLSGGSWLVGSLAYNNWT
                     SVQEIIDHTSEATSIWNITASLASLGGINSSLTNETWSTIMSDVDSKQQAGYVVTITD
                     YWGRALSYGFFPNAADGGVASQWSSLRDNDIFRDGEMPFPISVADFRSPNTATTYSNS
                     TIFEFNPFEMGSWDESLHAFTDLKYLGTNVFNGVPVTKGRCVTGFDNVGFVIGTSSSL
                     FSPMMSPAIGILLNEGPLATIFTKAMGNDSNDVANYSPNPFRGIDLGSSGLEIFSSDD
                     YLFLADGGEDGETIPLAPLLQKDREVDVIFAFDNSADTTHGWPNGSALVNTYKRQFTP
                     QGRGMPFPHIPSPEEFVQLHLNERPVFFGCDANSLSDLEHVPPLVIYVPNAHYSFNSN
                     QSTFKLAYDERERLGLIRNGFEAMTRRNLTEDVSFPGCVACAIMRRQQERLDEPLPEE
                     CSKCFANYCWDNIASNVTGNGWSNSSYFLSSTSGSTITLAPTSSTGLLSSSSASFTRT
                     TSIHQNAARRSEQTTYNIRPLIVMVCLLIVVSCNV"
     gene            complement(<783810..>785033)
                     /locus_tag="HG536_0H04390"
                     /db_xref="GeneID:59328329"
     mRNA            complement(<783810..>785033)
                     /locus_tag="HG536_0H04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285841.1"
                     /db_xref="GeneID:59328329"
     CDS             complement(783810..785033)
                     /locus_tag="HG536_0H04390"
                     /inference="similar to AA sequence:RefSeq:NP_013718.1"
                     /note="ancestral locus Anc_6.40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141737.1"
                     /db_xref="GeneID:59328329"
                     /translation="MIVLYISTSSVRASKLSSVVVVADIRSIMYSPVKREGAGGGESA
                     KKRSKSNTSFDDTEAAFDLAPQQKVISEEMPHSGTGGFSADVPTALDNFATDNATMPK
                     TTQPSMDIKRNSSTTGLALPKKDEKKKVKVQGKQSLSSSMQQKETVGGKSAQATQSDP
                     NKMQDVLFSAGVDIREEEALLSSSVNASKSQTQVVNVQIPKHPPFLHPEQLSAFMRKV
                     CKTQSFPQNFSKNPEVLRMVSTACEMYIKDIVANSLVISRHRRKAVKVNSGRRNEVAM
                     VLRSIAIAEKKDEERRIKKRIALGLEKEDLENKMDSEETLHRASNVTAGLRAGSKKQY
                     GWLTSSTSKPTTLGTKSHGMVAAAVAARGDSGLRFREAREEPGIVMRDLLYALENRRN
                     GVHNVISKGYARIRD"
     gene            <785689..>786786
                     /locus_tag="HG536_0H04400"
                     /db_xref="GeneID:59328330"
     mRNA            <785689..>786786
                     /locus_tag="HG536_0H04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285842.1"
                     /db_xref="GeneID:59328330"
     CDS             785689..786786
                     /locus_tag="HG536_0H04400"
                     /inference="similar to AA sequence:RefSeq:NP_014633.1"
                     /note="ancestral locus Anc_6.39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141738.1"
                     /db_xref="GeneID:59328330"
                     /translation="MSSRGSYVVFSGSQNFRLRLILATLSGKAIKIEKIRSNELNPGL
                     KDHEVSFLRLLESVTNGSAIEISYTGTTVIYRPGIIVGGSVTHNCPKGKPVGYFVEPM
                     LYLAPFSKKKFSIIFRGCTASSEDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPL
                     GGGEVHLIVDSLIAQPLTMHELDRPTISSIRGVSYSTRVSPSMVNRMIDAAKKVLKKV
                     GCEVNISADVWRGENSGKSPGWGITLVAETKKGWSFFSEQIGGAGDVPEDIGTLAAYH
                     LLEEVSKSAAVGRNQLPLALVYMVIGKEDIGRLRITREQIDERLVGLLRDIKLVFGTE
                     VFLRPVDHDNTDDFIATIKGIGFTNTSKKIA"
     gene            complement(<786870..>788417)
                     /locus_tag="HG536_0H04410"
                     /db_xref="GeneID:59328331"
     mRNA            complement(<786870..>788417)
                     /locus_tag="HG536_0H04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285843.1"
                     /db_xref="GeneID:59328331"
     CDS             complement(786870..788417)
                     /locus_tag="HG536_0H04410"
                     /inference="similar to AA sequence:RefSeq:NP_013717.1"
                     /note="ancestral locus Anc_6.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141739.1"
                     /db_xref="GeneID:59328331"
                     /translation="MDALKDIDPWNTNKDEALSGNEWTSGDGAASIAPLAETSRPSLD
                     ASIRNISVVESTEASDTLGRSTWEEELPRNTDILSEATLTGSGSSLLGPFGSTDFSVT
                     SRNFQEPHHSLDENLSDWLKTVRGTYKPLGPDIVVIEQLPDKEGLLFKHTNYLVRHLV
                     ALPHAESNNDRSVIRRYSDFVWLQEVLLKRYPFRLIPELPPKKIGTQNADAVFLERRR
                     RGLTRFINLVVKHPVLSKDDLLLTFLTVPTDLSGWRKQAIYDTTEEFSDKKITHSFVK
                     MWQKEISEQWNESEATIEKSIELWVKITVSMERYERRVKFMAKERAALGSLIHEFSVS
                     TPKLYPTEQSSTVLEINNHLSIIEKHLKETTELSNERTAEYSTNLVPSFRVFIDILIS
                     LRDLFERYRIMAGNNVPLLQRRVELNNQKLESMKDKPDVSGAEYDRIKSAIQRDKRTI
                     AEELNRAWLIRECILEEFTIFQETQFLISRAFQEWSKLNSNYAGRTVNAWEKLSENLM
                     DMPTSQN"
     gene            complement(<788648..>789427)
                     /locus_tag="HG536_0H04420"
                     /db_xref="GeneID:59328332"
     mRNA            complement(<788648..>789427)
                     /locus_tag="HG536_0H04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285844.1"
                     /db_xref="GeneID:59328332"
     CDS             complement(788648..789427)
                     /locus_tag="HG536_0H04420"
                     /inference="similar to AA sequence:RefSeq:NP_014634.1"
                     /note="ancestral locus Anc_6.37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141740.1"
                     /db_xref="GeneID:59328332"
                     /translation="MSFDIDWTKIESDAGLNESIKCHLNSYLQSIDLPDYVSHLRIVD
                     FSIGKVPPNIILREISDPLDDFYQALNEDIEGVEGAKPVERNPNDVQFLTEIEYKGDL
                     LITIAADLVLHYPTKSFMTLPVKLTISNIGIHSLCLIAYLSKQVFVSFLCDVSDSMLD
                     KNESILDTSGSLLTPKRSLERILILRTMKIETEIGEQCQGEGSVLRSVGKLEQFLLEN
                     FKEVLRKELSWPSWISLDLSNDDDGEDYSARPDQPSEDRPV"
     gene            <789579..>790202
                     /locus_tag="HG536_0H04430"
                     /db_xref="GeneID:59328333"
     mRNA            <789579..>790202
                     /locus_tag="HG536_0H04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285845.1"
                     /db_xref="GeneID:59328333"
     CDS             789579..790202
                     /locus_tag="HG536_0H04430"
                     /inference="similar to AA sequence:RefSeq:NP_014635.1"
                     /note="ancestral locus Anc_6.36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141741.1"
                     /db_xref="GeneID:59328333"
                     /translation="MILVCSLRRATGYTRNCYAFASRSSRSLFGWNSSQAGEHVQRYT
                     LTKIMNAPPEQVYNVVSEISKYRDFIPYCEDSFVNKRNPIDGKPTEAGLRIGFRQYDE
                     KYTCKIKCTKLIDDGVETYRVIADSITESLFRGLCTRWTIKPHPERPHASKVELILSF
                     EMRSRLYNSVSALFASSVTELAMKAFDKRVFQLRRQALKASTLNKTS"
     gene            complement(<790302..>790976)
                     /locus_tag="HG536_0H04440"
                     /db_xref="GeneID:59328334"
     mRNA            complement(<790302..>790976)
                     /locus_tag="HG536_0H04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285846.1"
                     /db_xref="GeneID:59328334"
     CDS             complement(790302..790976)
                     /locus_tag="HG536_0H04440"
                     /inference="similar to AA sequence:RefSeq:NP_013716.1"
                     /note="ancestral locus Anc_6.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141742.1"
                     /db_xref="GeneID:59328334"
                     /translation="MRRLGIQSGGFRNMRFLLVTGAWLAESPCYAVSIRSTMNASIGL
                     FRSVHNTSKKNHTSLITADMKHSSFHKMSLNALKNECRSRGLKVSGKKAELIDRIMTF
                     NGSSGNKAAKMQRMSTASPVRGPTAAVKLKVPTSSIEMCKTREVSTASGKLDFQTKSF
                     SPLNINSATDSAIATDTQATKQADLRDNIVMGDELTWRDRLFLAGFATVALLWWGAQS
                     SEKETG"
     gene            complement(<791177..>791635)
                     /locus_tag="HG536_0H04450"
                     /db_xref="GeneID:59328335"
     mRNA            complement(<791177..>791635)
                     /locus_tag="HG536_0H04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285847.1"
                     /db_xref="GeneID:59328335"
     CDS             complement(791177..791635)
                     /locus_tag="HG536_0H04450"
                     /inference="similar to AA sequence:RefSeq:NP_013715.1"
                     /note="ancestral locus Anc_6.34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141743.1"
                     /db_xref="GeneID:59328335"
                     /translation="MARSRGPARPASRPMQTRSASTMAAPAHAPAPTQSAYSHPPATA
                     AAQPKQPGLFAQMASTAAGVAVGSAVGHTIGAGITGMFSGSDSAPAEQQQQQQLATAN
                     TQQSVGEQTKACDVDARNFTRCLDDNNGNFQICDYYLQQLKACQEAARQY"
     gene            complement(<791869..>792879)
                     /locus_tag="HG536_0H04460"
                     /db_xref="GeneID:59328336"
     mRNA            complement(<791869..>792879)
                     /locus_tag="HG536_0H04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285848.1"
                     /db_xref="GeneID:59328336"
     CDS             complement(791869..792879)
                     /locus_tag="HG536_0H04460"
                     /inference="similar to AA sequence:RefSeq:NP_014636.1"
                     /note="ancestral locus Anc_6.33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141744.1"
                     /db_xref="GeneID:59328336"
                     /translation="MRSNLLSSSHFSSMATASMTFARSKKDTVQRSRILFCCFLLVRG
                     AMSEVMLDERGLPNLNSTTTSISSSVSSTSSSAQSTSATFTPFIPSSEGNKYVYHATH
                     TGGTVFIAVGSCLAFILGIVLVVWIVFGFSSWRSARKEYKLKDMEEKCQYDPFFYSTF
                     KDTSDGSDSDERSDMSEKVLRNKPSTLSLYSLTSTSMLNLLNQTKNDSAGGDQNVHQS
                     NNRRSMFISPIELLQNEANRTTLWTNDNTSTGTPFDSPVSTQVEQSCTQILNNMDGLT
                     GQARSNIYHHNKRSKSTVDLLPGGGSPSSLEDTSQTRETINNKKHYRSPSIVLDQLLD
                     QD"
     gene            complement(<793171..>795450)
                     /locus_tag="HG536_0H04470"
                     /db_xref="GeneID:59328337"
     mRNA            complement(<793171..>795450)
                     /locus_tag="HG536_0H04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285849.1"
                     /db_xref="GeneID:59328337"
     CDS             complement(793171..795450)
                     /locus_tag="HG536_0H04470"
                     /inference="similar to AA sequence:RefSeq:NP_014637.1"
                     /note="ancestral locus Anc_6.32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141745.1"
                     /db_xref="GeneID:59328337"
                     /translation="MTTEKRQYSSDEEDTPLSRTSKRRRAAQLDEEDDDTGEFDSDTA
                     LSQVSETPNGRTPELEEEKTTRIEVKSEPTKKPRKKQATGLNKVKKETSTRKTKTSKS
                     KIKKEEEGVGEEEEEDGGYKWWEAEKEDDSVKWTTLKHNGVIFPPPYEPLPSHVKLYY
                     DGKPVDLPAKAEEVAGFYAALLGSDHTKNPVFQKNFFNDFLEVLRECGGTQNNIEIKD
                     FNKCDFTKIFEYFELQKEQRKQLSSQEKKQLRLEREKLEEPYKFCELDGRKEQVGNFR
                     IEPPGLFRGRGAHPKTGKLKRRVYPEDVVLNLDKDAPIPPLPEGQKWGEIRHDNTVQW
                     LAMWRENISNSFKYVRFAANSSLNGQSDYKKFEKARQLKDHIDAIRKDYTKNLKNKVM
                     LERQKSVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYEHVTLNPPNTVIFDFLGKDS
                     IRYYQEVEVDKQVFKNLAIFKRPPKQPGDQLFDRLDPSILNKHLQHYMPGLTAKVFRT
                     YNASKTMQDQLDLIPNEGTVAEKLLKYNAANRTVAILCNHQRSVTKNHAQSVQKASDK
                     IKELEWQKIRLKRAILQLDESELKKRPKYFEELDDLTKEDEASIHKRIIEREIEKCHK
                     KFARENDKRKFEGQELLTESDLKEWLDKVEETRRNYEEELETREIKLKSANTTVEKLD
                     KQIEKLDQRIQVSAIQLRDKEENSQVSLGTSKINYIDPRLSVVFCKKYGVPIEKIFTK
                     SLREKFKWAVESVDETWRF"
     gene            <796438..>798612
                     /locus_tag="HG536_0H04480"
                     /db_xref="GeneID:59328338"
     mRNA            <796438..>798612
                     /locus_tag="HG536_0H04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285850.1"
                     /db_xref="GeneID:59328338"
     CDS             796438..798612
                     /locus_tag="HG536_0H04480"
                     /inference="similar to AA sequence:RefSeq:NP_013714.1"
                     /note="ancestral locus Anc_6.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141746.1"
                     /db_xref="GeneID:59328338"
                     /translation="MSLAPLQTVSEKLLNNRSNLIHTPVKGTKANNNAGVGIGIGTGL
                     DGKENQAESLHHHHYQNNHNKRVDTNGQPAQKKKKEKLSALCKTPPSLIKTRGRDYHR
                     GHFLGEGGFARCFQIRDDSGKIFAAKTVAKLSIKTEKTRKKLLSEIQIHKSMRHPNIV
                     QFIDCFEDETNVYILLEICPNGSLMELLKKRKTLTEPEVRFFTTQICGAIKYMHSRRV
                     IHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLMGKHSGH
                     SYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFPKEKYLSPEARVLIQD
                     LLSLDPLERPSLMEVMDYVWFRGIFPPYIQSDVMTEVPNYEGTISAEESLINFKNCME
                     RSGIIDNSKLQKNVKDVISFVNQENDNTSNQQRQNILPNSLSPGGTRNKYKEVVDLEA
                     QRRLNDLAREARLRRAQQATIKRDLVATSTNLIKSEISLRILASECHLTLNGILEAEA
                     QKRMGGLPQSRLPKVKHPIIVTKWVDYSNKHGFSYQLSTEDIGVLFNNGTTVLRLADA
                     EEFWYISYDDREGWVASHYLLTEKPRELTRHLEVVDFFSKYMRANLSRVSTFVREEYH
                     KDDVFLRRYTRYKQFVMFELSDGTFQFNFKDHNKLAVSEGGKLVTYISPSHESLTYPL
                     VELLKIGEIPNYPDCNFMEKLSLIKEGLKQKSSIVTVEQNQP"
     gene            complement(<798803..>799171)
                     /locus_tag="HG536_0H04490"
                     /db_xref="GeneID:59328339"
     mRNA            complement(<798803..>799171)
                     /locus_tag="HG536_0H04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285851.1"
                     /db_xref="GeneID:59328339"
     CDS             complement(798803..799171)
                     /locus_tag="HG536_0H04490"
                     /inference="similar to AA sequence:RefSeq:NP_014638.1"
                     /note="ancestral locus Anc_6.30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141747.1"
                     /db_xref="GeneID:59328339"
                     /translation="MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVISFEKEDHTLGN
                     LIRAELLNDRKVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALKNACNSIINKLAVLK
                     TNFETEWNLQTLASDDNYGI"
     gene            <800075..>804649
                     /locus_tag="HG536_0H04500"
                     /db_xref="GeneID:59328340"
     mRNA            <800075..>804649
                     /locus_tag="HG536_0H04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285852.1"
                     /db_xref="GeneID:59328340"
     CDS             800075..804649
                     /locus_tag="HG536_0H04500"
                     /inference="similar to AA sequence:RefSeq:NP_014639.1"
                     /note="ancestral locus Anc_6.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141748.1"
                     /db_xref="GeneID:59328340"
                     /translation="MSNSHVWSQPAGSGSGNKDDPGPKDHENGENGSSEQPGTITGLT
                     SVVQGSLPMSSPVSSELPKQNLEVNGEHKPHVVLPSISDLSGETSQATRIAGNLADVP
                     PKDSPVSNARVTILPHQPLRLPSVHSTYNSPPVIPAMPENRSPVHDTNGQKLEVTNAN
                     MNNGVKSSQATNTGISLANFDNPMPPSQYQTALPNSNFQLLQPTAQQQQQQQQQTQDV
                     YYRPLNVKDALSYLEQVKYQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSSLFKG
                     YPNLIQGFNTFLPQGYWIECSANPDEPIRVTTPMGASCVAGTMENAGQSFQAQPRARQ
                     MQQLGSKQEQATSVSQGDRQAAVESVVPTINPNLNVSNPAQHQSQQQIQDFQVPLQAP
                     LGQSLQLQANDQTKKTADVEFSQAINYVNKIKNRFADKPDIYKNFLEILQTYQREQRP
                     INEVYAQVTVLFQNAPDLLDDFKKFLPDSSATSGREQQQHQAPSLMQQPQIYGFGSYY
                     NETSPPTSRQNLPPLGSFSPPSNGTIPHTYYREQQPRPVGLPPVPQVESHLEPKLSLQ
                     HAAGISGEPLPMSNLRSQIAGQSPSEFAQIQQQQLQQMPLAEQSVNQQEAQFLDVTVR
                     PEIDLDPSIVPVVPEPTEPIEDSLSFVEETNFFDKAKKFIGNKQVYTEFLKILNLFSQ
                     DLLETEELVDRVEHYLGGNKELFTWFKNFVGYQDKPKHIENIVHEKHRLDLDLCEACG
                     PSYKKLPKTDTFMPCSGRDEMCWAILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI
                     EEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKASFKLPPGLGHTSLTIYKKVIR
                     KVYDKERGFEIIDALHEYPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYK
                     SLDHLGLTFKQADKKLLTTKQLVSEISSIKSDQTNKRMHWLTPKPKSQLDYDILDKEV
                     LFDILCLTDVFINHSSNYSNPDKERLGDLFKVFVSLFFSIPLEEVNIAIKSRNNDGNN
                     VEQPDETETGRASTGSKRFREDELQLCDILHRAKYQKLRNRSTDDEASEGSGMDVEPE
                     FEGEDETIKQEAKKPWLLGNLVDEVNAQGLMSNRKTFNLIANTNIYVFFRHLTTLYER
                     LYEVRKINEEVTKEINSRKIVQFAKDLNLISQQLKDMGLDFEGADAYEQLLHLCKRLI
                     EGDIEHQWFEESLRQAYNNKAFKLYTVDKVLQSLVKHAHAILTDSKTSQIMILFEKDR
                     NQINTSAKDQILYRLQVRSYMSTSENMFRIEYNKQKRHVCIQYIAIDDLTLAEPKSLE
                     DKWKYYVTSYSLSHPTEGVSQEELQVPFLEKIVESEEDLGSDVDNPNERHSPEGVSKS
                     ALKIQIDPETYLLKIEPGSFDVFSRKSINKFPEEAGSTQIKLQKKKAKLIKFLEGTKG
                     WKQSLTDVQRKEVEARLAYIRKHGSFEGYTSNVSGEDRMAEKASLGIAKPTEQAGFMN
                     RSPANKGITEVEDKENDTTADEVDTEAPAH"
     gene            complement(<804760..>805905)
                     /locus_tag="HG536_0H04510"
                     /db_xref="GeneID:59328341"
     mRNA            complement(<804760..>805905)
                     /locus_tag="HG536_0H04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285853.1"
                     /db_xref="GeneID:59328341"
     CDS             complement(804760..805905)
                     /locus_tag="HG536_0H04510"
                     /inference="similar to AA sequence:RefSeq:NP_014640.1"
                     /note="ancestral locus Anc_6.28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141749.1"
                     /db_xref="GeneID:59328341"
                     /translation="MPVKLKWPWLGIAIPCFLISFIGYCSHLFILLNFLSPLLQVWFQ
                     FSLILIWISYYLAIYTDPGTAASHFEPLEREWRNYCRKCSNYKPPRAHHCKTCGKCVL
                     MMDHHCPWTMNCVGYKNFAPFLRFLFWVITTTGFLFYHLVYRIMFLWKNRNLPNYLVK
                     RSELIFLTILTPLDGFVLLTITSLFVRCLNNQIFGGMSQIESWELERLQSLFNAKRLI
                     PLLLESAWKLFPQSREQISQVRANKTLVQQRLHFDDVVNFPYDLSPWENAAQLLGHPF
                     LWLTPIGGPLGNGMSFPKNDISEYTPDSRIEDILLALPWPPDGASRKSGSGTTMEIIE
                     TRTEGGEQLVRRRPADRWDLVERKDWQNEWGENLTDFGVDIDTEQIG"
     gene            806306..806378
                     /locus_tag="HG536_0Htrna7T"
                     /db_xref="GeneID:59328407"
     tRNA            806306..806378
                     /locus_tag="HG536_0Htrna7T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:59328407"
     gene            complement(<806465..>807448)
                     /locus_tag="HG536_0H04520"
                     /db_xref="GeneID:59328342"
     mRNA            complement(<806465..>807448)
                     /locus_tag="HG536_0H04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285854.1"
                     /db_xref="GeneID:59328342"
     CDS             complement(806465..807448)
                     /locus_tag="HG536_0H04520"
                     /inference="similar to AA sequence:RefSeq:NP_014641.2"
                     /note="ancestral locus Anc_6.27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141750.1"
                     /db_xref="GeneID:59328342"
                     /translation="MYENLKKRSTGSVTIQRPVAMISHEDSPADKDSLRRKARRLYTW
                     DEIPEWQRDNEHILTGYVGETKSSWECFKSLFYLHNESINIYSHLMPGIAFFFILFFN
                     KFAITKFETTSFIDYFMIDLFFVGAFTCLTLSSIFHCLKNHSLSVATFGNKLDYLGIV
                     VLIVNSMISIMYYGFHESPSLFYFFTVVTCSFGLACAVVSMKERFRTREWRPYRAALF
                     VAFGLSAVLPIIAGSIHYGFSELYLRIQVKWVLLGGIFYIVGAVLYGMRFPEKCSPGR
                     FDIWGHSHQLFHILVVVAALCHLNGLIKSYDLVHLKMAMAPASSPSIDTFN"
     gene            <808477..>809493
                     /locus_tag="HG536_0H04530"
                     /db_xref="GeneID:59328343"
     mRNA            <808477..>809493
                     /locus_tag="HG536_0H04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285855.1"
                     /db_xref="GeneID:59328343"
     CDS             808477..809493
                     /locus_tag="HG536_0H04530"
                     /inference="similar to AA sequence:RefSeq:NP_014642.1"
                     /note="ancestral locus Anc_6.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141751.1"
                     /db_xref="GeneID:59328343"
                     /translation="MQIMKVAEATTADKSLPEDRPKEESKEIPTIYLHPKFSNCSRTD
                     LAILISRMLTFLIQINDSSSSSAPDKLSGLTRFHSRVPPNISVYNYLLRLTKYSSLEH
                     CVLLTAVYYIDLLSSVYPIFKLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGV
                     HSSELNILECEFLKRVNYRILPRDNNIDWCKLESKFHSFSLYDEPTELPNIGSTAALK
                     NSGYNVLNAYFRKIVQLVGPYDASPDKSKAANYALLPPSPKENCAKILGDGELVIQSD
                     SLGKSSTGAMISGTKRPSIQEAHSRKRNLEIEGTDHQPIEKKVSELTKSKKQTFNQKA
                     PTFT"
     gene            <809863..>812073
                     /locus_tag="HG536_0H04540"
                     /db_xref="GeneID:59328344"
     mRNA            <809863..>812073
                     /locus_tag="HG536_0H04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285856.1"
                     /db_xref="GeneID:59328344"
     CDS             809863..812073
                     /locus_tag="HG536_0H04540"
                     /inference="similar to AA sequence:RefSeq:NP_014643.1"
                     /note="ancestral locus Anc_6.25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141752.1"
                     /db_xref="GeneID:59328344"
                     /translation="MTTYDGSQLLSKVLDTIRASTALGAQDVDFCRSMSKDIGDALDK
                     TCDEIVNLINGLLTSVDQNTEPLECGRDRLQDSWKDFSNVMDNIFELSDRSIDILTKS
                     SGTMNNGIQMQFLDDSSRTKFTSSAKIVKPQLSFRTPVDNTEGHPFVPLLKEKPFALK
                     PFAKVKLLPGNDSMPEHYEHPYQDEIESQEYDHSVILKSEPIASQPWDTTEAVWVDNT
                     EVLDAMLSDLKSATELAVDLEHHDYRSYYGIVCLMQISTRSTDYLVDTISLRDDLYVL
                     NEVFANPKILKVFHGAFMDIIWLQRDLGLYVVSLFDTYHASRAIGLPRHSLAYLLERY
                     AHFKTSKKYQLSDWRIRPLSKPMKAYARADTHFLLNIYDQLRNTLIEQNKLAGVLAES
                     RNVAKRRFEYSRFRPTVPSTSVYCPIEKPDQWKTLMVQYNIPPEKEELVKRLYDWRDT
                     IARRDDESSRYVMPNQLLVSLAVNTPTTPVDVISVNNVVTDHVRSNSLVLANLIKSSI
                     QSIKLSKAQSVLQSDKTNNLTADSLLTIPQIKKVMSIFEGIAQTGLTTEEHEKDNGSS
                     KLVDILTSKNNAVDYSDGGPRRIKHEQFESRCHEAWKTMEDFDNTVVYSIQAPEPDAV
                     IKESAQEPPRRSPGISEQAAQPEEDMDEIVTLKRVRRHDQSPETNAEEPKRQAVDYSK
                     SEKILVENRNASKKRDSKKRSFDPYAASNHSGDAPRGVKKRRSTNRGRNVSFKK"
     gene            complement(<812201..>812827)
                     /locus_tag="HG536_0H04550"
                     /db_xref="GeneID:59328345"
     mRNA            complement(<812201..>812827)
                     /locus_tag="HG536_0H04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285857.1"
                     /db_xref="GeneID:59328345"
     CDS             complement(812201..812827)
                     /locus_tag="HG536_0H04550"
                     /inference="similar to AA sequence:RefSeq:NP_013713.1"
                     /note="ancestral locus Anc_6.24"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141753.1"
                     /db_xref="GeneID:59328345"
                     /translation="MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGAD
                     FLTKEVVVDDDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFENIKS
                     WRDEFLVNANVSSPETFPFVILGNKVDVEESKKVVSTKSAQELAKSLGNVPLFFTSAK
                     NAINVDTAFEEIGRSALQQNQADADAFEEDFNDAINIQLDGEPSSCSC"
     gene            <813646..>814563
                     /locus_tag="HG536_0H04560"
                     /db_xref="GeneID:59328346"
     mRNA            <813646..>814563
                     /locus_tag="HG536_0H04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285858.1"
                     /db_xref="GeneID:59328346"
     CDS             813646..814563
                     /locus_tag="HG536_0H04560"
                     /note="ancestral locus Anc_6.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141754.1"
                     /db_xref="GeneID:59328346"
                     /translation="MKTNNLRSIVKHFVASQQAEGVGATVRRSIGSMQMRRFSPFLML
                     DHFTVSPPAGFPDHPHHGQETITYVLGGMIAHEDFSGAKGILSPGDLQFMTAGKAIVH
                     SEIPVKMDSGEPAVGLQLWVDLPQKLKNCEPRYRNLRSKETPVVRPSENLEVRVISGN
                     SYGVESVRDLAYTPVHFYHYITSKEGTPFTQNFPRDFNAFMYVMKGSVAIGDQVFPQF
                     STVFFNNDGDAIAGVSATKDAEFALIGGEILDQDVVQHGPFVETDRERLLEVFKNYQY
                     SINGFERARDWRSSIAEGISEEEAKKQLE"
     gene            <814771..>816402
                     /locus_tag="HG536_0H04570"
                     /db_xref="GeneID:59328347"
     mRNA            <814771..>816402
                     /locus_tag="HG536_0H04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285859.1"
                     /db_xref="GeneID:59328347"
     CDS             814771..816402
                     /locus_tag="HG536_0H04570"
                     /inference="similar to AA sequence:RefSeq:NP_014644.1"
                     /note="ancestral locus Anc_6.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141755.1"
                     /db_xref="GeneID:59328347"
                     /translation="MKPKGKATLRRSSVEESFYASPLYDFLYPFRPAGSQWLTEYVIV
                     LFALIIACAVGLGNYSGFNTPPMFGDFEAQRHWMELTQHLPPSQWYWFDLEYWGLDYP
                     PLTAYHSYILGKIGSFIKPEWFRLNESRGYESPDLKTFMRFTVLLSEALFYIPAVVYF
                     TKWLGKHRNQSPIGQFITAATILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLLEEFY
                     AAAAVCFVLSICFKQMALYYAPIFFSYLLSKALFSPRFNFPRLLSIAVATLSSFAAVY
                     APLYVLGGGLPNVLQSVHRIFPFARGIFEDKVANFWCVTNIFFKYKEAFTQDELQLYS
                     LIATLAGFLPAAFVIFLYPKKHIIYYALATCSMSFYLFSFQVHEKTILVPLLPVTLLY
                     TSSNWDVLSLVNWVNNVGLFTLYPLLKKDGLTLQYYVCFALSNWLIGNFSFVTPKFLP
                     SFLTPGPSVSSIDINYRRRSLLPRNIVWKVVIVGSYVSMGIVHVLDLFFIPPAKYPDL
                     WVLFNCTIGFVCFLLFWLWSYYMLFTMPSKSLQQL"
     gene            818182..818254
                     /locus_tag="HG536_0Htrna12R"
                     /db_xref="GeneID:59328396"
     tRNA            818182..818254
                     /locus_tag="HG536_0Htrna12R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGU"
                     /db_xref="GeneID:59328396"
     gene            <818544..>819560
                     /locus_tag="HG536_0H04580"
                     /db_xref="GeneID:59328348"
     mRNA            <818544..>819560
                     /locus_tag="HG536_0H04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285860.1"
                     /db_xref="GeneID:59328348"
     CDS             818544..819560
                     /locus_tag="HG536_0H04580"
                     /inference="similar to AA sequence:RefSeq:NP_014649.1"
                     /note="ancestral locus Anc_6.21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141756.1"
                     /db_xref="GeneID:59328348"
                     /translation="MSPSNKEVASLIIDYLAQVIEDKKVSDDAADSLNVAIDCIAESF
                     EVQKGDSEALFGGKSLLDLLEVGSGVSASASQGESIQVNIPPEDAETKAKAEALKLEG
                     NKAMASRDFELAVKKYTEAIAVLPTNAVYFANRAAAHSSLKAYEEAVKDAESAIKTDP
                     SYSKGYSRLGYAKFALGRAEEALEAYKKVLDIEGDNASDVMKRDYETAKKKVEQSLDL
                     EKKPETKSRSEGATGAGGFGDIASMLGNGLGGLLNNPQLMQAAQQMMQNPQAMQQMES
                     LMQNPGIRQMAENFAQGNGAPNMSDLMNNPALREMAGNIFGGSGPGDASSNGGSGASG
                     DVNK"
     gene            complement(<819714..>822974)
                     /locus_tag="HG536_0H04590"
                     /db_xref="GeneID:59328349"
     mRNA            complement(<819714..>822974)
                     /locus_tag="HG536_0H04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285861.1"
                     /db_xref="GeneID:59328349"
     CDS             complement(819714..822974)
                     /locus_tag="HG536_0H04590"
                     /inference="similar to AA sequence:RefSeq:NP_013712.1"
                     /note="ancestral locus Anc_6.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141757.1"
                     /db_xref="GeneID:59328349"
                     /translation="MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFALIKEEKFILLIP
                     PSDKLLNFKDKLTGLPLLELCYSFDFVASHVLLINESNGENGGISHLSQVKFDTVNGK
                     KVLVRLQHRVALTSDGFQFKKRCKITDVSFIANFNDYLLPSDQFPVIYIDEPLCGELM
                     EAIPSQQELKNERTKEVKDVIPPSLELSQGNKVSFENMLRIHPDWTSRFNSLFAEYRN
                     TPERNGPDDELFHDIVHRIYSTMGREPAFKNLPDLFDLIYEYVELNLFDDIWIRITSH
                     LKDNEISIENLENLSLNQLETELYAASFENFQLKKIVALEKGIELAMASFSRISLAHK
                     HSEKSEALIETLRNLSNGGSATDSSHDSPMAMDADTLLSLFVLVVCRTQVKNLKAHLF
                     YLQHFARNESTIKYGVLGYAISTLEAVVCHFEDLKGTERLNELVKQCHTNRAFVAVLS
                     ASDETPVDIDHYQGSLSYRTDQGESALSLCITNGKNGVLRKLLERQRDFPLEDILNDE
                     TTDGCTLLVQALRCGNSDAARIVVDLLILSCTEQELITYFNRPDRHKRISAHYLTHEV
                     EILQKIGIFINWDTKDSSGHTALFTIFRSYDQANYEQMVRASFDCAATWYTRNGIVFD
                     FKAHEDSKGNTLLHIMKKGISMLLKFDGIDVNATNKKGLTPLMVYAKYNRMDNIKAIL
                     KDNRAMIWKIQQPFLLDSLCYAKNPLILHELAKHAANLTFGKCLVHTLKYEAPSWLIS
                     VTSQIKQDGQFRTTELHLKTIQNFFRTFQKMNPMTFIPLDSTLDPLLSSLGKTRLSTI
                     TKLETMILLRNITNCISALIHVGNLPDEILSNEATLLSWIKTQVKASRDGSARPIFNK
                     KVEPEEMSIIQSFLRFNQAELSALKTKLQVMKKLAIFLRLKATDVVESNKLLFSQAAR
                     TIESFALLSTEKQVNCRVYGDGPMVILAEEINFLLQCTLRLHGHISNLLQVRIPDWWK
                     SYGELLSLHKQYAQNFPQLVKEDNSSMDSGILGRLLEGKREKLEKRLSFSIAETRRNM
                     NQAGADIARLHEDLAEQLNKFMEYKGAFFCRSVIKKWTTENILTLKDQLLHLERDS"
     gene            <823242..>824129
                     /locus_tag="HG536_0H04600"
                     /db_xref="GeneID:59328350"
     mRNA            <823242..>824129
                     /locus_tag="HG536_0H04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285862.1"
                     /db_xref="GeneID:59328350"
     CDS             823242..824129
                     /locus_tag="HG536_0H04600"
                     /inference="similar to AA sequence:RefSeq:NP_014648.1"
                     /note="ancestral locus Anc_6.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141758.1"
                     /db_xref="GeneID:59328350"
                     /translation="MSKGKNKNREPRGDRSAKGSNGHSARQNHKRMEMKQGGEGSKFP
                     VKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPNDRAIVE
                     EQGASVVECSWARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFA
                     IVGRMDWASELLSHFSWGPSFLELNSELIEIYQKCTDAQSVKDAETAWLAKIQQEVEE
                     RKAQAKTDDIWMTGNVNRRDASISESEDCSDLVLSEEEDSKTYRYDSLGNIIASESEE
                     ETQSDTEEEELNDRHADET"
     gene            <824400..>827309
                     /locus_tag="HG536_0H04610"
                     /db_xref="GeneID:59328351"
     mRNA            <824400..>827309
                     /locus_tag="HG536_0H04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285863.1"
                     /db_xref="GeneID:59328351"
     CDS             824400..827309
                     /locus_tag="HG536_0H04610"
                     /inference="similar to AA sequence:RefSeq:NP_014647.1"
                     /note="ancestral locus Anc_6.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141759.1"
                     /db_xref="GeneID:59328351"
                     /translation="MEVTEGFVDDAEAPPNDVLSLEPPEDSPKNFAPSPDFLWLCEEL
                     FIRVEDVKKQGRERLGSKPISMRYYDVIHHFVKLWRRTVGDDIYPAFALILPYRDRRI
                     YNIKDYTLVKAVCNYLALPKQSATEKRLLKWKRRATRGSRLSNFCVTEIKKRKSEPSP
                     ERRITIDKLNECLDQLVEERNAKGGFKGLSESPAFNFCLQNMTFVELKFFFDIILKYR
                     LIGGQEDKLLSCWHPDAPEYLSVVSDLKTVTKRLWNPENRLRHDDLSINLGYAFVPQL
                     AKKVSVSYEKICGKLKNDFVIEEKMDGERIQVHYMDFGGSVKFLSRRGIDFSYLYGES
                     ISEGPVAQYLKFNPNVKDCVLDCEMITYDTDRGVVLPFGLVKSSARQALSMEGICTQG
                     YRPMLMVLDLVYLNGVSLIKLPLHQRKEYLVKILTPFPHAVDILSYVRCSDQIAIKRS
                     LERAISMGSEGIVLKNFNSRYEIGARNDNWIKVKPEYLEQFGENMDLIIIGRDPGKKD
                     SLMCGLAVYENESDAAEIKAAEEAEIISLDSDREEADEPDHNKVIKKFISFCIIANGI
                     SQEEFKDIDRRTRGNWTKSEDRLPPSSLLEFGSKIPEEWIDPKKSLIIEVKARSLDNT
                     ESSKKKFSAGCTLHGGYCRRIRDDKDWTGCYSLSELWRERRQRSGTAIGSLNKKYPKT
                     DKARRKRNDIFVDQALEMDDAGLKSNVFANLYFYVLSDYIDPELNTRITKPQLNNLIK
                     QNSGMLVQNLISKHHMENSFRIISGKLTGECKSLINRGYDILSPRWILDCVSYGKLVR
                     IEPKHCFNVSEELMKIARERVDRFGDSFVSTISEQQLESLITSNIDSTPVTDYNHMDR
                     SPELSQVPIFLFSGRICYVPEMFFSATERAALLSKIKLYGGLVASELINCNLIVVSMT
                     TCSRDPPLQKLRESVAQLIANFDSPQPIPHLVTSEWIDRSIQENCQVPEEDFYPA"
     gene            <827401..>829449
                     /locus_tag="HG536_0H04620"
                     /db_xref="GeneID:59328352"
     mRNA            <827401..>829449
                     /locus_tag="HG536_0H04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285864.1"
                     /db_xref="GeneID:59328352"
     CDS             827401..829449
                     /locus_tag="HG536_0H04620"
                     /inference="similar to AA sequence:RefSeq:NP_010852.4"
                     /note="ancestral locus Anc_6.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141760.1"
                     /db_xref="GeneID:59328352"
                     /translation="MDGKNQKMGDQFKGFVPIHTIFYAVFHPTEGTKVRFEFPPGNLE
                     NHNINFDTIKNYIIPKPQLCHKLLTLKYKNYRIASYPVTVNSAIYARNFFSFNFVFVF
                     QYDCETSPYEPAIARLGKMFKVLEEQNLILSKAEKDPVFYQNSPEGVTQDGKSNSEKG
                     TVKLPKVQNNVRSEYEQVTEGSFSLHDLVLRVYQDLNNYSECLIPIDDGNAVDIKIFP
                     LMTPPQSNVSIEDVPVSTVNLKKVIDLNWDPTMLKIVPFIDGLNCVSKIAKLSNSSPD
                     LVMECVKHLIYYDCVFLADIFQFSNIYAPTSLLRCFLTDLALATECQSHVVCEESSLL
                     PSVPFDRGESLDSEHSDHDFSGLHSINRSLGSLKNSMSSKSAISSHRHKQSVSSASEA
                     SLCKSGKHSQGSFSSNNTNSSNILPRYLPTRSCLFDLYRSLSQGVTVKEWYAANCNTI
                     RHNRIDIRRFISFGVMKGLIYRCHSYPVIKKLDIFDLAKNSSLDAGLSSNSSNVKRGK
                     NKNRSNNIFSTSDIRFGAEEDDGTKKHRNALDSEIADQVLKNVYKKLSAVDTSDSKNG
                     IANLMKRLDAQRSSATAPSNSISNLYRLRNSERPSRVSFDKQQEDRKSGKNLTSADEK
                     SKEEEFADHVARRQRDILLLRSIEAADNLDKICVELEMPRSQVEDLLKILGDYKIVNS
                     "
     gene            complement(<829521..>832436)
                     /locus_tag="HG536_0H04630"
                     /db_xref="GeneID:59328353"
     mRNA            complement(<829521..>832436)
                     /locus_tag="HG536_0H04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285865.1"
                     /db_xref="GeneID:59328353"
     CDS             complement(829521..832436)
                     /locus_tag="HG536_0H04630"
                     /inference="similar to AA sequence:RefSeq:NP_010853.2"
                     /note="ancestral locus Anc_6.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141761.1"
                     /db_xref="GeneID:59328353"
                     /translation="MVASSRESNGAVEELNITVAVRCRGRNEREIKAKSSVVVSVPDV
                     TGSNEVSINTTGDVGIAAQINSKTYTVDEVFGPSANQSLIFHKIAEPLFADFIKGYNC
                     TVLVYGMTSTGKTYTMTGDEKLYDGELSESAGIIPRVLFKLFESLENEDYVVKCSFVE
                     LYNEELKDLLSDSQDFSSSARKLRIFDSSTLNGGTTSMSNNSSRKSSRNNSPRSSSEL
                     STATFMRKRWKNNMPTSNGSAGSSVSNGNSNKSQSLQGSQDQNAGIYIQNLQDFHITT
                     AKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYHGELFRVSKMNLVDLAG
                     SENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSLHVPFRESKLTRLLQDSLGG
                     NTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKSITAELAK
                     IKADLLSTKTREGIYMSQDNYKELTNDLDSYRTEVQEYKRAIETLTSQNTLLLKDKKA
                     SNEVNDLQRIKLQNMKDSISELHARIDRQNRREQNLVNMASTLRTTLNTMQTILSERE
                     KKEKDLKENINRLIASDFAQVREMIDKNFQEIQNNIKLESAGIQPNIDSIKEEIRMLL
                     ETAQEHTDEVYKDCVEKVSGELPALYEAASERITEVEAMVGKCYRDLSENLSDASEEY
                     NNFKQYLNDHFFKNNHEELLASHVDRTYHHIQASGEDLFQKFKEMMDNYLENNKHLML
                     NSLRTATCDVIEKEMQLFEPQKDKWESSFKYINNCDALNIALQKDIKSPLSDFRSTLQ
                     TSRNMIEQAMTKVKKRMSDHESPRSALSKNQTFNQEFSGLLNKENQLQEGLKKSLQFT
                     DAYGSALDQLQASISSAVGDDDHATDKSRPENIDGVLRRIDEQNVLYPDRSPLKSTSF
                     RVNKSERSSPNKSSPIKANSHSPCKPQLSLARSGYKRSYTDLDGTLDDSSTKVTRHH"
     gene            complement(<832657..>833445)
                     /locus_tag="HG536_0H04640"
                     /db_xref="GeneID:59328354"
     mRNA            complement(<832657..>833445)
                     /locus_tag="HG536_0H04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285866.1"
                     /db_xref="GeneID:59328354"
     CDS             complement(832657..833445)
                     /locus_tag="HG536_0H04640"
                     /inference="similar to AA sequence:RefSeq:NP_014646.1"
                     /note="ancestral locus Anc_6.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141762.1"
                     /db_xref="GeneID:59328354"
                     /translation="MRQKRAKAYRKQMLVYNHTFKFREPYQVLIDDQIVLDCHGSTFD
                     LVKGLKRTLQAEVKVMITQCCMQSLYETNNQGAIDLAKTFERRRCNHPPKEPKPPKEC
                     IESVVNVNGQNKHRYVVATQDIDIRRSLRRTPGVPLVYTSRSVMVMEPLSDASSKVSK
                     AVEEDKLFKGLNDPRNASLKAKEDASKDNQQETTRKRPRGPKQPNPLSVKKKKSIKPS
                     SADQSAETGSGDATKSSKRRRKHKSGTTRAQPSVERADDATSSS"
     gene            complement(<833913..>834503)
                     /locus_tag="HG536_0H04650"
                     /db_xref="GeneID:59328355"
     mRNA            complement(<833913..>834503)
                     /locus_tag="HG536_0H04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285867.1"
                     /db_xref="GeneID:59328355"
     CDS             complement(833913..834503)
                     /locus_tag="HG536_0H04650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141763.1"
                     /db_xref="GeneID:59328355"
                     /translation="MVFLTIHIPRALKTSTITVQYGNATTLHIAHSMSGQLTAPYPPS
                     IHDDISFQGPPSLRQGQQKPLGSLNDHSLNGIDGEYIEVIRSRPIPDGSRRYLQMNPV
                     PNFSSNFNATKTAGRKTPSNSSHLPDPRDPTSVWMDVMLRSSLQRIKGPVEGTGSSAL
                     VRHKQTIIAVCILAVTWQLAILMDYLAQLVRYYCQT"
     gene            complement(<834598..>836271)
                     /locus_tag="HG536_0H04660"
                     /db_xref="GeneID:59328356"
     mRNA            complement(<834598..>836271)
                     /locus_tag="HG536_0H04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285868.1"
                     /db_xref="GeneID:59328356"
     CDS             complement(834598..836271)
                     /locus_tag="HG536_0H04660"
                     /inference="similar to AA sequence:RefSeq:NP_010854.1"
                     /note="ancestral locus Anc_6.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141764.1"
                     /db_xref="GeneID:59328356"
                     /translation="MRFEKSVVPIAVFASLGSSLVIPELSGGSKMPCRSKEKHTTQEL
                     PAEKDVSTQDRFGNGDKHKKLGQKADTLQFQEAPFPLAPMVMSGTASDKILPHRYIVV
                     LKKGASREEIDFHKELISEVQLQSARQLDDKDPFFASTADAENCAVATGGIQDSFDIA
                     GLLNGYVGYFTDAVVDLIRLSPLVEFVERDSMVHASEFDTQNGAPWGLSRISHRDRLN
                     LGSFNKYLYDDEGGKGVTSYVIDTGINVDHKDFGGRAKWGKTVPLNDEDVDGNGHGTH
                     CAGTIASKHYGVAKAANVVAIKVLRSNGSGSMSDVIKGVEFAAQSHQKNVKEKKKGFK
                     GSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGAS
                     TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLS
                     LQPDSDSDFFSAAGGVTPELLKKKLIAYSTNDILYDLPEGTPNALVYNGGGHDLKRFW
                     GGKDKGVASAQPNDRFQDFDLQDMVDNLGSKTDALFDQVRNVLDKLNII"
     gene            complement(<836637..>838118)
                     /locus_tag="HG536_0H04670"
                     /db_xref="GeneID:59328357"
     mRNA            complement(<836637..>838118)
                     /locus_tag="HG536_0H04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285869.1"
                     /db_xref="GeneID:59328357"
     CDS             complement(836637..838118)
                     /locus_tag="HG536_0H04670"
                     /inference="similar to AA sequence:RefSeq:NP_015061.1"
                     /note="ancestral locus Anc_6.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141765.1"
                     /db_xref="GeneID:59328357"
                     /translation="MLRSSLLKTSPRASSFSSRMSFSSRSMVSQEFRVETDAFGEIRV
                     PADKYWGAQTQRSLENFKIGGARERMPEPIIRAFGVLKKSAAVVNESLGTLDPAIAGP
                     IKQAADEVAQGKLTSHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEMGSKQIHPN
                     NHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELGALRDALDAKAQEFKDIVKIGRTHL
                     QDATPLTLGQEFSGYVQQLTNGIDRVEKSLHHLKFLAQGGTAVGTGLNTKVGFAEMIA
                     EQVSKETGIEFQTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCG
                     YGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGASGQFELNVFKP
                     VMISNLLSSVRLLADASYSFRVHCVEGIQANRDKISKLLHESLMLVTALNPKIGYDAA
                     SKVAKNAHKKGITLKESALELGVLSEAEFDEWVVPENMIGPKP"
     gene            complement(<838368..>838610)
                     /locus_tag="HG536_0H04680"
                     /db_xref="GeneID:59328358"
     mRNA            complement(<838368..>838610)
                     /locus_tag="HG536_0H04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285870.1"
                     /db_xref="GeneID:59328358"
     CDS             complement(838368..838610)
                     /locus_tag="HG536_0H04680"
                     /inference="similar to AA sequence:RefSeq:NP_058154.3"
                     /note="ancestral locus Anc_6.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141766.1"
                     /db_xref="GeneID:59328358"
                     /translation="MAPPTPVLTREQLERQISFPSADGCQLKSLTQFQCQIFPPGSGE
                     YLCIPFKRLFEECVVAAGASKNTPSRFEVTSPLTNS"
     gene            <838731..>840341
                     /locus_tag="HG536_0H04690"
                     /db_xref="GeneID:59328359"
     mRNA            <838731..>840341
                     /locus_tag="HG536_0H04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285871.1"
                     /db_xref="GeneID:59328359"
     CDS             838731..840341
                     /locus_tag="HG536_0H04690"
                     /inference="similar to AA sequence:RefSeq:NP_010856.1"
                     /note="ancestral locus Anc_6.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141767.1"
                     /db_xref="GeneID:59328359"
                     /translation="MVDGQLVAELVEKYCTTRGYRYSYGTAGFRDDASRLDTVMFATG
                     IIACLRSIALDGRPVGVMITASHNPASDNGVKIVEPDGSMLVQSWESTATDLANLLSS
                     GSAEAIRQKIGQLASSGSGVRPRLVVGRDSRVSGPRLLQCLLGSASSLFQAQIRDYGL
                     LTTPQLHYPTSRSLSMDRSVEEEDYFVDFSSAWNEITRLHDVEGLPCAGLVVDCANGV
                     GGLKIHSFIPRCRVLSGTTTVINDNCSDAESLNRGCGADFVKTNQRLPTGIKETDGDS
                     RLYCSFDGDADRVVFYYLNEDSKFQLLDGDRISALLAYFIAQLLEQSGLRSVLSMGVV
                     QTAYANGSSTKYLQNQLNVPVTCAKTGVKHLHHEAVSNYDVGIYFEANGHGTVIFSDR
                     FHDTVGSQTQDSLATKTLRLLPQLINQTVGDAISDMLAVLAVLSILKWSPSRWGKEFT
                     DLPNLLNKVIVPDRSKFIATDQERRLTSPAGLQEKIDEAVSRFRSARSFVRASGTEDA
                     VRVYAEAATQEEANELSAVVSRLVLESC"
     gene            <840525..>842429
                     /locus_tag="HG536_0H04700"
                     /db_xref="GeneID:59328360"
     mRNA            <840525..>842429
                     /locus_tag="HG536_0H04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285872.1"
                     /db_xref="GeneID:59328360"
     CDS             840525..842429
                     /locus_tag="HG536_0H04700"
                     /inference="similar to AA sequence:RefSeq:NP_015060.1"
                     /note="ancestral locus Anc_6.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141768.1"
                     /db_xref="GeneID:59328360"
                     /translation="MAKKSKKDKEAKKARAEAKLKKSEGKAAEKEKKKSKKIFGADEE
                     DDLDIEEVLANFKKEQEKFEKVVVESINKPSKRINSCMISNPNHGKSELIIFGGENTN
                     QATSTTTFYNDLIVFSPDNGQWKKITSQNAPMPRSSAAMAGHPSGIALLHGGEFSSPK
                     QNTFYHYSDTWLLDCSTKEWSKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTT
                     YLNDCWLFDITTHKWKQVEFPPNHPVPDARSGHSLISDQDGAILWGGYCKVKAGKGLQ
                     KGKILTDCWHLKMNSNVNAIRWDRKKKQGFQPSPRVGCSMVPHKGRGILFGGVYDYEE
                     TEESLDSNFYNDIFTYQINTNRWYSLALRPQRTKQVKLNNKSTRDQEKELEELLNKIL
                     ENAQLGDGDEDGENSEESSTLVGSRDDSEDEIKSAAKDYKISSELPHPRFNAATTVID
                     DTLFIFGGLWECGEKDYSIDSFYSIDLNRADGVTIYWEDLTALQNAQDNSDDESDMED
                     GDDTDDDNSDEEGTDRKLVAEEEEEEEEVEEEEMEYPDPRPWLPHPKAFESLRSFYVR
                     TGPAFLEWAISNNRDAKGKHLKTKAFEICESRWWERRDQVRIEEDKLEELGGVGEIVE
                     KDTTKTSKRR"
     gene            <842602..>843789
                     /locus_tag="HG536_0H04710"
                     /db_xref="GeneID:59328361"
     mRNA            <842602..>843789
                     /locus_tag="HG536_0H04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285873.1"
                     /db_xref="GeneID:59328361"
     CDS             842602..843789
                     /locus_tag="HG536_0H04710"
                     /inference="similar to AA sequence:RefSeq:NP_010858.3"
                     /note="ancestral locus Anc_6.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141769.1"
                     /db_xref="GeneID:59328361"
                     /translation="MTSVTGEEAEKPLSVDDEYELWKSNVPLMYDFVSETNLTWPTLT
                     LEWLPSSSASERQELILGTHTSGEEPNYLKIAAIDLPDEIIPGKVEADTNGTTKSNIR
                     ITKKFKHDEEVIRARYMPQDSNIIATINGKGVVFIYDRSRETADGFLSALKYHQENGY
                     GLSFNPRDKGKLLSGSDDSNIALWDVTSKNINPIATWENCHQDIVNDCKWHELDGNTF
                     GSVSEDLTLQLHDQRVKDAAGTKIVTPVAFNTIAFSKHSTNLFAAAGTNSLIYLYDAR
                     RPSEALHSMSGHDGNVTNLEFYAEKDGIVTSSGEDRRVLLWDLTEIGAEQTPDDAEDG
                     APEVLMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKLPKIGGAPAIDDS
                     LLE"
     gene            complement(<843887..>845398)
                     /locus_tag="HG536_0H04720"
                     /db_xref="GeneID:59328362"
     mRNA            complement(<843887..>845398)
                     /locus_tag="HG536_0H04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285874.1"
                     /db_xref="GeneID:59328362"
     CDS             complement(843887..845398)
                     /locus_tag="HG536_0H04720"
                     /inference="similar to AA sequence:RefSeq:NP_015051.1"
                     /note="ancestral locus Anc_6.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141770.1"
                     /db_xref="GeneID:59328362"
                     /translation="MSFRSLSSVEKKVLSQSLEGHRNGIVFGAMYSTTPEEWSDDATL
                     LTYKDSRLNVSLLSRALAKLISEHVELYTTITEGLEFAPVKEIKADDVINTITFDSYK
                     DELVNCRFGAPPYLLRHIFNQTIFQPGSGNVLWELFVVDETLVIFHGHDVLFDVFSAA
                     NFHKLFLDTLNSIPKKGKELSTIFKLDRAVLPHFPKSIYDSAKLRLPAKAADLFNLQT
                     QSFFKALYVNALKKPFNYLNSNPPQQLKEFRARYADILRTDNNLCGTTIFGNIPPERL
                     ERLNCLFKQQDICLRSFVCAITMLCLKPIVRNFTGTITFCVPADLRSSLEDSSEFGMF
                     YKDIRVECPLSLIDDQNFSGLTVYNGYDSSSIKLSEKDPKYREQLLEYQFKKVTDHVV
                     TILRQRMKAWEKFGFNDDDIKRMRFSYEEKNNNTKLIQINDLSNIKIGTDNVPDGKFG
                     VRELNVTQSLRPGQLMSLSYTHSEKGLNICIHYPDSYNMEAFMECFQSFIEDV"
     gene            complement(<845901..>848972)
                     /locus_tag="HG536_0H04730"
                     /db_xref="GeneID:59328363"
     mRNA            complement(<845901..>848972)
                     /locus_tag="HG536_0H04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285875.1"
                     /db_xref="GeneID:59328363"
     CDS             complement(845901..848972)
                     /locus_tag="HG536_0H04730"
                     /inference="similar to AA sequence:RefSeq:NP_010859.1"
                     /note="ancestral locus Anc_6.7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141771.1"
                     /db_xref="GeneID:59328363"
                     /translation="MVSARVNRDWFYKLASDLQDERVEAAVGLIGELSALTLPDDADE
                     WSYVLKRLINGLASSRNSARLGFSLCLAEVVNVALNMEGDVPAELGSMNNLLDLLSDT
                     LSLNSKSADSKKPAKGKDERGLLFGKMFGLQALLSEVVFAKIFISEDGEISAFAFRFM
                     DELCQLAVVRTWLREPCLFTLFQAIQKLLPYVDIHVAQSILKLLDQYQLTLTNEGIAI
                     YVLLNHNRSVDLSSALAQVTLSSKSWKANDPLARGNLPLLSKVLCNSGAADGEDSVKA
                     ANWAPRLHFVWDVLLPVVTQEPSSSNGSGKQKNKKRKKEKSHIIQFPEFWQAAVDETI
                     FNEKASNERKFLGFVIFEKTLPLVPSNWVSCCFSQNFLRTLINHSSDSRRFLFKISHK
                     ILNSIVDICQKDPSHKLVPCFTALLFGPNGSINFDKLTKTKTVSKLLALDQLDEATLC
                     EIFESLSNYSVKSSSSAEKTQLQFALDTLLYVVRGHRAQLTHDMVVELLLRPIVSLAF
                     FFEGDETINTLANERLQSILSEAMQSTTQNHSYQYYALQMIREAESSGKQLATKMDES
                     LNEVKENAFKVLSSVSTDLENAQLRGIEMLLSMSLLQLYSGESDAVQVAEELCSFYKN
                     RDENDSSLVGMTEILLSLLAQRKALLKKSSLYVWQQFIEDIGEEELKVLLDVLSAREN
                     KKGFSQLFEGAGEYEAMDEGSSEEKELDDEKSEEEDEEDEQDESSIEDDDESSASVDD
                     EQEEGAEQSDIAKIDREAASALAKALNLPENIVNEKGEVKFDQLGDDDEHEFDAEEDG
                     DEDEESMDDEKMMELDGQLSEIFKRRKQALSSISTGNQRKIEAQESRESVIAFKQRII
                     DMLEIYVRHVEKSALKESNLEAEKSAYPPCLLLIQPMIRCIQQTTDKALANRIAKLLK
                     SKLFKIKTSFFSRISHQNTLFEMLKSVHDALLQSKPGLHQETYYSVGSSASLFLSKII
                     MESSDGNSDDNLGQIIDLYAETMKKWASSGKFGPSLFMDLPNWLFTRKQTC"
     gene            <849428..>849781
                     /locus_tag="HG536_0H04740"
                     /db_xref="GeneID:59328364"
     mRNA            <849428..>849781
                     /locus_tag="HG536_0H04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285876.1"
                     /db_xref="GeneID:59328364"
     CDS             849428..849781
                     /locus_tag="HG536_0H04740"
                     /inference="similar to AA sequence:RefSeq:NP_015052.1"
                     /note="ancestral locus Anc_6.6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141772.1"
                     /db_xref="GeneID:59328364"
                     /translation="MRCSKLGELPKQLLEPLHSQLGRLASEEIYCYSSLVLCFHIQLF
                     QFAQNTITAIRMSSWRKAGLTYNTYLSVAAKTVRAALKPELQTSKVLARSKTEARYVK
                     YEKGSPTSDPVPLQE"
     gene            <849983..>852268
                     /locus_tag="HG536_0H04750"
                     /db_xref="GeneID:59328365"
     mRNA            <849983..>852268
                     /locus_tag="HG536_0H04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285877.1"
                     /db_xref="GeneID:59328365"
     CDS             849983..852268
                     /locus_tag="HG536_0H04750"
                     /inference="similar to AA sequence:RefSeq:NP_015053.2"
                     /note="ancestral locus Anc_6.5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141773.1"
                     /db_xref="GeneID:59328365"
                     /translation="MLALGGGSLVMRRSAISAVRMVMFGRGNLTGRPLQMIKSSLLGA
                     DSVSKRLCHQLVRPRLLSNERVTLAVFVRSMQPGTPALHRSYSATAKLQQAKRKKVKD
                     GEEKSGLGDVARLLMLARPDWKLLVVAITLLAISCAIGMSIPKVIGLILDVLKTGLEN
                     NEGQEGPIPMANVPPIFMGLSIYEFLAGFAGLMVLGIAANYGRIVLLRILSERVVARL
                     RANVIKKTIHQDAEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVG
                     MMVSISPELSGLLLLFTPPVLFSSSIFGRKIRHISTELQEATGQLTRVSEEQLSGVRT
                     VQSFVAEQKEIHRYNFAIRDIFNVGKKAAFINAQFFTATSSLGDISFLVVLAYGSYLV
                     LQGSLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSISPTS
                     GKKFVPGKGEIVFKDVSFSYPTRPGNIIFNDLNLHIPAGSNVCVVGPSGRGKSTIALL
                     LLRFYNPTSGQIFIDGQDISKLNSKSLRREIGIVQQEPVLMSGTIRDNITYGLTETPT
                     KEEIRTVAKQCFCHNFITKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKQPSILVL
                     DEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSEKIIVLGNDGSVVET
                     GDFKDLFANPSSELSKLLNEKSSRTEVSSANYQPPADEKQLEDEIIAHSSELGSEGHD
                     DSVEEILKDVSSDGKPIKLPQ"
     gene            <852579..>854294
                     /locus_tag="HG536_0H04760"
                     /db_xref="GeneID:59328366"
     mRNA            <852579..>854294
                     /locus_tag="HG536_0H04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285878.1"
                     /db_xref="GeneID:59328366"
     CDS             852579..854294
                     /locus_tag="HG536_0H04760"
                     /inference="similar to AA sequence:RefSeq:NP_015054.1"
                     /note="ancestral locus Anc_6.4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141774.1"
                     /db_xref="GeneID:59328366"
                     /translation="MIEHDESRNFLLKITGHVAGIQDILKSIEESSDWNDSFSDLILD
                     LWNQLRGLKGHLASIFTLDVPLDRISDQLLRLQNNKGDFASIVGTVSRIEPSLSHLLD
                     ILESERSKCKESQDFGSVLNLIENCMQIASEADVWLGSSKSVLDASLEYNEILKDHIE
                     TLENVIETNIELCFELQEERFSSPVRHTPSFTLKQLIRLLSSNSEGSGVKLPTFSAVE
                     EALCKKFLALKHSIPPIERSLTEILPERIQDFGRRNVPNIAHITLLLEDKKKGLLSKY
                     RFMVDEIRELQTELIDKRWSVLFRNLNHELASILNEIEVLQSKISQHDHSSVINGRLR
                     EQLEKKTKTVMKTFNVAYKALEFSLLEPQVASETNALAQRWLDIRPQSDKILTKVTRE
                     QDDVQSLSDRLQDLSLRSNIPPAQSNPSQRSNFGAFLLKKMNIRPVIVKGTPASAAKA
                     NPVYQHSPLKEKSGPMDGLILKTAPLLPYSRQRSSSEDLFDTLEGSSGLTSDSLESLE
                     FEKISYYSRQQSRIPILPATTLPITAIRSQSVKSSQQWTPCPLRRRSLKQPTPRALLL
                     SAGMM"
     gene            <854512..>857067
                     /locus_tag="HG536_0H04770"
                     /db_xref="GeneID:59328367"
     mRNA            <854512..>857067
                     /locus_tag="HG536_0H04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285879.1"
                     /db_xref="GeneID:59328367"
     CDS             854512..857067
                     /locus_tag="HG536_0H04770"
                     /inference="similar to AA sequence:RefSeq:NP_015055.1"
                     /note="ancestral locus Anc_6.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141775.1"
                     /db_xref="GeneID:59328367"
                     /translation="MVLVGNSSRVSLGELGKGNHEETDSKRNLQLGTFRLSNSSGTIV
                     TRNIKAIFKRSGFINSPRESSITDHAGPMTYAHSYNDAVSYFISMNAEPSLKDSLASM
                     RNGLCLRRINRRKQVMYIFKLENDEAITWRDGAKRLELDSIKDIRTGNMASNYREEYG
                     VSSKVSDFWVTIIYTVCNKLKALHVVAENEHDFSLFFNCVCGLVKSRRELMESISVPD
                     NEKFANFHWHRTVSDRKEDETKDTLTFEDVKRLCNKFHIYCSSNHLLKFFVIADVNHN
                     GLLNFQEFQTFVKLLKERPEVRKIWNTVTKGTKGMDFEMFYRFLSDVQRENISREKAY
                     QIFAQFRKPKHSLLYEEDFVKFLGGQPYVRGIEEDYTKPLNHYFIASSHNTYLLGKQV
                     GETPSVEGYVHVLQQGCRCIEIDIWDDDMGPVVCHGFLTAAIPLINVVEIIKKYAFIT
                     SPFPLIISLEINCNKENQIIANSIFQNCFGSLLYYPSEPMAALPSPMELRHKIILKGK
                     KTIITLPPGNGGSLSNTESTSSYSSSHDSETESTTKGKENQSSSSIQRMKRIKKKNVV
                     VTRELLATCGLHGLKFRNFSLPDSKTPAHCFSFDEKAFDSMQKDKTLELSIDKHNRRF
                     LMRVYPHALRYKSSNFNPIKFWKLGVQMVAANWQTNDLGQQINLAMFQLYNRKHGVLR
                     SGYVLKPARLLPTVSKVLSIPQIYKQMQTDPIKLELKILSAQLLPKPTEIKNSKEGSF
                     APYVTVELISDEELSSPLTVKSGTKYSATVACTENCKENGFNPVWDMTVHATFKSLDF
                     AFVKFTVKTGELQLATSCFRLQLLRSGYRSIPLYNSEGELYIFSTLFIYTRLD"
     gene            <857312..>857956
                     /locus_tag="HG536_0H04780"
                     /db_xref="GeneID:59328368"
     mRNA            <857312..>857956
                     /locus_tag="HG536_0H04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285880.1"
                     /db_xref="GeneID:59328368"
     CDS             857312..857956
                     /locus_tag="HG536_0H04780"
                     /inference="similar to AA sequence:RefSeq:NP_015056.1"
                     /note="ancestral locus Anc_6.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141776.1"
                     /db_xref="GeneID:59328368"
                     /translation="MASPIKKRTALAGKSTNVRQTPGSIYKNNGTSSHTSPSKRSQVN
                     VSYALTNSPVRSLSFSPRKNHNSAIFTFHEETPSERAATLMMHMSLNKRALSNPDEND
                     ASAVKENMSPSKASRLGELPQRSPKRKRLQDLSITEYMGFVEQPHSGQIAPLTLHYKH
                     KTVLPSFVTPPRDQRLREFFATSSSDAPTPASRTTDDIPKNKVVRKLNFKICEN"
     gene            <858238..>859197
                     /locus_tag="HG536_0H04790"
                     /db_xref="GeneID:59328369"
     mRNA            <858238..>859197
                     /locus_tag="HG536_0H04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285881.1"
                     /db_xref="GeneID:59328369"
     CDS             858238..859197
                     /locus_tag="HG536_0H04790"
                     /inference="similar to AA sequence:RefSeq:NP_015057.1"
                     /note="ancestral locus Anc_6.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141777.1"
                     /db_xref="GeneID:59328369"
                     /translation="MGKAAKKKYSGAPASSKQVDAEKHLSSVFKFNTDLGQHILKNPL
                     IAQGIVDKAQIRPSDTVLEVGPGTGNLTVRILEQAKNVVAVEMDPRMAAELTKRVRGT
                     AAEKKLEILLGDFMKTELPYFDICISNTPYQISSPLVFKLINQPRPPRVSILMFQREF
                     ALRLIARPGDSLYCRLSANVQMWANVTHIMKVGKNNFRPPPQVESSVVRLEIKNPRPQ
                     VDYNEWDGLLRIVFVRKNRTISAGFKSSTILEILEKNYKTYLAMNNEMVDDSKGSMLE
                     VVKQKIETVLRETGLGEKRAGKCDQNDFLKLLYAFHQAGIHFS"
     gene            complement(<860347..>862074)
                     /locus_tag="HG536_0H04800"
                     /db_xref="GeneID:59328370"
     mRNA            complement(<860347..>862074)
                     /locus_tag="HG536_0H04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285882.1"
                     /db_xref="GeneID:59328370"
     CDS             complement(860347..862074)
                     /locus_tag="HG536_0H04800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141778.1"
                     /db_xref="GeneID:59328370"
                     /translation="MFATADTNKDRLFHNPSLPEETARDALDDAELEQVFSEDREVEY
                     REDSEEMPPITWYSIRRYAVTRFTSLAHVHSVSWHNLNPIPELRKMSLQNWNYFFMGY
                     LAWLCAAWAFFCVSVSAGSLSQLYGKSTHDITWGLSLVLFVRSAGAVIFGFWTDRYSR
                     KWPFIACLLIFAVAQLCTPFCDTYNKFLGVRWLTGISMGGIYACASATAIEDAPVKAR
                     SFLSGLFFSAYAMGFIFAIIFNRAFIHVNGADSWKIQFWFSTFLPVLLSAWRLLWPET
                     RYFSKVLKARTLMQRDAIEANGGRPLPKISAGERFQKVKATVRKYWIHFVYLVILLVG
                     PNYLTHSSQDLLPTMLRSQLGLSEDAVTVIVVVTNIGAICGGMIFGQLMEITGRRLSL
                     LIACTMGGCFIYPAFMLRTKEAILGAGFMAYFCVFAVWGVLPIHMAELAPADARALVS
                     GLAYQLGNLASAASATIETQLADRFPYEKNAQGETTKHDYAKVMAILTGAVFIFTFVC
                     VFVGHEKFHRDLSSPVMKKYISEVETLEADGVSINEYVDKEMKLESTAMNLCDSSVSK
                     TSEEQIERV"
     gene            complement(<862117..>862572)
                     /locus_tag="HG536_0H04810"
                     /db_xref="GeneID:59328371"
     mRNA            complement(<862117..>862572)
                     /locus_tag="HG536_0H04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285883.1"
                     /db_xref="GeneID:59328371"
     CDS             complement(862117..862572)
                     /locus_tag="HG536_0H04810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141779.1"
                     /db_xref="GeneID:59328371"
                     /translation="MQYCLSGPIFPQISKQPRRPVPELQFRRMMDSVKSSTPEITRLC
                     RISLTHAPTHAPPPRGLRNCPALPGPAPTAGSPVSILQHFGAVHHLCQLDLQGLGTVA
                     AGASSRNTGGALLRAKVKFPAYCQCDDQLNELGVDLQSLIGCIKQVTSV"
     gene            <863007..>864824
                     /locus_tag="HG536_0H04820"
                     /db_xref="GeneID:59328372"
     mRNA            <863007..>864824
                     /locus_tag="HG536_0H04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285884.1"
                     /db_xref="GeneID:59328372"
     CDS             863007..864824
                     /locus_tag="HG536_0H04820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141780.1"
                     /db_xref="GeneID:59328372"
                     /translation="MNSSKKKYESSVNLAGCLRMIEQVYTADSSTEGVYYDRDHRAKD
                     EKKVNRVEIDVDWENAKTESQPYYDGDGKEEGTRLKKDLKARHISMIAIGGSLGTGLL
                     IGTGTALATAGPVSCLIAYSFIGVLVFFTMACLGEMATFIPLDGFTSYASRYCDPALG
                     FAVGYSYLCKYLIITPNQLTAASMVIQYWIPRDQVNPGVWITIFLLVIVLINTVGVKF
                     FGEFEFWLSSFKVVVMLGVILFLFIIMLGGGPNHDRLGFRYWKDPGPFKPYSSAISGS
                     KGKFVAFVSVFVYALFAYLGIELTGIVAAEAQNPRRNIPRAVKLTMYRIIVFYILSIF
                     LLGMCVAYNDPRLIAAKSKKTSAAASPFLVAVVNSGVHVLPHIFNVCVLIFVFSACNS
                     DLYVASRSLYSLAIDGKAPKILARTNRWGIPYYALSVAVLFCLLAYMTVSSGSAQIFN
                     YFVNVVSIFGVLSWISILITYIFFDRALRVQGIDKSTLAYAAPWQPYGAYVTLAFCVL
                     LALIKNFTVFLGDTFDYKNFITGYIGIPVYVFCFFGYKYVKKTKFVKPHEADLYTYKA
                     SVDLEEEEWKIFEAEKRERLKNGRKNFEWFYEKFLGKIF"
     gene            complement(<864975..>866738)
                     /locus_tag="HG536_0H04830"
                     /db_xref="GeneID:59328373"
     mRNA            complement(<864975..>866738)
                     /locus_tag="HG536_0H04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285885.1"
                     /db_xref="GeneID:59328373"
     CDS             complement(864975..866738)
                     /locus_tag="HG536_0H04830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141781.1"
                     /db_xref="GeneID:59328373"
                     /translation="MSGSGLSSQMKAETWSESSYPFNEPPLDDKDAGVHNIEVYAAQY
                     EHFGYKVLLFFSIFLIAYAYGLDGNIRYTFQTLATNSYSQHSLLATVNCVIAVIAAPG
                     QICFARAADIFGRATILFIAVVFYCMGTIIESQATTVPRFAAGACFYRLGMTGIVLIL
                     ETIAMDFSHLNWRLLASFVPALPFIINTWISGNVTSAVGSNWKWGIGMWAFILPLSCI
                     PLACCMLHMRYLAQKNAKQQLKGEFKMLKTMSWAEYIIEIFFWRLDLPGLILICVTFG
                     CILIPFTLAGGLQDKWKTAGIIAPEVIGWVIALPLYMIWESLYARHPLTPFKLVKDRG
                     IFSALIIAFHINFIWYMQGDYMFTVLLVAVNESVKSATRITNLYSFVSVITGTMLGFV
                     LIKVRRTKPFILFGIGCWFVSFGLLVYYRGDVGSHSGIIGSLCLLGFGAGFFTYTTQA
                     SIQASTKLHQDMAVITSLYLATYNVGSAVGSAVSGAIWTNLLPEQVEKRLANSTLSAQ
                     AYSAPLVFIETYTWKTPERQGVVAAYRYVQKILCIVGLCFCAPLLLSAFFLRNHKLEN
                     VVALADLDEKKSLEDDKTADF"
     gene            <867447..>868379
                     /locus_tag="HG536_0H04840"
                     /db_xref="GeneID:59328374"
     mRNA            <867447..>868379
                     /locus_tag="HG536_0H04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285886.1"
                     /db_xref="GeneID:59328374"
     CDS             867447..868379
                     /locus_tag="HG536_0H04840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141782.1"
                     /db_xref="GeneID:59328374"
                     /translation="MVSLRKLFPIEKEFELDNTVDENIPWPFEVNRKRNMPIAKFLGT
                     DGYFLFPSENSYDVYKQNNNEIGRLDAEGVGIPLLHISLEFPTLGNAVGNSPSLMVWK
                     YILLHAGEAPPPIDHKVVRCGSKWTLYKVPFCEIYRKWSFNYREYRFTFPYDRFPMTN
                     LTLKRTVANRDLYTYMGEVSLRWHVPMPFLVDTDHYTLQILDDSVPNLLDDSVTTNRK
                     KRLKTDRKFIEIARYTREDRDMMPHRTSKRANLYIGEWSSTTAYGIAEVPWTTQVLAC
                     HGLLIHYIEHQRREGGGQRRGRSTQLPPQVSLFR"
     gene            complement(<868527..>870227)
                     /locus_tag="HG536_0H04850"
                     /db_xref="GeneID:59328375"
     mRNA            complement(<868527..>870227)
                     /locus_tag="HG536_0H04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285887.1"
                     /db_xref="GeneID:59328375"
     CDS             complement(868527..870227)
                     /locus_tag="HG536_0H04850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141783.1"
                     /db_xref="GeneID:59328375"
                     /translation="MISSVLLGLLGAAGVVSARNGTNRTNLYEGRPLAHLTPPEGWMN
                     DPNGLWYDAKEDLYHAYFQYNPNGTVWDLPLYWGHSVSSDLTNWLYQGIAIEPERDDS
                     GAYSGSAVIDTNNTSGLFNDSVDPRQRVVAIWTYNTPDKESQYLSYSVDGGYSFIPYE
                     NNPVLDINSTQFRDPKVIWHEESKKWIMTVAHSQKYEILIYSSPNLKDWKLESSFGDQ
                     GYLGYQYECPGLARVPLVQSGNGLTLSNLTYPNTTFYNSSYFNSTSNGKAKEAWVLFI
                     SINPGAPQGGSATQYFIGDFNGTHFVPFTHQTRFIDMGKDYYALQTFFNSKHEGDVLS
                     IAWASNWQYGSLVPTEKWRSSMSLVRNLTLKEWAPNPESVQLNLNSEPILDMKPLNAK
                     NASTEVTDFLLTTNNSLSANFAPRINTGIYDFEIVWSVNENAFNNSRLNEWILYIDSQ
                     DYYSEYLALGYDTTAGAFYLDRGNSYNDFVTLNPFFNNRQSVFLEPYSTSSNGTNTYK
                     VYGVIDQNIIELYFNDGSVVSTNLFFFSDQNQIRGFETWTNVNGGFKFDSFKFHVLDF
                     "
     gene            <871425..>872345
                     /locus_tag="HG536_0H04860"
                     /db_xref="GeneID:59328376"
     mRNA            <871425..>872345
                     /locus_tag="HG536_0H04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285888.1"
                     /db_xref="GeneID:59328376"
     CDS             871425..872345
                     /locus_tag="HG536_0H04860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141784.1"
                     /db_xref="GeneID:59328376"
                     /translation="MSEDLTTPQVVDDIVDRKAPSFKRTAKDITAGTVSGIAQVLVGQ
                     PFDITKVRLQTANGNSSAFQVVKSLIKNEGPLAFYKGTLAPLVGIGACVSCQFGCNEA
                     MKRYFHLRNGGGENRTLTLPQYYMCGAVSGSANAFLATPIEHVRIRMQLQTKDLSASE
                     YTSSFDCFKKLLKKGVLMRGFTPTLMRTSHGFGMYFLTYEALINTQLHRGIQREDVAT
                     WKVCLFGAISGALFWAMTYPIDVVKSVMQADKLHLPAHGNNVFEVARTIYRTRGPSAF
                     LKGFAPTMLRSLPVNGATFATFELAMRVLA"
     gene            <872716..>874005
                     /locus_tag="HG536_0H04870"
                     /db_xref="GeneID:59328377"
     mRNA            <872716..>874005
                     /locus_tag="HG536_0H04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285889.1"
                     /db_xref="GeneID:59328377"
     CDS             872716..874005
                     /locus_tag="HG536_0H04870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141785.1"
                     /db_xref="GeneID:59328377"
                     /translation="MVTMTATVRVMTSRVMNGLIYKRAAVNGKVLTSPLFQSTIASNF
                     RRMSSSVTGFYIPPTSYFGEGALEESVAHLKKQGFGRVLIVTDPGIAKIGVSDKVANL
                     LKNAGLQVSVYDKTQPNPNVQNVEDGLKILKENNAEAVVSLGGGSAHDNAKAIALLAT
                     NGGQIGDYEGVNKSKKASLPLFAINTTAGTASEMTRFTIISNEAKKVKMAIIDNNVTP
                     VVAINDPTLMYGLPPALTAATGMDALTHCIEAYVSTGANPITDACAIKGIDLIHKSLL
                     EAFNKGSDKEARTDMCYAEYLAGMAFNNASLGYVHAIAHQLGGFYHLPHGVCNAVLLP
                     HVQSFNKRVPAIEKRLGEIAAHLGESTATADSAIEAVHKLNRSLNIPRNLKDLGVKVE
                     DFDILAENAMKDACGLTNPVQFTKDEVKQILQQSYDY"
     gene            <874283..>875518
                     /locus_tag="HG536_0H04880"
                     /db_xref="GeneID:59328378"
     mRNA            <874283..>875518
                     /locus_tag="HG536_0H04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285890.1"
                     /db_xref="GeneID:59328378"
     CDS             874283..875518
                     /locus_tag="HG536_0H04880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141786.1"
                     /db_xref="GeneID:59328378"
                     /translation="MLNPRTANYARPLRLLMSFFTVHKKVGILLAVGLVWALTFILYP
                     GRKDPAEGRLEQLISTNAKMETATFDVARKIAYVSRHIGTTVDFQYMAKHLQLENVDY
                     YDASEYYGFQASAKEYRSIVDDGTVQKICSTHDLVFVSDSLADGWPFIMDGNQNCKNV
                     VFVITNRFDIGAVGDDKEAFIRDFNYSLNRDDEYRAKIIVNNLFEVPYLESRGVHVPE
                     YHPLIRPFGYNSVDAKELEEDDDDFSCLIISRVTQDEYLMSELVAKHTSHHCKVLPTH
                     YGGPKTLSKYQSVVVHLPYQVSVMKMWENLAYGVLMIIPSPDFFTQICSENRCAEVRD
                     AMQPKEVFGEATWSNYLDFYLPDWEKCFIQYSSWEQLDDILTRKDYLKDINHCRNKME
                     DLRELGLQSWKEFLVKLQN"
     gene            <876349..>878142
                     /locus_tag="HG536_0H04890"
                     /db_xref="GeneID:59328379"
     mRNA            <876349..>878142
                     /locus_tag="HG536_0H04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285891.1"
                     /db_xref="GeneID:59328379"
     CDS             876349..878142
                     /locus_tag="HG536_0H04890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141787.1"
                     /db_xref="GeneID:59328379"
                     /translation="MERPINSRRSTVYSIKGIVSSTQPLANAAGIKILSLGGNCVDAC
                     VAVSACLCVLEPSSTGIGGDCFSLFYKNDEKKVYGLNGSGRSASSLSLDWLRVNYPNH
                     ILPSLRFNRDSVFKVQVPGAIAAWCDLIDTWGSGKVTLEDVLAPAIELADSGFVVSEI
                     SACLWKDAERKLKRVNDAAQLAVFLPNDGLKAPVKGQFMQNKALAQTLRIIAKNGKKG
                     FYEGEIAKSIVSELSKRGSLISEKDLASHTSTFVEPISYCFLGCKLWEIPPNGSGIVA
                     LLTLGLIKELDETGVIDLKSMQHNSAEYLHILAECLKLSFKDSDEYVNDFEYFIKSHD
                     LDQNITLKSLLSQSYLRERIALFNKDKIITNRHVKHGVPNPIFKSDTVYLTASDEEGN
                     ACSFINSLYENFGSGIVVPDKGFVLQNRGGNFNLNPQSKNCLAGNKRSYHTIIPGMIT
                     VPDQQRAGFENLYASFGVMGGFNQPQAHVQVYLNLLLFNMDPQEALDAPRICLFPHPD
                     LEATDTGLGSDGPASRDVTCIGLEDGISGEAAVRLTELGHDVRFFRNNDRKLFGRGQI
                     IRKESGPETSGHLVYSGGSDLRGDGASVPLI"
     gene            <880416..>883331
                     /locus_tag="HG536_0H04900"
                     /db_xref="GeneID:59328380"
     mRNA            <880416..>883331
                     /locus_tag="HG536_0H04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285892.1"
                     /db_xref="GeneID:59328380"
     CDS             880416..883331
                     /locus_tag="HG536_0H04900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141788.1"
                     /db_xref="GeneID:59328380"
                     /translation="MNVSLITRNLCKMRSLKISLYVSWAIACYSAIVSASQLSPTDVL
                     VPATTTVTSTWSATSFLTSTVSAKDTDTVYTVVIYGPSVSSTTTTSSYTGTSTSYDTI
                     AENPTGVTVIEYDPIPRTTVTRGWYYGTTETTVFNCGDIEDTGASAMPIRKRDNPYTQ
                     NCDPMNTVTTMITEVVHVPIVTSTIQVPYPGETTSTLYSWEDGAVTETDFVYVPNAVC
                     GTSGAACGTSGAEAVVNVVFDAVFDPVVGSQTACCQIGLRCATESADIVCVPATSELT
                     YYWTSTETLTTTYTTYINGLPSVVVEVGQPIVTQTVTTSGDVDYTATLTTITGNSTVG
                     TATVIVEVPYSKEYYNSTFVTDWTGTFTSTYATSTTTIKGSNGVDTVSTIYYVETPQA
                     HGVSTTYSPWSGTFISTYATATSTVKGSDGIDTVSTIYYVETPQVNGVSTIYTPWNGP
                     FTSTYATATTTVKGSDGIDTVSTIYYVETPQSRGVSTIYSPWSGTVTSTYATAMTTVQ
                     GANGLDTVNTIYYVQTPNSGYYGNLTAASLAPITQSSGSTSTQSTSVTDASRSSTPES
                     GSTSIQATSVTEASRSSAPVSQLTQQITSSVSRNSASSFASNDASSGPSSTSNKPSST
                     LSDKPSGFASGQPIVSSAESVKSSSHVSRSNDYSESTISFSTNRTPSNVSSTESVKSS
                     SAVSRSNDYSGGTISFSTNRTPSNSGEPATPVSVLSSATSNKGISRSVVTTIDSDTVT
                     SYPTTCAVTDSQTQVGLQTSNQVTQLVVTTTVSGVVTSYITTCPIGGYHKETLSEVIQ
                     TQTPAATLVPGNHTTSQGSASGADTSIAQSTGARAPPKLPTGSGEHAQNSSARQSPSN
                     IAASSGSFNNAATSTVPAETGSAATQSLRATSNGEVSGAPAATGSGANISQVPAVVSP
                     TVLSGSNGSGQTTGAMPSASISPVHVSTTSDIHLSTYAGSAAKLRAAFMLLLPLAVV"
     gene            <884500..>885648
                     /locus_tag="HG536_0H04910"
                     /db_xref="GeneID:59328381"
     mRNA            <884500..>885648
                     /locus_tag="HG536_0H04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285893.1"
                     /db_xref="GeneID:59328381"
     CDS             884500..885648
                     /locus_tag="HG536_0H04910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141789.1"
                     /db_xref="GeneID:59328381"
                     /translation="MSNFSSSDPWWMQWNPDNVTISDHSVSDAWKTCVLQGVYYGGND
                     YNGWLGARISSIFVILVVSTFCTLYPVIAKHIKWMRINKWFYMFARNFGTGVIVATAF
                     IHLMDPAYGEIGGLSCVGSTGHWADYSWCPAIMLATVFLTFLVDLFSAVFVEKKYGTV
                     HEHNYDEIAQTIVRSNKPAHDYERQVEQTSSQSAIANDKDAKVLNTDTESVVDSVQAD
                     ISFKSEFAAFLVLEFGVLFHSVMIGLNLGSSGKEFATLYPVLVFHQSFEGLGIGARLS
                     AIEFPDSKKWWPYILCVIYGLTTPICVAIGLGVRTTYNSSSYTVNVVSGVLDAISAGV
                     LLYTGMVELLARDWIFNAHRTKEIKEILFCLTSMLWGAGLMALLGKWA"
     gene            complement(<886161..>886817)
                     /locus_tag="HG536_0H04920"
                     /db_xref="GeneID:59328382"
     mRNA            complement(<886161..>886817)
                     /locus_tag="HG536_0H04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285894.1"
                     /db_xref="GeneID:59328382"
     CDS             complement(886161..886817)
                     /locus_tag="HG536_0H04920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141790.1"
                     /db_xref="GeneID:59328382"
                     /translation="MTTCTVNKTNDIAKLQKTLAIAFADSAACHYLSKKFLEIPTSKH
                     LSDEELYDTYRYFCEDFLARGGLLLESNNFDCAAIVLPPQDKPVKTAKTKDPRFNEQF
                     IETIARHKEALQLGSKIKYYYLFMIGKNLEQPEVRGSARAILTYLKQKADEQNAAVVL
                     EAISDKAKKVYEYFGFIDYADVNYGQGDVDSNGRPDPDGEGFVLNLMVYYKGGKLLPK
                     "
     gene            complement(887039..887112)
                     /locus_tag="HG536_0Htrna13V"
                     /db_xref="GeneID:59328398"
     tRNA            complement(887039..887112)
                     /locus_tag="HG536_0Htrna13V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59328398"
     gene            889099..889170
                     /locus_tag="HG536_0Htrna7Q"
                     /db_xref="GeneID:59328406"
     tRNA            889099..889170
                     /locus_tag="HG536_0Htrna7Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAG"
                     /db_xref="GeneID:59328406"
     gene            <892917..>894110
                     /locus_tag="HG536_0H04930"
                     /db_xref="GeneID:59328383"
     mRNA            <892917..>894110
                     /locus_tag="HG536_0H04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285895.1"
                     /db_xref="GeneID:59328383"
     CDS             892917..894110
                     /locus_tag="HG536_0H04930"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141791.1"
                     /db_xref="GeneID:59328383"
                     /translation="MSFVKDFEPVALGDTTLFKPIKIGNNELKHRVVMPPLTRMRAYH
                     PGNVPNDWAIEYYDQRSKRPGTLIITEATYPSARSGGYDNVPGIWSEEQIEKWKKIIA
                     KIHDNKSFVWVQLWSLGRKALPGALVRDGLPFVSASDELYMDEARCEEAVKSNNRQRG
                     LTKDEIKQYINDYVNAAKNSIEAGADGVEIQCAGGNLLNQFLDPISNKRTDEYGGSIE
                     NRARFTLEVVDAVTEAIGCNKLGIRFMPYGTFSAMSGGQEPLIIAHYAYVLGELEKRA
                     RAGKRLAFVHLVEPRVTNPFDTEGQGEYNEGTNDFAYSIWKGSIIRAGGLASHPEEVR
                     KMVADGRTLIGYGRFFIANPDMVDRIEKGLPLNKYIRETFYAKTKEGYTDYPTYDEAL
                     KLGYK"
     gene            895226..895297
                     /locus_tag="HG536_0Htrna11E"
                     /db_xref="GeneID:59328392"
     tRNA            895226..895297
                     /locus_tag="HG536_0Htrna11E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAG"
                     /db_xref="GeneID:59328392"
     gene            complement(<899889..>900596)
                     /locus_tag="HG536_0H04940"
                     /db_xref="GeneID:59328384"
     mRNA            complement(<899889..>900596)
                     /locus_tag="HG536_0H04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285896.1"
                     /db_xref="GeneID:59328384"
     CDS             complement(899889..900596)
                     /locus_tag="HG536_0H04940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141792.1"
                     /db_xref="GeneID:59328384"
                     /translation="MVKALIAITSYNEVFYQDGARAGVFVVEALHPYEVLREKGVEVD
                     FVSETGKFFGWDEHSLSTDFLKAKDREIIEKSESSFMKAIRNVKKPSELNVKDYQIFF
                     ASGGHGASYDFPRSPHLQKLVADVSANGGVIGAVCHGPAIFDNLKTLEGNIFIKGKKL
                     TGFTDEGEEILNLAQIMKDKGMKTIKQVADTNGATYVQPADPWGSFVVVDGKLVTGVN
                     PASAAETAAKTVETLKH"
     gene            complement(<902949..>903287)
                     /locus_tag="HG536_0H04950"
                     /db_xref="GeneID:59328385"
     mRNA            complement(<902949..>903287)
                     /locus_tag="HG536_0H04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285897.1"
                     /db_xref="GeneID:59328385"
     CDS             complement(902949..903287)
                     /locus_tag="HG536_0H04950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141793.1"
                     /db_xref="GeneID:59328385"
                     /translation="MIPVHSVDGRKQRVSDLSSGSMSKGLPHHKFLMTSVGLTPQVTD
                     LNNILCGISSGVVQILVSQPFEQIKVRNQSSSYLKSSYQATERRESSGTLQGYSDASL
                     ETAHLRLLPV"
     gene            complement(<903789..>904382)
                     /locus_tag="HG536_0H04960"
                     /db_xref="GeneID:59328386"
     mRNA            complement(<903789..>904382)
                     /locus_tag="HG536_0H04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285898.1"
                     /db_xref="GeneID:59328386"
     CDS             complement(903789..904382)
                     /locus_tag="HG536_0H04960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141794.1"
                     /db_xref="GeneID:59328386"
                     /translation="MMFQVKNICFTSLLATFVIGSAPVKTNSPTDVKYVARFENKIEG
                     SIEFSSPNGSVLVNVNLSGLPASGGPFPYHIHLLPVPADGNCTGAGGHLNPYNGSEAA
                     TASADKEVGDLSGKHGRITDQSFTTSYIEQYISLNETDLAFIGNLSVVVHFSNSSRLA
                     CANITKVTTLIGSSETSSTLLTANGGKINTSGSTVFQ"
     gene            <908477..>908947
                     /locus_tag="HG536_0H04980"
                     /db_xref="GeneID:59328387"
     mRNA            <908477..>908947
                     /locus_tag="HG536_0H04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285899.1"
                     /db_xref="GeneID:59328387"
     CDS             908477..908947
                     /locus_tag="HG536_0H04980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141795.1"
                     /db_xref="GeneID:59328387"
                     /translation="MGFLGRQNRKNERYSPADDVSATTFLTVVMFAFWLNCSDFLDLL
                     FFAICVPYSVGVAKVVSAVLVADMIRPEHLLPAWSFVNSPDAPFLLVCEVIAQFMVDD
                     TDRVIPYFHAQMFAGLCSYTYTSVARIQGAACATRKSRDVALQLREKLLQRYSA"
     gene            <909231..>910793
                     /locus_tag="HG536_0H04990"
                     /db_xref="GeneID:59328388"
     mRNA            <909231..>910793
                     /locus_tag="HG536_0H04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285900.1"
                     /db_xref="GeneID:59328388"
     CDS             909231..910793
                     /locus_tag="HG536_0H04990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141796.1"
                     /db_xref="GeneID:59328388"
                     /translation="MLSKSRNSCEHCLEEKMKCGRERPTCGNCTDLGISCKYRMVLHW
                     GGRPNKKVNKKPKIHEGLSVVNGVFVIKRCEKSSQHRRRKSSAQSSEVAFPKQTKFSP
                     AVDPNSPMGFVRSSEHYWSLWLHFTENTSHILVATIEANKGEHPFRVTIPNLAKRSLT
                     LTKLLIAFGARHRYQLCQQPKDYDISQLMLGEAGKELVKIIESLPHMDEKTGELTLAC
                     ILMLAGYCIFFGDNKMRWTIHLGAARYILSSILNRTKRSDGQKSVVVTYCADPGPRFF
                     LIRWFAFMTVLGLLSSSPLANSEPLVFDFSGFNQRCRTAKGKLDFESFEYNAGLRTTT
                     LEMLMKTGKLIIAHESQSCSAKERNMLLGEAIELDYEIMRYFDSSESWNRILASAKGD
                     ELLLATDLLFGLSGMLHLRRRIMNLPSSSKMVKDLVLRAARVLLDEVPSSGTALCSIT
                     SCIFAFGCECGAGSGLEPLQPLFSSRLEQIELLGMPATSPARSIMHECWEKGSCWWEI
                     YKERNIELSFGT"
     gene            <911778..>912461
                     /locus_tag="HG536_0H05000"
                     /db_xref="GeneID:59328389"
     mRNA            <911778..>912461
                     /locus_tag="HG536_0H05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285901.1"
                     /db_xref="GeneID:59328389"
     CDS             911778..912461
                     /locus_tag="HG536_0H05000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141797.1"
                     /db_xref="GeneID:59328389"
                     /translation="MALPLIRVHWLNDSRAFRVLFLLEQLKLDYEIVSYRRDEDFRAP
                     AELKKVHPLGRAPLIELEDRSTGKKKVLAESGYIFQYILSHFDTDGVLKNNDPDMAEK
                     IQYYLYYAEGSLQPPLTMERLLLMAKKAPVPFPISYLVGMVIGQISSKYSAGRLKNQI
                     DYVEAEIAKNQGFLVGGKLSGADILISYPLMSVFDVGIAHKKDYPNISKLLDTLSNSG
                     FLCHCKGKG"
CONTIG      join(CP059253.1:1..914501)
//
DBGET integrated database retrieval system