GenomeNet

Database: RefSeq
Entry: NC_052374
LinkDB: NC_052374
Original site: NC_052374 
LOCUS       NC_052374            4259431 bp    DNA     linear   CON 13-FEB-2021
DEFINITION  Brettanomyces nanus chromosome 1, complete sequence.
ACCESSION   NC_052374
VERSION     NC_052374.1
DBLINK      BioProject: PRJNA691332
            BioSample: SAMN12257692
            Assembly: GCF_011074865.1
KEYWORDS    RefSeq.
SOURCE      Brettanomyces nanus
  ORGANISM  Brettanomyces nanus
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Pichiaceae; Brettanomyces.
REFERENCE   1  (bases 1 to 4259431)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 4259431)
  AUTHORS   Roach,M.J.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2020) Research, Australian Wine Research
            Institute, Adelaide, SA 5064, AUS
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP064812.
            Annotated using 1.8.1.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: OCT-2018
            Assembly Method        :: Celera Assembler v. Canu v1.7
            Assembly Name          :: AWRI2847_1.1
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 50.0x
            Sequencing Technology  :: Oxford Nanopore MinION
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..4259431
                     /organism="Brettanomyces nanus"
                     /mol_type="genomic DNA"
                     /strain="CBS 1945"
                     /isolation_source="Bottled beer"
                     /culture_collection="AWRI:2847"
                     /type_material="type material of Eeniella nana"
                     /db_xref="taxon:13502"
                     /chromosome="1"
                     /country="Sweden"
                     /collection_date="21-Jan-2014"
     gene            complement(<9180..>10547)
                     /locus_tag="FOA43_000001"
                     /db_xref="GeneID:62193402"
     mRNA            complement(<9180..>10547)
                     /locus_tag="FOA43_000001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920337.1"
                     /db_xref="GeneID:62193402"
     CDS             complement(9180..10547)
                     /locus_tag="FOA43_000001"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776265.1"
                     /db_xref="GeneID:62193402"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MGHQSKIPVWLEWWFFGCQVLGAFFAGWYNDKFGRKSSLAISCI
                     ITIIGNTVAITAPVGHPINLVMAKCVIGIGIGILVSTCPVYLSELMSPTLRGIGSMGI
                     NFSICFGQWIGSLIYFGCSKNYTGIDDSTGYKIAFGIQYLLVGGYLLLFWFMPESPSY
                     LIHRGKLEEAKAAIKKLYHNKNNTEYDIDSHYEILIKEVEEEKMNAESEKEVSYAELF
                     KATNLKRVVLSIFALTGQLWVGVSFVLTYISYFFELAGVSSSIEKTVGMFTLCVGGNL
                     VSYFVIERVDRRVLYIGGVALCTIMNLLIACVSYGSSQAAAYTTVVFVFLWAFIYEAT
                     VGPLTYALITELPQGRMRAKSVAITSNVNSLCSFGLGYLIPYLFNPDEVNMGARIMFV
                     WTGTGVVLFVVMLFFLPETRGRTANEIEQLFVNKVGALKFKRAKFDEDDKLIMSSVGK
                     EVSQA"
     misc_feature    15934..16402
                     /note="contains ribosomal RNAs"
     gene            complement(<32752..>34500)
                     /gene="LAC12_1"
                     /locus_tag="FOA43_000002"
                     /db_xref="GeneID:62193403"
     mRNA            complement(<32752..>34500)
                     /gene="LAC12_1"
                     /locus_tag="FOA43_000002"
                     /product="high-affinity glucose transporter"
                     /transcript_id="XM_038920338.1"
                     /db_xref="GeneID:62193403"
     CDS             complement(32752..34500)
                     /gene="LAC12_1"
                     /locus_tag="FOA43_000002"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="high-affinity glucose transporter"
                     /protein_id="XP_038776266.1"
                     /db_xref="GeneID:62193403"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MGALIFCLLLGLSFIKLLSLYPQEIMSESINSLNAALDREDSAN
                     SKAALEKSEDDVPENMDNMELPPAFSKQYIPLYCMCLVVYFVSTMQGYDGSLMGSIYT
                     MKDYLAYYNLDVNSSTSTGLVFSIYNVGQITGAFFVWIMDWKGRKIAIMIGCFGAIVG
                     AIITAATTNKEGLIGGRWFLSFFTTIANTAAPSYCVEVSPPHIRGKVAGLYNTLWYCG
                     SILAAFTTYGTNKNFAGSSLSFKIPLYVQVCFPGLVVLFGWFLPESPRWLVGVGRYDE
                     ARKFLVKYHCNGDDSNPLVDLEMAEMEESFKDVKISDPLTAMDIRPLFKNRSDRYRLG
                     LVVAMAWFGQFSGNNVCSYYLPTMLIKVGMTSVSTNVLMNGVYSIVSWISSILGSFAH
                     DKVGRRKMFMISTLGSALALTGLAVCTARYEATQSDGASKGTLVFIYLFGVIFSFAFT
                     PMQPIYPGEVSSNLIRGKAQFVLSIVAGVAQFVNQFASPKAMENIRYWFYVFYAFFDI
                     FEFIIIYFFFVETRGKTLEELEYVFEAPNPRKASTDPEFLSSIRVASGFEAENMKNEH
                     DIKATVDHLEEGVDSE"
     gene            <35581..>38649
                     /gene="LAC4_1"
                     /locus_tag="FOA43_000003"
                     /db_xref="GeneID:62193404"
     mRNA            <35581..>38649
                     /gene="LAC4_1"
                     /locus_tag="FOA43_000003"
                     /product="Beta-galactosidase (Lactase)"
                     /transcript_id="XM_038920339.1"
                     /db_xref="GeneID:62193404"
     CDS             35581..38649
                     /gene="LAC4_1"
                     /locus_tag="FOA43_000003"
                     /note="CAZy:GH2"
                     /codon_start=1
                     /product="Beta-galactosidase (Lactase)"
                     /protein_id="XP_038776267.1"
                     /db_xref="GeneID:62193404"
                     /db_xref="InterPro:IPR004199"
                     /db_xref="InterPro:IPR006101"
                     /db_xref="InterPro:IPR006102"
                     /db_xref="InterPro:IPR006103"
                     /db_xref="InterPro:IPR006104"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR023230"
                     /db_xref="InterPro:IPR032312"
                     /db_xref="InterPro:IPR036156"
                     /db_xref="PFAM:PF00703"
                     /db_xref="PFAM:PF02836"
                     /db_xref="PFAM:PF02837"
                     /db_xref="PFAM:PF02929"
                     /db_xref="PFAM:PF16353"
                     /translation="MTTQLIPSHLKDPKVVFENRLPTRAYTYDPDIFQSLNGKWSFKL
                     FDSPILSPDLTKLRNSDFDSWSSISVPSHWQLQGDGKYGRPHYTNVQFPFQIDIPNPP
                     TLNPTGVYSRQFYISNPEEFNHRIRFEGVDNSFEVYVNQKYVGFNKGSRNGAEFDVQK
                     LLVQGQNLVSVKVFQWSDSSYIEDQDQWWLSGIFRDVSLLTLPRAAHIENYKVDPRFL
                     GSSYKDARLLLDLSVVGTDYDSVKFTLYDFEDPHKSIDTEALLNDFDKPITSAIKFVK
                     FSKEDAQKTLEISVTTPKHWTAEDPYLYKYALELIRVDGTSVHTVHNHVGFRQIERLD
                     GNIKVNGRTILFRGVNRHEHHPRYGRAVPLEFVIRDLKIMKLHNVNAVRTSHYPNHPR
                     VYNFFDKLGFWIIDEADLETHGVQEPYNRYNDIVTEGSDTKHANYDANVRFLSSNPDY
                     KTAYLDRASQLVLRDINHPSVILWSLGNEAGYGTNHQLMYKLIKKLDSSRLVHYEGDV
                     NAKTADVYSFMYPPLDLMERWRKNHTDSNGKFDKPLILCEYGHAMGNGPGNLKEYQDM
                     FYSHDFYQGGFIWEWANHGIEFETISRKDGKLHKAYAYGGDFNEEINDGIFIMDGLLN
                     SEHNPTPGVVELKKTLEPVVIDLTSSKVKITNRYDFSTTDHLKFLDVDNDKVLEVTSL
                     KPGESITLDVTTKNVSAVLKRDSGVLKAGFEVAWGQLEPDLQVIEPTSETVRDEAAIL
                     ETAQLVTITSKNVVFEFNKLLGKIERLTIGDRTVSTKYDGSSITFWRPPTNNDNAKDA
                     PNWKKFNMNLVKQNVREVIVKKGTGEYLAKVIVKSRVGPPVFYYGFDVIQEYIIFPNR
                     LTLHTTLKLTGDYQPKDIPRIGYEFWLGDNYDSYEWTGRGPGESYPDKKLSQRFGNFN
                     SNGVEDFVYDYPQENGNHTETHYLKIKYKNAEKLVISEKNKTFNFKLSDEYGVEEADH
                     PCDVKHYDQYYVRLDHAIHGVGSEACGPAVLDKYRLDIQDFDFTFDIDFD"
     gene            <40094..>41827
                     /locus_tag="FOA43_000004"
                     /db_xref="GeneID:62193405"
     mRNA            <40094..>41827
                     /locus_tag="FOA43_000004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920340.1"
                     /db_xref="GeneID:62193405"
     CDS             40094..41827
                     /locus_tag="FOA43_000004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776268.1"
                     /db_xref="GeneID:62193405"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MSATQSSESDFSKSGRDLEKEKNVGPTESTSPLKGHAEVELDNI
                     GVVRETRVKRGLKTRHVTMLALGGTIGTGLFIGTSTPIHEAGPVNALIAYLFFGVLAY
                     FVTQALGEMATHTPVSGSFCIFNTRYLSKSIGLASNWLYWFQWPITFAVELFAIAQVI
                     EYWTDVVPNWAWMLIFYILLTAANFFPVEYYGEVEFWVALVKVIAIIGFIIYALCMVC
                     GAGVQGPIGFRYWRNPGPWGAGAGLASNVKTDRFLGWLSSLVNAAFTYQGIEFTGISA
                     GESSNPRKTVPKAINQVVVRIFIFYILTLFFMGLLVPYDDPELTNDTSFISSSPFLIS
                     IQNSGTPVLPSIFNAVMLCTIISAGNSDIYIGSRVLYAMAGTTAPKIFRRTTKQGVPY
                     IGILITSSLGLLAFLNISHSGQTVFNWLMDISAVAGMIDWIFISAAHLRFMAILKSRN
                     ISRDTLPYKARGMPFFGWFSMISLTIITFVQGYTVFFDFNASDFFANYVSLIMFFVIW
                     IGSQLTVYKHDPWLVPVDQVDIDTDARRIDEEVWEDEENEEKGICDRCRKWSYKHNRF
                     VQKVVNGILSL"
     gene            <42053..>44207
                     /locus_tag="FOA43_000005"
                     /db_xref="GeneID:62193406"
     mRNA            join(<42053..42060,42083..>44207)
                     /locus_tag="FOA43_000005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920341.1"
                     /db_xref="GeneID:62193406"
     CDS             join(42053..42060,42083..44207)
                     /locus_tag="FOA43_000005"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776269.1"
                     /db_xref="GeneID:62193406"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="PFAM:PF04082"
                     /translation="MRSCDQNGTPCLQKDPLSDRLLPRDYTLMMEKEVSRYKEIVESQ
                     RNLISDLKQGNSPAIDGRVGNGEQEMGHMQRLYSSFENSLETDVSSLMTDGTIQDKEK
                     LLLYTEYYTNPIHKSLENEITEPIRHLSPTGDKNNDNSGNDGSASGIISSNNLVNSSA
                     DHLTRIASSLTTSDEDYTGIEGSTDGLSANRNTLIKSLKRLPTSQFSNYLLKIYLDNE
                     YPIYPILNQVDTYANFYQIAEIKNALSMNNNAEISNKTLLLTFSNLYFSNLIFALAAS
                     NLESTHTKEFTLSNIFYNRDYYLKAVYDLAGIIFDRLDTITKLQAMVLLGQIALCRPC
                     FPGLWNISSLISSIVTKQGFFDESIVICPDVGGAKKIDLKRRCFWAAYLMDRYVCLCL
                     SKPHLIDEFSITTRYFSTIDDECMFGETESNTLLSTKQYSIFYIKYFRTMSEINALLY
                     SNYMPRLFDGHANGNDKEKYFQTMKIEMQEKLNITRKEVESFELKFKGRSNFYAGYLT
                     LLYYQAVCLLYKPNQHYAEPSVSDYRNLYDATGRIIDIFKGMSDKHQLTYRILSVSSL
                     FFASVMYNYCVWKCDEICLEAKIEHIQQRCNDSKVVFQRIDNFYNADREHTERVNSIV
                     SVCTSVLTKLTSAAIDHIIGMQQNEKEQQVEEQQPPSTNKPLANYEDVPNARENDDQK
                     FFGSNFDVDSPFDIVASLENIPWDLNIN"
     gene            <44335..>45066
                     /locus_tag="FOA43_000006"
                     /db_xref="GeneID:62193407"
     mRNA            <44335..>45066
                     /locus_tag="FOA43_000006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920342.1"
                     /db_xref="GeneID:62193407"
     CDS             44335..45066
                     /locus_tag="FOA43_000006"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776270.1"
                     /db_xref="GeneID:62193407"
                     /translation="MTSKEFKRPLNEVPKHKKLVKKAKPAKPFIKTIWLVGHSLTLVM
                     GSVYTSYFLLFRSHSSRISFYAYRLSLMGVMLSYCCTIASQFNKKSLPSYRSLLGTLN
                     FQYLLLSVVWFFNRGSLFKIFPYLVVSTMQLASKFNVKPVLKLSSKLKVITAYDEVFI
                     FVVLLVDVIFLRSTSGYALVIYAAMYWLRVIQSEDTRHLLFTVVGKLDSFMSNQKNPK
                     VAESWSVVKNFLTAKNDRFQAEFLA"
     gene            complement(<45817..>46137)
                     /gene="RPS25A"
                     /locus_tag="FOA43_000007"
                     /db_xref="GeneID:62193408"
     mRNA            complement(<45817..>46137)
                     /gene="RPS25A"
                     /locus_tag="FOA43_000007"
                     /product="ribosomal 40S subunit protein S25A"
                     /transcript_id="XM_038920343.1"
                     /db_xref="GeneID:62193408"
     CDS             complement(45817..46137)
                     /gene="RPS25A"
                     /locus_tag="FOA43_000007"
                     /note="BUSCO:EOG09344QRP"
                     /codon_start=1
                     /product="ribosomal 40S subunit protein S25A"
                     /protein_id="XP_038776271.1"
                     /db_xref="GeneID:62193408"
                     /db_xref="InterPro:IPR004977"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF03297"
                     /translation="MPAKVQATKAAKAAAAAAGSKKSKKKWSKGKVKDKADHVVILDQ
                     EKYDRILKEVPTYRFISVSVLVDRLKIGGSIARVALKQMERDGLIKAVDKHSKQWIYT
                     RATA"
     gene            <46685..>48586
                     /locus_tag="FOA43_000008"
                     /db_xref="GeneID:62193409"
     mRNA            <46685..>48586
                     /locus_tag="FOA43_000008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920344.1"
                     /db_xref="GeneID:62193409"
     CDS             46685..48586
                     /locus_tag="FOA43_000008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776272.1"
                     /db_xref="GeneID:62193409"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015007"
                     /db_xref="PFAM:PF00638"
                     /db_xref="PFAM:PF08911"
                     /translation="MGSKRTKIQLTREQAYVERSDDYGDEVEAKPKIASRAVMAHRKI
                     AHFKSRVAGQTGDLKPSSDRSGPSVNSKASTITKATQLKSLNANFLKAVNDALMKNPV
                     ADLRPLGAKYSEYYFKVDEGRIEVKHLDVPKTEVKPTVTSRAFSFNPIVQKPAEKSEE
                     AVGSEPAKLSGISGPKFTIDKVPTSDNYGLKFGYKPPADSDESDDDVKVEGPTFKITA
                     DLKKPDPDSAFKFPTKLQLSNQKSLPATPSDQPKTTFSLKPKPTEAEKQKPLFSFKST
                     QTNTDLTSKPAKPAFGATPSSSFKFSSGPSEPMSFVPKDKDPAAVATVAPAAPAATVV
                     TVAPVAPAAIVAPAAPVTPAATVATVTPATVAPAAPAAPAAPAAPAAPAAPAAPAAPA
                     APAAPAAFKFGSTEPAKPAFSGFKFESTNPGVKTAFSFGSKTDTVTESKPPSQFNFGA
                     HNNGSVNPFASGSSSFGFSFTPPKPAVTADTAIDSEESQKEKTDDGDDNVKGDFAVVK
                     LDEKVETKTGEEDEKAIYVKRSKISKYDPEDKETPYKSVGVGELKVLVNDKTHKARIL
                     VRSDGNGNVLLNVLILKEMKYSLMGSKKNILQVPVVNSQGKVDMYIAQVKTGDDAKTL
                     LEKVKSCQN"
     gene            complement(<48659..>50590)
                     /locus_tag="FOA43_000009"
                     /db_xref="GeneID:62193410"
     mRNA            complement(<48659..>50590)
                     /locus_tag="FOA43_000009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920345.1"
                     /db_xref="GeneID:62193410"
     CDS             complement(48659..50590)
                     /locus_tag="FOA43_000009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776273.1"
                     /db_xref="GeneID:62193410"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="InterPro:IPR035969"
                     /translation="MRLQKKLKDIEKEATASPSPLLNTLDSLSDDELPDDLIVFDVPF
                     SNPLKALSDHRTAYKTSMFTQWGSNPSGKLKRSRSADPVYHSGPYTAAFLDSTTSSGA
                     STRSHESSVSAPGSFSSPSTGNFVHNGSLAPFRFASRSTDSTTSSHSASSSRSSPVTR
                     ASSIFSIASDLSEMSFMDDESSNLSFEGKLLNSNKDLRLDEALQRISMLKSMSHLSVS
                     QLAEEGGPDHKSVLPSKEKLDCLSVTRQPNLPPKDRFESIKHQRDYESLVETQIHEEK
                     QKLAEYRTQQDQLKKRDDHDFKLWQMVCQKYDILVCLPTTRELWWRGIPAKGGLRGSI
                     WRHQLVGKRKLKCDLKQCLSEAHEIIDKACDYKTTISELGRKKFEKENVEIMTVIQSV
                     EVYSNQIQRCFPNLLVFQLGTTFESVLSIAIAFDIMKAHEESVELSLIETGKLLHLIC
                     VLLKNLESEELTLHALIDLILKRLPRALLTSKNIPRTLNEQLQFEKGHQFEKDSGYLK
                     DIKDQFDRFLLSTSPNVYNHFVQHGVNTLVLIQSATANLFSTLLNMDVLERILDIYIF
                     EGDTFLLRCLLALIKKVSYKLYGSCDEIYKVLGENCLDALNRHTSRKGALAGYVYLDV
                     GEADHFIRDVRSILRRHTS"
     gene            <51499..>54744
                     /locus_tag="FOA43_000010"
                     /db_xref="GeneID:62193411"
     mRNA            <51499..>54744
                     /locus_tag="FOA43_000010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920346.1"
                     /db_xref="GeneID:62193411"
     CDS             51499..54744
                     /locus_tag="FOA43_000010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776274.1"
                     /db_xref="GeneID:62193411"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MPSFRRDSRRDSSHSNSEINSVGDSTALPASAGGLITGSATVSA
                     TDPGSISATDSATASAAASPLVSRNPSLSLPSSPEASDSANSSAKSPSTLRPQSPIPK
                     EDSDTTLYDTAASTPVQESSHGSALKSRHRSSSLSQRLKHLFSSHREAERGSTSLTTA
                     PAVSIVTGPTTSVYPSAGPLSASPIPVSHSNVSLGSKSMPSSPVLDLKPDIFRSLHKH
                     PVSELQTQTCQDSSGDNDDFLTPTIHRPRTKSRRSPRLQPNSPTLSPLVIPRSTSSSP
                     GERGANSSDSDLPSALSKLRIMPSVPENDLDDLLEEDEDNVEDDDLAINPQNGSCTNS
                     SREDDTGYYTSESTDPRHHHHHHHHHHHDPQSQNQQQLQQLGHRSRRHTTSSRSLPSS
                     PLIRPHEGVTSTALETNKSSTARTNSQDSSKRERSASKVPHPSTSPPISRSNSGSRSS
                     SNHGSRHRATSVTASDLNDHDAIDNVLKHSQSINYSSAHLLNQKMFKLKSGRIKISAD
                     GKTHEHDYNRFRTQPVRPNRGLFGWMKRKDAEEDSFTTLEHSISLLPDSYSKQLIELK
                     GNPENYRWNYDDSDENDEEDNDKDENIGDEDDDNNEGDDDDDDEDYDFDDEAEDELIE
                     PIIGKEQLRLINVMLDKIEHPELFRERLRTKGSNKKSLIEKYGRIEGFIGKESYGTVS
                     ISSKTYPGDRKHKTYFAIKQLKRRSGETMHHFGNRVTSEFMISSCLTHQAIINVYDLM
                     LDPVSMTYSQIMEYIPCGDLFSLISSTNGLEVIECDCFFKQILNAITYLHSVGISHND
                     LKVENLLLTKKGQLKIIDFGTSAVFKTAWESKVQFSKGPCGSERYVSPEQYDLDKEYD
                     PRLADVWSLGIIYLVMLYGNYCWDVAKDCDERYEQFLETRAKYDYHKGSTTRNKQFKT
                     IRKGVFNPIESINWGEFPNSRRYTLYNILNPDPKYRMRTYQIWQSDWITNFQVCDAGR
                     GYLSYDDYIELAIQTAHAAGNALPSTANTSRANSGYNSGVDTPITPSTPLISATTMAT
                     SPVNLLPTAPTPMAPMAPMAPMAPTAPTAPTAPTAPTAPVPQRSLSLRRTK"
     gene            <56546..>57052
                     /locus_tag="FOA43_000011"
                     /db_xref="GeneID:62193412"
     mRNA            <56546..>57052
                     /locus_tag="FOA43_000011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920347.1"
                     /db_xref="GeneID:62193412"
     CDS             56546..57052
                     /locus_tag="FOA43_000011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776275.1"
                     /db_xref="GeneID:62193412"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PFAM:PF12171"
                     /translation="MGRYARRKYKTKRRKREVDQIFEDLSSPESIQKLKHQACDEDKP
                     GLGQYYCVHCAKYFQDNGALAQHLKTKVHKRRVKLLKVNPFTTLEAEAAAGFNLEEFT
                     QKVANYHTSEPLRKQMETQILSNQLEENEQKDRERFAQLFPDKAKEEEEQETQKRMAK
                     GVEAMATD"
     gene            complement(<57084..>58346)
                     /locus_tag="FOA43_000012"
                     /db_xref="GeneID:62193413"
     mRNA            complement(<57084..>58346)
                     /locus_tag="FOA43_000012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920348.1"
                     /db_xref="GeneID:62193413"
     CDS             complement(57084..58346)
                     /locus_tag="FOA43_000012"
                     /note="MEROPS:MER0021865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776276.1"
                     /db_xref="GeneID:62193413"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR015063"
                     /db_xref="InterPro:IPR037518"
                     /db_xref="PFAM:PF01398"
                     /db_xref="PFAM:PF08969"
                     /translation="MPMNSETLVKAPSLKVLKGTATSYHYSNQIPLSIWVRTASRILK
                     HANSYASKDVQDQAFVLYTRFIDLFAYNLYRHPDLVRAKSDYQANKKTNEAKIYREYV
                     QLRSKLPQLMEEAEKLGSALKLRYNEYQEKLKREETTPDRQRLIAAESRRPEPQLKSG
                     RVFSDIELSRKLERLSDTSQSSVSGKRVSQLKYPEVPSTKSFEVAISGHENSIQVAPV
                     ASPLTHPAINSTEGRSPLRTIFLPSELINNFLDIASHNTQQGMETCGLLCGKLNRNAF
                     FVTYLVIPEQTSTPNTCSTKNEEHLFDVIDQLDLFILGWIHTHPTQSCFLSSVDLHTQ
                     NSYQIMLNEAVAVVCSPGERFSKKLGIFRLTDPPGIATITSCGKSGFHPHPEKNLYVE
                     CYRISKENAKSGHVVIKKGLPYHLKDLR"
     gene            complement(<58458..>60614)
                     /locus_tag="FOA43_000013"
                     /db_xref="GeneID:62193414"
     mRNA            complement(<58458..>60614)
                     /locus_tag="FOA43_000013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920349.1"
                     /db_xref="GeneID:62193414"
     CDS             complement(58458..60614)
                     /locus_tag="FOA43_000013"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776277.1"
                     /db_xref="GeneID:62193414"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR036322"
                     /translation="MYLPPDLSRYSRQTPQQFMQMLNSTILPLQTTDPNCIFRLKEEE
                     FEFDLLDATFKPDMALRVSRTPLLSTDPRTYASLSKFIEYNLRKYHSTLANANQNQLI
                     RPLGLPPDLTGVQAESKTEVLPLGCSINPLSSDPFKNVHLTPGFLCAIVDYAVVEEWQ
                     SRVEKQRHAGSPAATSKSSHSASSKNAESSGLPGMLFGKSRQNSKTLPDRSLHSLKSP
                     QTVISRNSSSFIDRVVTGDNFNKKFANNGKLLIGCNGRAINMIVLDNSPKHIEVDPPA
                     LKMNASSSVITCLDTFPHIGSDGERSLDVLVGFGSGDLLWLDPIIQKYTRWNKRGWLK
                     EGPVMSVEWSKCGSFAMVGFADGDVLIFSRDLEDDESYGDTPKTLVYKDRYMRTYRTL
                     MTEGDNRRKRNPIAHYKFSRKAIVDITTHPLYHNIVAMACDDGYLRIFDLLKERITDI
                     QESYYGGFLSVSFTEDGKYLLAGGEDDLVSIYEFQGISKFTPASSGLIKLVARLEGSK
                     SWVRDITVDRHRSKSGILYRIGTAGDDGVLRFYEFQPRNLPKVKKIARKTAISTSSAV
                     RALPLKVSVSNSMPAKATAMRRALTSKHGKNTESISSLTSSNTNRRLSLLEMISHGSA
                     TSLQQLQQQQETNLEDKCVKANYIFSDHKLPCLKTDSGTLGSHFHISVGLKECPIIFP
                     ICEKDVKLGRLSGLYFEKDYVWAFVATGDSVRWKRP"
     gene            <61357..>62565
                     /locus_tag="FOA43_000014"
                     /db_xref="GeneID:62193415"
     mRNA            <61357..>62565
                     /locus_tag="FOA43_000014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920350.1"
                     /db_xref="GeneID:62193415"
     CDS             61357..62565
                     /locus_tag="FOA43_000014"
                     /note="BUSCO:EOG09343OVI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776278.1"
                     /db_xref="GeneID:62193415"
                     /db_xref="InterPro:IPR004015"
                     /db_xref="PFAM:PF02731"
                     /translation="MSKEIDETTARTKHAVQKIIDAKLNGEKIGSSISGSHSNDPIYI
                     RYTPSTNLLNQGSSKKQRIIKIVDKQEDPTLPPSFKIRKTPQGPSDEAPVPILHEETT
                     AKLTKKEQKIWTIPPAISNWKNTKGFTISIDKRLASTVEDSERYEISDKFSTLSEALD
                     KANKEAKEELEMRARLNQKLEKQKLLENQKKLSRIAQEARGIPGSRSSRRSKWEVEDE
                     KEQGNREKDSAALRREWIRKERRRKAEKELHTGSLSTENKVKMLAKEQGREVSERVAI
                     GVSQNKGKRSAENNTEEMYDSRLYLKAAGTNTRHSEDQVYDSALFGNTSAINDIYRAR
                     EPDRYKGLGSGSGSDANKEKRKLDKERRFDELSSKEPTGPVVFEKDTADKNISLEAHG
                     LKTKKREWEE"
     gene            <62871..>64322
                     /locus_tag="FOA43_000015"
                     /db_xref="GeneID:62193416"
     mRNA            <62871..>64322
                     /locus_tag="FOA43_000015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920351.1"
                     /db_xref="GeneID:62193416"
     CDS             62871..64322
                     /locus_tag="FOA43_000015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776279.1"
                     /db_xref="GeneID:62193416"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="PFAM:PF01593"
                     /db_xref="PFAM:PF13450"
                     /translation="MSEDTAEHHEVIVIGAGISGLKCCADLNDRDVDFLDLEARGRFG
                     GRIYTDRTGKCSYEIGPSWAHDTLANPLFDEIVASDYNYDLYYDDQRPYYFGEKLDDA
                     DFEGYRVNQVVEEMRKYVELAYFQELGRKDVSLREIALNYAYRQRKLLTPEQILYAPQ
                     FIRHLELWHGISWEDMSSKYSLVDNVGRNCVLRKGYDHVIDHLVKELPKDRLLKNMVV
                     SKIHHDAKRIEVFTTDGRRFTCDYLVVTVPQSILQLDPKEQGGIEWEPKLPKRIEEPL
                     ANMSFGKLGKFILEFPEAFWKHHDTDRFVAIANPDLVEGKHILSALKHNKMPVLPKSD
                     SSKLPKPWDFPVLILNLYKVNNVASLLCFTQGPLTEYLERNPQKVWEYMKPIVSRLAK
                     KPEDVLEPENVISSQWTVDPYSRGSFAACEPGNDPTDLVIQLTKGMGNVRFAGEHTIL
                     DGAGAVHGAWMSGKREGKYIMVKTGKMKGEIDF"
     gene            <66458..>66964
                     /gene="UBC7"
                     /locus_tag="FOA43_000016"
                     /db_xref="GeneID:62193417"
     mRNA            <66458..>66964
                     /gene="UBC7"
                     /locus_tag="FOA43_000016"
                     /product="Ubiquitin-conjugating enzyme E2 7"
                     /transcript_id="XM_038920352.1"
                     /db_xref="GeneID:62193417"
     CDS             66458..66964
                     /gene="UBC7"
                     /locus_tag="FOA43_000016"
                     /codon_start=1
                     /product="Ubiquitin-conjugating enzyme E2 7"
                     /protein_id="XP_038776280.1"
                     /db_xref="GeneID:62193417"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="PFAM:PF00179"
                     /translation="MARPSTAQKRLLKEFKELLNEPTEGIIAGPVCEDNLFIWNCLLV
                     GPSGTPYEYGIFRATMKFPKDYPLSPPKMKFDTPILHPNIYKDGTVCISILHPPGDDP
                     MMYESADERWGPLQSIEKILLSVCSMLAEPNPNSPANVDAAKLWRDNRDTFNEIVRGQ
                     VVKTLVNC"
     gene            <67208..>67624
                     /locus_tag="FOA43_000017"
                     /db_xref="GeneID:62193418"
     mRNA            <67208..>67624
                     /locus_tag="FOA43_000017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920353.1"
                     /db_xref="GeneID:62193418"
     CDS             67208..67624
                     /locus_tag="FOA43_000017"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776281.1"
                     /db_xref="GeneID:62193418"
                     /translation="MPSSRPNPASSDQKDTATKPFTNANASYQSDKIITGLSHVIIKS
                     TLTGALYGALVSIPTELLLRWRSPSYRSFGTRIRVFYHTIILTYSAAFMTESNVMKFE
                     EKVRAEEARKREELIEWSVQNGLYTGEEEGYSPKRT"
     gene            complement(<67677..>70325)
                     /locus_tag="FOA43_000018"
                     /db_xref="GeneID:62193419"
     mRNA            complement(<67677..>70325)
                     /locus_tag="FOA43_000018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920354.1"
                     /db_xref="GeneID:62193419"
     CDS             complement(67677..70325)
                     /locus_tag="FOA43_000018"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776282.1"
                     /db_xref="GeneID:62193419"
                     /translation="MCAYDGPPNWNMDGSRRFDSPNSDLPLPQKSPKSFSDIKELSRT
                     PMAFLNMDPGDSQAPSEASVLAIPSTAISSMPIHMPPPRYNTISTPSLNVRMDGLPPL
                     YAPTDVAVTIQTLKRRVDVLEANLHDDAQNAQDVISLAVAEDGRNAISFGVKKNRMLA
                     LGSFKGPVVWKRDPFMQTLFTSFRSIKNRLETKILAGGKKLQDKDNGPRYLVGLKNME
                     RQVKLRKKMNKMKVSRPEDYGSLRTKMESMFPPENIFKWHLERFFHYIYPFYPIFDEY
                     TVKSYADRIVKYQHPDHKVVLDIEDKSDIVRAATLLLILRLSYISLYLETETENPFVS
                     RKEHLDILLHPIEANAIVLVRMTLEKVNFLRKTSLEDFQLLLLMRMYQIIAPEDGDGG
                     DYTDGTVFVGLLTSTAMCIGLNRKVDLPLNTETFARSNDSFQDLWAKLWKVCLGCDLE
                     LSVVYGKKPYLEGSDSDNPSPTVVIRNSNLPNFNIDRFSIGSLAKFGQIYAPLYDLVR
                     MLHRVSNFPTVLEVQEKVASTIFLCERLYPIRNLFANAPQYMRYDDVSLEIVNTVKAR
                     LVVDPFLLNVNYYLLVHFEKRNALNNFLSAFDSAVDLSLDCMRLAIRSFNSLFNVMSV
                     HALMLTPYILQAVGKVSQFFLYFAVHLLVVKARLEKRLAGDSERKAEEAAKDQIEKLI
                     GRVAKVMKLIIKCTSISLDHYYSSFRGYGAYACMIGWIENGGKPILNFDDERWEMYPN
                     LLEKFNCEHFRKLNEKLESFLEEDYCKVLSVRNKRWTSDGDAKGVVSLEKESMKMKTD
                     GKGVTIGDYVDDKSNGDPGEQITTDVTNIQEEFPVSSNGTSDIVDPDFLLTNPSFGDT
                     DLEEWLENPEFMDSLDMLADFGLSSF"
     gene            <73223..>75309
                     /locus_tag="FOA43_000019"
                     /db_xref="GeneID:62193420"
     mRNA            join(<73223..73226,73598..>75309)
                     /locus_tag="FOA43_000019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920355.1"
                     /db_xref="GeneID:62193420"
     CDS             join(73223..73226,73598..75309)
                     /locus_tag="FOA43_000019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776283.1"
                     /db_xref="GeneID:62193420"
                     /translation="MIPYEMPPLTSGRRGSIDSVNSSISSGPYSLGSRPSSISGIMSA
                     HSPTNISENSNNSSDVEEDYFISNSSSPQGSRGTFKAPLGSAPVVSPQNSFSREQGSV
                     SPAQSLSSLQDINHGIARLSLPSQSSGSSISSQPFQSQSQQLQQQPEQSQKYLEFYKS
                     LQFNLDTFYEKLQKQYPILPPKNILSHCIQNLEGQDYMPVLQLLESALRVLNSMDFNS
                     SFPEVVKAFEDVVKLYPTKSFINRNQYCEIPFTTALVLFNYIVILSGYNFSLGFGVAF
                     SIFKDWMIFKDDIDNVNFHNLIQLMMLDNCYSLYFGTPRSSTLCSSLDMNFLSTYIKH
                     LERDQQTDSESQYNSGSLEFLKIGMTLIILSNDLEDIDATKKLDVGNFDYKFLNIMKY
                     TNESLIYIHHLPGLIDQCEPGHIDEFIFQSQHEVFKTCKKIINLIDEQLDDFEIFKLQ
                     PLLSLIVLKCLKILQSTRTVLQGMIDLNEMLSTDMLNGKIRKVIETTDNNVARCVNLR
                     LPNELAKSCLMNIANSKNVGIRLIKTSTNSAVDHASMLKSWCHLTDDYMVTRLTNDSR
                     NGWCS"
     gene            complement(<75399..>75860)
                     /locus_tag="FOA43_000020"
                     /db_xref="GeneID:62193421"
     mRNA            complement(<75399..>75860)
                     /locus_tag="FOA43_000020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920356.1"
                     /db_xref="GeneID:62193421"
     CDS             complement(75399..75860)
                     /locus_tag="FOA43_000020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776284.1"
                     /db_xref="GeneID:62193421"
                     /translation="MSNLINKLSEKLGGDHEESKTSQDYDQQQSQGGVKSQSGNSRPQ
                     GWDQDDMGAENLGTEDSQDTRYQGTRSQGTRSQGTRSQGTRSQGVRQNQGIGQDQGTR
                     QDQGLRSGEHGGQGLRGKAGFESTGEQSMPQQETTRHRDEYETTYGHERDI"
     gene            <76271..>76978
                     /locus_tag="FOA43_000021"
                     /db_xref="GeneID:62193422"
     mRNA            <76271..>76978
                     /locus_tag="FOA43_000021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920357.1"
                     /db_xref="GeneID:62193422"
     CDS             76271..76978
                     /locus_tag="FOA43_000021"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776285.1"
                     /db_xref="GeneID:62193422"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF13242"
                     /db_xref="PFAM:PF13419"
                     /translation="MTVQVHRMILIPSKVGDLVVKGLIFDMDGTLTKPQSYMFKEMRE
                     ALDIVDKPIDILTQLESLPRIQREIAAKRIQDIEHRAMLKMQPQKGVEDLFKFLHEET
                     DLKFTICTRNLITPVNYLLDHFLDGIKLHEPIITRSFDPPKPSPKPLLHISESWGIKP
                     ENLIMIGDSRDDMFAGLRAGCSLVLMRHKDNGHLVEEIPEIDYIVDDFHQLIDILQNG
                     FEVKPKVARKMTGFSGY"
     gene            complement(<77004..>78297)
                     /locus_tag="FOA43_000022"
                     /db_xref="GeneID:62193423"
     mRNA            complement(join(<77004..77010,77081..>78297))
                     /locus_tag="FOA43_000022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920358.1"
                     /db_xref="GeneID:62193423"
     CDS             complement(join(77004..77010,77081..78297))
                     /locus_tag="FOA43_000022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776286.1"
                     /db_xref="GeneID:62193423"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="InterPro:IPR036168"
                     /db_xref="PFAM:PF00928"
                     /translation="MHPLNPLQYYQFFKDFTLVAKAFLETDILTGAIVESYSYRLVMI
                     LQEMVDASYPYIGDLNQLRELLPNSSIIKKIISTTRQLQRSATNSLHPMNQRPAVLPG
                     TIAPRITYVPKNSSIFEKSGNEIPWRGVNIKYTQNEIFVDVIERIDYIVGSSKSPLLN
                     SHAQFNSSGSAYYDLLTVSNDRSMVVRKAHPPVSANIQGQIVFSSSLSEMPQIELILD
                     PARHNLGIPSFHKCVDLGSWLSDHHTLEFIPPDEKFTLMEYSINLLEELGKNNFYNST
                     GLVEADMTTGLGIAKNMFEIRLQIKIMHTVECVDNLKLDIYLPRDYGYTIKVVRITQG
                     SVELKESGRYEWIFDKQTPTGLSCVLRGEIRSDEQEEADVTDDPLFDATKAKVVKPRF
                     VRLSYENKGCVPSGI"
     gene            <79269..>85007
                     /locus_tag="FOA43_000023"
                     /db_xref="GeneID:62193424"
     mRNA            <79269..>85007
                     /locus_tag="FOA43_000023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920359.1"
                     /db_xref="GeneID:62193424"
     CDS             79269..85007
                     /locus_tag="FOA43_000023"
                     /note="BUSCO:EOG093401HY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776287.1"
                     /db_xref="GeneID:62193424"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022707"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR038718"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF12054"
                     /translation="MSRLDRLVTLIETGSTPFIRNTAADQLSDLAKQHPEDIISLLSR
                     VYPFLQNKKWETRITAARALGGIISHASQWDPNCEEEDTAVDAEAAVTDQNFEEVLAK
                     CEGDLVTLADFSLAEVLQSGVVLLASSGVEYNLFSTEGAGADGSSKRRKSTFTTKLGL
                     DRVKKEAAVSQQLLESQELKQEPHVKKEVKKEDTIPMQVQPTSSLPPHPHHVSARMRA
                     LAKRKAKAARSHNHRNVNVDLMKSSVSRELFHSGNLNEDEKVKKESYDVTSQAQGSKL
                     VVESKVEISPLLEEQSKYSKYAWQFQGIYELLVRDLLSDVWEIRHGCALGLRELIKYQ
                     ATGAGRVKGKSREENDYRNRRTLEDLCVRMITLFAIDRFGDYVSDTVVAPVRENAGQV
                     LAALLLHLPDDTVLTIFDTLVTLIRQDPAELGTKVPCWEAKHGGILGLKYFVSIRTDL
                     LFAHPELLDRTIALVLYCLSDNGDDDVQSMAAATLIPITKEFVNLRLDMVFEVLNAIW
                     SNLSDLKDDLSASTGSVMDLLAKLCLHKKVLEKMKEYALKNEKFKFKFLVPKLYPFLR
                     HSITNVRKSMLKTLLAFLQIDDDSVKDWIDGKTFRLIFQNLLMEQNAEVTQLSMKVYQ
                     KLLEEVGKGGHGCMDDLFQEHWLPLLKLLTTPIGVARFNYSMDTKYILRPSGSTLASS
                     DIRLTGFNVQHMHGRKRKLTSPSENDDDEAETKRVLAGIPDSEYDLRVNIDAPVINGD
                     LTLVSKEVLIHTRMFAATAMGLTLARYENENNLDQIWKQITHYLNDSHSTPRLLLAIV
                     VDEYCKACDKLGKQPSQSSKTAFMPIFQEALNDPSSLPTFREFVPTLRGLRTQCLQLL
                     GVFREIGRISSSKLPTLAVVVEGERDSGPGAFGISTAENIVGDWYKKTYKSMPALYRM
                     SAIQPLEDTKHRISMGVAEAKTSKVSRATSILASYASCFVRLDGLPKKLNPIIRSLMD
                     SIKTEESPQLQSRSAEAVASLIILLHERGKVGASDKMVKNLCAFLCVDTSEVPEFIPN
                     RQYKNIVLSLKKEETKTGPAELAAAEREIHLAKIKRRGSKMALDTLLEEYKGSLFDKI
                     PKIKSMMLDALEIFDVDEERVPTDREGQAAIDSLELIRSLVGKLDKTLYSEIFDRAHL
                     VLKALQSSYSVFRYSASKCMGSVCATAPSIGFRTLVKSILPMLSNPVEVTQRQGAIEC
                     IYHITNLMGSDILPYVVFLIVPVMGRMSDSDQNVRILATTTFASIIKLVPLEAGIPDP
                     ADMPKELLAGREKERDFIQQMMDPSKIKPFELPVSIKATLRKYQQEGVNWLAFLNRYH
                     LHGILCDDMGLGKTLQTICIVSSDHHLRQERFEKTGASDARKLCSLIVCPPSLTGHWE
                     QEFAQFAPFMSVLVYAGPPVVRAQLRPKMSQYDIIVTSYDAARNDIEYIIQSEYNYLV
                     LDEGHIIKNAHSRLTQAAKRIRAEHRLILTGTPIQNNVLELWSLFDFLMPGFLGTEKA
                     FHDKFVKPIASSRTNKGSREQEAGALALETLHKQVLPFMLRRLKEDVLSDLPPKIIQD
                     YYCELSSLQKQLYQDFISKQKGSVKKELGDTEKDGKQHIFQALQYMRKLCNSPALVLT
                     PKHPQYKEVTAYLHRYNMDINDIHHAPKLMALKNLLKECGIGLSGDLSSATGSAELLQ
                     ENVISQHRALIFCQMKDMLDIVENELLRKRMPSVTYMRMDGSTDPRYRQEIVKKFNSD
                     PSIDVLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRIGQKKVVNVYRL
                     ITKDTLEEKIMGLQKFKLNIANTVVNQQNAGLSSMDAGQLLNLFDDDANGAIKAGELG
                     GGDNTYEGDTDNNGGNSSDKTAGGGAEKDVPNEVGLSGKLGNAVKGLGELWDESQYEE
                     EYNLDSFIKTLK"
     gene            <86486..>89060
                     /locus_tag="FOA43_000024"
                     /db_xref="GeneID:62193425"
     mRNA            join(<86486..87232,87303..>89060)
                     /locus_tag="FOA43_000024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920360.1"
                     /db_xref="GeneID:62193425"
     CDS             join(86486..87232,87303..89060)
                     /locus_tag="FOA43_000024"
                     /note="BUSCO:EOG09341IA3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776288.1"
                     /db_xref="GeneID:62193425"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="PFAM:PF00515"
                     /db_xref="PFAM:PF07719"
                     /db_xref="PFAM:PF13181"
                     /db_xref="PFAM:PF13414"
                     /db_xref="PFAM:PF13428"
                     /db_xref="PFAM:PF13432"
                     /translation="MNQQLLGQTLNGARGIPLQQQQAVQAQAQAQAQAQAQAQAQAQA
                     QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQAQVQAQAQAQAQA
                     QAQAQAQAQAQAQAQAQAQAQAQAQNQSQNIDPNSLDGRFAHENAETWIAIGSCADTI
                     GSVEKAVEAFSTALRYTPNNPKALTKLANVYRTRDAFAEAADLYRRALSLDQNNGETW
                     GLLGHCYLMLDDLQSAYTAYQQALLNLQNLNAFVRVLEMDPNFEKANEIYFRLGIIYK
                     LQGKLQKALECFNYILTMPPAPLSQSDVWFQIGSVLEQNRDYTGAKEAYERVLQTNPN
                     HAKVLQQLGCLYSQQEAPFHDSDIALHLLRQSLELNQADAHSWYYLGRVYMSKQDYPN
                     AYEAFQHAVNIDSRNPTFWCSIGVLYYKISQYKDALDAYTRAIRLNPYLSEVWYDLGT
                     LYETCNNQIGDALDAYHRAASLDPNNPHIQERLIQLTKYQKEGGVLPPPPPPPQAAQQ
                     PMPQPETNTAAAIGGPGVVPPQLRQPPPPGPTGSSSTGPPLQFPGAQQLPQTAGSRVP
                     LPPPQQPQQQQQQQQQQLQSVAPLRPVSGSAQAHLPPVQQPENGNTDSSANEQVSLPP
                     ISTNSPSPTPAARAATPTGIVAHENHKRPGESEDNDYKRQKVEVEENSSEPEPAAEKP
                     KDKTDKKVDSPNDGLSEKPVEKLAEEASEQSVEKPVEPEASESETSETGAKKDVTSIA
                     DAAPSISPTEATDGDKESSSKETKPSIELKPLDKEEVAEIKTEKEEEEEKNKEKEKSI
                     SNGSNSSTSSSNSAEKDEAATEAPVRKIEEDEDYDD"
     gene            complement(<89205..>89501)
                     /locus_tag="FOA43_000025"
                     /db_xref="GeneID:62193426"
     mRNA            complement(<89205..>89501)
                     /locus_tag="FOA43_000025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920361.1"
                     /db_xref="GeneID:62193426"
     CDS             complement(89205..89501)
                     /locus_tag="FOA43_000025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776289.1"
                     /db_xref="GeneID:62193426"
                     /db_xref="InterPro:IPR018783"
                     /db_xref="InterPro:IPR038212"
                     /db_xref="PFAM:PF10163"
                     /translation="MTNESPDELRLRIQQELVASGKYQEIYNLLKVELVNSGWFDKFR
                     DMTNDTISPKGENGDLKFGEIVGQLEGKGFEMVPDDVKVKVLRKIKEFLDGVVE"
     gene            <89681..>90343
                     /locus_tag="FOA43_000026"
                     /db_xref="GeneID:62193427"
     mRNA            <89681..>90343
                     /locus_tag="FOA43_000026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920362.1"
                     /db_xref="GeneID:62193427"
     CDS             89681..90343
                     /locus_tag="FOA43_000026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776290.1"
                     /db_xref="GeneID:62193427"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="InterPro:IPR020476"
                     /db_xref="PFAM:PF00293"
                     /translation="MSITTSSAAKKTVDLALAKVTKITPLTNDQSRFIRLSKIKYQGA
                     DGKMRDWEMADRTTRPKGMEIDGVGIMAITKTHKAGEVPNIVLQKQFRPPVGGICIEM
                     PAGLIDPNETVEQCALRELKEETGLVASIKTVSPKVFNDPGFTNTNTVIVTVEVDMSL
                     EENIHPVTHLEENEFIETFTVPLNNFYESLVDLQNKGYRVDARVQNVAEGIKLAKELG
                     LS"
     gene            <90768..>91649
                     /gene="SPE3"
                     /locus_tag="FOA43_000027"
                     /db_xref="GeneID:62193428"
     mRNA            <90768..>91649
                     /gene="SPE3"
                     /locus_tag="FOA43_000027"
                     /product="putrescine aminopropyltransferase"
                     /transcript_id="XM_038920363.1"
                     /db_xref="GeneID:62193428"
     CDS             90768..91649
                     /gene="SPE3"
                     /locus_tag="FOA43_000027"
                     /codon_start=1
                     /product="putrescine aminopropyltransferase"
                     /protein_id="XP_038776291.1"
                     /db_xref="GeneID:62193428"
                     /db_xref="InterPro:IPR001045"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="InterPro:IPR030373"
                     /db_xref="InterPro:IPR030374"
                     /db_xref="InterPro:IPR030668"
                     /db_xref="InterPro:IPR035246"
                     /db_xref="InterPro:IPR037163"
                     /db_xref="PFAM:PF01564"
                     /db_xref="PFAM:PF17284"
                     /translation="MSELTHPMIKDGWFSEISNTMWPGQAMSLRVEKILHVEKSKYQD
                     VLVFKSTDYGNVLVLDGAIQDTERDEFSYQEMITHLAMNSHPNPRKVLVIGGGDGGVL
                     REILKHDTVEEAHLCDIDDAVIRVSKKYLPEMSKSYRDPKVHVHIQDGFEFLKKYQNT
                     FDVIITDSSDPEGPAKSLFQEPYFKLLSDALTGKGVMTTQGECIWLHLPLIKEVKADC
                     KKVFPVVEYAYCTIPTYPSGQIGFMVCCKDKTANLQKPLRTVDSETERKLYTYYNKEI
                     HEASFVLPNFARKALEN"
     gene            complement(<91682..>92887)
                     /locus_tag="FOA43_000028"
                     /db_xref="GeneID:62193429"
     mRNA            complement(<91682..>92887)
                     /locus_tag="FOA43_000028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920364.1"
                     /db_xref="GeneID:62193429"
     CDS             complement(91682..92887)
                     /locus_tag="FOA43_000028"
                     /note="BUSCO:EOG09342YU9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776292.1"
                     /db_xref="GeneID:62193429"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00155"
                     /translation="MTFDISKIIRPNILTLEPYRCARDDFQEGILLDANENTYGPGLD
                     RLSTTEKALNLNRYPDPHQIELKKKICAYRNSQALKPESLIKVPSGQELTADNLCLGV
                     GSDESIDALIRASVKPGAEKVMLCPPTYGMYSICCVVNDVEIVQVPLNLDTFQIQPDK
                     ILEQLRRDPAIKLVYITSPGNPTATLIKQDLLLEVLRGIERLSWNGFLLLDEAYIDFS
                     PIGSSMCVLVNKYKNLVVMQTFSKAFGLAGIRLGITYSTPELSSLLNAMKYPYNVSNI
                     TSSIALRATNLSSLKKMRATVDVIVEQRSLVLEQILKLKGVGRNIGGTNSNFILIELL
                     NRQGVADNAVAREVYSKLATERQVVVRFRGNELGCKGCLRITIGTPEENRKLLEQFEQ
                     VLNEVYEKS"
     gene            <93098..>94958
                     /locus_tag="FOA43_000029"
                     /db_xref="GeneID:62193430"
     mRNA            join(<93098..93713,94060..>94958)
                     /locus_tag="FOA43_000029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920365.1"
                     /db_xref="GeneID:62193430"
     CDS             join(93098..93713,94060..94958)
                     /locus_tag="FOA43_000029"
                     /note="BUSCO:EOG09344ES3;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776293.1"
                     /db_xref="GeneID:62193430"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR003462"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00583"
                     /db_xref="PFAM:PF02423"
                     /db_xref="PFAM:PF13508"
                     /translation="MQSENARSVYMERGSEIAQAKILEDEIKAHFPLSITCKNESRCI
                     ITPYVLGVESVSQHQLLQCLEILTSNLGETYKKLHGRLWKVDKIREMNESGLVYALLK
                     KDSTLIGFMSMKLVVDDNLSVIYLYEIQIANYYRGMGLGSQLMEAFSSLPDSINANTE
                     YLDKFGPIDGTSLTVFSTNERAIQFYRRHGYRNSRHSPTDKITTNVITTQYATHIFMP
                     SIGTTVGMKTVTGSSKGFNGLTTILDKEDGHPIGILNAATLTAFRTALCTSLVLTETF
                     PLNDPESSIGGNLICYGVGAQAEWHIRLALLLYGDRFKQVVIVNRTVSKAHKLTGMIH
                     KEFPQIIVTTCALNDTDDLLTFYEDASVIFSCVPTTSPTVLNCEIDANNRDKIFIGAI
                     GSFKPQMIEIEGELIKQKCLAKGGKVIVDSVSDCLAEAGEFIQNDIGEESLIELASLF
                     VEPSSKNAKKQIEYLKKGKVVISKLVGLAIMDVSIGNAILSLAKERNIGTAVEF"
     gene            <95094..>96920
                     /locus_tag="FOA43_000030"
                     /db_xref="GeneID:62193431"
     mRNA            join(<95094..95099,95154..>96920)
                     /locus_tag="FOA43_000030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920366.1"
                     /db_xref="GeneID:62193431"
     CDS             join(95094..95099,95154..96920)
                     /locus_tag="FOA43_000030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776294.1"
                     /db_xref="GeneID:62193431"
                     /db_xref="InterPro:IPR024319"
                     /db_xref="PFAM:PF12921"
                     /translation="MLTRLYSKSRRFARLDKESNATLLTYHDLELFERYLKGTDFAAP
                     QTKHDKEDAGHSNRHFEFTGRQLSRLISNTMSPFSSSQGTAATVNENDLDVKHGNLHG
                     LNEKQWITISKIKLCLKSADDEALYDILKCNQNVIPTLVERLSPFQTSLLIKRLTDYQ
                     IAISKQFTVEQKYSSRLHSDSNMRGLVQMKDKTYQGVRSILRKIGRNHHLNNLDYETI
                     VSFCMGNLRYRDAIEFICEMETKIRQGDTSLKLRNSLWADKISILCRSTEKTWSLGRY
                     DLKSNRAQILPEDYSYPLLNGRGVATLVKQYEDSNLIPDRRVYEALILASGKSKEMSQ
                     LDSLILNVWGVNAKTGEMVEGFQIPKKNSLDYPNFDILRSIVLAYTYNSELVKPLSVC
                     NTIIENYDLDSIRSQKYWETVLQCTALQCENVYREIQTKLWKAGADKDEYSCEMLLSE
                     DIFDEMWEHIIKIVQKPSKSMVRLRLSYASLKALLRDLPKIHQRSVDPAVNITASEAA
                     YNENLLFSYLNVCRIRLMKLRKFYQTEDMINRFSINKQMKQTLLRRLNSYQQRYLKRV
                     KDKRVLERQRIRDDDDEDSMLGLW"
     gene            complement(<96931..>97902)
                     /locus_tag="FOA43_000031"
                     /db_xref="GeneID:62193432"
     mRNA            complement(<96931..>97902)
                     /locus_tag="FOA43_000031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920367.1"
                     /db_xref="GeneID:62193432"
     CDS             complement(96931..97902)
                     /locus_tag="FOA43_000031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776295.1"
                     /db_xref="GeneID:62193432"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="InterPro:IPR024078"
                     /db_xref="PFAM:PF02585"
                     /translation="MGGGGYTLNRVFLKLFSAFFLWVFISTISPCILKSYFPGLLITS
                     LPDNDGYLHSSSLYQLNAETVISNDLVNSDIVLVTAHPDDESMFFSPTIMELNKKNYG
                     NQIHLVCLSNGNFDGLGEVRRHEVDKASQYLDISSVVVLRFEDNISKEWDPVEISQRL
                     NGELPKMHFSSKRLIFLTFDEDGVSGHPNHQSLFYGVKRFVDSKDRVFMRMDIRFFKL
                     STWPIYKKYSGFFWVNFELLRKTIRELGVFDKIRFLCNEFFANVSPLKSATVTKAPVM
                     IYNNFNTWIVSLSTMTYAHYSQIVWFRWFWIFLSKYMNSNELVEVLP"
     gene            <98232..>99635
                     /locus_tag="FOA43_000032"
                     /db_xref="GeneID:62193433"
     mRNA            <98232..>99635
                     /locus_tag="FOA43_000032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920368.1"
                     /db_xref="GeneID:62193433"
     CDS             98232..99635
                     /locus_tag="FOA43_000032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776296.1"
                     /db_xref="GeneID:62193433"
                     /db_xref="InterPro:IPR031467"
                     /translation="MTDLLTVLTSSDAIAKKEVNIPSKKILESTLEQKENYRTPFIGF
                     NYTDYLDVALTNQTQPLFTRYEEYISIKDSQARDYRHANKNFLDLMMDYSKRTFIPLN
                     VLQRHFTCNQVSLPEDIEERVISQIYQANTPEQVSRLVLALADKLNRYTVANIVSGML
                     LYLLKEKSEQSASAIRSLAQYVAFEVVEFDQAEIEGLVGQLAINGEMDHASLIISSFD
                     KINGPATNFINSASPSIKLELFDGYTCSRSFQLASEYLESLIIVDKACPPTESIEKYL
                     EMVSSIAGAIKSNFRSKKLVFNAYSSSVAYTMRVPGTLSAKLVKIIIPWLTKSEFPWF
                     VNFLKLCPGYQNVMPKCAGKLLETYAKEIGRLDDSNVDKSISLTAFISQMEIPKSSFD
                     SETKQLIATLYATFKSPIATKLWVDNLEKKADSDFINELIKLLKPNLKGSMIDQPLPG
                     RLPSDSLRVIEQLRDEI"
     gene            complement(<99646..>100425)
                     /locus_tag="FOA43_000033"
                     /db_xref="GeneID:62193434"
     mRNA            complement(<99646..>100425)
                     /locus_tag="FOA43_000033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920369.1"
                     /db_xref="GeneID:62193434"
     CDS             complement(99646..100425)
                     /locus_tag="FOA43_000033"
                     /note="BUSCO:EOG09343RUC;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776297.1"
                     /db_xref="GeneID:62193434"
                     /db_xref="InterPro:IPR002809"
                     /db_xref="InterPro:IPR008568"
                     /db_xref="PFAM:PF01956"
                     /translation="MNILIDSLIKLWVLLPISVVMVLVGILRTYITLLFQPSPSLQDR
                     ELVRQQQHLARLGNYLNNRSVFNSKRDYDTKLSYLVNEYSEDKYLKVKFPKDPSQENP
                     ANPLEALTSPASNDMLMQSVKASIANYVPQSVIMWWVNYFFKGYIIMKLPFDVTANFK
                     SMLQTSINTPDLDASYVSSVSWYFVNLLGLKSVYALIFNDNSLANKLMAQQQQQPIQP
                     QIAGAGPSPKQLFQSQLENLKIAPFESCLTDVTDRVVKMYK"
     gene            <100556..>101566
                     /locus_tag="FOA43_000034"
                     /db_xref="GeneID:62193435"
     mRNA            <100556..>101566
                     /locus_tag="FOA43_000034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920370.1"
                     /db_xref="GeneID:62193435"
     CDS             100556..101566
                     /locus_tag="FOA43_000034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776298.1"
                     /db_xref="GeneID:62193435"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR036526"
                     /translation="MKLRIAAVQLNPIIGHVEDNCRRAVQIIEMAFKSRQPPDLIILP
                     ELALTGYNFRNREHINPYLELKGQGRSYKLGRQLSEKYHCHTLLGYPEKSRLSSNDFK
                     VYNSAILISPSGDVVFNYRKTFLYETDENWGCVESPDGFQAFNLNIKGHTFKTSIGIC
                     MDLNPYKFKAPFDKFEFANFCYKNDVDLVLLPTAWLNTSWSEDWTQNDVDKYTKLYHK
                     EEAIEVNTDESQNEIILAPEEPDHFVRCEPDKKTGRYWILRMNPLYTKPHPGKKKLVI
                     ICNRSGMEGSMMYAGTSSIFEFNGGPSRFNEATGDMFIDFNVDGSLGQGNEGVLLRGV
                     EI"
     gene            complement(<101632..>102420)
                     /locus_tag="FOA43_000035"
                     /db_xref="GeneID:62193436"
     mRNA            complement(<101632..>102420)
                     /locus_tag="FOA43_000035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920371.1"
                     /db_xref="GeneID:62193436"
     CDS             complement(101632..102420)
                     /locus_tag="FOA43_000035"
                     /note="BUSCO:EOG09343ZVI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776299.1"
                     /db_xref="GeneID:62193436"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR036638"
                     /db_xref="PFAM:PF00010"
                     /translation="MSGKRTQHSETAVSGSKRSRVEEQAPTQTRDSHASGDPEGADGG
                     KDRNEVSTKLEENDSNNKPEDNSEKEKINGDETDSTVLSAVSAAATAAAATAAAVEAN
                     VAAKLEAALPPHSVNATLTVPQVTQLPPEMGKPAHGTEEWHRLRKLNHKEVERRRRES
                     INMAIHELQDLLPTHNSNKSQIIKRAAEYIRRLKENESANIEKWTLEKLIMDQTVNEL
                     ANSNEKLKSELEKAYREIEHWKKVFFDTQKEIDRLKKLNNAEKS"
     gene            complement(<102714..>103775)
                     /gene="FPS1"
                     /locus_tag="FOA43_000036"
                     /db_xref="GeneID:62193437"
     mRNA            complement(<102714..>103775)
                     /gene="FPS1"
                     /locus_tag="FOA43_000036"
                     /product="glycerol channel"
                     /transcript_id="XM_038920372.1"
                     /db_xref="GeneID:62193437"
     CDS             complement(102714..103775)
                     /gene="FPS1"
                     /locus_tag="FOA43_000036"
                     /note="BUSCO:EOG09342N1Z"
                     /codon_start=1
                     /product="glycerol channel"
                     /protein_id="XP_038776300.1"
                     /db_xref="GeneID:62193437"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR033749"
                     /db_xref="PFAM:PF00348"
                     /translation="MKADKAGSRSKFLSVFPDLVDETIEVLKSYGMPQDAIQWFKQNL
                     DYNTPSGKLNRGLSVVDTYGILKGYQTVEDIPVEEYKRAAVLGWCIELLQAYFLVADD
                     MMDQSITRRGSPCWYKVEGVKEIAINDAFMLEGAIYILLKKYFSNESYYVKLMGIFHD
                     VTFKTECGQLLDLITAPEDSVDLNKFSLDKQMFIITYKTAFYSFYLPVALAMFMTGID
                     NEKDLSQAREVLIPLGQYFQIQDDYLDCFGKPEDIGKIGTDIQDNKCSWVVNTALNVC
                     TPEQRKVLDENYGRKDAVKEKKCKDLFYALKIDDLYHQYEENEVAILKEKIARVDETR
                     GFKGEVLTAFLSKIYKRKK"
     gene            <104055..>104984
                     /gene="EBP2"
                     /locus_tag="FOA43_000037"
                     /db_xref="GeneID:62193438"
     mRNA            <104055..>104984
                     /gene="EBP2"
                     /locus_tag="FOA43_000037"
                     /product="rRNA-processing protein and EBNA1-binding
                     protein ebp2"
                     /transcript_id="XM_038920373.1"
                     /db_xref="GeneID:62193438"
     CDS             104055..104984
                     /gene="EBP2"
                     /locus_tag="FOA43_000037"
                     /note="BUSCO:EOG09343G8X"
                     /codon_start=1
                     /product="rRNA-processing protein and EBNA1-binding
                     protein ebp2"
                     /protein_id="XP_038776301.1"
                     /db_xref="GeneID:62193438"
                     /db_xref="InterPro:IPR008610"
                     /db_xref="PFAM:PF05890"
                     /translation="MTEIMSKDSEYKSHTLSKKEHRLLRKLGKKATEDKKEVKEDKGT
                     KGMDLNILDESDDENEVEDFESEKKEEEEEKEETDDVPYSDVELDDDADVVPHTKLTV
                     NNNAAIKQAYASISIPWEKHPFDESQSIMYHEKVELEIKDIYDDTERELAFFKQGLDA
                     ANEGRKKLLALKVPFSRPADYFAEMVKSDEHMEKLRLKLVAEATDKKAKEEAKRQREL
                     KKFGKQVQHETLQQRQKDKHDTLDKIKSLRKKRQNNEIDNKEFDVGVEEASAGKEEVS
                     RKKRRIHNQVMSKSKDKGKQQRPGKSKRRHWKK"
     gene            complement(<105025..>107946)
                     /locus_tag="FOA43_000038"
                     /db_xref="GeneID:62193439"
     mRNA            complement(<105025..>107946)
                     /locus_tag="FOA43_000038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920374.1"
                     /db_xref="GeneID:62193439"
     CDS             complement(105025..107946)
                     /locus_tag="FOA43_000038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776302.1"
                     /db_xref="GeneID:62193439"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031950"
                     /db_xref="InterPro:IPR035647"
                     /db_xref="PFAM:PF00009"
                     /db_xref="PFAM:PF00679"
                     /db_xref="PFAM:PF03764"
                     /db_xref="PFAM:PF16004"
                     /translation="MDEYDEFGNPIGGSAGESSESSSISSEDHDELKQIVENEESDHE
                     EKGIETSSNQIILPEDKAYYPSAEEVFGSEVETIVATVDAKNINEPIVEPLDEEAFKI
                     EEKDLPETMYSKQYMWELMKIPSKVRNVALCGSLHSGKTSFVDMLVNETHKLSTPSSR
                     YTDNQTLEVDRGITIKASTMTMLLGDISGHSLVVNLIDAPGHTNFIDEVAASVRLADT
                     MVIVVDALEGVTKSVELALKIAVNTNTEICLMVSKIDRLIMEVRLTPLDAYYKIRKTI
                     EEVNDVLKAVGGENVSPVLSPALGNVCFESATFNICFTLMSFAKLYIQQRKLNAISAY
                     DLAAKFWGDSYFLDGKFTKITDDVLGSASSRTFVKFILEPIYKIVTRAITLDPENLEE
                     FVRKKLGILDIRHPEFKKDPRVLLKRLLGSYFGLSSSPFAEMLRDIGPSPIRNAPNKL
                     KSLYVSEKLDSITEHVQKCDCDGPLIAYVSKLVNSRDGSRFYAELRVLSGTLKPSSSV
                     KLLGESYSQEFAEDMKVQDVRRTFLECGRYRIKVEGIPAGSIGLISGHGIDSFITKTA
                     TIYDIHIPDDQMHIFKPMGHVLQPVFKVAVQPFNPSDMAKFTEGLKHTNQSYTGCEIK
                     VEEGGEHAIIGYGELYMDCLLRDLRKLYTKIDIKVSDPMTRFAETCVDMSMVKLDIKS
                     NNQKNSITIIAEPLDPQISSDLEGALITMSTPARKMSKIFRQKYGWDALAANSIWAFG
                     PVENHSTCVLCDDTLPDETNKDSLMAVKESVIQGFRWAAREGPLCDEPIRDVRFRIID
                     ARISPDFIEANSAQIIQMVRKACHCALMTGTPRLLEPLFEIEITCLSKIAGKMGRFLD
                     KRRGSIIYRSFIDGTPLSKVIGMVPVIDSVGLETDIRLLTDGKAMCQSVFTKWQVTPG
                     DPMDSTCYIPLLKPAPIKSLARDFTMKTRKRKGLDDEPSLQRYVDEETWHKLQSTGLF
                     E"
     gene            <108084..>109982
                     /locus_tag="FOA43_000039"
                     /db_xref="GeneID:62193440"
     mRNA            <108084..>109982
                     /locus_tag="FOA43_000039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920375.1"
                     /db_xref="GeneID:62193440"
     CDS             108084..109982
                     /locus_tag="FOA43_000039"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776303.1"
                     /db_xref="GeneID:62193440"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MDSNSDERPRITIRQSIYTALPNTDILNTQEIQRALRGIGQQVV
                     QEIYLDDDNGQNVEHFDYKPELKRHFSVASIVGLGFSIMNVPFGISTTLSLGLVCGGS
                     VTICWGWILFGFFSVLITLSLSEIVSKFPSSGGVYHFSYLLANEKYGLVTSWYTGWFL
                     IIGNWLMFISCAFGGSQFILSIFGLKESDYRHDDYVVLLLYIIIVVVSGFVNLQCQKY
                     LEKLNKLCIYWTVYTILIMDFLLLLFSTEYHDLKYIFTHFDASRSGWPPFLAFVIGGI
                     QFSSMTFNGYGSITSMSEEVLTPETTIPKGMIYSVLISTFIGISFIIPILTILPDLER
                     LLDDNPDIFPIDIVFKLSTKSFLVSIVLVLLIVGSLVFATVGTLTTASRVVYAFGRDN
                     GLPFNYLWQRVDTMKDEEIVPKNALLLSVGFASLMGFFSLLSSSAFSAFIGCSVIALN
                     VANGIPILSSLLGRRRKIRGAVFKLRKFGYLINILSCLFIVFTIVFLSFPASSYIDLK
                     TMNYAFVVFFFFVVLITASWFGWGRNHFQGPPINHTDFIERGESSSSSDPRVMEIPLQ
                     DASSSVVFSQQKEDRAATNSEDVAGRNTFIVSEDSDSDSNSGITDVFDTGDLTVPKAA
                     KMADLVAK"
     gene            <110220..>111536
                     /locus_tag="FOA43_000040"
                     /db_xref="GeneID:62193441"
     mRNA            <110220..>111536
                     /locus_tag="FOA43_000040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920376.1"
                     /db_xref="GeneID:62193441"
     CDS             110220..111536
                     /locus_tag="FOA43_000040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776304.1"
                     /db_xref="GeneID:62193441"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF01926"
                     /translation="MVEIRPFLLPANWTHRRYYKNLPKEKRTRFIDEMQNASIHKDEK
                     QVLDIIPATLDDVLGTIPRNSDSRIIYCLSARDFPLSLAKRFFRLAQLRGLNFNNIYY
                     VITMLDSISNNLDTDTFARYKQYYTISLRKFVEELALKMKFDICDDHMFVVSDKVQKP
                     LLQLYESIPLHSCTYYVIGETNSGKSKLSKRLMKLAMKEGKCVKRVDDENGDSKDEDV
                     DSRQNANHFYTVSPSPFRTRKNMTYYAPQFDFTLIDTPGYLQKRNGIFGILNERLRLN
                     LYTQYQVDSAPLGVEFKSPTTTEVFSIGEFFFIKPRGITGFKYRRFMYGKPAVYSRYS
                     AATRKMARSDRLVTPKMRRYLIPPFKGKIDLIFDNMGYIEIDNFQGDGSDYWQIFAPQ
                     NIKKLIRIPSMSVSLLSGQLADYAPFLEIPMTVNVQDFISDHPTEM"
     gene            complement(<111601..>113124)
                     /locus_tag="FOA43_000041"
                     /db_xref="GeneID:62193442"
     mRNA            complement(<111601..>113124)
                     /locus_tag="FOA43_000041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920377.1"
                     /db_xref="GeneID:62193442"
     CDS             complement(111601..113124)
                     /locus_tag="FOA43_000041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776305.1"
                     /db_xref="GeneID:62193442"
                     /db_xref="InterPro:IPR022703"
                     /db_xref="PFAM:PF12051"
                     /translation="MKENSSSVSGSPQEYENASGLEELDKSQPESATSRLLRSVSQYT
                     AYSVASGQAARDTQEEEEHHEGVADPPPAPKFGFWASENSDLRKTAFKQWGFTILLLS
                     AYVLAVFSIYWGSMYNRYDRLINLKVLVVVEDDESGVISSSLLRAINSSSVNRLAGWT
                     VKKYMPPEEVVKLVHTEKYWGSIYVSSNNASTELVSALQNNSTLNDTGLVVSYYETAR
                     DMIAVASYVKPALLEAGGIYGNIMQTQIYPQLVANLSSDQFGALQMNPLLTNTPNFEY
                     VDGNPVISSMMLAPLQVGLIYIIILSFFQILWFIKLNGELAQRVKPVSYIITRLLMSQ
                     ANFLILSLAYTCLNKAFQIDLNRAWKGGFGVMWMVSYLLMAAVGGANENVSMVTAATL
                     PPATGFWILFFVIINISATFAPIELCPQVFRFTYAMPIKNGYEIMKVVLMDTYRGNLG
                     RNFGVLVAWLVLNSILQPFCMLFFAYMTKRRLEKQGLANIAADKKAEAERELKVNEK"
     gene            complement(<113517..>113963)
                     /locus_tag="FOA43_000042"
                     /db_xref="GeneID:62193443"
     mRNA            complement(<113517..>113963)
                     /locus_tag="FOA43_000042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920378.1"
                     /db_xref="GeneID:62193443"
     CDS             complement(113517..113963)
                     /locus_tag="FOA43_000042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776306.1"
                     /db_xref="GeneID:62193443"
                     /db_xref="InterPro:IPR018854"
                     /db_xref="PFAM:PF10448"
                     /translation="MSNLGFEEGHREISRQLESCELTCRIVEFLDKVIVDIQKDGEMD
                     VSYDIQLGKTGIKKHPIGSTIEENVYDAVLDNNIVPTSLLDGSCNVKNQVVASQIGKL
                     MGELQKRNVIVNMSGKLFKGTEFEKSDFQRLQIVVKLVRDTYEKKS"
     gene            <114132..>115475
                     /locus_tag="FOA43_000043"
                     /db_xref="GeneID:62193444"
     mRNA            <114132..>115475
                     /locus_tag="FOA43_000043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920379.1"
                     /db_xref="GeneID:62193444"
     CDS             114132..115475
                     /locus_tag="FOA43_000043"
                     /note="MEROPS:MER0211636;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776307.1"
                     /db_xref="GeneID:62193444"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PFAM:PF00561"
                     /db_xref="PFAM:PF04083"
                     /db_xref="PFAM:PF12146"
                     /db_xref="PFAM:PF12697"
                     /translation="MTPLLMTSEEEEIHIGTPLIKDEELTDLGEMTTSAKVKTSIIIF
                     ISNVLSLFFLSVLTQLALLYYFYRIHIKREHRYTASDKDAYPIKKPKISLDLRYYAQL
                     LGCELYEYKLVTEDGFVIVLNRLVDRKILRADHNCKPILMIHGLLQSSGAFLSGGYKS
                     LAYLLVQNGYDVWLGNNRCGFDPQHTRYSINDPRMWDWDLTEMCKYDLTCMIDQVLKI
                     TKYSGKISLLGHSQGTTEITMLLSSQLSLGYEEKIDKCVLLAPAVYGGHLVNRKLFIK
                     FMRFLPNSLFDLFFGIHAFIPIMMFMRNHMYRSPMYGLSSYAMFSYLFTSDDYRWDRS
                     LRDIHFLFAPSYQSSKLMKWWLKGKGFREGKAILDEDVPWFNASTPELLLVIGEQDRL
                     VDGNLFYEHLKAKEVSMQGKFSRLSIPEYNHLDVMWADAVQETVGREMLHFLGTQ"
     gene            complement(<115491..>116243)
                     /locus_tag="FOA43_000044"
                     /db_xref="GeneID:62193445"
     mRNA            complement(<115491..>116243)
                     /locus_tag="FOA43_000044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920380.1"
                     /db_xref="GeneID:62193445"
     CDS             complement(115491..116243)
                     /locus_tag="FOA43_000044"
                     /note="BUSCO:EOG09343DNB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776308.1"
                     /db_xref="GeneID:62193445"
                     /db_xref="InterPro:IPR002140"
                     /db_xref="InterPro:IPR018023"
                     /db_xref="InterPro:IPR018978"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="InterPro:IPR036786"
                     /db_xref="InterPro:IPR037188"
                     /db_xref="PFAM:PF01172"
                     /db_xref="PFAM:PF09377"
                     /translation="MGKINQPSSQIRLTNVSIVRMKKAKKRFEIACYQNKVQDWRSGV
                     EKDLDEVLQIPQVFVNVSKGFVAPNDMLRESFGTTDLDKIILEILNKGELHLSGKERS
                     QQIAKLHNEVLTIISTKCINPKSKKRYPPTMIDKALKELKFNMTNARNAKTKALEAIR
                     ILVDKQIMPIARAQMKVRINVPSKLYILEEKELRANMFSTIESIKKIESETEIVCLIE
                     PENYKQLGAKMNELKGTVEVLDMAVIDDEATL"
     gene            complement(<116400..>116987)
                     /locus_tag="FOA43_000045"
                     /db_xref="GeneID:62193446"
     mRNA            complement(<116400..>116987)
                     /locus_tag="FOA43_000045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920381.1"
                     /db_xref="GeneID:62193446"
     CDS             complement(116400..116987)
                     /locus_tag="FOA43_000045"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776309.1"
                     /db_xref="GeneID:62193446"
                     /db_xref="InterPro:IPR007667"
                     /translation="MKVINKEERAAHDAAVKWGGAKGLVIGTAVSCGLYVAARFRYKK
                     ILALTASAKTAIFVTPPAFLISLYGELASNGFDRNMYSSESSQRAIIEEHKKWDAMST
                     KNKITITLNDNKYKIITGLWALSLWGSWEYASRDKLLSRAQKFYDARMYAQFITILLL
                     LGSIGLSVQDENKAKGKKLTNQDRYLNEMMSSEKE"
     gene            <117658..>118848
                     /gene="FAL1"
                     /locus_tag="FOA43_000046"
                     /db_xref="GeneID:62193447"
     mRNA            <117658..>118848
                     /gene="FAL1"
                     /locus_tag="FOA43_000046"
                     /product="RNA helicase"
                     /transcript_id="XM_038920382.1"
                     /db_xref="GeneID:62193447"
     CDS             117658..118848
                     /gene="FAL1"
                     /locus_tag="FOA43_000046"
                     /codon_start=1
                     /product="RNA helicase"
                     /protein_id="XP_038776310.1"
                     /db_xref="GeneID:62193447"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /translation="MEFNKDLDKSLKFKTTKSVPVVPTFEEMDLKEDLLRGVYGYGFE
                     APSAIQSRGIMQIISGKDTIAQAQSGTGKTATFAIGMLQVIDIKKKDTQALVLSPTRE
                     LAMQIQNVVKSLGDYMNVKCHACTGGRAVGDDTKQLAKGQHIVSGTPGRVLDMINRRV
                     LNTRHIRILVMDEADELLGKGFQDQISDIYKFLPPGTQVVVVSATLPKSVLVMTKKFT
                     NNPVKILVKRDDITLEGIKQYYIQVEKEDWKFDTLCDLYDSLTITQAVIFCNTKKKVD
                     WLANSLRKANFTVVSMHGDMKQEERDRIMNEFRLGNSRVLISTDVWARGIDVQQVSLV
                     INYDLPSDRESYIHRIGRSGRFGRRGIAVSFVTKDDVLTLHDLERFYTTEIEEMPGDL
                     GSIM"
     gene            complement(<118854..>119315)
                     /locus_tag="FOA43_000047"
                     /db_xref="GeneID:62193448"
     mRNA            complement(<118854..>119315)
                     /locus_tag="FOA43_000047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920383.1"
                     /db_xref="GeneID:62193448"
     CDS             complement(118854..119315)
                     /locus_tag="FOA43_000047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776311.1"
                     /db_xref="GeneID:62193448"
                     /translation="MTLQITSLLEDRTSISHDITCLAAATTLVPSVQYSCKDEQIDLN
                     ADDLSKSDNFTIIDISDNLSVDKTTCLSNSWQVTHVGIENWKFEDAGAETSKVDTLKL
                     VVLHGTQSELSMEPNSEVDDVVPRNDLKYTAQLATLFTERNKQLNEMIDLN"
     gene            complement(<119429..>120811)
                     /gene="SES1"
                     /locus_tag="FOA43_000048"
                     /db_xref="GeneID:62193449"
     mRNA            complement(<119429..>120811)
                     /gene="SES1"
                     /locus_tag="FOA43_000048"
                     /product="Cytosolic seryl-tRNA synthetase"
                     /transcript_id="XM_038920384.1"
                     /db_xref="GeneID:62193449"
     CDS             complement(119429..120811)
                     /gene="SES1"
                     /locus_tag="FOA43_000048"
                     /note="BUSCO:EOG093423F0"
                     /codon_start=1
                     /product="Cytosolic seryl-tRNA synthetase"
                     /protein_id="XP_038776312.1"
                     /db_xref="GeneID:62193449"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR015866"
                     /db_xref="InterPro:IPR033729"
                     /db_xref="PFAM:PF00587"
                     /db_xref="PFAM:PF02403"
                     /translation="MLDILQFIDEKGGDAKAIRESQKKRGGSVEIVDEIIAEYKKWTH
                     VRFELDELNKKQNKLQKDIGKKFKAKEDASELLKQKDEIVAQKLELANKEDEADKALR
                     YKVNQVGNIVHSSVVVSLDEANNSLEKTWTPEGLEFEKLTKTATGTQKPAKLSHHEIL
                     LRLDGYDPERGVKICGHRGFFLRNYGVFLNQALINYGLSFLLEKGYTPMQAPVMMNKD
                     VMAKTAQLSEFDEELYKVIDGDDEKYLIATSEQPISAFHSGEWFEKPAEQLPVRYAGY
                     SQCFRREAGAHGKDAWGIFRVHTFEKIEQFVLSEPDKSWNEFNRMIGVSEKFYQSLGI
                     PYRVVGIVSGELNNAAAKKYDLEAWFPYQQEFKELVSCSNCTDYQSRNLEIRCGIKAL
                     NQKEKKYVHCLNSTLCATERALCCILENYQTEDGLVIPEVLRKYIPGEPDFIPFVKEL
                     PKNSTSNKKK"
     gene            complement(<121008..>121880)
                     /gene="ATP3"
                     /locus_tag="FOA43_000049"
                     /db_xref="GeneID:62193450"
     mRNA            complement(<121008..>121880)
                     /gene="ATP3"
                     /locus_tag="FOA43_000049"
                     /product="atp3 gamma subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase"
                     /transcript_id="XM_038920385.1"
                     /db_xref="GeneID:62193450"
     CDS             complement(121008..121880)
                     /gene="ATP3"
                     /locus_tag="FOA43_000049"
                     /note="BUSCO:EOG09343KAJ"
                     /codon_start=1
                     /product="atp3 gamma subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase"
                     /protein_id="XP_038776313.1"
                     /db_xref="GeneID:62193450"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023632"
                     /db_xref="InterPro:IPR035968"
                     /db_xref="PFAM:PF00231"
                     /translation="MFRLGASQVFRATLAARARNYATLREIEMRLKSIKNIEKITKTM
                     KIVASTRLTKAQRAMASSRYFKGADQDFFEAAGTVAPKEAEKVLLIAVSSDKGLCGSI
                     HSSVAKVAKAKLQDYPNADIVSIGEKVKLQLLRTHPDNIRISFTGTGKVAPTFKEASL
                     IADEIAKLGRYDRVEIIYNKFASSVSFDSTAAPAYGKASIESSKNLSTFDIEDDSSAV
                     AGFSDFSFANTIFSAMAEGYASEVCARRNAMDNASKNAGDMINKYSILYNRTRQAAIT
                     NELVDIITGASSLD"
     gene            complement(<122130..>124037)
                     /locus_tag="FOA43_000050"
                     /db_xref="GeneID:62193451"
     mRNA            complement(<122130..>124037)
                     /locus_tag="FOA43_000050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920386.1"
                     /db_xref="GeneID:62193451"
     CDS             complement(122130..124037)
                     /locus_tag="FOA43_000050"
                     /note="BUSCO:EOG093410DI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776314.1"
                     /db_xref="GeneID:62193451"
                     /db_xref="InterPro:IPR011387"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="PFAM:PF08662"
                     /translation="MSKVPQIYCRQPKCVELIEAEPVFKSVAGFTKPEAEVRCAAYSP
                     VGNYFVYSQPTGLIVCDPFSGEQLFTIQNPDVFHFGISPKGTFLTSWSRPTKMEDETG
                     NWNDNVQIYRLDITGRKYEAIQSYLNKMQSGWKPQFTADESIFCRLVNPSQISFYETD
                     SEEIHKALYSLNLKDIGKIQSFELSPGKNPSLAVFIPGSRGNPAFIRVYSLPNLNTPI
                     SQKQFFKGETCLFQWNGLGTSILALVSTDVDSTNKSYYGESQLYLFGITGAFDQKINL
                     DKEGPIHDITWSPTSREFAVIYGYMPSITTFFDARGNEIHTLTEGPRNTILYSPHAKY
                     ILVGGFGNLQGNVEILDRQNRFQKVASFKASNTSVCKWSPDGRFIMSATTSPRLRVDN
                     CVKIWYFNGTLCYIKEFNELYGVDWKFQPLSDFSPISTSTADKCEITPDISAIEYMAK
                     KTSISGGNRAGSTGGAYRPPHARNGGAAKPSRSLAEVEAQHSSSMLISSSSSNNSSTE
                     SFASSYANRRIPGALPRRVIPGAIPLDKNAKKKKRHHKKDDTEDEINSSSQQEATTAV
                     ENGGSMVVGGVFSFEEKKIRNLLKKLRSIEKLKVKQGNGDFLEKTQVLKIETEPQVRK
                     ELESLGWTEGR"
     gene            complement(<124301..>124759)
                     /gene="NDK1"
                     /locus_tag="FOA43_000051"
                     /db_xref="GeneID:62193452"
     mRNA            complement(<124301..>124759)
                     /gene="NDK1"
                     /locus_tag="FOA43_000051"
                     /product="nucleoside diphosphate kinase"
                     /transcript_id="XM_038920387.1"
                     /db_xref="GeneID:62193452"
     CDS             complement(124301..124759)
                     /gene="NDK1"
                     /locus_tag="FOA43_000051"
                     /note="BUSCO:EOG093445OW"
                     /codon_start=1
                     /product="nucleoside diphosphate kinase"
                     /protein_id="XP_038776315.1"
                     /db_xref="GeneID:62193452"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR023005"
                     /db_xref="InterPro:IPR034907"
                     /db_xref="InterPro:IPR036850"
                     /db_xref="PFAM:PF00334"
                     /translation="MSNNERTFIAVKPDGVQRGIYPEVLKRFTQRGFKLVGIKLTLAN
                     EPLLRTHYADLQQKPFFPSLLSYMMSGPILATVWEGKDAVKQGRAMLGATNPLNSAPG
                     TIRGDFAIDMGRNVIHGSDSVENAKKEIALWFRPEELVDSKSTLASWIYE"
     gene            <125391..>126311
                     /locus_tag="FOA43_000052"
                     /db_xref="GeneID:62193453"
     mRNA            <125391..>126311
                     /locus_tag="FOA43_000052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920388.1"
                     /db_xref="GeneID:62193453"
     CDS             125391..126311
                     /locus_tag="FOA43_000052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776316.1"
                     /db_xref="GeneID:62193453"
                     /db_xref="InterPro:IPR012445"
                     /db_xref="PFAM:PF07855"
                     /translation="MEFNLKLVTDLDTAADYIKGIVWTIFFNRLFGFIVPQDGLNFLG
                     VPYPTTDLPELDRLIESKIECIMGELNKGEKEYNDQLLYKCVIVVKFYEKAVMLDNNS
                     NGLQDRQGSNNVSTSSASSSSILMPRRTKKYQNCWEKWILKVTILNNHNTKMLETDTN
                     SRLDFFKEDFEKNMFKLFDYVDKNRSHIPPIQSVDKAPFPYKILFALNTHEPKSLESA
                     FASFEMSSKSTLETGTNIGSGSASGSVSGSLASLEYVTTTEEGDLILTTTPLQHEQKD
                     ANTNPNYRPNIPSGEELLRNGYKFIKKFLE"
     gene            complement(<126326..>126775)
                     /locus_tag="FOA43_000053"
                     /db_xref="GeneID:62193454"
     mRNA            complement(<126326..>126775)
                     /locus_tag="FOA43_000053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920389.1"
                     /db_xref="GeneID:62193454"
     CDS             complement(126326..126775)
                     /locus_tag="FOA43_000053"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776317.1"
                     /db_xref="GeneID:62193454"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF13380"
                     /translation="MSAIKQFFSDKTHYFVVGASTQPEKYGNKVLKWYIDHELPVTPV
                     NPNAETKIYGLPVLESLAEALKRHFDKDHPKISVSFVTPPKVSLREIQMVADISALTE
                     IQSLWFQPGSCDDDVINFCECFGFSKEKGNLIDGECILVEGEEGLMK"
     gene            <127042..>129519
                     /locus_tag="FOA43_000054"
                     /db_xref="GeneID:62193455"
     mRNA            <127042..>129519
                     /locus_tag="FOA43_000054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920390.1"
                     /db_xref="GeneID:62193455"
     CDS             127042..129519
                     /locus_tag="FOA43_000054"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776318.1"
                     /db_xref="GeneID:62193455"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /translation="MTNLKANEIRESTLKPILPNPTHQLQLELEKYQEQVTTRITHED
                     AGVTEAGQKRISSTTPNESKQSSSRHFEKRSKACTNCRRSKVRCVKLGDDEVCKRCRN
                     QGIQCVYEYKIASYRIVGTGAKADPPCQQRLVHPLAPLSRLPHSSASSTMASISNLLN
                     PSDESPEPPHTSSEPPHTSSEPLNSPKFEWQNSVEERLKNFDSKLGSIITILNDQNSS
                     PHPIRQLPSLNAFMGNALSVATSTSPCISSNVPVTKFGPISRNSSLDLTMISPPNKRR
                     KIEHKDHKSLDDILTRKQAMELFNYFDANISSQLFGFSVGQYSVNSVWETCPLLVATI
                     CCISSIHHPVFNNLFTSLEALIHKLSMDTLSSSPKTELEAFNTIMALCFCGFWFQKDQ
                     MFTGLALQLARSMNLMSSLNKQSKIPRKDRVKLWFLLYILDGQQSLVFNRQTLVDPRD
                     ITLSKGKSILLEAEDFEAGKIEGANKDQQPAQDHSFESTYSNLRLVSQVQYHQAIDCA
                     FEEEAWDLFAPASFGLPYKTNLELDKWMVQWTVLLSSLKACPVWSSKSTLIYYNFAKM
                     HINSTAIRKLQIVGTELPRLDQCEVDDDWNENSKKIETGKGAQLDTNGNPIEENENSE
                     EDENDDSDYNTYQDIIKEMSPYQSRRVSSELAFSAAETVLKIVLEDPNIISALRYVPI
                     HIHIMLYYAALLVLRTPSYLISNREASFEESLRSIRMVKKLRIAVLANTPTDREFAQR
                     LVVALTSILREKVKTLKERISRETDGDRKFKQLEDMLSSNDSMFLKHRKPHKIMAWPG
                     FDSGHPGLDEKRSSITTKPLKDYYNLE"
     gene            <129664..>130527
                     /locus_tag="FOA43_000055"
                     /db_xref="GeneID:62193456"
     mRNA            <129664..>130527
                     /locus_tag="FOA43_000055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920391.1"
                     /db_xref="GeneID:62193456"
     CDS             129664..130527
                     /locus_tag="FOA43_000055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776319.1"
                     /db_xref="GeneID:62193456"
                     /db_xref="InterPro:IPR027267"
                     /translation="MARSFISTEIDWQGLSQQIASVPKILKRINCDSSVTKDIENDQL
                     DQFFEDIRRISNLFILLQDSVLRHCKAVTSFMQHSLKLYQIFKEILESNVDFRKAQDR
                     LSEILIIRLDGVIHEASTEIESFQLQFKDTMSKILKLLKLVNKNLKRREYLILDITCF
                     KQDLAKLNKKKLLTTSEHEKKFVLDQDLQNSLSMLTGMNELLNAEIPSFKKGLHVIAS
                     DLTVIIIFFHMRLHFHLYNLTKDVIEIKEVKELFASRIIAVFRDHHQPVKEVVNSLML
                     LTNINRINQFS"
     gene            complement(<130562..>132495)
                     /locus_tag="FOA43_000056"
                     /db_xref="GeneID:62193457"
     mRNA            complement(join(<130562..132155,132491..>132495))
                     /locus_tag="FOA43_000056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920392.1"
                     /db_xref="GeneID:62193457"
     CDS             complement(join(130562..132155,132491..132495))
                     /locus_tag="FOA43_000056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776320.1"
                     /db_xref="GeneID:62193457"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MPSAQSEIRDIDPRKTVGDEGLLAEIGYKQELNRTFNTFQVFGI
                     AYSIMGLLPSISSLTGTGLTAGPAGFLWSWFVSALFILSLGVSMSELASSEPTAGGLF
                     YWTFYYAPRKHRVLISYVIGMSNSMALIAGSVSIAYGNAEEILAAVYLSKNGNFDITN
                     GKTYGIFAACIVSQAICTCISSRHIALLQTISAVSNTGLIALFFIALPIGTMRNRGHF
                     NDGSFIFGQVNNFSDWPIGFQFCLSMMTAVWTIGAFDSCVHMSEEARNASMSVPIGIT
                     SSISFCGLLGWLIIICTNACMNPDLDSILSTPSGFPMAQIISDSLGNKWAVAFMSLTA
                     ACQWLMGASILTALSRQVWAFARDDGLPFASWVKVINKKMKVPIRAVIFSCIIALLLG
                     CLCLAGSAASSALFSLAVSGNYVSWCTPVLFRLTSGRKRFRPGTFYLGDRLSIINGWI
                     TIAWGAYIICLAMFPSSKVVDKSTMNYTVVITCGVWILSALYFILYKYKHYHGPKANI
                     SAEEALSIDGSAEVIPMSIDDKVE"
     gene            complement(<133025..>134005)
                     /locus_tag="FOA43_000057"
                     /db_xref="GeneID:62193458"
     mRNA            complement(<133025..>134005)
                     /locus_tag="FOA43_000057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920393.1"
                     /db_xref="GeneID:62193458"
     CDS             complement(133025..134005)
                     /locus_tag="FOA43_000057"
                     /note="BUSCO:EOG09342R2S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776321.1"
                     /db_xref="GeneID:62193458"
                     /db_xref="InterPro:IPR004013"
                     /db_xref="InterPro:IPR010140"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="PFAM:PF02811"
                     /translation="MVFSHHSHSGQYVSHAVNTLDEVVSRAKEMNFRTFCLTEHCPRY
                     SRDLLYPEESEISLEGLSATFDRYVTHAKKIQRQVNSDKTNRLKILVGFESEGGIDSS
                     HLEKYQELRAKYHMDIVLGSVHYIDRIPIDFDRENWLRAKSHYKSFHDFFLAYFNCQY
                     EVISKLKPEVVSHFDLIRLFQDEDNDTCEITGKPLKDINLAKDWPQVWYSIGRNIELI
                     NQQGALIELNSAAIRKGWNSPYPKRDIVQYALSKGARFCLSDDSHGIKQVGLNYHKVL
                     SYIVSLGSQIEYIYFWDLDDSGASFVNKETVADLSKDSFWKINYPNLPGV"
     gene            complement(<134138..>134752)
                     /locus_tag="FOA43_000058"
                     /db_xref="GeneID:62193459"
     mRNA            complement(<134138..>134752)
                     /locus_tag="FOA43_000058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920394.1"
                     /db_xref="GeneID:62193459"
     CDS             complement(134138..134752)
                     /locus_tag="FOA43_000058"
                     /note="MEROPS:MER0015472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776322.1"
                     /db_xref="GeneID:62193459"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="InterPro:IPR035952"
                     /db_xref="PFAM:PF01694"
                     /translation="MHLLYGLLGINCAVFGLWQLRYSNSRLYRLLEQYFLMDRNSLTR
                     KTNWSVVFSTFSHQDFFHLLINMGCLYSFAISMISVMGVSNFTTVYLISGCVSSLASM
                     IFSFLTSSYGCSLGASGAISAIFAAFTALFPAAHVAFFVFPIPGGAITALALFTAYNV
                     GGCLFKWSTFDFAAHLGGTVIGYLWGLSYKKELKDRSRKRRGYW"
     gene            complement(<135286..>136644)
                     /locus_tag="FOA43_000059"
                     /db_xref="GeneID:62193460"
     mRNA            complement(<135286..>136644)
                     /locus_tag="FOA43_000059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920395.1"
                     /db_xref="GeneID:62193460"
     CDS             complement(135286..136644)
                     /locus_tag="FOA43_000059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776323.1"
                     /db_xref="GeneID:62193460"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="PFAM:PF01399"
                     /translation="MAFSIVLNRYINESVAEYGAILDFELKEVDNKYQKSYEELLKND
                     DKQELLNQIVGSSKFLLVNFSDKSLEPTANLYIHILDALTSELNIDISGVFKQVLTNF
                     SSESLSKSAEIKPTTVISLLSNIFNFLKESNHLRADILKDIITLVSANDLQSMLLPIA
                     QNFSVWLSDIEGVTDDEWRALANQIFAQIYAQDQMAALTFYKKLVESETDSSKLQPQD
                     YDEFLVKVLSSKKYFNVCNLDIGAKLGDGSLAHLFEIIRNADLSEFLTFVNSKEGSKL
                     GDKLDLAKLTYKVKYLAAPQVLEKFEEETGKNEFSYEQIAQQLDVPSDSIEEFLINCI
                     QQGLITGRLSQAKQVFYLSKIDRLNTPSKTLNAKDWHRANQYLENWSRTIEDLQSLIK
                     NLTSRKGKKMLPPQAIQTFHQQKQELKEHLQQEKQKERERHQDDEETEDSQEPAVQQI
                     VA"
     gene            <137250..>138674
                     /locus_tag="FOA43_000060"
                     /db_xref="GeneID:62193461"
     mRNA            <137250..>138674
                     /locus_tag="FOA43_000060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920396.1"
                     /db_xref="GeneID:62193461"
     CDS             137250..138674
                     /locus_tag="FOA43_000060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776324.1"
                     /db_xref="GeneID:62193461"
                     /db_xref="InterPro:IPR017703"
                     /translation="MSLLSHGLARLATSNTTALVSGPESAKFLNGLLTLKLLPSVSKH
                     NQTTISGLDLEAIEQSKRIQIFPDQIQHSNWGLLHEDEYSEGNEDRLGIRRDGRYGMM
                     LSSKGRVISDLFLYPSPFLPAEESSRISSYLLEFNTDSARFNKSLMILKMHKLRAQIN
                     IERVSGIQSWIYFNKQNKFQDYLIDLKDKYFNNRISSSPEFALQLASQLIHDDVLFKA
                     DHYDEIRENLKGFAIDDRCPNFGLRFIFGNKLSTLSLKSLFSDKFMSQFEPSASISVL
                     PRSSKVIDLQRITEGIVQASDYASNSRESLPFENNIDYMNGINFEKGCYTGQELTIRT
                     YSSGVIRKRVMPVQFYILGQEKLQDTVQYIPDDAVNSLLSGVNDLEIQRNNTSTITSD
                     ASTDFANPFGVHAKAPTLAIGNIIRVESNIGLASVKVSEIDMNHGNDKNNRFTVSSKS
                     RPQINGRVGCKVYLPEWWPEENDE"
     gene            <139274..>140359
                     /locus_tag="FOA43_000061"
                     /db_xref="GeneID:62193462"
     mRNA            <139274..>140359
                     /locus_tag="FOA43_000061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920397.1"
                     /db_xref="GeneID:62193462"
     CDS             139274..140359
                     /locus_tag="FOA43_000061"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776325.1"
                     /db_xref="GeneID:62193462"
                     /db_xref="InterPro:IPR013861"
                     /db_xref="PFAM:PF08551"
                     /translation="MKKLSIGSFKVWPLTIIYIWLIILFSSLTAYVRFQSYNELKSQS
                     NSVDSNSVVVVPSLQLVPSKFFLYPWTLLTATLVQTSIFRLIVSLVITFFGIEYLQSN
                     WTAANIGYSSNKRIFDETVHYLFVVPLVTNILFVLLKSSLAVLGLTSSVSLFHPINYG
                     IYSVVMSFVVVIKQLSPEYNVKLFKVIKFRLKRLPFIILSVALFVSIFITSSLDPFFT
                     PLFINFYVSWCYLRYYQISYVGDILPTTAGSTTATTSSSTVRGDASDTFAFIQFFPDN
                     WQRYLKPMSRFFYHSSVFLGLFRPFNDDDIESSNLRTIQRLNKSNAVDGANSNDDSDR
                     RKRVALKVLEQRVADKGNQDTTHSTHD"
     gene            complement(<140403..>141689)
                     /locus_tag="FOA43_000062"
                     /db_xref="GeneID:62193463"
     mRNA            complement(<140403..>141689)
                     /locus_tag="FOA43_000062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920398.1"
                     /db_xref="GeneID:62193463"
     CDS             complement(140403..141689)
                     /locus_tag="FOA43_000062"
                     /note="CAZy:GT34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776326.1"
                     /db_xref="GeneID:62193463"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="PFAM:PF05637"
                     /translation="MALRLPPRNKKSVLSSHAVRRFIRANKGPKSIIIFILLISLTNW
                     VLFGNAFLGPLGKGSLPSSIKSFYHLMTPAYLDKLQTTYGFQGHDTIPVKTLEIVPDV
                     QDASMLRHLGLDNLFRVEVHTKDSSEEKRYFYTPDYFEEVNVEGEAIASSSSKDIVQK
                     AVVAFKRMGRTVYKGSKSPQIVLVMGLDFQKYEDEYALKVLPNRVNYASKHDYGLYVR
                     WIQEFTPRLQESHNLDTNWWRPLLIREAMSAFPQAKYFWFLDERSLIMRDDLTLESYL
                     LNADSLGKAMLRDQPVILPESAIKTYRNTAPSDVSFIFTQDSYALNTDSIIVKNDMYG
                     KSFLEYWGDNLYRGYSNFADNEVKALTHILQWHPYLLSRTALVPPRMLNSIHTDEKAK
                     KDSMHSYQKGDLVVNFRSCELGNTCNNLAEAYLKDK"
     gene            <141911..>142231
                     /locus_tag="FOA43_000063"
                     /db_xref="GeneID:62193464"
     mRNA            join(<141911..141914,141972..>142231)
                     /locus_tag="FOA43_000063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920399.1"
                     /db_xref="GeneID:62193464"
     CDS             join(141911..141914,141972..142231)
                     /locus_tag="FOA43_000063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776327.1"
                     /db_xref="GeneID:62193464"
                     /db_xref="InterPro:IPR009053"
                     /translation="MNLDSRNQMIDLSLQEIAGSGNENIWESCGKAFLRVNRNQYQNK
                     LKDEKDGNVEVMSDLDKKKRYLETSINTTVDNMNRILDRLEKK"
     gene            complement(<142270..>143085)
                     /locus_tag="FOA43_000064"
                     /db_xref="GeneID:62193465"
     mRNA            complement(<142270..>143085)
                     /locus_tag="FOA43_000064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920400.1"
                     /db_xref="GeneID:62193465"
     CDS             complement(142270..143085)
                     /locus_tag="FOA43_000064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776328.1"
                     /db_xref="GeneID:62193465"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="InterPro:IPR018939"
                     /db_xref="PFAM:PF09451"
                     /translation="MHGSLIVLSLLVSTVFSIDLSNKAFKEYTAIKNIAGVHNIEKTK
                     STPPSTTTQKWYINMVDPEQKDLPKDIEDVKGCPSGSQICGLTTVKLPEGDDKEVTTE
                     IFAFSSKLVPQFDDDDEHDELTVKLSGANWGDKTLEAVLNLKCSPDKKEDSLDVVFDY
                     TTLKINWENNAFCKDASAEKPHGKHHKDDHRHGKDRSWGLFTWFFILLVLALAGYIIG
                     QAWVNTSRVGNSGEFLNELGDATVETAGKVPEFLKQVVSKVTGGGDRGGYSAV"
     gene            <143468..>144028
                     /gene="RPL17B"
                     /locus_tag="FOA43_000065"
                     /db_xref="GeneID:62193466"
     mRNA            <143468..>144028
                     /gene="RPL17B"
                     /locus_tag="FOA43_000065"
                     /product="60S ribosomal protein L17B"
                     /transcript_id="XM_038920401.1"
                     /db_xref="GeneID:62193466"
     CDS             143468..144028
                     /gene="RPL17B"
                     /locus_tag="FOA43_000065"
                     /codon_start=1
                     /product="60S ribosomal protein L17B"
                     /protein_id="XP_038776329.1"
                     /db_xref="GeneID:62193466"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005721"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="InterPro:IPR036394"
                     /db_xref="PFAM:PF00237"
                     /translation="MARYAAVPANPAKSASARGSYLRVSFKNTRETAQAINGWKLEKA
                     KSYLDAVLDHKRAIPFRRYEHSIGRTAQGNEFGITKARWPAKSVKFIQNLLINAESNA
                     EAKGLDTSKLIISHIQVNKAPKMRRRTFRAHGSINAYQSSPSHIEIILTEEEETIAKA
                     KEDKVASKLNSRQKGRFAQQKRLTAA"
     gene            complement(<144133..>145026)
                     /locus_tag="FOA43_000066"
                     /db_xref="GeneID:62193467"
     mRNA            complement(<144133..>145026)
                     /locus_tag="FOA43_000066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920402.1"
                     /db_xref="GeneID:62193467"
     CDS             complement(144133..145026)
                     /locus_tag="FOA43_000066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776330.1"
                     /db_xref="GeneID:62193467"
                     /db_xref="InterPro:IPR002472"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PFAM:PF02089"
                     /translation="MHVLSLVPVNLALQLFKGAKYDQSTNLAETHLPVVVWHGMGDSY
                     NSESMHWVNETLNSYIPGLDVYSIALKEDGRGDQEASIVGDAMTQILQVCEQLHQESA
                     LNEGFNAIGFSQGGLFLRSAMELCGLPINNLITYGSPHNGVVDLPECDSWLCKQRNAF
                     LKKHIYDDKIQDSIIQAQYFRDVYNYDEYMEKSAFLKYVNNELVVNRTYSENLQRLNK
                     LVLVKFDRDKTLVPKESAWFYDIDTVTGDSIPFTQTENFEYDLIGIRKLYGEGRIDFK
                     EVDGQHMEINEKDLKEIIGYL"
     gene            <145167..>147353
                     /locus_tag="FOA43_000067"
                     /db_xref="GeneID:62193468"
     mRNA            join(<145167..145932,146113..>147353)
                     /locus_tag="FOA43_000067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920403.1"
                     /db_xref="GeneID:62193468"
     CDS             join(145167..145932,146113..147353)
                     /locus_tag="FOA43_000067"
                     /note="CAZy:GT15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776331.1"
                     /db_xref="GeneID:62193468"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF00687"
                     /db_xref="PFAM:PF01793"
                     /translation="MLDSNIQASAQKAVVSLKKHLETQNLQHEPIYLIIDTELPTCKR
                     KEFTPRIIPLTNRIGKVSNSKIFLITKDPVSLYREPLVGKDSATDNVFTTIIAFRKFK
                     SISHSRKSTARVYHDNDFILIDHRLHKFLPDLLHGTIFQKSSKKYPIMIQMARPSADA
                     KLTQSKKSTKMKDERVDPDYLLRQVKMICRSTTFVPSTGKCLSIVVGFSDMSSEKLVQ
                     NINSILEYLTNAKFQPVGGVISGGMAGILDLHLKTATTWLFYVIKQDFSFVHLPSLNS
                     SRLKELYSQSLEASHYLDNNTNLILQEARLKPATNSYVKPRFPLHSKQISHIHLENAT
                     LLMLCRNWELPEVLKSMRSMEDKFNRDYHYPWVFLNDVNFTGDFISQTTNMATGPTSY
                     GLIPENDWNTPDSINKTRYAECLKDYIKNDVIYGGSRSYRNMCRFNSGFFFRQDLLLS
                     YDYYFRVEPGIEYFCDFQMDPFRLMKDNGKKYGFVISLLEYPDTIPTLWDTVEDFLHE
                     HPEYQNTDSAVDFITTKEPIGPKTVVSTTDSPYNMCHFWSNFEIGDLNFFRSKEYLDY
                     FNYLSQNGGFYYERWGDAPVHSIAASLLLNKDEIMHFEDIGYTHTPFFTFPDSLSMRS
                     GKRCLVPEGEKNIDILAHSCLPRWWRYGSGKRFMREYFYEEEYI"
     gene            complement(<147370..>147957)
                     /locus_tag="FOA43_000068"
                     /db_xref="GeneID:62193469"
     mRNA            complement(<147370..>147957)
                     /locus_tag="FOA43_000068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920404.1"
                     /db_xref="GeneID:62193469"
     CDS             complement(147370..147957)
                     /locus_tag="FOA43_000068"
                     /note="BUSCO:EOG09344J6U"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776332.1"
                     /db_xref="GeneID:62193469"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR006590"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR038324"
                     /db_xref="PFAM:PF03874"
                     /translation="MNISTSAGVKRRRGGRSSQPEDEVNASELKLGPEFQLDQLDNHG
                     NHTKLIALNLSEARILVRAALKERMEMIQGFNGTNETMDKDKLMADGEPDDETLARLA
                     TAPGANEVLRKTLEYLSMFSRFKDAETCTAAETLLKSEENSGLHPFEVAQLGSLASED
                     IDEAVTLIPSLNEKKDEIDLQRILDELNRLETNFP"
     gene            complement(<148206..>148688)
                     /gene="TIM17"
                     /locus_tag="FOA43_000069"
                     /db_xref="GeneID:62193470"
     mRNA            complement(<148206..>148688)
                     /gene="TIM17"
                     /locus_tag="FOA43_000069"
                     /product="translocase of the inner membrane"
                     /transcript_id="XM_038920405.1"
                     /db_xref="GeneID:62193470"
     CDS             complement(148206..148688)
                     /gene="TIM17"
                     /locus_tag="FOA43_000069"
                     /note="BUSCO:EOG093448QM"
                     /codon_start=1
                     /product="translocase of the inner membrane"
                     /protein_id="XP_038776333.1"
                     /db_xref="GeneID:62193470"
                     /db_xref="PFAM:PF02466"
                     /translation="MSTPEADHSRDPCPIVILNDFGGAFAMGAIGGCVWHGIKGFRNS
                     PYGERGSGAINAIKARAPVVGGNFGVWGGLFSFYDCAIKGVRKREDAWNAILAGFMVG
                     GSLAIRGGRRHIFNSAVTCACVLGVFEGVGMMFSRYMAWANKPVAMPVPDGPGSPLAA
                     "
     gene            complement(<148890..>151226)
                     /locus_tag="FOA43_000070"
                     /db_xref="GeneID:62193471"
     mRNA            complement(<148890..>151226)
                     /locus_tag="FOA43_000070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920406.1"
                     /db_xref="GeneID:62193471"
     CDS             complement(148890..151226)
                     /locus_tag="FOA43_000070"
                     /note="BUSCO:EOG0934135F"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776334.1"
                     /db_xref="GeneID:62193471"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MESHMLYTHGYSVDQQQPSRLPPQPEQVRSESQSQAQLQSQAQQ
                     QRSVSNGYSEYPDYAYSSNVYYQRTPAYNMQQGQFSGFSFEAQSDALTGGASASSSSP
                     SSASRVGLSNRTLSSFSHNQQRIVPASIQAGQMGPGLSSDYLIPLLRNSYSDPSQQQI
                     SSSSSVFRDPWVSSFTSNSRTTTNEYQPNLSNVRRTPRKSFTSTLSTTFEDMELTSGL
                     KRQKTPSLQPLQPLQPLQVAYQQEIVPPSRIDPPPPSTLTAQAHAPPRRQSVAAGYLV
                     PNHERDEGTSSTSSSPVTRFQHGYPQGYYQVQPSVKTLSLKPLAPIVPKRVLPAPKFR
                     KLTSREDLSPHINAKPKYRRAASSNTFLSPLNALTSSLTVTYSMCVPEFDYKTSKNPR
                     RVLTKPSNAVTNNGYDNEQSDYILYVNDVLGVQENRKYMVVDIIGRGTFGQVVKCQNL
                     DTQEIVAVKVVKSRPVYLNQSLTEAGILEYLNRKVDPGDEHHLLRMKDKFMHKNHFCL
                     VFELLSSNLYELIGQNQFHGLAIKLIKKFTVQLLDALCVLKDAELIHCDLKPENILLV
                     SLDRPEIKVIDFGSACHEKQVAYTYIQSRFYRSPEVILGLSYGSAVDMWSLGCIITEL
                     FLGLPLFPGTSEFNQLEIIVRMLGMPPTWMIEMGKNSINLINKRVDPQTGKKYYALKS
                     VEQYSRESHTKQKPGEEYFKDRYLDDIIMHCRLPRKNMTKPMIDLEMENRKCLLHFIK
                     GLLNLNPLERWTPQEAFAHPFVTNQKFTGDWNPPSRKI"
     gene            complement(<152323..>153222)
                     /locus_tag="FOA43_000071"
                     /db_xref="GeneID:62193472"
     mRNA            complement(<152323..>153222)
                     /locus_tag="FOA43_000071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920407.1"
                     /db_xref="GeneID:62193472"
     CDS             complement(152323..153222)
                     /locus_tag="FOA43_000071"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776335.1"
                     /db_xref="GeneID:62193472"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF01370"
                     /translation="MTKSIFVTGATGLVGKNTVDELLRQGYHVTGLARSDASEKALKD
                     NGCEVIRGDLKDIEALKKGAAESDGVIHLGFVHNFADFETCALIDRAAIDAMLSALKG
                     TDRPFISIGGTLGVSEGDGKPNDEDSPYVDLPGFGLRFETERRVLAYASKGVRTISLR
                     LPPTVHGKGDVNGFIPILIAAAEKAGYSFYIPESKNVWSAVNVEDCASLLVLALKKGK
                     AGKAYHAVGEPGVPLKVIGEAIGRKHNLPTKSISYEEAKKLLGFFTDMTLLGETSLSE
                     KTQKELGWKPTHATLVEDIAEFY"
     gene            complement(<154899..>155927)
                     /locus_tag="FOA43_000072"
                     /db_xref="GeneID:62193473"
     mRNA            complement(<154899..>155927)
                     /locus_tag="FOA43_000072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920408.1"
                     /db_xref="GeneID:62193473"
     CDS             complement(154899..155927)
                     /locus_tag="FOA43_000072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776336.1"
                     /db_xref="GeneID:62193473"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MAVSISRVYADINEHKPQSYWDYENVSIFWGPQYTYEITRKVGR
                     GKYSEVFEGYQITTGTKIIIKALKPIKKKKIKREIKILQDLAGGPQIVDLLDVVRDPI
                     SKTPALIFEYVNNTEFRTLYPKLSDMEVRYYMYQLLEALDFAHSMGIMHRDVKPHNIM
                     IDHAHKKLRLIDWGLAEFYHPGTDYNVRVASRYFKGPELLVDYRYYDYSLDIWSFGAT
                     FASIIFKKEPFFHGKSNTDQLVQIARVLGTDELYKYLDKYGLKLGPEYEDLGHYVRRP
                     WNRFVNPNNKDLISDEALDFVDHILRYDHQERLTAKECMMHSYFAPIREEQKKQAISQ
                     AQPVDLAD"
     gene            complement(<156072..>156902)
                     /locus_tag="FOA43_000073"
                     /db_xref="GeneID:62193474"
     mRNA            complement(<156072..>156902)
                     /locus_tag="FOA43_000073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920409.1"
                     /db_xref="GeneID:62193474"
     CDS             complement(156072..156902)
                     /locus_tag="FOA43_000073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776337.1"
                     /db_xref="GeneID:62193474"
                     /db_xref="InterPro:IPR001698"
                     /db_xref="InterPro:IPR019771"
                     /db_xref="InterPro:IPR037282"
                     /db_xref="PFAM:PF01115"
                     /translation="MSEEAFDASLDLLRRLDPKKIKKNLDNLCRLQPELAEDLLSSVD
                     TPLRAEVCQSSGKSYLCCDYNRDGDSFRSPYSNEYYPAIEDEAEAPHPSSYLRQLEMQ
                     ANDSFDIYRELYYEGGISSVYLWDAEDEVVDKSGRIGFDGVVLLKKSIDNDSGGAWDS
                     IHVFEVQPKINGDASYKLTSTIILDLSTSNDIDMYLSGNLTRQTTREAKYTDAASHVA
                     NIGSLIEDTEGKLRNMLQEVYFGKTKDIVGDLRSIEKLNVKEDQKLKHQEMIKEFEKI
                     "
     gene            <157211..>157645
                     /locus_tag="FOA43_000074"
                     /db_xref="GeneID:62193475"
     mRNA            <157211..>157645
                     /locus_tag="FOA43_000074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920410.1"
                     /db_xref="GeneID:62193475"
     CDS             157211..157645
                     /locus_tag="FOA43_000074"
                     /note="BUSCO:EOG09344D87;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776338.1"
                     /db_xref="GeneID:62193475"
                     /db_xref="InterPro:IPR005352"
                     /db_xref="PFAM:PF03694"
                     /translation="MSLIDTITSHLPTAPGLLPKWLFFISVVSIFNSAQTYINLELTK
                     QVYGNKPQEVSHLSARTFGTWTLISAIIRYFAAFHIDDVNVYNICIASYCVALWHFGS
                     EWLFYRTCRFDRGLFGPLIVSTISISWMISQKDFYTGLIAQI"
     gene            complement(<157763..>158824)
                     /locus_tag="FOA43_000075"
                     /db_xref="GeneID:62193476"
     mRNA            complement(<157763..>158824)
                     /locus_tag="FOA43_000075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920411.1"
                     /db_xref="GeneID:62193476"
     CDS             complement(157763..158824)
                     /locus_tag="FOA43_000075"
                     /note="BUSCO:EOG09341S58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776339.1"
                     /db_xref="GeneID:62193476"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR012198"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="PFAM:PF00027"
                     /translation="MAGTDANSASKESVSVDPFSKDSQSLQQLQQELKPEKLPQSQPQ
                     KGTGFGFFKGSGFGAAVSNQVPPRNFNTNRRTSVSAEAMNPDSFKDNWKPPMHQLTHE
                     QLQRLNDSAVKNFLFGQLDKESLQIVIFALEEKRIPKNTEIIKQGDQGDYFYLVERGA
                     VSYYVDGKKVNTSADGSSFGELALMYNSPRAATVIADTECILWALDRMTFRRILLDRT
                     SKKRSMYDRFLRDVPLLKSLSSYERSKLADALNTESYETDQNVVTQGEDGENFYFIED
                     GTADVIKDGSIVQKLTKGHYFGELALLYDLPRQATVKATSPLKVVTLGKSGFQRLLGP
                     AVEVLKLQDPTKGDQEKAN"
     gene            <159302..>160666
                     /locus_tag="FOA43_000076"
                     /db_xref="GeneID:62193477"
     mRNA            <159302..>160666
                     /locus_tag="FOA43_000076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920412.1"
                     /db_xref="GeneID:62193477"
     CDS             159302..160666
                     /locus_tag="FOA43_000076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776340.1"
                     /db_xref="GeneID:62193477"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00155"
                     /translation="MTVDWDKYFSNEAKLREPSVMKMAARTPDTISFASGMPHPDCFP
                     LKGLSIKYETADSGFSKLATGSNEDAVNAAQADDEIYEACQYMSGRGTTFFDKFCRHH
                     IEEFHKPVYGEWGTLIQSGGTFSLDAIIRMLCNPGEDTILAEELTYPCLLETCRPLRL
                     KVFAVKIDNHGVIPEDMERILTDWYTDLSTKDYKKPKFFYSMPVGQNPSGVTMTVERK
                     RQLFGVCHKHDVLVVEDDPYYHLQLDGDKKEIPSLLKFDTDGRVIRIDSFSKMLMPGM
                     RISIVTANKTFIKMLTMQNELTIHSAAAPSQLIVYMLMNEWKNDGFRSWLTHVQDIYL
                     KRRNTILDAFDRHLPADLCSWNKPSYGMFLWIKISIAQFPKLEEYSQLTDPEWAAKLE
                     DMIFEQALQDEIQLAKGHWFMIDQLNMAGFRATYAFASLDDIYTGSERFGNAIRQIHA
                     KLYN"
     gene            <160832..>162511
                     /locus_tag="FOA43_000077"
                     /db_xref="GeneID:62193478"
     mRNA            <160832..>162511
                     /locus_tag="FOA43_000077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920413.1"
                     /db_xref="GeneID:62193478"
     CDS             160832..162511
                     /locus_tag="FOA43_000077"
                     /note="BUSCO:EOG093432V7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776341.1"
                     /db_xref="GeneID:62193478"
                     /db_xref="InterPro:IPR001580"
                     /db_xref="InterPro:IPR009033"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR018124"
                     /db_xref="PFAM:PF00262"
                     /translation="MKLISAAVAGCVFSSVALAIDHPQFKPYTKTLSEDSFFEQFDLS
                     ENKWRVSHAKKDGELSYSGKWEIEESTVNIGFKGDKGLVVKSEAALHAISVPLPKVFD
                     NKDNTLVLQYEVKLQKGLDCGGAYIKLLDANGAPDLEENEFNNETPYQVMFGPDKCGS
                     VNKVHFILRRKNPQSGKYEEKALKVPPMARIVKTSVLYTLIIKPNQDFEIRIDGDVVK
                     AGSLLDPRYFELNPPKEIVDKHDKKPKNWVDEEFIRDPNAVKPENWDEDAPYMIADPS
                     ATKPNDWDEDTPVSILDPEASQPSYWDDEEDGEWEAPLIANPECKDHGCGVWNIPKVK
                     NPNFKGKWFPPMVKNPAYKGEWEPRTIVNPKFYDDKTPSNLEPIGALGFELWTVTDSI
                     LFDNIYLGHSIEEAEDIGNSTFLPKVELEDQESAASAPKAKYEPENPVETEWEPEPWY
                     STMFDSVVGKAFVFLNSANSYLLNLMSDPVHTLSNRPGEAVLYSSVLVSFFSMVFAFW
                     SALLYLITGGERNSNTPAAVKSPKTEPKEAVGESSKPTESEKNETTAVKRQ"
     gene            complement(<162520..>163422)
                     /locus_tag="FOA43_000078"
                     /db_xref="GeneID:62193479"
     mRNA            complement(<162520..>163422)
                     /locus_tag="FOA43_000078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920414.1"
                     /db_xref="GeneID:62193479"
     CDS             complement(162520..163422)
                     /locus_tag="FOA43_000078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776342.1"
                     /db_xref="GeneID:62193479"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR027520"
                     /db_xref="InterPro:IPR035901"
                     /db_xref="PFAM:PF01541"
                     /translation="MTQSKHDSRMPLLYGVYLLRSLTKQNSFYIGSTPNPYRRLRQHN
                     GELSQGGAWRTKKKGYRPWRMVIYVHGFPSNISALQFEHAWQHAYRTRHIPVEKRRHN
                     GKKNTGSGTTVHEKVANCRLLLGSGSFSRLGLKVTIFNRDIYDVWLTNKFQIDIPDYI
                     LLEIRVDDAIDQRLIEGGNYEQVKSFMSDIQKMEEQYTDESIETLKQQQEQHLCCICE
                     MPLDVESDVICFCFHKECTAIYHCACWSKLIMLENPTQEMAPVLPIRGKCCQCGKVNF
                     WNMVVRNAQTVKERCRKKDYLFTA"
     gene            <163667..>165076
                     /locus_tag="FOA43_000079"
                     /db_xref="GeneID:62193480"
     mRNA            <163667..>165076
                     /locus_tag="FOA43_000079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920415.1"
                     /db_xref="GeneID:62193480"
     CDS             163667..165076
                     /locus_tag="FOA43_000079"
                     /note="BUSCO:EOG09342CYR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776343.1"
                     /db_xref="GeneID:62193480"
                     /db_xref="InterPro:IPR005549"
                     /db_xref="InterPro:IPR038275"
                     /db_xref="PFAM:PF03800"
                     /db_xref="PFAM:PF18595"
                     /translation="MPRPSSIYRFSKVPAFSRTQYKFPILEADEIIQVFDALDFGVSE
                     AMLVKPTFSFMNSLIEQVLDKFLYVPPYSLRKKIQETQFEDAQEEDNLHTSMNVMAPK
                     RIVYKFLCDCGVNDFSIRDVSKPDPTRVRIILSAIINFARFREERMNDCDGLLDSSED
                     VIVKYREVLEKNEKLENQMTSLNNQIAAEGYTMDEVDERNNLLENQLKELRSNQQKLA
                     SEHTKYKSEKTGLIKELENQSALYIASEKDLEQVRPYIKESPESVRELITRMQESLAE
                     EQEKLKNLETRSRKISISFDSFQLLIQEFKLLNRTLEDVQVETSKQDSSSKALNELKN
                     ETEERESVIKDYTRRVAQIERQVQHNEERIEKLSKFYSDKLGQLQEKMEQKSTELASL
                     KTKKAEQDADATSKKSQIELWQMQMSNLKRSFETECREASFELEKLNSHIQLYEVEMS
                     KKLKEQKNELGLVNRKTSH"
     gene            complement(<165166..>165810)
                     /locus_tag="FOA43_000080"
                     /db_xref="GeneID:62193481"
     mRNA            complement(<165166..>165810)
                     /locus_tag="FOA43_000080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920416.1"
                     /db_xref="GeneID:62193481"
     CDS             complement(165166..165810)
                     /locus_tag="FOA43_000080"
                     /note="BUSCO:EOG093449Q6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776344.1"
                     /db_xref="GeneID:62193481"
                     /db_xref="InterPro:IPR031781"
                     /db_xref="PFAM:PF12874"
                     /db_xref="PFAM:PF16835"
                     /translation="MDYQNRVGSKKGSGGVAGDAETNQYRRERLRKLLLSKIDIDSDP
                     YVVKNRAGVLECRLCLTTHFSEASYVTHTHGKRHQLSLMRRADKKKEQATGEQTVTGI
                     SDIPKKKFVKIGRPAYKITKIRDPVTAQKGLVFRLQFPKIKLDVKPRYRLMSSFEQSV
                     EKPDSKYQYLIVGGEPYENVAFKISSDSIDLREGRTWDFWDRDIKEYYIQLFYM"
     gene            complement(165910..165993)
                     /locus_tag="FOA43_000081"
                     /db_xref="GeneID:62193482"
     tRNA            complement(165910..165993)
                     /locus_tag="FOA43_000081"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:62193482"
     gene            complement(<166362..>168854)
                     /locus_tag="FOA43_000082"
                     /db_xref="GeneID:62193483"
     mRNA            complement(<166362..>168854)
                     /locus_tag="FOA43_000082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920417.1"
                     /db_xref="GeneID:62193483"
     CDS             complement(166362..168854)
                     /locus_tag="FOA43_000082"
                     /note="BUSCO:EOG09340Y7P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776345.1"
                     /db_xref="GeneID:62193483"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR006560"
                     /db_xref="InterPro:IPR013257"
                     /db_xref="InterPro:IPR025788"
                     /db_xref="InterPro:IPR036020"
                     /db_xref="InterPro:IPR038190"
                     /db_xref="PFAM:PF00397"
                     /db_xref="PFAM:PF00856"
                     /db_xref="PFAM:PF08236"
                     /db_xref="PFAM:PF17907"
                     /translation="MVRNIHIVSSGSGSESEISSSATPQPDGVKLFSHLPDKTEEALS
                     TFELLSENHYIDKLRNVYSASGEVMTCDCAERRVAGVNVACGVDSDCINRLTNVECVD
                     DQCVSCGSQCQNQRFQRNQMADVSVFLTEHKGYGMRANCDIPAHTFIVEYKGEVIDDR
                     EYKLRKESYADEGIGHFYFMMIQENEIIDATKRASLGRFCNHSCDPVAYVEKWVVNKR
                     YRMGIFAKRKIMKGEEITFDYNVDRYGSEPQKCYCGAKNCVGFLGGKTQTEILRLLPY
                     AAREALGIRSSDEKRWIRLEKKMGIKISKDNVEAKVGDFVESFELQPLTISDIPKVSS
                     CLLLPDNDVLIIDRILERFDTEDTGYGELLHMFNRLHGLQALTSSINTILFTVSDGKE
                     LRQREKNALVKIVNIFDAWPKLASKNTINSCNLETLLQELAVKMADKHIANLIDRILL
                     NWRDLPVIYRIPKRIDGGEDGKPMDKFSTHIDDRRSRLAQSAMRLVDPAASGAGSSAG
                     SAMASRTDSAGESVSLSPAISAVSKGQPNDVDVASLPESRKIEGKALPPGWEWTTDPT
                     SGSVYFYNREKGLTQWQRPEWPPTNLKAGLESILKAVPNSTVDDGKKKRERERDRERD
                     REREQKKRLRELEKKRLAEQDAVVKIEEQRMEKLTKIIEQASKEASLKQARGQRHHSH
                     DSEGGRDRSSRHTHKHQHTTLHANHSHRRDSYETNDTEISSGKHGKVEKQWMLLFASA
                     VPNMLKKYESHVGRGNMKNCAREITHVLAQKDMKRHTGQPVPSKLSDERKKKIDSFVS
                     EYMHKFVSKFDTKKAEKRHSSSEELPSKKLKD"
     gene            <169104..>170255
                     /locus_tag="FOA43_000083"
                     /db_xref="GeneID:62193484"
     mRNA            <169104..>170255
                     /locus_tag="FOA43_000083"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920418.1"
                     /db_xref="GeneID:62193484"
     CDS             169104..170255
                     /locus_tag="FOA43_000083"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776346.1"
                     /db_xref="GeneID:62193484"
                     /translation="MELEPELSELLTIQSNGDKQTEQFFASGCVAPSSALQSSSLSTI
                     SLGNPLTVQDSVDKYREIEKTIIKIPQFAREGEFLEFLAQSLKEASWKDSLSDKAARY
                     EIIVENQRGSTLFGVPMYSKQSMFYGADPPTFQALNGCGLGNMGIYPLPGRDWRWSWD
                     SWHVMMISDVDEDGWVYSNIRFGSKYWKGTRGFGRMVRRRVWVRMAERVTVEHDNDSD
                     SELASTLIVNGGAETSRDVSSPKDLPERSSNLPLVKLSVPVALPDPELELKSFCKSLS
                     KEVLDRLKSQRILEFFLNADTSLLAYLTNDFDKKHPAKHIGTSSYLRIITNSTWIDRL
                     IMSLRFHESRTIFLRRLSALIDDPPLQISPEKRTLLEQICKDGYICIGM"
     gene            complement(<170319..>172595)
                     /locus_tag="FOA43_000084"
                     /db_xref="GeneID:62193485"
     mRNA            complement(<170319..>172595)
                     /locus_tag="FOA43_000084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920419.1"
                     /db_xref="GeneID:62193485"
     CDS             complement(170319..172595)
                     /locus_tag="FOA43_000084"
                     /note="BUSCO:EOG093412J3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776347.1"
                     /db_xref="GeneID:62193485"
                     /db_xref="InterPro:IPR000178"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006847"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036925"
                     /db_xref="PFAM:PF00009"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF04760"
                     /db_xref="PFAM:PF11987"
                     /translation="MLARSSHPFDCNYSSVAAKRSRFGRQLGKNQDKAFEKHLSEGAV
                     KVDLHPSLLDVDEKKKGVNKRKEKGPRTKSKTRKEIDKGVQDFKDHKDRSDSKDHHKD
                     QKNHWDNKSHIRGENFAKVKSKPVKQKKKSSGKKVKLDIPSFLSVSNLATILRVRVPD
                     LLGQLNELGFENMTNDYILDGDTAALIAEEYGFEVNQDDNLGADLFPSPDPKDISKLE
                     PRSPVVTIMGHVDHGKTTILDYLRKSSIVKGEQGGITQHIGAFVVKTQSSERSITFLD
                     TPGHAAFLKMRERGANMTDIVILVVAAEDSVMPQTVEAIKHTKSAGVPMIVAVNKCDK
                     EDANPDKVVADLSRYGVDVEDYGGEVPVVKISAKTGLGMKDLEEAIVTVAELLELKAE
                     LDNIPVEGWILESQIKKGLGNCATFLVKKGELKKGMILVAGTTWCKVRVMNDENGEPL
                     KIAGPSTPVEISGWKEVPEAGDLTIEAKDESFAKKVVGNRERRKQQMAEAEQVDEMNS
                     RRVKQLKDAHRDEKIQEYQRDGFSLVEIKELDPDLFDAEVNKKKEVSFIIKADVSGSS
                     EAVRQSIEGLGNEEVTAQVLYDEVGAPTESDIERAKSSNSQILVFNLKVPKDIASSAS
                     AAGVEIKEFGIIYHLIEDVVNTLTESLPPKFETKVTSKATIKKLFDINLKGKESMTIA
                     GSRIIDGIFKKSAEVRLLRKGEEIYRGKVKQLKVEKDSVSEVKNGAECGIALEGDPEL
                     HEGDILETIKKISIKQHL"
     gene            complement(<172827..>174551)
                     /gene="ILV1"
                     /locus_tag="FOA43_000085"
                     /db_xref="GeneID:62193486"
     mRNA            complement(<172827..>174551)
                     /gene="ILV1"
                     /locus_tag="FOA43_000085"
                     /product="threonine deaminase"
                     /transcript_id="XM_038920420.1"
                     /db_xref="GeneID:62193486"
     CDS             complement(172827..174551)
                     /gene="ILV1"
                     /locus_tag="FOA43_000085"
                     /note="BUSCO:EOG093419FF"
                     /codon_start=1
                     /product="threonine deaminase"
                     /protein_id="XP_038776348.1"
                     /db_xref="GeneID:62193486"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001721"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005787"
                     /db_xref="InterPro:IPR036052"
                     /db_xref="InterPro:IPR038110"
                     /db_xref="PFAM:PF00291"
                     /db_xref="PFAM:PF00585"
                     /translation="MSYCILKMPLLVPQLRLVLTKGALCSARSIGTSTAAATLKKFPD
                     LRPSDLLPNGRPDYVKMILTSRVYDVIDDSPLSSAPLLSQKTKSNVYLKREDMLPVFS
                     FKLRGAYNMIANLSKERREKGVIACSAGNHAQGVAYSARQMGIPATIVMPVATPAIKF
                     NSVSRMGARVVLFGEDFDAAKDECDRLAEQEGLTNIPPFDHPYVIAGQGTIALELLRQ
                     VKANKLSAVFVAVGGGGLISGIGSYLKRLAPHVKVVAVETFDADAMYQSLKLNRRITL
                     NSVGLFADGTAVKTLGEETFKTCQEFGVDEVVRVTTDEISAAIKDVFEDTRSVMEPSG
                     AMTVAGMKRYVADHPEIDHSDKTYVPVLSGANMNFDRLRFVAERAVLGEGQEVFLGVQ
                     IPDEPGTFLKLQNIIDPRAVTEFSYRYSDEAKVTGVANIYTSFSVHNREKELPQLLKE
                     ISGAGFEAWDLSDNELAKSHGRYLLGGKSYVPNERIVAFEFPERPGALTKFLNLLQTR
                     WNLTLFHYRNHGDDIGKVLAGICVPPEDNAKFQDFLQKLGYKYSEESSNIAFKLFLTK
                     TNESSQEN"
     gene            <175636..>176289
                     /locus_tag="FOA43_000086"
                     /db_xref="GeneID:62193487"
     mRNA            <175636..>176289
                     /locus_tag="FOA43_000086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920421.1"
                     /db_xref="GeneID:62193487"
     CDS             175636..176289
                     /locus_tag="FOA43_000086"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776349.1"
                     /db_xref="GeneID:62193487"
                     /db_xref="InterPro:IPR007667"
                     /translation="MKVISDEELKEHNKWVLQAGLKGAGLGVIISLGIFGLARYKFPT
                     RVANMTWSVRTGAFVIPPAFCITVNAANASESFGSLKYNDDVALSEARAKENDDWSAM
                     TGRQKTIQVLNSNKYKIITGLWALSMWGSWKYVSRDKLLSKSQKFYDARMYAQFITIV
                     LLLGSIGLSMMDDKDAKNSRKFDDLADDDYMRQIMSQNLQAEQAQKEIRQQKAKAAN"
     gene            complement(<176392..>178954)
                     /locus_tag="FOA43_000087"
                     /db_xref="GeneID:62193488"
     mRNA            complement(join(<176392..177676,177933..>178954))
                     /locus_tag="FOA43_000087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920422.1"
                     /db_xref="GeneID:62193488"
     CDS             complement(join(176392..177676,177933..178954))
                     /locus_tag="FOA43_000087"
                     /note="CAZy:GH76"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776350.1"
                     /db_xref="GeneID:62193488"
                     /db_xref="InterPro:IPR003956"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="PFAM:PF00808"
                     /db_xref="PFAM:PF03663"
                     /translation="MTGYQLREQDRWLPIANVARLMKNTLPATAKVSKGAKECMQECV
                     SEFISFITSEASDKCLLEKRKTINGEDILYSMNILGFENYSEVLKIYLAKYRQQQALK
                     QERGEPRKKKSKSKKKTDEGGGVKEEVDEIQSDNETHDTAESDDVKHGESEKEEEQED
                     VAKDGTTTSIDAIDTTRTDGQQDSPAPPESKNRYVDQLYEQSYGDGQYAHNPNYHNAS
                     YGGGVDMARVSLDPTRVSHLETKDEASDDSAAPRAAVTESSSSSSTPTGNNGMDNIAG
                     YVDSNNESEQQPLVAASKMKTTTTATSADAELSLNLNDNVATAVSETEELAGLTNGHH
                     GENVLYSYASIKAACELLSTGLMDYYWGSQYGGDIGMFTHPYYWWEAGGAFGSMIDYS
                     VFFENDTWVTTIIDGMIYQTGTDDNYMPLNQTTTEGNDDQVFWGISAMEAAERNFTNP
                     SGNKPQWLYLAQGVFNTMAWRWDTSSCGGGLRWQIFEWNSGYDYKNTVSNAGLFHMAA
                     RLARYTDNSSYSDWAEKVYDWLLDVDFISENDASGYYLAYDGASTDENCTNVKSYQWS
                     YNAGLMVAGCAYMYNYTENGTWLQRAEGFVTGATVFFNSSTDIMYEAACQGAGSCNND
                     QRSFKAYLARFLSVTSILVPSTYDDISSLLTTSAKAAALSCSGGTDGHTCGMNWFEDG
                     WDGMYGLGEQMAALETIQSLVAKDRPAPYTSKNGGSSTGAGDAGMGSTEVLDKPLNLK
                     TADTVGAAIITVVLGLSVIALGYYVIVK"
     gene            <180906..>182375
                     /locus_tag="FOA43_000088"
                     /db_xref="GeneID:62193489"
     mRNA            <180906..>182375
                     /locus_tag="FOA43_000088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920423.1"
                     /db_xref="GeneID:62193489"
     CDS             180906..182375
                     /locus_tag="FOA43_000088"
                     /note="BUSCO:EOG09341NFB;
                     MEROPS:MER0013463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776351.1"
                     /db_xref="GeneID:62193489"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="InterPro:IPR036005"
                     /db_xref="PFAM:PF00557"
                     /db_xref="PFAM:PF05195"
                     /translation="MLKSLALLRISSRRYATLRAGQPLHETRPHLIKAGDITPGISAK
                     EYFNRRLRVAEHMEPQSIAVIAGQPTKFATESVFYYFQQNNDLFYLTGWNEPNSVCIL
                     EKPSADPSSLVFHMIVQPSDPAKELWEGDRTGVQGAMDIFNADITESIAKLSPHLEGL
                     LNHYKTVYYDFDETQKSSSFSKIIGKKDQAGRNALGSILRERRISLLSLKSITAPMRA
                     IKSNAELKMMRLAGKISGRAYNQAYARHFKSEKGLQAFLEYRFVSGGCDRNSYIPVVA
                     GGENALCIHYTRNDNLLKGNEFVLVDAAGSLGGYCADISRTWPVDGKFSPEQADLYEA
                     LLNVQRKCIAECTEDANVSVNDLHYKSVTWLTQELRNIGFNELTEWEVMKYLYPHYLG
                     HNLGLDVHDVPTYSRTAKFRKGQVITMEPGVYVPNDTKWPKAFRGMGIRIEDDIAIGK
                     DTNVIFTVEAAKEIADIESIAKSGVTTKLEDEVIDVYSL"
     gene            complement(<182401..>183937)
                     /locus_tag="FOA43_000089"
                     /db_xref="GeneID:62193490"
     mRNA            complement(join(<182401..183839,183895..>183937))
                     /locus_tag="FOA43_000089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920424.1"
                     /db_xref="GeneID:62193490"
     CDS             complement(join(182401..183839,183895..183937))
                     /locus_tag="FOA43_000089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776352.1"
                     /db_xref="GeneID:62193490"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="PFAM:PF01399"
                     /translation="MDIDIVNDYIKKYKVGPLFIRRLFFVVGKYSEDARIVVVVKRLL
                     ELILTSDSYYRLFNGIPVLIEVLNRHGETQAAFHYIDLYRSLAEPYLVADLNSQMALV
                     NKKYDGDISNYTSKQVNQENFNSLTELLKRKSLDLLMSTGSSEYLSDNTSFYYNINPQ
                     YLEYYKRVSLKEFEDYMVYRNYNNSLGLARGFLARKLEQILAYDKEREPEGEENDEEL
                     TDTRSTGSPDMLDKDELVLNSNSVITAAKLSQPEIVSYFRCRWYLIYASSLNNDYKGV
                     MSDFDKIVEENCLGNLGVSASQVLSEQFSNELVLSVNLLRIICLSVLIVKRSSELVRY
                     WKIPLLKSAILSDPLLNGLIKSYSSCKFDQSLKILAKMDEEYRYDYQISTIFPDMQRI
                     LRYKAYITYLSLVMRVSVEHMAGMFGVDVNVLYDELVMVIDMFGLQFKMDVTNRIVEF
                     SPSSSRLHKMGQELEAIDEEVKIGSRSLEVNSIVQGTFPEKDN"
     gene            <184086..>185369
                     /locus_tag="FOA43_000090"
                     /db_xref="GeneID:62193491"
     mRNA            <184086..>185369
                     /locus_tag="FOA43_000090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920425.1"
                     /db_xref="GeneID:62193491"
     CDS             184086..185369
                     /locus_tag="FOA43_000090"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776353.1"
                     /db_xref="GeneID:62193491"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="PFAM:PF13041"
                     /translation="MPSLQGFVRRFHSYIPHKVGHRVRNRLNAAVKLSRVPRDVESEN
                     ERQERRIQEKNARPVTNASAQSLVEKLLGKQLEENTVIGPRTSFTEEELNTIFKQRNL
                     RLKYKVLGTTGNQLKDSLIVDRDVIKYLERDEVTKAVWLARLARYQGIFAYGTILKYL
                     LIHEKFNAALSLFNDIKKRGQRPNGRVLNILFNGFANYGEGDMETVKISGSKVDSLYS
                     IFLRALETSPADVSIVHVNTLLKVFRRAKKPDLAIKLYDNILASKRRELRPDVRTYTE
                     MFSSLRSYTPDFKTAVQKAEELFARLQKDPLVKIDSQLIRSYSSVFVFANDPRLNARA
                     ITILREWYRLCTKEDIKKTVNWSKFNKNMLHDGPRKISVDVDVDQEVLLPLSDVNLKK
                     TKRFEPDESIVRRYSKMCKLFGIKDEYKPRYVEVE"
     gene            complement(<185469..>187283)
                     /locus_tag="FOA43_000091"
                     /db_xref="GeneID:62193492"
     mRNA            complement(join(<185469..186885,187135..>187283))
                     /locus_tag="FOA43_000091"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920426.1"
                     /db_xref="GeneID:62193492"
     CDS             complement(join(185469..186885,187135..187283))
                     /locus_tag="FOA43_000091"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776354.1"
                     /db_xref="GeneID:62193492"
                     /db_xref="InterPro:IPR036259"
                     /translation="MLGRQNQQTTTEGGPQSASSVPSQNFYNPVRSSLYIIILTLTVG
                     ALQLACTKDQQKIDLYTVPFACIGVYILDFSIALIQASARALIVDVVPTSQQQIANAW
                     AARMIGIFNIVGFCFGSINLPRRFPFFGNTQFKVLSVIVTILMGSMIAFCCWYVKERD
                     PKHDFAIRLQRQKQQMRLRQLCSDSDESQKIWIQTRLFFAQIVRSFKRLPPQVKMVCY
                     TEFFAWVGYFPLLFYTSSYVGELYLFENGYASPDQLPIDLKQHILDESTRRGTIALLA
                     NAIVTLAVDCLLPFLVERACPTSRWYRFFSTRYMWTLSHLVFILATMSTFMVTSSTSA
                     IILFAFLGFPWGCAVWIPFAMISEEISRIKDVRTIQIYDQQQKLNNEDNTQPAFMSGQ
                     SPSDPAQDSVRNGKYMELEQEMPMERPSITKKSRIYLAPSLVEHYDNLEHDSGILLAI
                     HNVFVSAPQMVSSVASSILFKLLGSKGGYDDSLAWVFRFGGVVSIGALVLSTRVKTND
                     QLYQDDKEMAKEA"
     gene            <187610..>190103
                     /locus_tag="FOA43_000092"
                     /db_xref="GeneID:62193493"
     mRNA            join(<187610..187616,188113..>190103)
                     /locus_tag="FOA43_000092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920427.1"
                     /db_xref="GeneID:62193493"
     CDS             join(187610..187616,188113..190103)
                     /locus_tag="FOA43_000092"
                     /note="BUSCO:EOG09341129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776355.1"
                     /db_xref="GeneID:62193493"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="InterPro:IPR014712"
                     /db_xref="PFAM:PF01417"
                     /db_xref="PFAM:PF07651"
                     /translation="MVRMTTYEKLVEGATKIKLAPPKPKYIEPILMATANGDDAESFR
                     TVMRTLTRRLQDSAWTIVYKSLITLHIMIREGDENVTIRYLARHPGMLELKITNGSGH
                     YIANGGELHMLLTYANYFAVRGREFGATTHDFIRETKRPAGSWSSQVANSSLRKLSVE
                     KGLLREIESVQRQIEALIRCRFRESEVNNDLVVLGFRMLTTDLLSLYQTLNEGVLNIL
                     EHFFELSKVDAERAFEIYTSFTKETTQVIEFLRVAKHLEHITKLHVPTIKHAQTSLTE
                     SLSDYINDPYFEVNRRQYLAEQDVKNGKGDGKGKENEKAKENEKKESKAVAQSSQQSV
                     PSVQGSLELQTTGFNPFSNYIRFQPSNLAPVPEFPQQTVGQQIPPPVQFVQQPTVQPI
                     SLVSAATIGEFPQQQMQSALQQTPQTVPGVAMSSVVPQPIQRAQTTGNSVRGNLRRQS
                     TNPFIMDSQKNSNVSVDSHNPFANTRFSSNSGITAMSFPQDRSTQRPAISRMESNPFT
                     SAGPAPTPYVEPMPQGLKPQATAGGLENLPTIPIFPETRRESADQQRQMDAARQLHQQ
                     KMQQMQQAQAQMQAQAQAQAQAQAQAQAQAQAQAQAQAQAQFQAQFQSQFQPQMQMQP
                     QMQIQTPQNYNPFLQTSNGEQNATSNGQPFSSVYNGPNLLG"
     gene            complement(<190232..>190492)
                     /locus_tag="FOA43_000093"
                     /db_xref="GeneID:62193494"
     mRNA            complement(<190232..>190492)
                     /locus_tag="FOA43_000093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920428.1"
                     /db_xref="GeneID:62193494"
     CDS             complement(190232..190492)
                     /locus_tag="FOA43_000093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776356.1"
                     /db_xref="GeneID:62193494"
                     /translation="MGQVSAAKFLGGILLVAIPLVGTSYFARPTFANAINSKLVQEDI
                     EKNRKHNYSSDGYNPSKSQDEIIKRYMKSGSGKARDFKPTTN"
     gene            <191212..>191667
                     /gene="MBF1"
                     /locus_tag="FOA43_000094"
                     /db_xref="GeneID:62193495"
     mRNA            <191212..>191667
                     /gene="MBF1"
                     /locus_tag="FOA43_000094"
                     /product="multiprotein-bridging factor 1"
                     /transcript_id="XM_038920429.1"
                     /db_xref="GeneID:62193495"
     CDS             191212..191667
                     /gene="MBF1"
                     /locus_tag="FOA43_000094"
                     /note="BUSCO:EOG09343VYU"
                     /codon_start=1
                     /product="multiprotein-bridging factor 1"
                     /protein_id="XP_038776357.1"
                     /db_xref="GeneID:62193495"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR013729"
                     /db_xref="PFAM:PF01381"
                     /db_xref="PFAM:PF08523"
                     /translation="MSDWENVTVIGRKARSSTNTGPKEKVVRSSGALNAARRQGAVTS
                     VEKKYNAGNLRGDPEGQRLTRVDRSDDIVVPKKLDADVGKVIQQARQEKKWTQKDLAQ
                     RINEKPTIVNEYESGKGIPNQQVLGKMERALGIKLRGKNLGAPLFKKKN"
     gene            <191894..>193111
                     /locus_tag="FOA43_000095"
                     /db_xref="GeneID:62193496"
     mRNA            <191894..>193111
                     /locus_tag="FOA43_000095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920430.1"
                     /db_xref="GeneID:62193496"
     CDS             191894..193111
                     /locus_tag="FOA43_000095"
                     /note="BUSCO:EOG09343ONU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776358.1"
                     /db_xref="GeneID:62193496"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR032675"
                     /db_xref="PFAM:PF13516"
                     /translation="MATLYESELNIPAERSFSLKDKTLKLDSLEQVQTYIDQLSKKKN
                     LEKIDLSGNTISPEASKYLAKEFLNHRDTLKELNLQDIYTSRDKFEIPASLKEFFAAI
                     EQLPQLRVLNLSDNAFGQDTIDVLEDFISKSKYFEHFIISNNGLGPFSGTRVGKALYK
                     MAKLREASNIEDENVRTLKTFWCGRNRLESGSAEFLALGLRANTDLQDIRLYQNGIRP
                     NGIARLVYHGLSRLPALQVLDLDDNTFTLPGSTALAESISHWPDLRELNINDCLMKAE
                     GCVKVLAKLSEFSDKSKLEALKLQYNELNSDGLKLLVGLLPNLKSHSILELNGNRFEE
                     DSEYIDKINSIFAIKGKGSLDELDDLEEPDSEEEAESEDEDESEKEEDDDQRKNIEDK
                     LASLEKELASTHI"
     gene            complement(<193198..>193908)
                     /locus_tag="FOA43_000096"
                     /db_xref="GeneID:62193497"
     mRNA            complement(<193198..>193908)
                     /locus_tag="FOA43_000096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920431.1"
                     /db_xref="GeneID:62193497"
     CDS             complement(193198..193908)
                     /locus_tag="FOA43_000096"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776359.1"
                     /db_xref="GeneID:62193497"
                     /translation="MNEFKIVVAGDNLETENALFISNHLSLVDYIIFPFLTTKTLEEA
                     ARQQNNLSGLESPIYAKDLTSFLLPKLQFFTWFQIWNMPSGRFWARISQTDENWELDG
                     QTLGSTFSEYLEQSRGTQWLITFPEVNIFTEKNSKMEQIMGEKYYLPHLEHVLYPRFS
                     GFANCIGGLYKAEFNRIYDTTLVYFQRSKETGKIINFTAPNLLQALGLIEDEIVIIVH
                     IHGKLLNRVRLRRDKLEK"
     gene            <194455..>197013
                     /locus_tag="FOA43_000097"
                     /db_xref="GeneID:62193498"
     mRNA            join(<194455..194463,194506..>197013)
                     /locus_tag="FOA43_000097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920432.1"
                     /db_xref="GeneID:62193498"
     CDS             join(194455..194463,194506..197013)
                     /locus_tag="FOA43_000097"
                     /note="BUSCO:EOG09341MG3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776360.1"
                     /db_xref="GeneID:62193498"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR003954"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /db_xref="PFAM:PF13893"
                     /translation="MSRLRHVFSEEGSVTDVKLIRKRNGESRRFAFIGFRSMEDAEGA
                     VKSRNGTFIDTAKIDVQLAKISTDPTLPLSWREKRKLKEREMQEMEEKMKDMEELQRS
                     VRSRKKQKKSNGTTLEEKIKENPELQQYLETMKSSGQGRSWNNDEVVDPENIPTATDL
                     ERALAKGDGTLVEATEGATEGATNEAFEANSEDDHSEVNVTTKSKEEKEEQVLQPKKG
                     KDSSDMDDLEWFKTKRVRIPEKSHERIEEPKDQEKKEPHNVEIVEKHHPTSVKPEAEP
                     RLSEHEINAGLISKSGRLFLRNILYSATESDFQGIFSKYGELEEVHVAVDSRNGSSKG
                     FAYVQFKDPDNAIQAYEELDGSIFQGRLLHIIPAKPKKENKLDEFALQNMPLKKQKLL
                     KRKIGAAKQQFSWNSLYMNNDAVLESVASNLGITKLDLIDPENSNSAVKQALAEAHVI
                     GDVRKYFEGKGVDLLSFNQKEKDDKVILVKNFQHGITKEEIGEKFAQYGKLTRILMPP
                     AGTIAIVEFRDTSSGKIAFNRMSFKRLGKSILYLEKGPKGLFSKEAEAGDVVDEKSET
                     SLDGVTEVKQSMDELMREESKPQQGNAVTGNVSENESEGDEEETGPTVSVFVKNFNFA
                     TTTSDINNLFKPLEGFVVALVKTKPDSKHPGKMQSMGFGFVEFRTRTQALAAIRAMDG
                     YVLDGHKLQMKLSTRTSERESGSESKKRRSSKSPKIIVKNLPFEATRKDVLELFNSFG
                     NLQSVRVPKKFDKSARGFAFVEFSTVKEAENVMDQLQGVHLLGRRLVLDFAEKEADNA
                     EEEIERMTRRAKKQTNARKMADIREGNSGKRKLDLEELDE"
     gene            complement(<197055..>197491)
                     /locus_tag="FOA43_000098"
                     /db_xref="GeneID:62193499"
     mRNA            complement(join(<197055..197434,197488..>197491))
                     /locus_tag="FOA43_000098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920433.1"
                     /db_xref="GeneID:62193499"
     CDS             complement(join(197055..197434,197488..197491))
                     /locus_tag="FOA43_000098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776361.1"
                     /db_xref="GeneID:62193499"
                     /translation="MIGTKVNQKVMDGLLDLTGLRKSLNSGSQLKLVNSLNEQLQFLN
                     ELHSIQIPRDEEKNLRLSRLVDDASDEAALNFDQLLSNIKDSEPEFIKGEVEETWNPI
                     SFTEEHDEDYYIVKEGLIKKNKTKN"
     gene            <197819..>199630
                     /locus_tag="FOA43_000099"
                     /db_xref="GeneID:62193500"
     mRNA            <197819..>199630
                     /locus_tag="FOA43_000099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920434.1"
                     /db_xref="GeneID:62193500"
     CDS             197819..199630
                     /locus_tag="FOA43_000099"
                     /note="BUSCO:EOG09341Z23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776362.1"
                     /db_xref="GeneID:62193500"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR010613"
                     /db_xref="InterPro:IPR036420"
                     /db_xref="PFAM:PF06732"
                     /db_xref="PFAM:PF16589"
                     /translation="MGRIQKRGVSGNAKNFITRTRAIRKLQVSLTDFRRLCIFKGIYP
                     REPRNKKKANNGSTAPVTFYYAKDIQFLMHEPIIQKFREHKSFAKKLSKALGKGEVGD
                     AKRLEEHRPRYKLDRVIKERYPSFPDALRDLDDALNMLFLFSSMRSTDKVHAKVISQA
                     TKLTNEWMAYVARERSLKKVFVSIKGVYYSANIKGQEIIWTVPFKFPQNIPTDIDFKV
                     MATFLEFYTTLLHFVLYRLYSASGLVYPPRINESKLKGIGGLSSYVLEGRKDDNTLFP
                     EVEGSEEKEAILSKEEITNAIKADEDNQEEEGDSEEIGKADSNADGEDVEKKLDEFED
                     KNSIKGDVLAQPSEFENATATLFSKFVFYVSREVPIDILEFVVLAAGGKVISEAALDE
                     ITLNGDVRKIDLSSVTHQIVDRPKVANKVQGRTYIQPQWVFDCLNEESLLNVSDYAPG
                     ETLPPHLSPWGDSGSYNPMEEDKKDAGEAGEDEEIEESEESEAEADEEESTEVSAIID
                     EDLKAQKELEMEAAGVKYSDVKEKEAKKKSKKRKIEGETEETEEKKLKMIMMSNKQRK
                     LYKKMQYGINKDEVRKGALQKKKRKLQKAESKLAKLK"
     gene            <200527..>203150
                     /locus_tag="FOA43_000100"
                     /db_xref="GeneID:62193501"
     mRNA            join(<200527..201782,201861..202282,202331..202359,
                     202584..>203150)
                     /locus_tag="FOA43_000100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920435.1"
                     /db_xref="GeneID:62193501"
     CDS             join(200527..201782,201861..202282,202331..202359,
                     202584..203150)
                     /locus_tag="FOA43_000100"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776363.1"
                     /db_xref="GeneID:62193501"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="InterPro:IPR029005"
                     /db_xref="PFAM:PF01803"
                     /db_xref="PFAM:PF04000"
                     /translation="MDAAGPFINVSTNAPSAHSTPSFIQASDQLQQYQIQGLDTGHMN
                     TNTMAAAAASAMMGRPESISHQQVIALQQLQASYGNLQNNIHKQLYQKRKYTTKDLRQ
                     QQLSQLPQQSSGNYISPRSTSASSPRASSSIRKSASSLSTPVDVPLMMAVPPEQEQQE
                     QQVRQRQSIRPQEIQQPQPVGPPNIQMDRPIESSRTSDMPSDHQAQQNSTVDGIANDA
                     IKKNIANVAIIRLFELTEKLSVKVGPDSVDYWRRVVSDFFSESGFASVALKQGQDMRR
                     YNFSCTLLPLILQAMVRDCATALEVSQNFIKASVLANGSAHLECARLVQRWWYPDGSY
                     KTRYGGLKVHFNSHLRIEKFDVSVLKCSWGIEMGPLESFLNSHPGADAGVIKKHFMAS
                     LGDNGYGFHESILRIMQIGDVMNLPKPDEKSPVPPQNLLNMLPQLYPQSQQSQQSQQS
                     QQPVHQVAQSLRGFLNAKNVVGLSDNTVPLGSLGPLDGMNPMAGTAPTDPTILAGSSS
                     HQPPQNTARFKLQQFQVPGNSGKGHNDSQKKTSRIPTQAQSKTRARKRAKNISTTKQL
                     SKDMENIEEVQKIIKSLGEETVDLNSALYDTLIKKELNELLSDLSDESNKITSELDKC
                     KLLNSYAYVIASLYFSYLKASGVNQHNDHPIMQELARVKAYTKRVASAEKMQTEREDT
                     KKVEKEAAQKFLEAEFGGHSGPAISSVHFEGKHRRFDVKTNIETISTEESKKIRQAMS
                     KPKTGPKNGQKRGHVHK"
     gene            <203314..>204624
                     /locus_tag="FOA43_000101"
                     /db_xref="GeneID:62193502"
     mRNA            <203314..>204624
                     /locus_tag="FOA43_000101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920436.1"
                     /db_xref="GeneID:62193502"
     CDS             203314..204624
                     /locus_tag="FOA43_000101"
                     /note="BUSCO:EOG09341QX8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776364.1"
                     /db_xref="GeneID:62193502"
                     /db_xref="InterPro:IPR006966"
                     /db_xref="PFAM:PF04882"
                     /translation="MFQYWRDLARKHRRKIVVTTGVVTVSYLIGRYVTNKVNEFQERL
                     REENFAKEQVKRRFKQTQSDCYMTFLSLLPVLVEPIYEELNVEQITRDLQNRRTDKSK
                     KGQDVVGSGPGLSTVASEDFPSSYAGADSNDDNNATQPMKTKTELWNTLKIESLTRFL
                     TLLYSESLLIIFLHLQLNVLSRKSYFETAVKLASQRVSNTLQEDDEEEEENTLAEQAF
                     LSFSWWLLNKGWIQLKNLIQDSIEDVFGEINPRQELTIEEFATLVNAVQQKICKSIAS
                     TAADNTTQGLIVSSLLPEPDLQFFLLQQTNDVGFLSSFNANLTHTENLNKLLMELKDY
                     LGNEQVSSILNLLVTVGISKVLDSIFADMVLKRKAIVNNEDQKMLANEQKLTKVKLAS
                     LLAAVTKQSNKLASNSLDNDILYTLNNLQELDDLSAGVYSNFEV"
     gene            <205202..>207253
                     /locus_tag="FOA43_000102"
                     /db_xref="GeneID:62193503"
     mRNA            <205202..>207253
                     /locus_tag="FOA43_000102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920437.1"
                     /db_xref="GeneID:62193503"
     CDS             205202..207253
                     /locus_tag="FOA43_000102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776365.1"
                     /db_xref="GeneID:62193503"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR023208"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="InterPro:IPR039261"
                     /db_xref="PFAM:PF00175"
                     /db_xref="PFAM:PF00258"
                     /db_xref="PFAM:PF00667"
                     /translation="MAIDTLDLTILVAILAALIAYFTKGKLWAKGDAEDVSASGASGS
                     RDIVLTLNETGKKAIVLFGSQTGTAEDYAHKFAKEFQSRFGIPTMCGDLADYDYDNFE
                     KIPTQVPNFQMVIFLAATYGEGDPTDNAIDFFEYLENDCEDLSGLKFACFGLGNSTYE
                     FYNASGKKVVKVLQEKNAELIGELGLGDDGKATTDEDYLSWKDSLFEVIKDSLSLQER
                     DLEYEAGIEVIEDHTLTEDSPSVSLGEPDASYVNPVTPEDKTYLERGPFDNTHPFLAP
                     VVSIRDMCPVRHCIHAELDISGSNLRYLTGDHLAIWPSNPDSKVNKMISALDLDSKKD
                     TIIKIHSLDPTVRSLIPTPTTYATVIRYYLEISGPVSRQFIKSVAQFCPDDATKGKID
                     EISGNKELFQKEITDQGLNIADALLLLSHGVKWTTVPFAFIIESIPHVQPRYYSISSS
                     FLSEKETVHITVMVEANKVTGTDRMTTGVASNLLYDIEANSNGTKAIESYNLEGPRGK
                     FRKYRLPVHIRRSTFKLPTNQDTPIIMVGPGTGVAPFRGFVREKVKLAENGKAGKGDV
                     VLFYGCRKSTEDFLYKSEWPEYAKKLGDKFTLITAFSRETDKKVYVQHKMRENSKKIA
                     ELLDQGAFFYVCGDASGMARDVQKALIDIMVKEKEILEDDAIEMVKQLKIQNRYQEDV
                     W"
     gene            <208737..>211955
                     /locus_tag="FOA43_000103"
                     /db_xref="GeneID:62193504"
     mRNA            <208737..>211955
                     /locus_tag="FOA43_000103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920438.1"
                     /db_xref="GeneID:62193504"
     CDS             208737..211955
                     /locus_tag="FOA43_000103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776366.1"
                     /db_xref="GeneID:62193504"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF04082"
                     /translation="MTSTNHRARSSTSKSKTIKPPGSNTTRVSVACDRCRKKKIRCFY
                     DDDDKDYKPGETRPCGNCKAVGLECIFTDKLARKAFPRGYTESLEERVRELEFENKKM
                     QKLLTLKNETSAESPSAPTSQSPDGIVHSSSEEHSSATTPSTHKLPLNDENLTMFNNQ
                     QQKGRVQNTIADHEVLSCGHLHDEACSCGYAHSIHNRPVSIAGSVDIDRGELSDDDIS
                     LYSATPSDQYPLTTSVDDLRDRYGYNSFEQANAPGAAAAISLQNKLRTKNFMNLANLI
                     AASIPRSTEETLFIPTLLARIVSVHGFNSKAPYLTARSIALLKEKPNEGGRYSQFSFT
                     FKGINFNAMKREESIQFFQDLNLPNYMNLDLCITVFFDTWNKVIPILSKEIFMSNYMR
                     FSKSREQNFQDGEMIGLEKFGELLVIITALVMLSHERHNSSQSKHQKNASNSEILQFY
                     DHMIKQFIESNLSSICSIPSLQMVSIELFYCLTTGDLNTSYELRGKMVTMSQQLRLQR
                     CPAAVLGYNGSSVSKLQQGERRILFWCSYTLDAFSAFILGVPRLFKDYEIECALPSSS
                     SSNKEKDSDTNMITFNNSQLSLVGKVGDSALSVMRYARILGTIVDTVFKRSSNNLKKP
                     SADESSCLVLEEMLDSWRREMPPTISFDRLDVDGKLSDYEKLNDTQLTLLYLYYQAKA
                     LIYMPLMASESKSTSKNSPAFISIQQATTAILTITKVLSSQKHNYYYLPIPMNVPRQK
                     ARFALLAAKGALEYTRGGALFQESKNLLNAVTDDLKNESDINMLGCLSMNCCTCLEHA
                     IDAILSQPKPSVSPSPPPSTAHIIQDRIDPHKNDTRRKGSSPLKNVAIMPDEGNAAVK
                     QEQDSTSALNDIFSNKAGYQIQTLQQQMRQPIQSQQQRSRSVSSGSGFAQGYTGAGAT
                     QALQAPITWNPDNMGSYRKEQEQQLNESLQNLQDSNGENVINMIHMNHYQEDKNMNAT
                     VQQIPPNMETQHQLQQPTVQQIHKQMVSEPIKSFSDLLMLNDFGVDASLGLPLMDFEL
                     DGPNKKPKIDGNSSPSNTVIQPRENGTSTGDYNSYNSLFNWH"
     gene            complement(<211981..>212904)
                     /locus_tag="FOA43_000104"
                     /db_xref="GeneID:62193505"
     mRNA            complement(<211981..>212904)
                     /locus_tag="FOA43_000104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920439.1"
                     /db_xref="GeneID:62193505"
     CDS             complement(211981..212904)
                     /locus_tag="FOA43_000104"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776367.1"
                     /db_xref="GeneID:62193505"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="InterPro:IPR036812"
                     /db_xref="PFAM:PF00248"
                     /translation="MTFSLPIGPLGIPQLGFGTGTYYYKGADTLTFNQSLVDMLVEAV
                     HQGFIHIDTAESYGVYPEVAAALKQLLTEMDRSSIFITDKYSGSPSKGISKNGTPYEH
                     LKKILNKLGTDYVDLYLIHSPFITNEKIGFTLAEIWKSMEKCLDEGFAKRIGVSNFAV
                     SDLQDILQTAGHKPLVNQIEFNAFLQNQTPGIFQFCKSHEITLEAYSPLAPLTKVDHS
                     SGVGEQMDLFLGQLAEKYDKTKTQILLRWVLQLGVVPISTTSKRSRLQEWKGVFDFQL
                     EQAEVDTVTSIGQSYKPRLRLYMRSQYSKYD"
     gene            <214833..>215846
                     /locus_tag="FOA43_000105"
                     /db_xref="GeneID:62193506"
     mRNA            <214833..>215846
                     /locus_tag="FOA43_000105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920440.1"
                     /db_xref="GeneID:62193506"
     CDS             214833..215846
                     /locus_tag="FOA43_000105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776368.1"
                     /db_xref="GeneID:62193506"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00044"
                     /db_xref="PFAM:PF02800"
                     /translation="MTFNVAINGFGRIGRLVLRIAVARKDINIVAVNDPFISAEYAAY
                     MFKFDSTHGRFKGEVYAKGDNLIINGHTIKTFQERDPENLPWGKLGVEFVIDSTGIFK
                     TNELAKKHIIAGAKKVLITAPSKDAPMFVMGVNEDKYTPDIKILSNASCTTNGLAPIA
                     KILNDNFGIAEGLMTTIHSITATQKTVDGPSSKDWRGGRTASGNIIPSSTGAAKAVGK
                     VLPELSGKLTGLAMRVPTTDVSVVDLTLNLKKPTTYEEICAVMKKASEGAYKGVVGYT
                     DEAVVSSDFVTDTHSTVFDAKAGIQLTPTFVKVISWYDNEYGYSTRVVDLLEHVAKVS
                     GSA"
     gene            <217187..>220107
                     /locus_tag="FOA43_000106"
                     /db_xref="GeneID:62193507"
     mRNA            join(<217187..217195,217234..>220107)
                     /locus_tag="FOA43_000106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920441.1"
                     /db_xref="GeneID:62193507"
     CDS             join(217187..217195,217234..220107)
                     /locus_tag="FOA43_000106"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776369.1"
                     /db_xref="GeneID:62193507"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MHVGAFPQPQPVYMNLSNSNSAPNLYKNGNSLSGRKLTSSLSEA
                     TFTSEEDVPNTHLPPDPNLSSRLVQDVQDDDNDEKLSTDGSVSPLAYPSSPSPPNQPL
                     SDTKAQQPLCSSKTSEDRTIKFSKLEKSNKVKDILNLIEFGPIESCQVHHPTISADDN
                     NNGDDDDDDGKSHAGDDVDSNTNTKLSASLSFVSPAVAVRCYTQLKEMLPDLKTALNS
                     PELELKLVTGEPLSQELRDAIKRDGASRGICVSNLPKGVSQSNMLKELRKYGEIEALK
                     YKLSKNSAFVYFTCIASAVSCLSELSSANREGQMFSQSKIFYAPDKNTSQTNIPDSVR
                     GAIDSYYTSVNDSLGDMCLTPSTSISSPRASASRIFRHSSSTSSSARFNSQMELPMSI
                     PAPGNVPPTLVPSSAGVLPGPYSSFPEYASVSPFVHSTSSTFNSSMSPLSGTFAEQQI
                     YSQNSHHGHSSSLNDALDAIPDNLGNRTIYLGNLDSVTNQEDICNVVRGGILESVKLL
                     RDRRVCFVTFIHSEDAAEFMSRATSSGVYVRSRCLKVAWGRNSGPLRPQIEEAIENGA
                     CRNLYIGIVRDEDENSAKEDTEPDPEEPAEHQKEKTSSEPFLNSSNASEGTEIPEEQT
                     LRRDFSFFGGIEQINYFEDGRCAFVNFFNILSCMKAVESFNGPDSQRTNASFHGRYTP
                     FKISFGKDRCGIPPKKKKKKKNRTSRSSSSADNEGNDNKQFEDSKFRAALDGMQISST
                     TLEEKKKEEHENKMDAVVEEKTEEEIKQKMNSSSTKLRKPSEYYPASSDSSSRSHSRH
                     DRRRRPSRRPLGSNPFGQSGYENTNSYYKNDGNLMGSPMAYYGNGGYYSSEGQVGSPA
                     MTQGPGFYMHGGYSLSSPQLVPPSQPGYYVPQVQMYYQPYPQSSAGQYSNRPYKYQHR
                     QRRRFSDKPETSVTEEESENDDDEEEEKGGVSTEEKHDASLVETVI"
     gene            complement(<220210..>221616)
                     /locus_tag="FOA43_000107"
                     /db_xref="GeneID:62193508"
     mRNA            complement(<220210..>221616)
                     /locus_tag="FOA43_000107"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920442.1"
                     /db_xref="GeneID:62193508"
     CDS             complement(220210..221616)
                     /locus_tag="FOA43_000107"
                     /note="BUSCO:EOG09340UBX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776370.1"
                     /db_xref="GeneID:62193508"
                     /db_xref="InterPro:IPR007306"
                     /db_xref="InterPro:IPR033421"
                     /db_xref="InterPro:IPR033449"
                     /db_xref="PFAM:PF04179"
                     /db_xref="PFAM:PF17184"
                     /translation="MTDPEILKDLKELEKSSRRSNLSIRNRLLSILHDHSYLVNLRNA
                     VFKEFDVLFIPNERCGLWYLKHDEFPATCYFKSTDGHTGQWDFSTRRLNFHLLPLLAS
                     HDALVIVDSTRSGKKMSDAFSRTIPIWCSILGKMISPELSWNQLLFVPSVVSTMERET
                     IIKKLDVLYEKFLGLDLSIPVPKPLRPFRPVWISPGSLIDASAVRELLNLETQQFQPL
                     FLVTASKACPDGEDKMAAYTYVQGAADDHESWSRGLDSQMFWNHVECFSDVLTDESMV
                     VSNVVRLVDSARLASSPVQTIVSGCTAFWDTTDVTQITSQIFLGKLQDQLPHHIDVNW
                     KSNDFTLVVVLDESIVASTPHCASYPLTSGSKKSSRQLRKELPKIMNLIKSVLYADDS
                     NRIILLCGDGSDLSVGVLLACLCMYYNENWTYRLDSPNINKVDKVQIHRHLARIVEKR
                     RVNPSRATLNSVNYVLMS"
     gene            <221729..>222286
                     /locus_tag="FOA43_000108"
                     /db_xref="GeneID:62193509"
     mRNA            <221729..>222286
                     /locus_tag="FOA43_000108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920443.1"
                     /db_xref="GeneID:62193509"
     CDS             221729..222286
                     /locus_tag="FOA43_000108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776371.1"
                     /db_xref="GeneID:62193509"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="PFAM:PF01661"
                     /translation="MSLICYAKGDLFELTKKASRGPVLLAHACNCKGVWGGGIAFAFK
                     QRFYSAYKLYHNYCLQFKLNPKKLLGTSLLLPVSPKDRGFIRGIGEQIIIVCLFTSVM
                     GEETENEIASNTENAMIDLKKQLSDPKFVGNEQVRDILNHADDSADKLLINMPKINAG
                     IFSVPWSLTEQALLKSKLPCRVFVL"
     gene            complement(<222302..>223450)
                     /locus_tag="FOA43_000109"
                     /db_xref="GeneID:62193510"
     mRNA            complement(<222302..>223450)
                     /locus_tag="FOA43_000109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920444.1"
                     /db_xref="GeneID:62193510"
     CDS             complement(222302..223450)
                     /locus_tag="FOA43_000109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776372.1"
                     /db_xref="GeneID:62193510"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="PFAM:PF00160"
                     /translation="MGRIVIELFVNQAVNATDNFLQLCKSKSYKKTYFHRVICNFMVQ
                     GGNNEVKSPITESAYPYDGEKKLAKGGHSIFKSNENSYGDFKDENLGNLDNSFLVCMA
                     NLGRPNTNRSQFFITTASASHLNGKHTIVGKVTHGKSVVRAIEHVEVYSTDPEDARGW
                     IPKDPVVVADCGVWNKDKDDTPVYCCCEDSLGGDVFEEYPDDNERLEEMNLSLDNPEQ
                     AYSICLVIKKSATMLLQHKRYQDSLYKYKKAMRYCNELLPDEEKHKEDYDKFLDLKKT
                     LYLNLAFVSLQLLEYQKCIDYCGYLFEFINDNKGVKLTSIQVSKAFFRLGKAFEGLKR
                     YTEALDALKNGLAVNIEDAGIKAEVVKVKKLKFESEKGERMRYARFFN"
     gene            <223730..>224432
                     /locus_tag="FOA43_000110"
                     /db_xref="GeneID:62193511"
     mRNA            join(<223730..223772,223825..>224432)
                     /locus_tag="FOA43_000110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920445.1"
                     /db_xref="GeneID:62193511"
     CDS             join(223730..223772,223825..224432)
                     /locus_tag="FOA43_000110"
                     /note="BUSCO:EOG09344CRY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776373.1"
                     /db_xref="GeneID:62193511"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR036967"
                     /translation="MLKNISRVRFNGLRAFSTFRSLLNELTGNNTFGSILGQESGAGN
                     SRTIPQSSTITANTIKTKKNTNMKTLKHILHCKFRKNNTFLTLTKVEVDMNYEHNNPN
                     ESFNEKVLYYLTLPQKVILSQSTGYVGFRKAQRGEYEASFQLTSHIFKLIRERHMLED
                     GQSLEIVVREFGKGRKAFFDALKGKEGMGIRDNVTKLSDLTAIKFGGVRSPSRRRI"
     gene            <224700..>225125
                     /gene="RPL25"
                     /locus_tag="FOA43_000111"
                     /db_xref="GeneID:62193512"
     mRNA            <224700..>225125
                     /gene="RPL25"
                     /locus_tag="FOA43_000111"
                     /product="60S ribosomal protein L25"
                     /transcript_id="XM_038920446.1"
                     /db_xref="GeneID:62193512"
     CDS             224700..225125
                     /gene="RPL25"
                     /locus_tag="FOA43_000111"
                     /note="BUSCO:EOG09344DH5"
                     /codon_start=1
                     /product="60S ribosomal protein L25"
                     /protein_id="XP_038776374.1"
                     /db_xref="GeneID:62193512"
                     /db_xref="InterPro:IPR001014"
                     /db_xref="InterPro:IPR005633"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="PFAM:PF00276"
                     /db_xref="PFAM:PF03939"
                     /translation="MAAETKAQSAKKGALKGSYSSKALKVRHSTTFRLPKTLKLARSP
                     KYTKSVPHYPRLDAQTVIQQPITSETAMKKVEDANTLVFQVSIKANKYQIKQAVKELY
                     EVEALKVNTLIRPNGTKKAYIKLTSDYDALDIANKIGYI"
     gene            complement(<225222..>226292)
                     /locus_tag="FOA43_000112"
                     /db_xref="GeneID:62193513"
     mRNA            complement(<225222..>226292)
                     /locus_tag="FOA43_000112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920447.1"
                     /db_xref="GeneID:62193513"
     CDS             complement(225222..226292)
                     /locus_tag="FOA43_000112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776375.1"
                     /db_xref="GeneID:62193513"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00056"
                     /db_xref="PFAM:PF02866"
                     /translation="MTRNIAIDSKKNTGVRVCVLGAAGGIGQPLSLTLKMNPHVRELS
                     LYDVSPHVPGVAADLSHIDTPAKVTWHTPETGGLKAALEGCDFVLIPAGIPRKPGMSR
                     DDLFKINAGICAELAAGIAQYSASATVLVISNPVNSTVPVFAEVLKKHGVFNPRKLFG
                     VTTLDSVRADTFIHEIKPDLPWGLIKVIGGHSGDTIVPLLSTVLGKEIDRVPNEKLHA
                     VNHRVQYGGDEIIQAKKGAGSSTLSMAYAAYKFFTTVLNSYLGLTDKNVACTFINTEY
                     DDDALDGVSELKDLVKKLTNRPDMKLKYFAMPCVFGPNGIERVEYECLETLDKTEVDM
                     VNICCETLASNYSKGVDFVNGK"
     gene            <227051..>227749
                     /locus_tag="FOA43_000113"
                     /db_xref="GeneID:62193514"
     mRNA            <227051..>227749
                     /locus_tag="FOA43_000113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920448.1"
                     /db_xref="GeneID:62193514"
     CDS             227051..227749
                     /locus_tag="FOA43_000113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776376.1"
                     /db_xref="GeneID:62193514"
                     /db_xref="InterPro:IPR001783"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR026017"
                     /db_xref="PFAM:PF00677"
                     /translation="MFTGIVEAIGEVKEYLSSDISEAGGNGASVTIKNADSILGDCHL
                     GDSIAINGTCLTVTRFDSDTFKVGISDETLRRTNLGLLSRGDKVNLERAISGNVRFGG
                     HMVQGHIDTVAKIVDRQADGNSISFQFQLRDREFINYIVLKGFIAVDGTSLTVTDVDY
                     REAAFKIMMVAYTQNKVVLPKKRLGDLVNVEVDLTGKLIARQVELQLEGQAFNKNSTL
                     YKLVSKIVDQKLAN"
     gene            complement(<227764..>229089)
                     /locus_tag="FOA43_000114"
                     /db_xref="GeneID:62193515"
     mRNA            complement(<227764..>229089)
                     /locus_tag="FOA43_000114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920449.1"
                     /db_xref="GeneID:62193515"
     CDS             complement(227764..229089)
                     /locus_tag="FOA43_000114"
                     /note="BUSCO:EOG093424MI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776377.1"
                     /db_xref="GeneID:62193515"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /translation="MSEEPSQESAEHSDTDQPEYVSVQEVEEVIDENDTGTPEAEDEP
                     MDSTMNGGDNSEGTSGNGVTEKEQGNIEIDLSNNSVAYFDQHEDSIFTVATHPTLPLA
                     ATGGGDNATYLWTTHTSPTRFVGKLEGYTESVIASGFTSDGKYLITGDMTGKVLVHKA
                     KKKGQIWTLFAELQQVEEVSWISVHPKQDIFAFGATDGSVWVYQMDESNSPTADLVFT
                     GYSHSMDCTAGAFFDVDNTMGELKLLTVSEDGSIIGWNCYTQQQLFKLNSNQMKGLTP
                     PWVTLDIYENSDHKIAAIGSRNSQVVIINLDAGTIVNVFTALELGPDANIYDASIEGI
                     SWCRCANLNLLAVGLVSGDVIIFDTHTWGVRKNMKCQDAVTKVVFFKDSAYLLGSSMD
                     GKVYKWDARTGEVVHTYVGHHMGVLGFGIDCGNRLITAGDEGVSLVYDI"
     gene            <229247..>230620
                     /gene="PRL1"
                     /locus_tag="FOA43_000115"
                     /db_xref="GeneID:62193516"
     mRNA            <229247..>230620
                     /gene="PRL1"
                     /locus_tag="FOA43_000115"
                     /product="Protein pleiotropic regulatory locus 1"
                     /transcript_id="XM_038920450.1"
                     /db_xref="GeneID:62193516"
     CDS             229247..230620
                     /gene="PRL1"
                     /locus_tag="FOA43_000115"
                     /note="BUSCO:EOG0934274R"
                     /codon_start=1
                     /product="Protein pleiotropic regulatory locus 1"
                     /protein_id="XP_038776378.1"
                     /db_xref="GeneID:62193516"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MTISSYERLKKDTKALFETPTAAALRNSLYNQKSNLAYEKCITN
                     LSLYSQFSQLPGYLERKLNKHKNILEKLKEESPNANTKDDLGLPIIDGNQALVTRSTT
                     TKSSALSKLQKNQILYKDRRSEDIFANDLIVPKLHKSNQKVTQHMKWKMFRVLMGHTG
                     QVTALAFDPQNKYFVTGSSDRTIKIWNLASGQLQLTLTGHIMAVRGLVVSDRHPYMFS
                     CSEDKSVKCWDLEKNKVVRDYHGHLSSVYTIDIHPTLDLIVTGGRDSSVKVWDIRTKL
                     PVYTLTGHKNTVNKVYCRSTDPQIISCSMDSTVKTWDLVAGKCDKTLTYHSKSVRSFC
                     CDETREEFISGSADGLKKFNLPSCEYLQEVDGLPHDQLNQGNLILNSNCCNNDGIMFV
                     GADNGQYGFWDWESGTVFEQGTTIPVPGSLNSEKGILCSSFDRSGIRLVTGNVDKSVR
                     VWKPVNE"
     gene            complement(<230650..>231792)
                     /locus_tag="FOA43_000116"
                     /db_xref="GeneID:62193517"
     mRNA            complement(<230650..>231792)
                     /locus_tag="FOA43_000116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920451.1"
                     /db_xref="GeneID:62193517"
     CDS             complement(230650..231792)
                     /locus_tag="FOA43_000116"
                     /note="BUSCO:EOG09343UDI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776379.1"
                     /db_xref="GeneID:62193517"
                     /db_xref="InterPro:IPR007134"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="InterPro:IPR019461"
                     /db_xref="PFAM:PF03987"
                     /translation="MASEYIRSTFSSLREYLTPVTHTSTFITTGEITPEEFVQAGDYL
                     VYKFPTWQWSPAPESRRRDFLPQDKQFLVTRHVPSYVRAIDYEKGESSDNMDEFTDSL
                     SPEEAWTSPQTKGIRRHCTPEDERRHSMEYVQMKESGDTVSGHSITTRSSGEGDIRAI
                     TPKITDESTSLGDEDFINDIDELIDDEAEEFIEGEHKNPENSREEIVNDPSKRSYDLY
                     IAYSTSYRVPKMYMVGFDLNGAPLTPEQMFQDIASDYRHKTVTIEKAPFLTNTTSVSI
                     HPCRHATVMRALMKMASKKIHNVDETQGILKGVSKLGLADAAQQTSSSTATTTTANAE
                     ADDEDWESLQDQPQSSIRVDQYLIIFLKFMASVTPGIEHDYTMDAL"
     gene            <232218..>234152
                     /locus_tag="FOA43_000117"
                     /db_xref="GeneID:62193518"
     mRNA            <232218..>234152
                     /locus_tag="FOA43_000117"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920452.1"
                     /db_xref="GeneID:62193518"
     CDS             232218..234152
                     /locus_tag="FOA43_000117"
                     /note="BUSCO:EOG09340VAG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776380.1"
                     /db_xref="GeneID:62193518"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PFAM:PF02450"
                     /translation="MTPKRRRNSDVSTSARIKTKTTVKKKVAPKKTAHTTITSEVEHK
                     KKKKKNNNNFFSTRRFIFIFGIVLGIVCAGYFGTKTVMDTDFLSDPDTYNRMTQYWED
                     WKDVLPQGLQSLLEESGKEEFHDPSASFAIGKLVKKKGYEAKHNVILVPGTTSSGIES
                     WGLEGVEGCPSESYFRKRLWGSFFMVKTMVLDKDCWLKHVKLDPTTGLDPPGVKLRAS
                     QGFDAADFFITGYWIWNKIIQNLAVIGYGPDNMFSASYDWRLAYLDLEIRDGYFTRLK
                     NNIETMQSVNGQKTVLLGHSMGAQVIFYFMKWVEADGEYFGNGGKHWVNDHIEAFVDI
                     SGCLLGTPKATVALLSGEMKDTIQMRGLGVQVLEKFFSRSERTELLQSWGGVVSMLPK
                     GGDLIWGNQQGAPDDLLLQKGQDNSSGTLGNFIRFTDPTGEYSSRNLSIEESVDFLYE
                     QGSHSFKKNALEHGSTGYATSEEELKDNNDKHNKWVNPLEVALPNAPDMKIYCFYGVG
                     KPTERAYYYKEEEDKASAHLNVSVDMSRDVPVLFGEGDGTVSLMTHYMCYKWAEAGHN
                     MYNPGNSNVTIVEIKDEPDRFDIRGGAKTADHVDILGSAALNELLLRVASGHGDGISN
                     HYVTKLKDLALRIDATKFAP"
     gene            <234734..>235828
                     /locus_tag="FOA43_000118"
                     /db_xref="GeneID:62193519"
     mRNA            join(<234734..234739,234884..>235828)
                     /locus_tag="FOA43_000118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920453.1"
                     /db_xref="GeneID:62193519"
     CDS             join(234734..234739,234884..235828)
                     /locus_tag="FOA43_000118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776381.1"
                     /db_xref="GeneID:62193519"
                     /db_xref="InterPro:IPR013734"
                     /db_xref="PFAM:PF08528"
                     /translation="MTRSMSMGLEEKELLCRRAKLTPRQEKARILKMRLQLAYYKVKT
                     NQADVPVHQLRLPGVGRKYNDVSFTPDTAPCSPNQPIHRKSKSQPKSLDALSDLLAAS
                     SPLFKRTNPVNATHRRPGRSGKHKMLKSINHSGKTRGKRLDDVVAARKSASSLMQRQQ
                     QQPLSMYGHIHAFSIDCTRSRPSYLQPLSAPPIASRMGLTLPTPFHHQSFSNQTSPSR
                     FLISNTGRGIARTSIFPPSVPTTNSQDLDATIIQNTSSLILTPVRGTRAPKLGVAGSS
                     DRYQSINQDEIQAQTKSPSRLQSTPSSIGAARCLLQLAHR"
     gene            complement(<236009..>238238)
                     /locus_tag="FOA43_000119"
                     /db_xref="GeneID:62193520"
     mRNA            complement(join(<236009..237075,237728..>238238))
                     /locus_tag="FOA43_000119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920454.1"
                     /db_xref="GeneID:62193520"
     CDS             complement(join(236009..237075,237728..238238))
                     /locus_tag="FOA43_000119"
                     /note="BUSCO:EOG09343PVM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776382.1"
                     /db_xref="GeneID:62193520"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="PFAM:PF08449"
                     /translation="MVTSQKDIPKRVKSYQFAPSTIQGWNDCPELPLSKSSNRRSRPR
                     RASSYASFLDVEQPRKGTGSTNRLSSATRPPKISKFIVESSSESHEPVGNLSIDVQSS
                     LDALLSKKTTLPLDAFNFYSARLGDKSVLTSEDNRHLSASIIEDIKNGHDKIYIKNRI
                     LEFMKVHAGMNGKLAPSAMKSSLGKSSLPLLFVCCAGIYSSFLTWSYLQEKISSKNYS
                     VDLDQPAYFKATLIINAVQSFFAIIVGTAYLSIKNKAVSNPVSFLISNPELFSKFSLI
                     ALSQSVSSPISYQSLNHVDYLFYLLAKSCKLIPVMLIHWLIYGSRFPLYKYIAAFVIT
                     LGVIIFTVGDGKSRGSALSNDGQTLTGLLQLMVSLMLDGYTNSTQDQLFKQSSLPSRR
                     NKEPMTAGHLMAVLNLLNFTMTFVYLVAFTNQWQQFTDFVATNGKEVLLDIVCFGLLG
                     ALGQVFIFITLEQFSSIVLVTVTVTRKMLSMCLSVFLFGHQLRCNQWVGLGLVCTGIL
                     TESAYKIIRIKPKAKRE"
     gene            complement(<238359..>239549)
                     /locus_tag="FOA43_000120"
                     /db_xref="GeneID:62193521"
     mRNA            complement(<238359..>239549)
                     /locus_tag="FOA43_000120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920455.1"
                     /db_xref="GeneID:62193521"
     CDS             complement(238359..239549)
                     /locus_tag="FOA43_000120"
                     /note="BUSCO:EOG09342CDA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776383.1"
                     /db_xref="GeneID:62193521"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MWEYLTCCFPCILDKTPTLRINGASFKILDLLGEGGFSYVYLVQ
                     SQTNHSLYALKKINCPYGDTNFQQAMKEVENYREFKSPYIMKSIDSSVVQEKDGSKTI
                     YIILPYFENGSLQDIIDKSSVNKVKMNEDEVLRLFIGICRGLIALHRHQLSKNYQMIL
                     SMDGRRARGGSESEMDVPGATDTNDNEEDNPFLSLQERQGLSDEDPTGRNQLPGHYAD
                     ADSDTVVDLLNAQDGTELTETVSMAHRDIKPGNLMLSKDGTPVLSDLGSCDKAQVLIQ
                     SRSQAITLQEFANEHCTLAYRAPELLDIKTGDELDEKVDIWSLGCTLYALLYGCSPFE
                     REEIVNGANITLAIQSGNYSFPDEPIYRDGLKLLVQFCLVIEPKKRPSIEEVLSKALD
                     VQRV"
     gene            <239765..>241180
                     /gene="RVB2"
                     /locus_tag="FOA43_000121"
                     /db_xref="GeneID:62193522"
     mRNA            <239765..>241180
                     /gene="RVB2"
                     /locus_tag="FOA43_000121"
                     /product="RuvB-like protein 2"
                     /transcript_id="XM_038920456.1"
                     /db_xref="GeneID:62193522"
     CDS             239765..241180
                     /gene="RVB2"
                     /locus_tag="FOA43_000121"
                     /codon_start=1
                     /product="RuvB-like protein 2"
                     /protein_id="XP_038776384.1"
                     /db_xref="GeneID:62193522"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF06068"
                     /db_xref="PFAM:PF17856"
                     /translation="MTSIQTKSEGSILSNLSLIAAHSHISGLGLDDHLQPKDCAQGMV
                     GQLKARKATGVILKMIQNGKIAGRAILFAGPPSTGKTAIAMGLSQNLGTGVPFTAIAA
                     SEVFSKDISKTEALTQAFRKSIGIKIKEETEMIEGEVVEIQIDRSLTGGHKQGKLTIR
                     TTDMETIYELGNKMIEELTKEKVIAGDVISIDKSNGKVTKLGRSYARARDYDAMGPDT
                     KFVSCPEGELQTRKEVVHTVSLHEIDVINSRQQGFLALFSGDTGEIRPEVRDQINTKV
                     AEWKEEGKAEIVPGVLFIDEVHMLDIECFSYINRALEDDFSPIVIMATNRGISKTRGT
                     NYMSPHGLPLDLLDRTIIIKTEAYSEDDVAKILGIRCQEEEVETTPDALRLLTKIGME
                     TSLRYASNLISVSYQISLKRRASAVDIEDIKRSYMLFLDSARSVDFLERNSESYIDDQ
                     GKVKLSKQDDEDKDKMDTSEA"
     gene            complement(<241276..>241692)
                     /gene="VMA11"
                     /locus_tag="FOA43_000122"
                     /db_xref="GeneID:62193523"
     mRNA            complement(<241276..>241692)
                     /gene="VMA11"
                     /locus_tag="FOA43_000122"
                     /product="v-type proton ATPase 16 kDa proteolipid subunit
                     2"
                     /transcript_id="XM_038920457.1"
                     /db_xref="GeneID:62193523"
     CDS             complement(241276..241692)
                     /gene="VMA11"
                     /locus_tag="FOA43_000122"
                     /codon_start=1
                     /product="v-type proton ATPase 16 kDa proteolipid subunit
                     2"
                     /protein_id="XP_038776385.1"
                     /db_xref="GeneID:62193523"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="InterPro:IPR035921"
                     /db_xref="PFAM:PF00137"
                     /translation="MVFSCLGSAIGTAKSGIGIAGIGTFKPELIMKSLIPVIMSGILA
                     VYGLVVAVLIAGNLNPQSDYTLFAGFMHFGCGMSVGLACLASGYAIGVVGDEGVRQLM
                     HQPRLFVGIVLILIFAEVLGLYGMIVGLIMNTKGNA"
     gene            <242036..>242761
                     /locus_tag="FOA43_000123"
                     /db_xref="GeneID:62193524"
     mRNA            <242036..>242761
                     /locus_tag="FOA43_000123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920458.1"
                     /db_xref="GeneID:62193524"
     CDS             242036..242761
                     /locus_tag="FOA43_000123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776386.1"
                     /db_xref="GeneID:62193524"
                     /db_xref="InterPro:IPR013950"
                     /db_xref="PFAM:PF08641"
                     /translation="MSQVPETYVKIHIQTKELKTLYDLLKRYLSEQIDEQLEELGLDG
                     NTKTRSKKGKTLREKVRKLVLNQFLDRLFNAIKYSIELDDGLLEVIDDPDTDIVTQLE
                     EVQEDSETKVEPYDFALNDKLRNVYLQVEEKIEEVTKLRKVKPLDYYNAYEKMLLANE
                     EWVDNKVEENKQFRDRCLSSLEKQMDAEAEDTNEEANYAVLVQDYEKFLANIALLKKE
                     IPDTVSQLDNLINVMEFLNNLKR"
     gene            <242939..>243853
                     /locus_tag="FOA43_000124"
                     /db_xref="GeneID:62193525"
     mRNA            <242939..>243853
                     /locus_tag="FOA43_000124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920459.1"
                     /db_xref="GeneID:62193525"
     CDS             242939..243853
                     /locus_tag="FOA43_000124"
                     /note="MEROPS:MER0034660;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776387.1"
                     /db_xref="GeneID:62193525"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="InterPro:IPR035952"
                     /db_xref="PFAM:PF01694"
                     /translation="MSIQDNLDFNRYASMAEKYLNPSSAGAGVPALTATVSVVLTIFY
                     IASLFNDNLVEKMCLFPDALFSLPEFPRLNTYPLVHAGFLHIFFNLVSLWAPMAQFET
                     LNGTFHTALVLSALSLVTAISYCLLGFYFFPDTSVLGCSGWVFSFIAYFSYVNSLQHK
                     TIRFFGRFDIPTITVPFVFLGFVFLMVPNSSFVGHLLGIIAGFVMAKGFLVPLTVLPM
                     DLISKVEVAAHKLIELIPHQLHYIRESDVKNGRYKYDNLSLPLYTTDAAVPMASGDAR
                     VIGEAAEAGEAGSPETFKGPGHVLGTSS"
     gene            complement(<243999..>244663)
                     /locus_tag="FOA43_000125"
                     /db_xref="GeneID:62193526"
     mRNA            complement(join(<243999..244445,244658..>244663))
                     /locus_tag="FOA43_000125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920460.1"
                     /db_xref="GeneID:62193526"
     CDS             complement(join(243999..244445,244658..244663))
                     /locus_tag="FOA43_000125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776388.1"
                     /db_xref="GeneID:62193526"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="PFAM:PF00036"
                     /db_xref="PFAM:PF10591"
                     /db_xref="PFAM:PF13202"
                     /db_xref="PFAM:PF13405"
                     /db_xref="PFAM:PF13499"
                     /db_xref="PFAM:PF13833"
                     /translation="MGSDKLTSEQIEEFKEAFSIFDKDGDGKISASELGTVMRALGQN
                     PTQQELNDLVNEIDTNGNSTIEFSEFLTMMARQIKEQDVEEEILEAFKVFDSDGDGKI
                     SQTELVRVLTTIGEKLTDEEAQQMLQAADTDADGQIDIEEFAKVLRGK"
     gene            complement(<244920..>247601)
                     /gene="RNR1"
                     /locus_tag="FOA43_000126"
                     /db_xref="GeneID:62193527"
     mRNA            complement(<244920..>247601)
                     /gene="RNR1"
                     /locus_tag="FOA43_000126"
                     /product="ribonucleotide-diphosphate reductase subunit
                     rnr1"
                     /transcript_id="XM_038920461.1"
                     /db_xref="GeneID:62193527"
     CDS             complement(244920..247601)
                     /gene="RNR1"
                     /locus_tag="FOA43_000126"
                     /note="BUSCO:EOG09340IY6"
                     /codon_start=1
                     /product="ribonucleotide-diphosphate reductase subunit
                     rnr1"
                     /protein_id="XP_038776389.1"
                     /db_xref="GeneID:62193527"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="PFAM:PF00317"
                     /db_xref="PFAM:PF02867"
                     /db_xref="PFAM:PF03477"
                     /translation="MYVFKRDGRREPVRFDKITARISRLCYGLDDKHVDPISVAQRVA
                     TGVYEGVTTIELDNLTAETAAYMTTIHPDYATLAARLAISNLHKQTKKHFSDIIEDLF
                     NYYNPKTHKKSPMISQQTYDVVMRHKDELNSAINYDRDFNYNYFGFKTLERSYFLRIN
                     GKVAERPQHLIMRVAVGIHGDDIPKVIETYNLMSKRYFTHASPTLFNAGTPRPQMSSC
                     FLVAMKDDSIEGIYDTLKQCALISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGIIPMM
                     RVFNSTAKYVDQGGNKRPGAIAIYLEPWHSDIFDFVDIRKNHGKEEVRARDLFPALWI
                     PDLFMKRVEENGMWTLFSPSEAPGLSEVYGDEFEKLYTRYEKEGRGRQVVKAQKLWYH
                     ILEAQTETGTPFMLYKDACNRKSNQKNLGTIKSSNLCCEVVEYSSPEEVAVCNLASLC
                     LPAFVESDDKGCSYNFEKLHKIAKVLTRNLNRVIDRNYYPVPEARTSNMRNRPIAVGV
                     QGLADTFFQLRLPFDSTEARKVNIQIFETIYHAALEASSEMAAEEGTYSTYEGSPASK
                     GILQYDLWGKKPTDLWDWDTLKAKIAKNGLRNSLLVAPMPTASTSQIMGYNECFEPFT
                     SNIYQRRVLAGEFQIVNPYMLRDFVDMGIWNDAMKNYIIHDNGSIQHLPNVPDKFKKL
                     YRTVWELPQKAIIDMAADRGAYIDQSQSMNIHLLSPTMGKLTSMHFYGWKKGLKTGMY
                     YLRTQAAAAAIQFTVDQKLAKEAGEVKANVDGVEFKDYVPRETSAVENVPVVMDDCVP
                     LSATNSPITSSHDSTPLPETDSVSTSVETSMVDLSLKDNIPEDDKQEENEDTEEPETA
                     VTSEKKQAAGDDEVDIYNSKVIACAIDNPESCTMCSG"
     gene            <248507..>248896
                     /gene="RPL26A"
                     /locus_tag="FOA43_000127"
                     /db_xref="GeneID:62193528"
     mRNA            <248507..>248896
                     /gene="RPL26A"
                     /locus_tag="FOA43_000127"
                     /product="60S ribosomal protein L26A"
                     /transcript_id="XM_038920462.1"
                     /db_xref="GeneID:62193528"
     CDS             248507..248896
                     /gene="RPL26A"
                     /locus_tag="FOA43_000127"
                     /note="BUSCO:EOG09344E3G"
                     /codon_start=1
                     /product="60S ribosomal protein L26A"
                     /protein_id="XP_038776390.1"
                     /db_xref="GeneID:62193528"
                     /db_xref="InterPro:IPR005756"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="PFAM:PF16906"
                     /translation="MAKCSKDVSSNRNKSRKAYFNAPSSVRRVMMSAPLSKDLVEKYG
                     VKRLPVRKADQVLVVRGSKKGQEGTISSVYRLKYAIQLEKLTREKSNGASVPINIHPS
                     KVVITKLHLDKNRKALIARKGGKVDEE"
     gene            complement(<248955..>249851)
                     /locus_tag="FOA43_000128"
                     /db_xref="GeneID:62193529"
     mRNA            complement(<248955..>249851)
                     /locus_tag="FOA43_000128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920463.1"
                     /db_xref="GeneID:62193529"
     CDS             complement(248955..249851)
                     /locus_tag="FOA43_000128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776391.1"
                     /db_xref="GeneID:62193529"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF01209"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF08242"
                     /db_xref="PFAM:PF10294"
                     /db_xref="PFAM:PF13489"
                     /db_xref="PFAM:PF13649"
                     /db_xref="PFAM:PF13847"
                     /translation="MSAFSDKNFDAHQYSSFRPTYPSELYEMLIRYHSKGNDGQLNTI
                     LDLGCGPGEASIPLLRQCTGKIVATDLSSTMIEVAKTNFQKALTELHLTNQPAVTVAV
                     SPSEDVSSVLPEDGTVDLVVAAECVHWFQWDKWLTEMNRVLKEGGTLAYFAYCDPVFV
                     GNSKMDEIYERFTCESGELVGPYWQQPGRSRLRHLCKELNDIVLADGRFTDVRVEYYE
                     PLKNPSKKEKMVIERNYTMEAFMKYVDTWSASHRWNMAHNGKDENAAETFYKIVHQEL
                     GWTKQTEFPVSWKTMYVFARKL"
     gene            complement(<250387..>253017)
                     /locus_tag="FOA43_000129"
                     /db_xref="GeneID:62193530"
     mRNA            complement(<250387..>253017)
                     /locus_tag="FOA43_000129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920464.1"
                     /db_xref="GeneID:62193530"
     CDS             complement(250387..253017)
                     /locus_tag="FOA43_000129"
                     /note="BUSCO:EOG09340F8O"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776392.1"
                     /db_xref="GeneID:62193530"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF03810"
                     /db_xref="PFAM:PF13513"
                     /translation="MEISQVLENAILNPDAQARQAAEAKLAAMASENWVSYLGQMVQV
                     LGDESQKTEVRMLAGLGVKNQLTSKDAVKKQQQTERWVQIDAETKQHIKDIALNTLLS
                     QTDRVANQAAQLVAAIADIELPRDEWPQLMHVIVDNTKSDRPVNVKRASLLTIGYICE
                     TADPDNPQVSAQSNGILIAIVQGAQSSEPAMVVRRTAISALVNSLEFIAGNFEREGER
                     NYIMQVVCEATTANDADLQALAFGALAKIMNLYYQYMGVYMEKALYGLTVTGMHSSDD
                     RVACMAVEFWSTVCEEELEIQLRHEAMAEPAQPSTANNHTADLVSYNFALVAIGDVLP
                     TLLSLLTRQNEDPDDDSWSVAMAAGACLQLFAQNTGNYVVRPTLQFVEQNLGGDGWRQ
                     KEAAVMAFGSILDGPDRGELRTVISQALPPILLLIKNESEPVRETVSWCLGRIADLVV
                     DAIDIQTMLPPLLEAVVFGLQNSPKVATNCCWTLINLLEQLCHDSTEQQTSVMSQYLN
                     GLVPTLLQISARNDNDNAARTSAYEALSSVVLYSAQQDMNFVSQIATEALSRLSQTME
                     VETSQPGATSGENKAELQELQSNILSLLTNVTRRIGSEAGSVADQLMETYLKLLGMQE
                     PDSVIEEDIFMAISAVASSVDAGFVKYMAAFLPFLTKALESVDSPVCDAGIGLVVDIC
                     HSLGENFIPYCQGFMAILGNTLSNPHVRRELRPLILSCFGDIASSIGKEFIQYLDVVM
                     NICNSAQSLQLEEQSYEYEDYLINVKESVLDAYVGIVAGLHDSPDSLFPYLGQMSQFL
                     MNTYTEPQLASNESVCRSAVGMIGDLAHMYQNGQWKEFFTQDWVADYIKKTRSNQHFG
                     KVTRDTARWAREQQKLQLQV"
     gene            complement(<253316..>254926)
                     /locus_tag="FOA43_000130"
                     /db_xref="GeneID:62193531"
     mRNA            complement(<253316..>254926)
                     /locus_tag="FOA43_000130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920465.1"
                     /db_xref="GeneID:62193531"
     CDS             complement(253316..254926)
                     /locus_tag="FOA43_000130"
                     /note="BUSCO:EOG093419YX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776393.1"
                     /db_xref="GeneID:62193531"
                     /db_xref="InterPro:IPR001018"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011084"
                     /db_xref="InterPro:IPR036866"
                     /db_xref="PFAM:PF07522"
                     /translation="MTPVNQEISTIKQSCILQFCRKRDLEEGEVREVIQTKEVITIDD
                     EDEGVEDKITAGEELKVDGDILCPICEIPLNSLSLERRYEHVCCHMDNVQEEKPTVLP
                     KTKKRKARKKKAGKALKPSKRRRPAKPIPAHNILQFGDDRVVVDAFCYAEDPSIDVYL
                     LSHFHSDHYGGLTKGWHKGKVIIATKTTVRLAVHKFHCPEELFLPLEYNETKQIPGTE
                     LKVTCLDGNHCPGSGIFILESIKTGEKFLHCGDFRISRLMIEYLLKWGSFNRIYLDTT
                     YLNPQYSFGRQETVINATCKVLRKRSQCKQTTQKRVIDFFCKSEDLSIDPAEFLIVVG
                     TYSIGKERLAIAIAETLGSKIYCTRSKADILHLLEWDELERLLETDPSKAKYCQVHLV
                     PLLGTNKNSLLDYYRPYSNHYRAVVGICATGWTGVQRSEERGFAQPDEYLSKFVDAVD
                     ENDIYNVLLGQMEFRNKKEKEKDLFLTKLLRVPYSEHSSFRELFYFINLVPCDMLVPT
                     VNLDRMDEHAKWIRMFKDYKGQLDLAKL"
     gene            <255044..>255604
                     /locus_tag="FOA43_000131"
                     /db_xref="GeneID:62193532"
     mRNA            <255044..>255604
                     /locus_tag="FOA43_000131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920466.1"
                     /db_xref="GeneID:62193532"
     CDS             255044..255604
                     /locus_tag="FOA43_000131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776394.1"
                     /db_xref="GeneID:62193532"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF04670"
                     /db_xref="PFAM:PF08477"
                     /db_xref="PFAM:PF09439"
                     /translation="MGLLSIIRKQKLKEKEVRVLMLGLDNSGKTTIVKSLLHKDIKEI
                     SPTMGFNIDTISYKGFNMNIWDIGGQSSLRTFWFNYFEKTDFLVWVIDSSSLQRLSEN
                     FKEFDKVLKEDRLAGCGLLILINKIDVYQGDTEKLKEAVINTLQLQKLENHCWNLLCC
                     SAYSGKNLTKGMDWIVDEYERKYYII"
     gene            complement(<255612..>256670)
                     /locus_tag="FOA43_000132"
                     /db_xref="GeneID:62193533"
     mRNA            complement(<255612..>256670)
                     /locus_tag="FOA43_000132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920467.1"
                     /db_xref="GeneID:62193533"
     CDS             complement(255612..256670)
                     /locus_tag="FOA43_000132"
                     /note="CAZy:GT15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776395.1"
                     /db_xref="GeneID:62193533"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF01793"
                     /translation="MFLSYYILFLIRIIFCFAQFLDDPQQPIEQYKPANATFYTLCRN
                     SDLYDILETINNYNNRFNSEYRYDWVFLNDQQFTDEFKKLVKVSVAGHAYFGQIPSQH
                     WSLPNSVDHDTMKENMQKMINDPDGAPPYADSMSYRHMCRFESGFFFKHELLQKYDYF
                     WRVEPGVKLRCDVNYDLFKYMIDNKYDHGFTISMLEYSKTIPSLFETFRKSLVSLGLS
                     KLLSDSRNYSGFVIDPKNGQYNHCHFWTNFEIGNLNVFRSKEYNQIFNELDKSNGFYY
                     ERWGDAPVRSLILSMILVKGKIKRFDEIGYTHPPYTQCPQEEGFRVSNRCSCNPDTDF
                     TSKWFSCSGHFDGLEQQH"
     gene            <257441..>257911
                     /locus_tag="FOA43_000133"
                     /db_xref="GeneID:62193534"
     mRNA            <257441..>257911
                     /locus_tag="FOA43_000133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920468.1"
                     /db_xref="GeneID:62193534"
     CDS             257441..257911
                     /locus_tag="FOA43_000133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776396.1"
                     /db_xref="GeneID:62193534"
                     /db_xref="InterPro:IPR007763"
                     /db_xref="PFAM:PF05071"
                     /translation="MDRINKVVPIWRRVWYSWKSLESVPFRKQFFAGYDLKGNTYWEF
                     YPRGKGPEKPRRIWHPYKSEEFVFDYFDKLPIQWLQWLRYSRYKAPTVQELVDDERRL
                     EKLQKVVKLKGEQMEYKKNLSDNKMVENMYKEIQKMEGEKATRKQKEHEKTSSA"
     gene            complement(<257970..>260291)
                     /locus_tag="FOA43_000134"
                     /db_xref="GeneID:62193535"
     mRNA            complement(<257970..>260291)
                     /locus_tag="FOA43_000134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920469.1"
                     /db_xref="GeneID:62193535"
     CDS             complement(257970..260291)
                     /locus_tag="FOA43_000134"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776397.1"
                     /db_xref="GeneID:62193535"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR036322"
                     /translation="MSFELDIVGGLSTASKSDRLVDVKGDLIAYTSGQRVIVCKLESQ
                     NVRNPFKWKRFYYTKYKTGEKRASSIPVSCDRFGFPLSPSPIIVQSQPSQSPRLNMLE
                     QFVQSKPSKLTNISCIALSPNEQLLAIGEVGVTTGRILVYSLAPDAAQHPLFVIKSHR
                     FGVAMLEFSPDSQLLCSLGVRRDSSMKIWSISGEQRPVLMADVTVPTAVIRPIWFNSK
                     TIITLGKAHLKVWDMDSSCSFKGHNILIQESLSRSKFIDAAVLGIEGIIILASDGRLG
                     YLDLDSQPLYLSFLTQLSSSVLRILVDYESMVLTTAGDGIQLIPLSDTPASQSIAHSS
                     IDKLISGMWSCSHHGLIYLNDGCLYAVDSTLKGDSCQLVDSLKGTLTGLKRSFDHQIV
                     AWSAEGDVTTFLQGGFPSLIASLGNSGEELTALDMYKGNLVQATNRGVVSFYRKYSNS
                     YEKIASFQSHQAIVKSVIFFQVKGLLAAASGAQDGTISVFIQPESNGLLWERVKILSG
                     KGKASVIKLLFINGCLLAALSDKTIGVYRISNQMVGGLIVSSEMSVQLTALPLDIGIY
                     ENQLLVSTDGRQLVSFSLRGFLLSETRQFADGNGLPIRISCFSIKHGYLLIGSSTGEV
                     LVFDYKNGTLLAEQYGDSRITSIILDDTCKRLITASEDRCIQFWKCRYDVARAPMTPH
                     TLHDVLTGLHTPLSLKSTPSRNTYSPQSSSDFIGSTVSQLEQLQHGIATGKVNVQKNS
                     KAISNLDAELKTTINLLQDRRRRAFDDKENIIG"
     gene            <260488..>261885
                     /locus_tag="FOA43_000135"
                     /db_xref="GeneID:62193536"
     mRNA            <260488..>261885
                     /locus_tag="FOA43_000135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920470.1"
                     /db_xref="GeneID:62193536"
     CDS             260488..261885
                     /locus_tag="FOA43_000135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776398.1"
                     /db_xref="GeneID:62193536"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR027421"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="PFAM:PF02732"
                     /translation="MDLEQDIKYLFTKWLEEEYKAKVQRGLRNATTFYRALKSVRQCP
                     YPLKHPKQLQSLKFIGEKLVKMMTQKLEEYCSENGYNFPEDPDGLKQPEEPEGHTEKD
                     NDDAHSSKKRKHDKEVAVKKRKKRKYIPAKNTGGYGILLVLYMCDGDRQGLTKNEIIR
                     QVTRFCSASFTSNPSTGQFYSAWSSINTLLKNEYVLSQGRPVYYYLTEEGEEVAKILE
                     KVDNETKSQQQGVEGELDSSPSINRTRETTTIQSTVVRKESDQLPSSPLLQGSRSNND
                     VLPRMQFDDVDYRIWSAGSYEITFVSDNREVRSQSDRDFFSNHIRSQGVKCEVKALSV
                     GDGVWVAINKETKQWATLDFIFERKRLDDFVGSIKDGRFREQKSRLERTGLKRIIYLV
                     EEQMASDISRFSEALQTSMSMAITYSNFHLKRTKDSDDTVRLLLALDKRIHAFLRKSI
                     FGGTGATELEITEGL"
     gene            <262607..>264337
                     /locus_tag="FOA43_000136"
                     /db_xref="GeneID:62193537"
     mRNA            <262607..>264337
                     /locus_tag="FOA43_000136"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920471.1"
                     /db_xref="GeneID:62193537"
     CDS             262607..264337
                     /locus_tag="FOA43_000136"
                     /note="CAZy:GT71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776399.1"
                     /db_xref="GeneID:62193537"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF11051"
                     /translation="MFNMRKLRFGTRRTKVVANVLVLIAILLILGAAFSSKTFGLPPE
                     IIGVNDDATDKSNNNAADQMLPGNDEDEIKQLTEERIKADKLVEINKNEYNDPTGERL
                     KMAKDYYQKIFKIFRKGEPKCKIVQRKSSAGAETVGVESIDNSPVLTKEYLASFIDLS
                     KDQRKELTKSHELMVKSLPDSYPEGLYKGNGIVYVGGGAFNWYALLSIQHLRRLGCTL
                     PIEVIIPEIDEYETDLCQRLFPTYGAHCIFLPKVLDNDVRSDFLFKGYQYKSLALLVS
                     SFENVLMLDADNIPTTNPEIIFKAEPFNSTGLVVWPDFWKRTTSPDFYSIAGIKLNEK
                     SRTSKGYARYGKYEKPNCPEGKVLLHQLKGAIPDPSSESGQLLISKKEHTKDILMALY
                     YNLYGPNYFYPLFSQGAAGEGDKETFIAGAHVLNRPYYQVRQLVSPIGMYKNGKFRGV
                     AMRQADPMADYQLGIKYKDSVEPVKEEPKMMFMHVNFPKLDPIKLKVEEFVFDAETKK
                     RNRFFGDDFARKLGYDFELAQYQNMKIFACDPDVQFEYFRKKNISQKELCDEVMSQLE
                     YLESTTDVAE"
     gene            complement(<264405..>265283)
                     /locus_tag="FOA43_000137"
                     /db_xref="GeneID:62193538"
     mRNA            complement(<264405..>265283)
                     /locus_tag="FOA43_000137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920472.1"
                     /db_xref="GeneID:62193538"
     CDS             complement(264405..265283)
                     /locus_tag="FOA43_000137"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776400.1"
                     /db_xref="GeneID:62193538"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF12710"
                     /translation="MKSPIALHNYLILSHRLNQISRYVSDWDETITAQDTIPLLFRWV
                     PDDSPYKLSYFYKIYMDSYQDYITRQLPSKPYRARDSIANEIAYQKDMKAVELSSFEA
                     CIRLDIFRGLTKQQLESLYTDVCVKPGFPEFYSKLICRKELQFGILSVNWSSLFIKKY
                     FKETFGSEVLVSANELSFDSNICTGKSAVDSVNSIRTGYDKLVQIKLKNDHLGRGKFV
                     YIGDSSTDVLALIYSDLGIIMKGGSAAKQLRQMGFRVADINSDVLDNDADSIKFVQID
                     DWFDILYMMEPKFLNQ"
     gene            complement(<265449..>266699)
                     /gene="PGK1"
                     /locus_tag="FOA43_000138"
                     /db_xref="GeneID:62193539"
     mRNA            complement(<265449..>266699)
                     /gene="PGK1"
                     /locus_tag="FOA43_000138"
                     /product="phosphoglycerate kinase"
                     /transcript_id="XM_038920473.1"
                     /db_xref="GeneID:62193539"
     CDS             complement(265449..266699)
                     /gene="PGK1"
                     /locus_tag="FOA43_000138"
                     /note="BUSCO:EOG09342FQL"
                     /codon_start=1
                     /product="phosphoglycerate kinase"
                     /protein_id="XP_038776401.1"
                     /db_xref="GeneID:62193539"
                     /db_xref="InterPro:IPR001576"
                     /db_xref="InterPro:IPR015824"
                     /db_xref="InterPro:IPR015911"
                     /db_xref="InterPro:IPR036043"
                     /db_xref="PFAM:PF00162"
                     /translation="MSLSNKLSVTDLDVAGKRVFIRVDFNVPLDGQTITNNQRIVAAL
                     PTIKYVLDKKPKVVVLASHLGRPNGERNSKFSLKPVSVELQKLLGQPVIFLDDCVGPE
                     VEKAVKNAPEGAVVLLENLRYHSEEEGSKKTSAGKVKATPEAVEKFREQLTSLADVYV
                     NDAFGTAHRAHSSMVGFKLPQRAAGFLMQKELTFFAKALENPVRPFLAILGGAKVSDK
                     IQLIDNLLDKVDRLIIGGGMAYTFVKVINDAKIGKSLYDANGAKLVPKLVEKAKKNGV
                     KIYLPVDFVTADSFSADAKTGYATLAEGVPEGWQGLDIGEKTIKEFSAAIAEAKTIVW
                     NGPPGVFEFEKFATGTKALLSACVKSCEAGNTVIVGGGDTATVTKKFGGANKLSHVST
                     GGGASLELLEGKQLPGVVFLSDKN"
     gene            complement(<268012..>268630)
                     /locus_tag="FOA43_000139"
                     /db_xref="GeneID:62193540"
     mRNA            complement(join(<268012..268590,268622..>268630))
                     /locus_tag="FOA43_000139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920474.1"
                     /db_xref="GeneID:62193540"
     CDS             complement(join(268012..268590,268622..268630))
                     /locus_tag="FOA43_000139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776402.1"
                     /db_xref="GeneID:62193540"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="PFAM:PF04145"
                     /translation="MELTWHVNSRGMFAGTCIGVFFWVLAYLWFHRMIVEYDRAIVEY
                     KLAQYAQTHSDACCCCENGAGESTDITEKAASSSDSSDAIYSVTDSKVSQFFRPIARV
                     LKHRWLVNHSHSDKDGSILVYPSPLEHLFKSVLYMMEWACSFLIMLMWMYYNGYVVIT
                     CILGYFFGQLLFSYAPLTVIGNKKYLPPKEEKTHC"
     gene            complement(<270149..>270495)
                     /locus_tag="FOA43_000140"
                     /db_xref="GeneID:62193541"
     mRNA            complement(join(<270149..270432,270489..>270495))
                     /locus_tag="FOA43_000140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920475.1"
                     /db_xref="GeneID:62193541"
     CDS             complement(join(270149..270432,270489..270495))
                     /locus_tag="FOA43_000140"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776403.1"
                     /db_xref="GeneID:62193541"
                     /db_xref="InterPro:IPR020163"
                     /translation="MTEGRPKFEHAPEVSFDEIDYRNHADLKAAQESMLKEQFVKVEM
                     VKFVRKALENCFKVNGPNGYEECRNLADKYLDMLPECRAQGYLGYQRNDPKK"
     gene            <270846..>273725
                     /locus_tag="FOA43_000141"
                     /db_xref="GeneID:62193542"
     mRNA            <270846..>273725
                     /locus_tag="FOA43_000141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920476.1"
                     /db_xref="GeneID:62193542"
     CDS             270846..273725
                     /locus_tag="FOA43_000141"
                     /note="BUSCO:EOG09340HLC;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776404.1"
                     /db_xref="GeneID:62193542"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="InterPro:IPR036691"
                     /db_xref="PFAM:PF10277"
                     /translation="MAVTPLLKLNAQAIAITHTVCSISAFLVALIIGCCLHYYKIVRN
                     EHYGYPDEWFPSVSATIGDRYPERSVFQILIALTSGPRFLLLFADYLCLYRSNSVLPK
                     FALISGIVRTVSCGGWVYITSTDDHDFHDFCMIAYIVLTIPWDASITLLSPPGSIQRR
                     RRKYTAILFFASLIPLIYLFIQHKVHKVPGAYSHYAYFEWSLIILDITFDAWSIKDFE
                     DLYIEVRASRDNDDYFNVNFEAKAIQEKQNEKHEIGNEHNHLVPKSSNASYLRSLVDI
                     VNSFIFWSVYTSLYLCIWYFPLWNMGISGYEASAAATFAPLLLCIPGVQRLFTAKPQV
                     ARFLCCLFGIGAYLVTEPATRLLIIAAGVAFGCIALATEISAYGSLNNVGAIRSYATS
                     FTLGVALSSLAKFAFWTENPIWPIMNSKTGGWNKTGLTVGLISALFTRLPSRTLKREE
                     SDAAKESADASTSSPSFLLTAFGFGALIFSISAMLTDTSTIILWTWDGYPVRGPTPVP
                     YGAVSLTAMCIGIYLGMRHGSRKFIKLLTAQGVVGAFLLYKFRHWVGYMGGLMYIVWL
                     SGIIPVCLHQMSKFHRRTGSIFLLSFVVTCIITLMHVWIVAYAFVPGGSYLRERTDIV
                     LGLSVVLIVGLVLNYTSPVVNTNRTNPALKKTINFCIAIAVLSCIIATQRIPKEKPVP
                     YHPDSRVLTTGIWTIHFGLDNDMWASQTRMIDAMRDLEVDVFGMLETDTERIIMGNRD
                     LTERIAEELNMYTDYGPGPNKHTWGCALFSKFPILNSTHYLMPSPAGELACAIHATLD
                     AYGEPVDVVVFHSGQEEDVEDRRLQSNGLAEVMGSSDKPMILMSYLVTKPLEGNYNTY
                     VSDKSGMHDIDPSDDDRWCEYVLYKRLHRIGYARVSRGTITDTEIQSGKFIVPKSGES
                     YDETYSQNRIEESVVPEDMRYPKIFYGEGVRGHHYHVFDEPRYFE"
     gene            <274764..>276455
                     /locus_tag="FOA43_000142"
                     /db_xref="GeneID:62193543"
     mRNA            <274764..>276455
                     /locus_tag="FOA43_000142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920477.1"
                     /db_xref="GeneID:62193543"
     CDS             274764..276455
                     /locus_tag="FOA43_000142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776405.1"
                     /db_xref="GeneID:62193543"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MNHSIKDLEQGSSSKENEQIEIKLQPADDDERSTDDESYLNVIE
                     TKGGLKRSLKARHVQFISIAGAIGTGLFISTGSVLSKCGPAPLLMGYTILCIFVWSIM
                     NLLSEMVTYIPLPGRSTPYAMCLRYTGNKSAAFTEGLNLAYAQAILTPAEISAAAFIV
                     SYWLDWNPAIWISIFLVLIVAINMCSSGTFGEIEFWIAAIKIITLTGLIIVGVVIFFG
                     GGPSQHGVLGFRYWKNPGSFKEFLVEGATGKFLAVLESTVKSGFAFVLSPELITCCAA
                     EAEDPRINLPKATERFIYRLIFFYVCGALVIGIIVPYNSSRLMSAINEGAQGAAASPF
                     VIGIQNAGIKVLNHIVNAAILTSAFSAGNSFMFGASRNLHSMAVNGAIPRVFARCNRF
                     GVPYYSVAAVAVVACLAYLTVSNGSSTAFTWLSNISTVSGFLSWIFISITYIRYRKAI
                     AYHHMESRITYRPPLQKIGAYFCVVIFTVITLVNGFPVFFDFNAADFIAAYITVPIIL
                     VLYFGHAIWTKNWRLFAPPEEIDCITGLKEIEAEQAAYIPKKPRNIFERIWFWIA"
     gene            <276813..>278829
                     /locus_tag="FOA43_000143"
                     /db_xref="GeneID:62193544"
     mRNA            join(<276813..276820,276915..>278829)
                     /locus_tag="FOA43_000143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920478.1"
                     /db_xref="GeneID:62193544"
     CDS             join(276813..276820,276915..278829)
                     /locus_tag="FOA43_000143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776406.1"
                     /db_xref="GeneID:62193544"
                     /translation="MLESDNTSYGPDTNNMSSESMTTNEELTDDDYESILSIVIRKPA
                     LRKVPSFTTPVDHNGCPLKTRKSMMVALTQCSAPTRQTSTTSTRRYGIPRVRGRNSLA
                     GRHGTKTLAGISNTALPRRESLGTVSSARIASASSSCYGPPTISSSIYSADAATISSK
                     QVSEISGTTDYNPYLNSVSTAIVEEPGLESLSQIDIPSDKTENNIQDTEAPTVTHKNV
                     VVSVKPHRSTSIKYISRHNSLYKSRKIATLGAAPGLKRSNAIRRRIGWISNKIRKFLR
                     SIKRKAHDGWRVVRSKRKSMFSFGRKRSTKLHNHHFSTTTAGQRSFADSSGLRSVEGL
                     VDAERYIPSGAYPHLPAPYELNERAMNSALHVPERNVEISRNDTIVIKSNSDDNKLSD
                     DDNNSSNDDTSEYNSESELDTILPIWTHFMKAAVSKRIQMNMDLHSAELKRKNTGSTV
                     AKDAFLSNYVSSTRSRYTNHSDIYLKSDSRSESSLSTEDSLFVEECQPPLGGTPPSMY
                     DNSSSSDSLYLNEEEKEIMISGKRCNDSYSSALPPTRAKSEQKKPNHDRHPFLRANPM
                     AVPPQHRRQLDLKGLNISVGTPLPVLTHPKLHYEHRLRLSSKASDCPFSFESSYNQSS
                     LSRQTWSQLRLQKLVH"
     gene            <279398..>280219
                     /locus_tag="FOA43_000144"
                     /db_xref="GeneID:62193545"
     mRNA            join(<279398..279401,279420..>280219)
                     /locus_tag="FOA43_000144"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920479.1"
                     /db_xref="GeneID:62193545"
     CDS             join(279398..279401,279420..280219)
                     /locus_tag="FOA43_000144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776407.1"
                     /db_xref="GeneID:62193545"
                     /translation="MHTSDVQTIKCTEVPASPQRTLYDEEQPPSQQRILDPPANLELH
                     KGNKSDDGATKNKRPSRSKSPCLSKLKILSRSSSSEFDSNQTRLGSLPAEPLAASEKF
                     VTRDPTVDSSLTRHRSSLRTVTATSTLGAPSNKEAGRHGIKILCLRDSLGSRHLLKRK
                     SLKKAQRKLRAKETYGTQNIQDIEKARGTYAKMSTISYEHPNMNVLPYDYSENTPLSV
                     PSTASSGITKTISQVSNTSSLNESFQLVFDDHLLPGIPSRLPTRSTNNV"
     gene            complement(<280336..>281355)
                     /locus_tag="FOA43_000145"
                     /db_xref="GeneID:62193546"
     mRNA            complement(<280336..>281355)
                     /locus_tag="FOA43_000145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920480.1"
                     /db_xref="GeneID:62193546"
     CDS             complement(280336..281355)
                     /locus_tag="FOA43_000145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776408.1"
                     /db_xref="GeneID:62193546"
                     /translation="MLFVTPNYYYQAYAPSGSCSLEVPVDRYRYEIEQRMRETELALN
                     KPLVDTAEDSFNYYILLKKRNLEPYDDFEIRTFSSYEIRIAKHTLLIRSTADQYYDTF
                     LLPADASNDIDYKLLNDGYSLLVVIPKEMKVKPFRKLCVGGEIPQLYWDAPYNVYSKN
                     SEIFDRHDPQNMIQKVPEVAQGSSSGVVKVNIARKPMAKSKMDALSKGKVQKLAETSS
                     DKMMKHPECMISVPISFSLPTLVEAPKKSATANEEEEEREANRSTTEEPEEPGKSDNS
                     EYSEYSEEPAEPAEPEKDPLLKNYETLSRKTIFPPDTKDEEASTPTKVPKSPILEDLV
                     DEEFA"
     gene            complement(<281685..>283340)
                     /locus_tag="FOA43_000146"
                     /db_xref="GeneID:62193547"
     mRNA            complement(<281685..>283340)
                     /locus_tag="FOA43_000146"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920481.1"
                     /db_xref="GeneID:62193547"
     CDS             complement(281685..283340)
                     /locus_tag="FOA43_000146"
                     /note="BUSCO:EOG0934215Z;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776409.1"
                     /db_xref="GeneID:62193547"
                     /db_xref="InterPro:IPR003788"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="InterPro:IPR038375"
                     /db_xref="PFAM:PF02636"
                     /translation="MLRVNSLIGKGSLGNTGIIDLGYRSLSTTAAPKAFRKRPTSKSN
                     KFIHDYSVLPYMLQYRIATDEELQLGPKSHSNIAKYLFQEGGVESLDWSTNSAMFERY
                     PLTDSRKLKKRTRRPKNVKMLTSDFIEDSLYNPKYGYFSREVVIFQPDEPFNYKNLKG
                     RDDFLDQWLKAYNKYDKERVAKFPQSKIKTEKENAVDNLVSKSTNITGKKDVQIEKPS
                     LQLWHTPTELFQPYYGEALAKYILINYKLNQYPYNDLIIYEIGAGNGTLMLNILDFLE
                     RNEPEVYKRTKYRIVEISSKLFNKQSSRLIRHMDKVEVINKSFLDWDTLVDEPCFVVA
                     LEVFDNLAHDAVRYDINTNKPYQGYVVVDEHNDFREFYSPDLEPWTAHFLKSRELSDI
                     PISSIPEHPVNQLSVVMKLKNSLNPLRNDLTGAEYVPTRLLKLFEILRNYFPNHQLLA
                     SDFSTLNEANRGYNAPVVQTMLHDNMVNVDSYMCDQGYFDILFPTDFAVINGLYKQVV
                     GKISNTCTHEDFLKVWGDIEATTTKSGENPMLELYSNASFIYS"
     gene            <283551..>286598
                     /locus_tag="FOA43_000147"
                     /db_xref="GeneID:62193548"
     mRNA            <283551..>286598
                     /locus_tag="FOA43_000147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920482.1"
                     /db_xref="GeneID:62193548"
     CDS             283551..286598
                     /locus_tag="FOA43_000147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776410.1"
                     /db_xref="GeneID:62193548"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR017151"
                     /db_xref="PFAM:PF03159"
                     /db_xref="PFAM:PF17846"
                     /translation="MGVPSLFRWLSRKYPKIISPVIEEEPVVVGDIEQPINYAGANPN
                     GELDNLYLDMNGIVHPCSHPENKPPPETEDEMMLSVFEYTDRVLRMARPRKVLVIAVD
                     GVAPRAKMNQQRSRRFRSAKEAKISNEEKEREVQEMEDRGEVIDEGIKKKRTWDSNAI
                     TPGTPFMDILATSLRYWIAYKLANDPGWAELQVVISDSSVPGEGEHKIMNFIRSQRSD
                     PEYNPNTTHCIYGLDADLIFLSLATHEPHFRVLREDVYANDQIQRKLKNSDRFGMDEE
                     TKKQLQKVDKKKPFIWLHIGILREYLAVELSTPRLSFKFDLERAIDDWVFVCFFCGND
                     FLPHLPCLDVRDSSIDTLVSIWKRIMPTMKGYITCDGELDLSAVEQLLSELGNLEDDI
                     LRKKHDKDRRRNDNFKRRRVDKSQQSVLKNELLKTVSKGHDNAPLMPSQNMVLTSLNT
                     GKTSGGLQMTNSEIIKNLNSISKANTANKSVAEILKQNMVRNAVAGADGNAENTDGAN
                     ADGNVASGEPIDVSEDSKKRDSTSAFPSSSSEITSDSESSMENIDNNDDSIRMWEDGY
                     RTRYYQTKFHTNDEEEINGIRRKMVEGYLEGISWVLLYYYQGCPSWNWYYPFHYAPFA
                     SDFTNLGEVKVSFDLGSPFRPFEQLMSVLPAASKHNLPNVFGPLMCNADSEIIDFYPE
                     EFQIDMNGAKMAWQGISLLPFIDEKRLLKAVRSKYDELTPEEVERNSLKHEILFVGRQ
                     NKHFERFKTLYNSETEECAELMFHGRKTGLAGTILPSKEYDPKSVRKFPLIVSSELEG
                     ENYIDVPNSTYLEVSYRMPPKVHGKSMLLNGFIPQLVILTEEDKDRVRHAYGRFQRGG
                     RFEVTNEIDYSQYVGPYGKAMYSFRPGGYKSYLEMYKYNSDRYQQTLQFNRYNEQQRH
                     LNNAQGSQGSRGYQGGYSEENQGNQGGYRGGYQGGYNQSSNGYDGYRGGRGGRGGRGG
                     RGGRGSGYGSGYNQGGSTGRGGYGNRGGYNNYNRGNHGNYNNR"
     gene            <286744..>287397
                     /locus_tag="FOA43_000148"
                     /db_xref="GeneID:62193549"
     mRNA            <286744..>287397
                     /locus_tag="FOA43_000148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920483.1"
                     /db_xref="GeneID:62193549"
     CDS             286744..287397
                     /locus_tag="FOA43_000148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776411.1"
                     /db_xref="GeneID:62193549"
                     /translation="MTESKRVPLADKTKLFTNSLRRSNVSKITKIFFKKGHGHDRNSR
                     SRGSANIASFIKSFSAPSSKQKGMDGSEITKSLVYTDSTAKKSYSTSDVVPQRSSVRV
                     FHTDGPLSGQLTKEQGRINTMNTILAYDQPIFTTGDVAEIQKAVIVRLVNDMSKSFKL
                     VQLLDKSLVGLLNFQKIWIKIKPGDKLKLSNDFFTIKLDGEDICCYYRWYKVVFSQK"
     gene            complement(<287421..>289019)
                     /locus_tag="FOA43_000149"
                     /db_xref="GeneID:62193550"
     mRNA            complement(<287421..>289019)
                     /locus_tag="FOA43_000149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920484.1"
                     /db_xref="GeneID:62193550"
     CDS             complement(287421..289019)
                     /locus_tag="FOA43_000149"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776412.1"
                     /db_xref="GeneID:62193550"
                     /db_xref="PFAM:PF02410"
                     /translation="MTMPIQFWKLIKHRDIRRFACANRTIFHGYIGTTSSLNRHIHTS
                     IKCRQDDSQLPWYMRPEESPKISSPLNKVEIPNLPENSPQTLRNIVEFLVIKLGIIDT
                     EVFDLRDDEEGKVNEGAKDIANFMVIGTGKSAKHLRKASTELTYFIKHKLHQVPSTEG
                     LVTNGEYAKYQRRLRKKGKGGPQYAKFDYGASENSWVMTDSKSDGIYIHMLTKDRRED
                     LNLEFLWAKDKSKYHNHEGPKESDNILTGLRYYSTAAPHANADATIFHPEILTRANYG
                     QRFQQLKKEHLEDPTKVPIVEIQNHFDAMQANGLQLNVDDVYSYVDLICQSLEFHLGL
                     EHETDVFNKRYHYTVYILKRYQPVFSGPRDLKKLLPLLVVSGSQFDNDQFVTLDKLSQ
                     LSDDELLRLGDEVFKYSPVVHKLYQISLKLTGKRLDVDRFQSEMDILCLTIFTNRKNW
                     VYSKKVVENALKREDLNILTAALRLIAIKGDTTSCSEFLNLYYPLLTLYKEFDLNQDG
                     IYVRMMLSKCDPEGSHHEEIRETL"
     gene            <290077..>291039
                     /gene="TRR1"
                     /locus_tag="FOA43_000150"
                     /db_xref="GeneID:62193551"
     mRNA            <290077..>291039
                     /gene="TRR1"
                     /locus_tag="FOA43_000150"
                     /product="thioredoxin-disulfide reductase"
                     /transcript_id="XM_038920485.1"
                     /db_xref="GeneID:62193551"
     CDS             290077..291039
                     /gene="TRR1"
                     /locus_tag="FOA43_000150"
                     /codon_start=1
                     /product="thioredoxin-disulfide reductase"
                     /protein_id="XP_038776413.1"
                     /db_xref="GeneID:62193551"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="PFAM:PF00070"
                     /db_xref="PFAM:PF07992"
                     /db_xref="PFAM:PF13738"
                     /translation="MVHNKVTIIGSGPAAHTAAIYLARAEMKPILYEGMMANGIAPGG
                     QLTTTTEIENFPGFPEGLMGSDLMERMKKQSERFGTEVITETISKVDFSSRPFKLWTE
                     FNEDAEPITTDAVIISTGASAKRLHLPGEEKYWQQGISACAVCDGAVPIFRNKPLAVI
                     GGGDSACEEALFLTKYGSKVFMLVRKDHMRASTIMRKRVDHNTKLEIIYNTVGLEAKG
                     DGKFLTALGIKNVKTGETKDLAVNGLFYAIGHNPATEVFKDQLDTDETGYIKTQPGTS
                     LTSVPGVFAAGDVQDKKYRQAITSAGTGCMAALECEHYLSELDV"
     gene            complement(<291091..>293094)
                     /gene="GUF1"
                     /locus_tag="FOA43_000151"
                     /db_xref="GeneID:62193552"
     mRNA            complement(<291091..>293094)
                     /gene="GUF1"
                     /locus_tag="FOA43_000151"
                     /product="Translation factor guf1 mitochondrial"
                     /transcript_id="XM_038920486.1"
                     /db_xref="GeneID:62193552"
     CDS             complement(291091..293094)
                     /gene="GUF1"
                     /locus_tag="FOA43_000151"
                     /codon_start=1
                     /product="Translation factor guf1 mitochondrial"
                     /protein_id="XP_038776414.1"
                     /db_xref="GeneID:62193552"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006297"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR013842"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031157"
                     /db_xref="InterPro:IPR035647"
                     /db_xref="InterPro:IPR035654"
                     /db_xref="InterPro:IPR038363"
                     /db_xref="PFAM:PF00009"
                     /db_xref="PFAM:PF00679"
                     /db_xref="PFAM:PF03144"
                     /db_xref="PFAM:PF06421"
                     /translation="MLRLGSRVLYRDIKCSFRPLWYSTSRWKYPTDPNTTGYMKYKNY
                     KIDLKNNPIKVSSDQELAERMDKIPLKNYRNFIIVAHVDHGKSTLSDRMLEITGVVDP
                     NVANKQVLDKLDVEKERGITVKAQTVSMIYYYKGEDYLFHLVDSPGHVDFRLEVTRSY
                     ASCQGALLLVDASEGVKAQTVANFYLAYSMDLKLIPVINKVDLDTADISKTEEQIQSM
                     FELPRDDIVHVSAKSGLNVQYLLPQIIEKIPPPLHCRPEAHFRAQIVDSWYDSYLGVI
                     MLINIVDGTVKKGSKIVAYRTKDKYEVKEVGIMYPDRKPFPKLVAGQVAYIIPGLKDP
                     NTVYVGDTLYEAGADIEPLEGFEEPKPMVFVGAFPAQGTDLKKMEESLEHLFLNDRSV
                     TFQHATSSALGQGWRLGFLGSLHASIFKERLEKEYGEKLIITAPTVPYKVHYKDGHEE
                     IVSNPDDFPDNLRKTTISHFSEPYVEAYMSLPQEYVGKVMQLCDTNRGEQKEIQYMTN
                     GQVLMTYLIPTAQLIDDFFGKLKGITRGYASLDYEDAGYKPSDVYKLEILVNGESIDA
                     LSMVMHKSQIEKNAREFVKRLKQFLRIQQFEVAIQAQANGRIYARETVRARRKDVLAK
                     LHASDITRRKKLLVRQKEGKKLLKSVGRVKIPPQAYQSFLRKQ"
     gene            complement(<293260..>293607)
                     /gene="SMD2"
                     /locus_tag="FOA43_000152"
                     /db_xref="GeneID:62193553"
     mRNA            complement(<293260..>293607)
                     /gene="SMD2"
                     /locus_tag="FOA43_000152"
                     /product="mRNA splicing protein"
                     /transcript_id="XM_038920487.1"
                     /db_xref="GeneID:62193553"
     CDS             complement(293260..293607)
                     /gene="SMD2"
                     /locus_tag="FOA43_000152"
                     /note="BUSCO:EOG09344MX7"
                     /codon_start=1
                     /product="mRNA splicing protein"
                     /protein_id="XP_038776415.1"
                     /db_xref="GeneID:62193553"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027248"
                     /db_xref="PFAM:PF01423"
                     /translation="MSELLNKAKTEMSEKELQDLEEYEFEHGPMKLLTQAVQKNTTVL
                     ISLRNNHKLIAKVKAFDRHCNMILENVKEIWNEPAPNDKKKKVLRERFVLKMFLRGDS
                     VIVILNHNETGGK"
     gene            <293843..>298059
                     /locus_tag="FOA43_000153"
                     /db_xref="GeneID:62193554"
     mRNA            join(<293843..294855,295579..295609,295825..295862,
                     296385..>298059)
                     /locus_tag="FOA43_000153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920488.1"
                     /db_xref="GeneID:62193554"
     CDS             join(293843..294855,295579..295609,295825..295862,
                     296385..298059)
                     /locus_tag="FOA43_000153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776416.1"
                     /db_xref="GeneID:62193554"
                     /db_xref="InterPro:IPR005931"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR024461"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="PFAM:PF00171"
                     /db_xref="PFAM:PF07798"
                     /translation="MVLRFGQTFKNGYAFSRPFIRRYNFRSRSNANKNTQMTTTGTNI
                     ANAIIEINDANNFKFLRDPNLIPKHDPFNIEQYERTHPEKGVELTSESDAKNFRSQPS
                     ESADPQGMPESFLDTNEMVEELKRGGFTNAQSEIIMNVTRDALQKKMTWLHGELAPRV
                     DMENESYLFQAAHNELLVEVTNSREISLMNLQNSSVILKRVLNNLQDETSTTIQLNDD
                     TIRMELSQFKHENNLQQRSLEIKNTDLNNRIISELMSGLRSTIEQFRWELTRAGIFAI
                     MLMAVSILGGWRLTSKMKAVEAEDESNIKHPELSYRHEPADEESHDYEADLDENVPVQ
                     ILKSEGIGSSWIIERGFSAKPERLQARRGVANLASFKAPAYITNQTNKAFGRDDRLDW
                     DLLKSEIFSLTDEPTEVPLVINGEEVFSGREKAPIINPGNLKQTLGQYAKATPEDVDK
                     AIQTSLEAKKEWANTSFADRASIFLKTAELITTKYRYKMLAATMLGQGKNVFQAEIDC
                     IGELSDFLRLNTKWAAELYASQPEKAAQGVWNRVEYRPLEGFVYAVTPFNFVAIAGNL
                     AGTPALMGNTVVWKPSDSSILSNYLVYKIFEEAGLPKGVINFIPGDPVLISEKVFSSS
                     AFNALHFTGSTQVFRSLWGEIAKNVSEGVYKDFPRIVGETGGKNFHLIHRSADLENAV
                     YNTLRGAFEFQGQKCSATSRCYVAQSIWPEFKKLLVEETEKIVPANTTSSEGLHSFLG
                     PVIHERSFDKLAKGIDSIKSDPELQLLTGGKYNKSQGYFVQPTIVQTKNPSHKFMKQE
                     FFGPLLTCYVYPDQQYEEVLALIDSTSQYGLTGSVFATDRSAIRLAEEKLRYAAGNFY
                     INDKCTGAVVGQQCFGGSRASGTNDKAGSSHFVSRWVTPRAIKENFQEVTGFTYPSNV
                     LPKN"
     gene            complement(<298156..>299922)
                     /locus_tag="FOA43_000154"
                     /db_xref="GeneID:62193555"
     mRNA            complement(<298156..>299922)
                     /locus_tag="FOA43_000154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920489.1"
                     /db_xref="GeneID:62193555"
     CDS             complement(298156..299922)
                     /locus_tag="FOA43_000154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776417.1"
                     /db_xref="GeneID:62193555"
                     /translation="MSLLSSSAPTADTTTTTTSTLKPSQFFNRRVSFDNYRPEIIEPT
                     DIPHTPSHSYEYNTDDFEFVKSPSPHLKPILKKTVNEANIPRSSSSSSRRLYEIPGTR
                     IKKHLLEMTDEEILLLDSQFAKKQIDVEKNYRFDSDPAMSPVGHRLDAKKESNSGFNC
                     LNMTDYPTKPIIKKNSICLNFRHSKYTQGINSDKFYLILISKHKSSLSAVDFYLENYS
                     KSGDNLVICASISNLFKEDILQQCIFQLVELILQKFVRFNKDLALQINFEFFRNINYM
                     SETLNLYQPSQIIVGCRAAKNKYTSIATSTKNFVSLVYVGTDYKPRTEYSSGKGSSKV
                     TFRTPFADKNVLTVPSLTGGSRRSLSPSAAILSPSESTTSSISDVSSIDGDADEDLQA
                     SFLDDSNATFPFLNSVPHLDHISRAEKEIHTIHSMIPRTRAQSSPSLGTTNLATTSTN
                     SASYSAPSSSTPSSSAPSILPPARTGPTVITPEWREKHAMFERYNRRLSSVKIQPQNR
                     SLTFDPPVILTTDSSRKSNPGRRRSSLLLLRTRSKSRSDSKLDLVNSNAVLTSSSSES
                     SPTSDDGSDGPQGFFKKFWKRR"
     gene            <300738..>301319
                     /locus_tag="FOA43_000155"
                     /db_xref="GeneID:62193556"
     mRNA            <300738..>301319
                     /locus_tag="FOA43_000155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920490.1"
                     /db_xref="GeneID:62193556"
     CDS             300738..301319
                     /locus_tag="FOA43_000155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776418.1"
                     /db_xref="GeneID:62193556"
                     /translation="MSDFTLDYIPLLDDDDIDDDSVTMAVKKEIEREMAKIANTKQLH
                     IKVVEQFPDGNIVLPYDIPITSKGMGIPSLAQKYTSFNGGSMMTKEDKLKLLASYSML
                     RSRSLDILQHNSNLVGNQWIMKLDQLERLNKQADSELNLKRRRIDELLEIRKRRCLEF
                     KPINEFMRNRWNEKIDELIVVGVQLAERQLQKD"
     gene            complement(<301388..>301912)
                     /gene="RPL11A"
                     /locus_tag="FOA43_000156"
                     /db_xref="GeneID:62193557"
     mRNA            complement(<301388..>301912)
                     /gene="RPL11A"
                     /locus_tag="FOA43_000156"
                     /product="60S ribosomal protein L11A"
                     /transcript_id="XM_038920491.1"
                     /db_xref="GeneID:62193557"
     CDS             complement(301388..301912)
                     /gene="RPL11A"
                     /locus_tag="FOA43_000156"
                     /note="BUSCO:EOG093440T2"
                     /codon_start=1
                     /product="60S ribosomal protein L11A"
                     /protein_id="XP_038776419.1"
                     /db_xref="GeneID:62193557"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR020929"
                     /db_xref="InterPro:IPR022803"
                     /db_xref="InterPro:IPR031309"
                     /db_xref="InterPro:IPR031310"
                     /db_xref="PFAM:PF00281"
                     /db_xref="PFAM:PF00673"
                     /translation="MSSQSQNPMKELKIEKLVLNVCVGESGDRLTRASKVLEQLSGQT
                     PVQSKARYTIRSFGIRRNEKISVHVTVRGPKAEEILERGMKVKEYQLDAKNFSESGNF
                     GFGIAEHIDLGIKYDPNIGIFGMDFYIVMGRPGYRVARRKRCKGRIGKSHKVTKQDTI
                     NWFKAKYDAVVTGA"
     gene            <302476..>303330
                     /gene="PRE2"
                     /locus_tag="FOA43_000157"
                     /db_xref="GeneID:62193558"
     mRNA            <302476..>303330
                     /gene="PRE2"
                     /locus_tag="FOA43_000157"
                     /product="Proteasome subunit beta type-5"
                     /transcript_id="XM_038920492.1"
                     /db_xref="GeneID:62193558"
     CDS             302476..303330
                     /gene="PRE2"
                     /locus_tag="FOA43_000157"
                     /note="BUSCO:EOG09342YB1;
                     MEROPS:MER0001516"
                     /codon_start=1
                     /product="Proteasome subunit beta type-5"
                     /protein_id="XP_038776420.1"
                     /db_xref="GeneID:62193558"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="PFAM:PF00227"
                     /translation="MSINAIAKKYSYRSSTDKELDDATQDYQHMVPSLDSLSPSLSLP
                     PISRPTDFLRAHTDDVSNPGCKIKIAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQT
                     VKKVIEINPMLLGTMAGGAADCQYWETWLGTQCRLHELRNKERISVAAASKILCNLVY
                     EYKGMGLSMGTMVCGCTPKEGPTIFYVDSDGTRLKGDMFSVGSGQTFAYGVMDSNYRW
                     DLTVDEALYLGKRAILAATHRDAYSGGSINLYHVTEKGWVYHGNYDVGPLFWEIKEKE
                     GSFNNVKS"
     gene            complement(<303441..>306224)
                     /locus_tag="FOA43_000158"
                     /db_xref="GeneID:62193559"
     mRNA            complement(<303441..>306224)
                     /locus_tag="FOA43_000158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920493.1"
                     /db_xref="GeneID:62193559"
     CDS             complement(303441..306224)
                     /locus_tag="FOA43_000158"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776421.1"
                     /db_xref="GeneID:62193559"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="InterPro:IPR030456"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF00250"
                     /db_xref="PFAM:PF00498"
                     /translation="MSGSMTSGQQQSQASSHQPESSLSDYHRINGDSELAALGTDTGN
                     GIDSIMDHPPTQNEITSLLASLPSGNQLIPTQNKHRSPIIPTSPAEGASVTSKTSPTT
                     QIASVRNDVIHSTSPASAIVSSSMVDNHPSRSVHGVTVQHDNEENSLPPEKIQAYALM
                     DFENFTFYVQTMQILLGRMVEGDKNTEALDIHLGSQKAISRRHAKIFYNFGHQRFEMT
                     VLGRNGAFVDNSFIETDVTLPLHDNTRIQIGETRFRFILPSEDSAKIGGLQSPELHNS
                     PINPSQAVNLKTSFNSSHSGMSTLTVSRAASTSPNSANAAVALARKPSMETISSSMQP
                     SLQPRQSPPLISQADLLRTTSAHAAQAQAIAQNEAFAIQKGYLPASYLSGASASLGPI
                     STSVLTAQQQQYVSSLQQTPYNPQTQSVPKLGKEFIDELRANAEASVIRKEEAKAAAA
                     TTTSSSSDTAVSGHILSPAALTQLTHNTTSSYVADQAFHSALTPDSEPVKTSVPPPAS
                     ALASASISSSTSTSTATSAPASRLMSLSPPPSNSAKKEKKKQRTKKVYTLEEIPIQYR
                     KKPTLSYSKMITECLRRYGTARGMSLSEIYHQIQKMYPYYQYCSDGWQSSVRHNLSMN
                     NAFIKVSKEGKGWLWGLDEGIAAEKERAKGHNKENSDTKRSPSPAPKLSGDTKRALSY
                     LQKELVRLTKDRKMYDKVTTTQILTQALAMTIAQVDQAAKNAGIKGSPLLTLIDKNPK
                     HVTMILSAALNAATIQIARRNGLAIQEHEALHKSEITSHVSASTVKSPTTQIRTSSAS
                     SEIKMPQYYGNSTPMKHTSKPATFTIRPVRPPVPSLSKKRISIEDLPEKFRQFARPTP
                     PIQAKPTKDEKVIDNDPEDDDDFNRMLDSLEEQNSKEQNRLKEQREALTKLKRHLDEG
                     QSTDGSNKAPKLE"
     gene            complement(<306479..>307711)
                     /locus_tag="FOA43_000159"
                     /db_xref="GeneID:62193560"
     mRNA            complement(<306479..>307711)
                     /locus_tag="FOA43_000159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920494.1"
                     /db_xref="GeneID:62193560"
     CDS             complement(306479..307711)
                     /locus_tag="FOA43_000159"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776422.1"
                     /db_xref="GeneID:62193560"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /translation="MPSTPPQTPVFDKGRKPDLNATTNSLFDVSTFNSTTLDEDDTLN
                     ENKDQNPYYSPTSPVALSEFLPFSCDKKEPQEQKTPTTSFSYDRYPLKSERLRNFVLS
                     SSVFHIRLVDRLGKGTNSYVFEAIMSSQGGSELEVAVKIPVSRSRVKSLERETEFMLL
                     LKNFRLNSNENSDTFPFVIPYGLYYLNRESFVMMRKRDELPCLVMKKMDCTLTDYIRV
                     CGKSALPEHIVISEELWWYLCGVLLHALRILRVLSSVHCDLKTDNVLVSLQKNSCSLQ
                     FKVSDFSSSSRVEDMDSMLETTPQFAPPELLNTGDPLARACTQTDLFSCGLILLNAAT
                     GKAPYQAYSYDQFYMISLVKENKALELLDRESINILRKNTAISQLIHMIVKDRCTLDS
                     AVDYFHQHQNLGTLHVAL"
     gene            complement(<310149..>311075)
                     /locus_tag="FOA43_000160"
                     /db_xref="GeneID:62193561"
     mRNA            complement(join(<310149..311059,311072..>311075))
                     /locus_tag="FOA43_000160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920495.1"
                     /db_xref="GeneID:62193561"
     CDS             complement(join(310149..311059,311072..311075))
                     /locus_tag="FOA43_000160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776423.1"
                     /db_xref="GeneID:62193561"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /translation="MEVDTKKFKGIDLLLFQNVMKEIRLQTHSANKYLIQLEGALVEQ
                     AALLGNRDAITMLSFKALDDATGEYTEDDKEHAAIFINKLSKLKHPLVFKMGGDYHYR
                     KHNLAKALELYKKFLKLDNNSFMSSDVYRTLGMILFQQQKLMQTKVLMEKSINLAPIN
                     KVSQAHFVLGLINEIDPLNARYHFEMAASEGFLESFVNLGFLELNYFSNLYKAKEWFK
                     LGAELGDYNCMIGLFDCYIKEENWKNARITYTKTKKFLKDSKVAVNLDDIRVQSVELM
                     NTSLGPAVFNEQYPNKLPGSKHKSKWDL"
     gene            <311410..>311823
                     /locus_tag="FOA43_000161"
                     /db_xref="GeneID:62193562"
     mRNA            <311410..>311823
                     /locus_tag="FOA43_000161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920496.1"
                     /db_xref="GeneID:62193562"
     CDS             311410..311823
                     /locus_tag="FOA43_000161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776424.1"
                     /db_xref="GeneID:62193562"
                     /translation="MSDKRARSRLEPLSRTATTTSSMAPVHPMELAVQSLLESPLELL
                     SLNLNSLYESQVILSTILKRLESKLNECLKNIEGGDEKVNEDSSSITTDHSDDTVNLD
                     TYSERIHKLRQTVEKISMKLEIVEKRIDKITNNMK"
     gene            complement(<311847..>312866)
                     /locus_tag="FOA43_000162"
                     /db_xref="GeneID:62193563"
     mRNA            complement(<311847..>312866)
                     /locus_tag="FOA43_000162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920497.1"
                     /db_xref="GeneID:62193563"
     CDS             complement(311847..312866)
                     /locus_tag="FOA43_000162"
                     /note="BUSCO:EOG09343ZHH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776425.1"
                     /db_xref="GeneID:62193563"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF04756"
                     /translation="MRLQSLLICAFLTGISLAETFSHVVKSLGSNGPVKVTDNNYQEV
                     MANEDYSLVLFITASSPRIGCVLCTEVMPKYSQLASSYYKNLRASGVLNVKDDGLKNE
                     DLELNKSKFVIAYADLSDAPEFFKILGINSVPKVYYYDPRKAMDAANPTDQYRFAGDD
                     IPQRMSGWIMSHSSKSDPELFHIIETPDYQSMMANVFAFLVALFVLYKKSDRLMQVVF
                     NKKLWRACCMILVILLCSGYMYNRIRQTEFTGHTQEGLPVYFAPSQQSQYAAETQIVS
                     VIYAFAAVGVIVIADTVNRAVNPKHRFSIIVVCLVVVYFAYAYLMACFKAKNQGYPFS
                     LMSVF"
     gene            <313180..>315417
                     /locus_tag="FOA43_000163"
                     /db_xref="GeneID:62193564"
     mRNA            <313180..>315417
                     /locus_tag="FOA43_000163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920498.1"
                     /db_xref="GeneID:62193564"
     CDS             313180..315417
                     /locus_tag="FOA43_000163"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG09340ROJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776426.1"
                     /db_xref="GeneID:62193564"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR022039"
                     /db_xref="InterPro:IPR022040"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="PFAM:PF00752"
                     /db_xref="PFAM:PF12246"
                     /db_xref="PFAM:PF12247"
                     /translation="MPIKSLEPYLFELKTVSNCPLDVLRNAVVGIDVEHYLSRLFTPR
                     KEPNLEAIGGLPMTLKMLMDSDFKFFKDLNVKPIFVFSGLRTAIQYSYLEQAEILSRE
                     RTFRHVWDDKVNKEYFNESFRDPDSPLTMRPVMDQFMELLDSKNVEYIVSPFSAWAQL
                     QYMLNEHLINCIFGSTDGLLVEGVDRIILSIEFESKQFKYLDKSNIFSKLNLSPKQFK
                     DISMCIGNGFQPFTLNIFPHIPSQSTFTALHHFVLNGGSIYNTLLGLTDDGRSFEIYM
                     KGCSALRFMPVLKLNGRVEPRQINSDASCLSVPSSGIPNSSGTDSSSIKGTSSEKVPE
                     DMHEFIGQRLPDELFFYQSIGLTTFDLCETLVHSNAVERLPPDMALTSLYRRLVTSDN
                     SLDIRGKTINLLANSLNRYYQFKKLKLTTYFNGSEEYELVQRMSPPIFLSLQPLLIRH
                     ATARSFDLVTLLSSLSDDFLAECTIPRKASNSDDTKISTNYELISTSLMRTLLLYGFI
                     KEGEFKFNAWGDALRCIARSSYNSQYLLLVLWFFKQFPDLKLSDLLEPYDLHSINKKH
                     KEQAILISKFVGLFSMNNLSSVNYAYKVSRPLLQFRSVFDKLNSNIGGAVRSNLIALL
                     LLNQDDLDKYERDNSEWRKLILELPFRSTLPSVLLGIISQQFFEMYLDNFDLSKSFAS
                     INESFQFVHASSSAELIRGFKCFQEVAGLVKLLGEKGLIVDKEVLELFAQSNEFVDQM
                     LSKSA"
     gene            complement(<315578..>318181)
                     /locus_tag="FOA43_000164"
                     /db_xref="GeneID:62193565"
     mRNA            complement(<315578..>318181)
                     /locus_tag="FOA43_000164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920499.1"
                     /db_xref="GeneID:62193565"
     CDS             complement(315578..318181)
                     /locus_tag="FOA43_000164"
                     /note="MEROPS:MER0015691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776427.1"
                     /db_xref="GeneID:62193565"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="InterPro:IPR036757"
                     /db_xref="PFAM:PF02225"
                     /db_xref="PFAM:PF04253"
                     /db_xref="PFAM:PF04389"
                     /translation="MPSDKKNYTPLPKGLEGASNGSVESHSAESLPSAPVSIEANSGQ
                     MSEDPPPYEQGGFEQFEIEDPVALEASSSRPGLLGKAEDLARNINTRIFTPINEALDP
                     VYEAWRYISSKIDACISKVGNPLIVKRLLYVLFVAVLIYMISASSVYGRNNSYYGSFH
                     DLNVLSQYIEDKIDPHRLEENLEYLSSMPHMAGTAGDLSLARYIEEYIKKTNIRQLDG
                     QPFQAFTEYPSNDSFVNLVGSDGQIVYNCYLVDSVQDGTDVEERDDNKEIQEIQEETS
                     KDSNDKPNDISHWSFNPGSRSGSATGKVVYANYGLRRDYDTLESYGIDLSSFVALVKY
                     GGGIPDYKKIQYAKARGAVAVLFISDPVSDSPYSLYSIQREPVAYPDIASGNIIDPGP
                     GSADKIPDYFDSDTLLATSSAYPEIPSIPISWADFIEIMDKVKETGVHISDWNVQIGD
                     KKVDIWTGSDQFKVNMANELVQRPFKEMWNVIGRIDGSEQDALAVVIAANRDSACYGA
                     SEASGTAVLLELMSVLSEMKASMKWSPLRSIYFISFSGSKYNQAGAANLAVRRSEFFK
                     RNVFAYIDLSDAVAGSKINFSGDPLFYNTMINLLHDTMDPIQNVSLSDMWDKKYDYSL
                     DVTKSYMPFVSHFSIPSLDLSFEGSGERRYPKNSCLDTFQRFKKMDMDSEMNYHKTLT
                     SLLAKVLLELSDKPIIPLDIYALVSLMNENAKDLRNYANLKLKNSNIHLDFSKFEQAL
                     VRMKEMGREQQSFFSTWMEIVDSSSGIEPNLLAVNRWDWNTRLSVLQKILSSSDGIYN
                     RPWCRNMIFGQQLNLPEEYDDSGNLITFRYNSYPGVRDALNDGNWKDAQTELDRTTSL
                     INELASVFQIP"
     gene            <318471..>319717
                     /gene="GPI3"
                     /locus_tag="FOA43_000165"
                     /db_xref="GeneID:62193566"
     mRNA            join(<318471..319535,319703..>319717)
                     /gene="GPI3"
                     /locus_tag="FOA43_000165"
                     /product="Phosphatidylinositol
                     N-acetylglucosaminyltransferase gpi3 subunit"
                     /transcript_id="XM_038920500.1"
                     /db_xref="GeneID:62193566"
     CDS             join(318471..319535,319703..319717)
                     /gene="GPI3"
                     /locus_tag="FOA43_000165"
                     /note="CAZy:GT4"
                     /codon_start=1
                     /product="Phosphatidylinositol
                     N-acetylglucosaminyltransferase gpi3 subunit"
                     /protein_id="XP_038776428.1"
                     /db_xref="GeneID:62193566"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR013234"
                     /db_xref="InterPro:IPR039507"
                     /db_xref="PFAM:PF00534"
                     /db_xref="PFAM:PF08288"
                     /db_xref="PFAM:PF13439"
                     /db_xref="PFAM:PF13579"
                     /db_xref="PFAM:PF13692"
                     /translation="MVSDFFYPQPGGVELHIYHLAQRLIARGHSVIVITHAYKDRTGV
                     RILTNGLKVYYVPFVVLYRECTFPTVFSAFPILRYIFIREKIDIVHGHGSFSSLCHEA
                     ILHGSTMGLKTVFTDHSLFGFATVGSILGNKLLKFTLTDVGHVICVSNTCKENTVLRA
                     SLDPSTVSVIPNAVVADDFMPADLRPSLETITIVVISRLFPNKGADLLTAIIPRICMD
                     HPEIRFLVAGDGPKFIDLEQMRERYQLQDHVELIGSIRHEQVRDVMIKGQIYLHPTLT
                     EAFGTVLVEAACCGLLVVTTNVGGIPEVLPSKMTVFAQPEEDSLVESVNVAVGKLKRG
                     ETDTSSFHKEIEKMYDWSDIAKRYR"
     gene            complement(<319754..>322042)
                     /locus_tag="FOA43_000166"
                     /db_xref="GeneID:62193567"
     mRNA            complement(<319754..>322042)
                     /locus_tag="FOA43_000166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920501.1"
                     /db_xref="GeneID:62193567"
     CDS             complement(319754..322042)
                     /locus_tag="FOA43_000166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776429.1"
                     /db_xref="GeneID:62193567"
                     /translation="MSDEVDKLHNIIRRLDEKLKTFSDQVQSLKEELTKSHQDNDEAS
                     RLIDNLSEELEKRTVEVNVLSIENRNIESELQAVNKSYNSLKKEYAKAKDQLILQFEV
                     EHDNINETMSPDQLRTRNKLLELTLVKLREESLDNELKLSEKVNSLTDKVSKYETRAS
                     MQTDLGRLNEELQAQLENLQKPEELIENLTLKNQDLITQNEKLAENVKELEELESLNQ
                     ELIENHSLIQTELKQEVSQLEKKLREREQQIDELDSKIQKLEKVILRLNAEKSGSTVQ
                     EKTSQPIITEESIVEVHEMSSKKFNEHLDNLLIREDNFKIGVMKKLVDLSTLTSYFFE
                     RVAAQVHLGKEERHLKSANCLFKINAYATSLLEVYKFKSTVIPHEIVEQIDVYLREFV
                     DNYKEGQLELDIQLDLISCDDLLRGRELAIIQLSTFSEELKLGLIVINNLEGFKVGQI
                     KENLSRLIQLTDAKLTKLISMRAAREGVASITIDVKPLHIYLCNLIATFDSHHVTEDD
                     IILDAAVINQKCKLLERLEWRREKIPVSIVLQEDASKLVQHALVKQPETNNDGFIDKL
                     NLKIGVLEARLKKLQINEEKLTEVGKSLEDEHITNENLVKQVTELKSLKEELQDKINH
                     MNKLLNAFGLDHYNHDERESKSQVHEEFHNLTKNRMINEIAKQRDLIERLSTKKGPSE
                     DYSWLEQDISVARYRDDGKTAIFIDGLFDLALNFIAGARTISKQKHDVAEYYAGIMEE
                     KLTDFILRSYGGKGEESYLMNL"
     gene            <322261..>322835
                     /gene="CDC31"
                     /locus_tag="FOA43_000167"
                     /db_xref="GeneID:62193568"
     mRNA            join(<322261..322359,322434..>322835)
                     /gene="CDC31"
                     /locus_tag="FOA43_000167"
                     /product="Calcium-binding component of the spindle pole
                     body (SPB) half-bridge"
                     /transcript_id="XM_038920502.1"
                     /db_xref="GeneID:62193568"
     CDS             join(322261..322359,322434..322835)
                     /gene="CDC31"
                     /locus_tag="FOA43_000167"
                     /codon_start=1
                     /product="Calcium-binding component of the spindle pole
                     body (SPB) half-bridge"
                     /protein_id="XP_038776430.1"
                     /db_xref="GeneID:62193568"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="PFAM:PF00036"
                     /db_xref="PFAM:PF13202"
                     /db_xref="PFAM:PF13405"
                     /db_xref="PFAM:PF13499"
                     /db_xref="PFAM:PF13833"
                     /translation="MSTAGPSPLSVNKTNRQAKEELLNEQKQEIREAFTLFDLDNDGL
                     LDYHELKVALRALGFNYSKKEVLSVIEKYDSNDQKLIRYDDFYRFVASKIVERDPVEE
                     IKRAFKLFDDDGTGKISLKNLRRVAKELGENLTDDELMAMIDEFDLDGDGEISEHEFL
                     NICMEN"
     gene            <326283..>327365
                     /gene="PDB1"
                     /locus_tag="FOA43_000168"
                     /db_xref="GeneID:62193569"
     mRNA            <326283..>327365
                     /gene="PDB1"
                     /locus_tag="FOA43_000168"
                     /product="pyruvate dehydrogenase E1, beta subunit"
                     /transcript_id="XM_038920503.1"
                     /db_xref="GeneID:62193569"
     CDS             326283..327365
                     /gene="PDB1"
                     /locus_tag="FOA43_000168"
                     /note="BUSCO:EOG09342IWL"
                     /codon_start=1
                     /product="pyruvate dehydrogenase E1, beta subunit"
                     /protein_id="XP_038776431.1"
                     /db_xref="GeneID:62193569"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="InterPro:IPR033248"
                     /db_xref="PFAM:PF02779"
                     /db_xref="PFAM:PF02780"
                     /translation="MSFRRALSKAPIVQHSIRSMATAAAGKTMTVRDALDNAMEEELD
                     RDPSVFLMGEEVAQYNGAYKISRGLLDKFGPKRIVDTPITEMGFTGLCVGAAFAGLKP
                     VCEFMTMNFAMQAIDQIINSAGKTYYMSGGKLPVNIVFRGPNGAAAGVAAQHSQDYST
                     WYGAIPGLKVISPYSAEDARGLLKAAIRDPNPVVCLENELLYGQSFPVSEEALSPDFT
                     LPIGKAQILKEGKDLSIISYTRNLNFCLEAADIVRDKYGLNVEIINLRSIKPMDWDTI
                     LKSIIKTKHALTVESGFPAFGVGAEICAQVMESSAFDYLDSPIVRVTGCETPTPYAKS
                     LEDFAFPDTPTVVRGIEKVMSLGEWA"
     gene            complement(<327859..>330087)
                     /gene="PRP43"
                     /locus_tag="FOA43_000169"
                     /db_xref="GeneID:62193570"
     mRNA            complement(<327859..>330087)
                     /gene="PRP43"
                     /locus_tag="FOA43_000169"
                     /product="DEAH-box ATP-dependent RNA helicase prp43"
                     /transcript_id="XM_038920504.1"
                     /db_xref="GeneID:62193570"
     CDS             complement(327859..330087)
                     /gene="PRP43"
                     /locus_tag="FOA43_000169"
                     /codon_start=1
                     /product="DEAH-box ATP-dependent RNA helicase prp43"
                     /protein_id="XP_038776432.1"
                     /db_xref="GeneID:62193570"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04408"
                     /db_xref="PFAM:PF07717"
                     /translation="MTESLRPKKKSKTSTIDTENEDIEDGYGLDLDKRFQTTIKYAKK
                     FEDGKINPFTGREFSDKYVSILKTRRNLPVHQQRKEFLKMFQSSQIMVLVGETGSGKT
                     TQIPQFVLYDDMPQLTGSRVGITQPRRVAAMSVAARVADEMDVKLGEEVGYSIRFENM
                     TSSKTVLKYMTDGMLLREAMEDHDLCKYSCLILDEAHERTLATDILMGMLKQLCERRK
                     DLKLIIMSATLDAEKFQSYFNSAPLLTVPGRTYPVELYYTPEFQRDYLDAAIRTVLQI
                     HATEEAGDILLFLTGEEEIEDACNKISLEADQLIREEGCGPLKVYPLYGSLPPYQQQK
                     IFEKAPQAFKPNGRPGRKVIVSTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESL
                     LVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFKKELIQQSYPEILRSNLSSTVLEL
                     KKLGIDDLVHFDFMDPPAPETMMRALEELNYLDCLDDEGELTSLGRMASHFPLDPMLA
                     VLLIISPKFHCSEEILTVVSMLSVPNVFVRPGGAGARKAAEDAKMAFAHPDGDHLTLL
                     NVYNAFNSDEARQTGGRKWCKENFLSFRSLKSGDNVRRQLSRIMESYNLEMNSTAYED
                     PKYDDNIRKALTAGFFMQVAKRKSTGKGYITVKDSQDVLLHPSTVLSKQDEWVIYNEF
                     VLTSKNYIRTVTSIRPEWLLECAPIYYNLDHFHEDDVKMTLERVRDRMEKPDKKHNGK
                     NF"
     gene            <332067..>332503
                     /locus_tag="FOA43_000170"
                     /db_xref="GeneID:62193571"
     mRNA            join(<332067..332072,332090..>332503)
                     /locus_tag="FOA43_000170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920505.1"
                     /db_xref="GeneID:62193571"
     CDS             join(332067..332072,332090..332503)
                     /locus_tag="FOA43_000170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776433.1"
                     /db_xref="GeneID:62193571"
                     /translation="MTTTETPETTDDCPESKSSETPETTDDCPETKTTVFTSEGTLCT
                     TGYKVVTTTANNTTIATTTLCPLPTKHITPNETVVTPTIVPSYPVTANSSLPAPTQSI
                     VPPVPSIPSVPIFEGAANMHHLPIGIAVGAALLSCLV"
     gene            complement(<332742..>333206)
                     /gene="EGD1"
                     /locus_tag="FOA43_000171"
                     /db_xref="GeneID:62193572"
     mRNA            complement(<332742..>333206)
                     /gene="EGD1"
                     /locus_tag="FOA43_000171"
                     /product="Nascent polypeptide-associated complex subunit
                     beta"
                     /transcript_id="XM_038920506.1"
                     /db_xref="GeneID:62193572"
     CDS             complement(332742..333206)
                     /gene="EGD1"
                     /locus_tag="FOA43_000171"
                     /note="BUSCO:EOG093449LF"
                     /codon_start=1
                     /product="Nascent polypeptide-associated complex subunit
                     beta"
                     /protein_id="XP_038776434.1"
                     /db_xref="GeneID:62193572"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="InterPro:IPR038187"
                     /db_xref="PFAM:PF01849"
                     /translation="MPVDPAKLAKLKKQSAKRVGGSRVKAKKVQKNPEGDDTKLQNAL
                     KKLNAQVLNDVEEANFFKEDGNVLHFNKVGVQAAPIYNTYAFSGFAQEKSVTELIPGI
                     LPQLGAENLSMLQKIAQQLQDRQAAAGNKEEEKDEDIPELVEGETFDKADID"
     gene            complement(<333663..>334982)
                     /locus_tag="FOA43_000172"
                     /db_xref="GeneID:62193573"
     mRNA            complement(<333663..>334982)
                     /locus_tag="FOA43_000172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920507.1"
                     /db_xref="GeneID:62193573"
     CDS             complement(333663..334982)
                     /locus_tag="FOA43_000172"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776435.1"
                     /db_xref="GeneID:62193573"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PFAM:PF00096"
                     /translation="MNQSSSEPSHSGDGGKEEVQRLLIELLNSQKPKISPNAQTKLLN
                     TQITDEDVSFFRAANEVIKLHQYRIDPTIRDILSRLQYSNSPHGGIPLSREYLDTVGL
                     GSQQQRDEPSQIQQQQQQQQQRQEEITDSLLFPQRSRSISDTSSLRNGITTGNGDNNG
                     GFPVLSNSIFKMDAPPNLLHTLSLLSPLSAQQTLVQPQQTQTTASDSNGSNGSQTGLV
                     NQLVARIKNMDASQQQNLISGIAQMLVGTLSGGQAQQAQQVQRSHQSSGQQLASLTQP
                     QTQVPIAPPQATFLNQSHSFTSGEQPAFKVQKNSEPHTQFILETPASGGMTRSFSGSN
                     ANFKNSAAKGRHYESSRNPGTHGEGKDEKRHFICGQCGISFKRSSDLKRHEKIHLDVP
                     PNICPLCKKGFARKDALKRHIDTLTCRRNREKLLKKLTNANGTKTSK"
     gene            complement(<335554..>336846)
                     /locus_tag="FOA43_000173"
                     /db_xref="GeneID:62193574"
     mRNA            complement(<335554..>336846)
                     /locus_tag="FOA43_000173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920508.1"
                     /db_xref="GeneID:62193574"
     CDS             complement(335554..336846)
                     /locus_tag="FOA43_000173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776436.1"
                     /db_xref="GeneID:62193574"
                     /db_xref="InterPro:IPR001114"
                     /db_xref="InterPro:IPR018220"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR033128"
                     /db_xref="PFAM:PF00709"
                     /translation="MAEVVLGSQWGDEGKGKLVDILCEDIDVCCRCQGGNNAGHTIVV
                     DGKKFDFHMLPSGLVNPKCKNLIGSGVVVHLPSFFAELHKLEAQGLDCKGRLFISSRA
                     QLVFDVHQRVDKLREAELSGNKKSIGTTGKGIGPAYSTKVSRSGIRVHHLVSDEPGAW
                     EDFVTRYRRLVDTRLKRYGNFKHDSDAEIERYRKLREAVKPFVVDSVPFMHNALADHK
                     KVLIEGANALMLDIDFGTYPYVTSSNTGIGGVLTGLGIPPQAISKVYGVVKAYTTRVG
                     AGPFPTEQLNATGDKLQSIGHEVGVTTGRRRRCGWMDLVVLKYSTWINGYTYLNITKL
                     DVLDSFKEVKAALSYSYKGKTLESFPDDLRILGKVDVIYKTFPGWEEDITKVTKYDDL
                     PTNAKNYLEFIEDFVGVPIKFVGTGPSRESMLEKPEKN"
     gene            complement(<337280..>339129)
                     /locus_tag="FOA43_000174"
                     /db_xref="GeneID:62193575"
     mRNA            complement(join(<337280..337376,337431..337499,
                     337564..337604,337660..337718,338088..>339129))
                     /locus_tag="FOA43_000174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920509.1"
                     /db_xref="GeneID:62193575"
     CDS             complement(join(337280..337376,337431..337499,
                     337564..337604,337660..337718,338088..339129))
                     /locus_tag="FOA43_000174"
                     /note="MEROPS:MER0018320;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776437.1"
                     /db_xref="GeneID:62193575"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="InterPro:IPR037045"
                     /db_xref="PFAM:PF05922"
                     /translation="MNSVFESHRTICKKPSLSILSGSSVNKLNNAQNVFPQKPIKERI
                     VSRSTGLIKFALERSTKTSKEGLVLESSLEKENTTSSKRQGLPIFIPVEENEKEDEPE
                     IENEEGSSCNEQEKKSLHSQQVRSQGLLYKLAAKQRRVLDLKEELAETEKELAHLELE
                     YTDEVLPQSPEKHKQIDQAKLHSSSSNGQSRRGRKISKKPSIMEFTSQLSKKASMINF
                     NGNDAQAIAKSFSTIGDNISHNIAANPILSRGKNMLMNMNRDNERWFNKQANLIKQKI
                     QQDPNTFIGSVYNKVNKYKNDMVEKRAFEEDLDEDLRDDFDETCDGLDYSDCFYYDYD
                     QESDTKKFRQKIQDSTKTPENTSKATGENKTFIVTLKEKTTEPAVAKFKQAVKTMGGT
                     IEHEYSLIKGFVVKLPPIHAAKLNKDDNVETVEEDKEVKANSV"
     gene            340183..340255
                     /locus_tag="FOA43_000175"
                     /db_xref="GeneID:62193576"
     tRNA            340183..340255
                     /locus_tag="FOA43_000175"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:62193576"
     gene            <340352..>341917
                     /locus_tag="FOA43_000176"
                     /db_xref="GeneID:62193577"
     mRNA            <340352..>341917
                     /locus_tag="FOA43_000176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920510.1"
                     /db_xref="GeneID:62193577"
     CDS             340352..341917
                     /locus_tag="FOA43_000176"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776438.1"
                     /db_xref="GeneID:62193577"
                     /translation="MLFGIERFAYVLLLITGFVSGTLYNSQYDAWPFLSANRAIALRT
                     QRDISKSSLITYDVVTGVNLTTVIFQSLGYNDSSFTDITDLLNVGIQALSLDLYYNEY
                     TKNWSLCPYKAVNSNSLATQCGNASTFNLASIASIVDSFLLDTDSILNTNMFYVLLNL
                     NSMVDHESSNLSGVHRLGKIFKNITNLITPEMIHTSKLPTIGNLLFTENIRLSVVIVE
                     NNMPANTSYDLSSDLDTVFIASDLMEASEYQDVQGNTLNPLPMLYEPFDLQNTYNSSD
                     SNQTKFRFLYETPDSQFTLSEFHTIISSGYSQIISRSFSNLSDISDFLDNSLWSWRSG
                     QPPFVGSIEGNNGEIIEVGKNAGRCAVVTKLGWKATSCALKYRSMCQNSNHDAEYVIT
                     DDTSNYRSAAEKCYELNETYVVAVPYTAGEQSKMTDMISGDDDGVWININSISSANCW
                     VQGVNTVCPYQKTISKRIFIKMITPGSVVSFVLVLLLIAFQFNRVPVHKNRRHWRRLM
                     NDRLAGEFEGVAS"
     gene            complement(<342013..>343665)
                     /locus_tag="FOA43_000177"
                     /db_xref="GeneID:62193578"
     mRNA            complement(<342013..>343665)
                     /locus_tag="FOA43_000177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920511.1"
                     /db_xref="GeneID:62193578"
     CDS             complement(342013..343665)
                     /locus_tag="FOA43_000177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776439.1"
                     /db_xref="GeneID:62193578"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR036322"
                     /translation="MDHGPSVAPRSFPQHQTELQITGDIIDRFIPEIRNLGERSLHSS
                     CFKLLHEKEKVLDLKSDTSEKRSNARARSAPRSFHIQNGYFLVSPNLHLDITTRTESE
                     TSSEDSDSSTDSLLSGSSSTKAKLRRQGDRIAGALGFKRKSRILSFKPFSFGNTHNNK
                     HVSFKMPSVNSDSFVERFARGKSQKRKKEKNESSSAKEISFKVLDAPGLRNDYYSNTV
                     CWSKESDVLAVGLGAFLYIWNEKQGTIPMQRLNSEIVSSVSYSSSGILAVGTKTGRIT
                     LYDSGSQKIAVSSILKPSTGISCIKWVNDHSLFYAGDDSGDVALYEFEKNRDLDGVYR
                     YTVVTRMTIRCNQQQVCGIDVNPECTQLAVGSNDNSCTLYRIDDLRKPKKMFTLNHQA
                     AVKAVAFCPWMSNLLSTGGGSKDRCIRFWHTTSGTLVKKFETKGQVTSLIWSRSRKEL
                     LATFGFGSPGEKNGLLRVYAYPSLRVVKKVDSNSEMRVLTADLSYDQKYVCAGLSDQS
                     VRIYSIWNSKYDLRIGNYDSGLFESQLIELEEGVNNSFEIIR"
     gene            complement(<343818..>346497)
                     /locus_tag="FOA43_000178"
                     /db_xref="GeneID:62193579"
     mRNA            complement(join(<343818..345343,346485..>346497))
                     /locus_tag="FOA43_000178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920512.1"
                     /db_xref="GeneID:62193579"
     CDS             complement(join(343818..345343,346485..346497))
                     /locus_tag="FOA43_000178"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776440.1"
                     /db_xref="GeneID:62193579"
                     /db_xref="InterPro:IPR039261"
                     /translation="MSPYTILLYQSYYKFRISSVTTVKICQVSTSIAIVEIPNSALKR
                     KSCLPGCHIRIIDFPRNSFFRRLYNGLLIPEQHPYTLSTLPSDDHQKLIVRKGHFLFQ
                     GDREYLVTGVFLPFLGFIQQIPNVNPKSLAFRTHVKKCLIVVGGSAISFALPILRVLS
                     YNGAMVKIIWVIRDHEDLKVLDYFKNALVSDDCIDIFITGKYSDSEKMHFREAVKELH
                     RRKEELDKIQGSRMMDFNNRSRSNPKSQGGSSSPRSSLGTENTELDEETNDTNGIGSS
                     LQRAAQKKKSYLSLKNHAPSSGYSYYDEDKFEDVDIELKGHSSEATDRSPLIRNTGAP
                     ENYGYLATQGGENDYSSVSGPDMGYYPSANISGISGSASKNDTSSSELYDDLADYWIL
                     KGLSCRIDFGRPTLGLYYYSWCTGSSCTGPMFDLQSGEPVCYNELLSQDPPYNVNVNE
                     SEDDLFNNANFISHRKARFRDRGGKPNNKILVVAAGPKGLVDKVRLWADDCGFCFHDE
                     SFGI"
     gene            <346583..>348182
                     /gene="RPS0"
                     /locus_tag="FOA43_000179"
                     /db_xref="GeneID:62193580"
     mRNA            join(<346583..346609,346665..346693,347100..347190,
                     347463..>348182)
                     /gene="RPS0"
                     /locus_tag="FOA43_000179"
                     /product="structural constituent of ribosome"
                     /transcript_id="XM_038920513.1"
                     /db_xref="GeneID:62193580"
     CDS             join(346583..346609,346665..346693,347100..347190,
                     347463..348182)
                     /gene="RPS0"
                     /locus_tag="FOA43_000179"
                     /codon_start=1
                     /product="structural constituent of ribosome"
                     /protein_id="XP_038776441.1"
                     /db_xref="GeneID:62193580"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005707"
                     /db_xref="InterPro:IPR018130"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="InterPro:IPR027498"
                     /translation="MIPIVFRSLITFSEAPTRRTTNMADFSLTQEDLQLLIAANAHLG
                     SKNTNVHQVPYIYKTRPDGVNVINVNKTWEKIVLAARIIAAIPNASDVVAVSSRTLGQ
                     RAVLKFASHTGATPIAGRFTPGNFTNYITRSFKEPRLVIVTDPRTDAQAIKEASYVNI
                     PVIALSDCDSPSEYVDVAIPCNNKGKHSIGLMWWLLAREVLRLRGTLPTRTEPWTVMP
                     DLYFYRDPEEPIVDAAADAEADETEETAETADAEWTAEPTAADWAQTSSTGDWAAEGA
                     ENVEGATAAASW"
     gene            <348770..>350695
                     /locus_tag="FOA43_000180"
                     /db_xref="GeneID:62193581"
     mRNA            <348770..>350695
                     /locus_tag="FOA43_000180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920514.1"
                     /db_xref="GeneID:62193581"
     CDS             348770..350695
                     /locus_tag="FOA43_000180"
                     /note="BUSCO:EOG0934331Q"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776442.1"
                     /db_xref="GeneID:62193581"
                     /db_xref="InterPro:IPR007720"
                     /db_xref="PFAM:PF05024"
                     /translation="MTICISENRVVSIFWPCDLLDPSEELPLVIVGYIIDMVKVVAID
                     LVPLEIYEKINLSKHVRGLKRLQALGTINFHSKQIPRRVNYNYAAKRPILNSNELLIL
                     YKPPRSGKLEYFSIDPIAINIFWTSTDFKSPMPKDIELDRYSSKLEYHFPSHSTTANT
                     KELLRYINLTEYSRSRLRQASHQRSPISEYATFCKSSFEAILRILASIYSLVVQPVCG
                     YINFLLEYPLIAKADTRVSDEDEDDEETENEDTSSPIVTGSVISLALVSHTFHQLNSR
                     FKQLYNLPDQLQKLRLSRSESETLILKGTKFSPTVYIKFYNTVWLIINDILMGITVSN
                     LLRLHKEEVIWGFSFLLRSSHNIMSSNVIWLMNSPAGFKLNNELARFFGEMILWTMKF
                     WEVEVIQPASENAALLLSIAIFCVRYCGVSLLVALMVDVFQLLTLELQGFYTACTRVY
                     HWLYHTLTSLFRLFYGKKYNVLRHRIDSNDYEFDELMSGIIIFTILLYLLPTVAAFYL
                     TFVGTRIICFTIVVLMEFILISLNHLPLGVILLRLKNKERLPAGISITASEKHFTLST
                     KWLTMHNIFRGHIRSMMNFNLINYNEVYAPINENHPANYGMQDVITNWNKASPMTISK
                     DIFLGEMIDTFDYKKMF"
     gene            <351354..>355229
                     /locus_tag="FOA43_000181"
                     /db_xref="GeneID:62193582"
     mRNA            <351354..>355229
                     /locus_tag="FOA43_000181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920515.1"
                     /db_xref="GeneID:62193582"
     CDS             351354..355229
                     /locus_tag="FOA43_000181"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776443.1"
                     /db_xref="GeneID:62193582"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR038718"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /translation="MKVSDQQKFLQSLTAITNDLDNYQHLGVLYCYNLPGIPAELISA
                     GDCYGWGDFPYDYNACFKGSSCLSHILCDLRYLVSRGYIRITSRVLKFGLAVLRVYIL
                     PDGFVGQGILNIYRENYGRLNRQLSWHAKAYQKIMKQMMAILDYDPMAWKIHNDAQFV
                     KYIGSEKRVIPLINCLADYSPFNADSMIGNSWSDQVNTFESLGYHMNRLINGKPFAKV
                     LSALLLDESKEKLGQNTLQERVSRIYSVIKSPHLDLKLNEISTDQQEILSAILNGRVP
                     GFKSNLYNYQRRSVAKMYEKEMYSRRVPMPTIVQIKNGMMYIDLSSFKVMVNPPTYCT
                     PRGGILAENMGLGKTCICLALICLSKLQISQTPRDCRIGNPNTPHVKSLMGKCVEFIS
                     NNSIQWRQYYNDLPKTCIEKLEVSLGYFEKVDIHVTRHNTRHTRSQAHTNIEDNAFET
                     ISSRRVYLSSTTLVVIPDNLFPQWVSEVKKHVMENYLKLIEIPNEKISLPDKVADIVN
                     SDVVLISLHAFARQSQNPDSILRSIYWKRVIVDEGHSMNAKHSRAVEMAATLMAERRW
                     TITGTPTSGLTSLLVEEDDNEYTVTKNFNAKQDLVRLGIVVSNFLQIEPWKSNSRLWN
                     NTVVKPFEKRVFHSEYELTELLKNLIVRHTIEDVQRDITLPKMHHRAVLLKPSFFDKL
                     SINLFIAVLSANAVTSERTGVDFMFNPSNKSDLRRLINNLRKATFYWTGFSIQDIENL
                     LNICRYSLRENQKRYSEADQLLLKKCMYVAKVALSNNRWRTNSSVHEMSYFVDNLPPC
                     IRRDFTISQYPDLKDLFFSPIGVYGFPQLISIQRFYYKHRMISTEHELETEMRDYTRK
                     FWQHYGRTNDKLNGIRKGTSVMNKELDFRSIDFEAIKEIDKIPNWVNRFNSVSEEEKF
                     YPLENMPHGVKREVETVSPAFQKKVPRIVEKDCPKMISSTPNCEDDTNLDYMTSSKVG
                     SLMRKATIRGTASAKLSYLTSRLLENQIQGAKSIVFYELENSAYYLTEFLDLLGMNYL
                     MYSPHISLTERAKSLAGFDEWDPKKQQGIALIMDLKLASHGLTILAATHVFFINPVWN
                     RTIEAQAVKRAHRIGQTHEVYVETLILKNTIEEEMYYRRSAKGLVENSRQQVKETEKE
                     LIDNTGIQKYIMRFEFLRFHFGEKASEIAPLMSKTSIPLRLNTYGIEEKCHGSTEEDN
                     DITMRFAKSDVTPDLERKWALPLFTENSMMKLNESDFSKNRKRGKAASALKTEAVPQK
                     KTTAWERVNEKTLGLMKKLKKGRKVHFTG"
     gene            complement(<355290..>356312)
                     /locus_tag="FOA43_000182"
                     /db_xref="GeneID:62193583"
     mRNA            complement(<355290..>356312)
                     /locus_tag="FOA43_000182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920516.1"
                     /db_xref="GeneID:62193583"
     CDS             complement(355290..356312)
                     /locus_tag="FOA43_000182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776444.1"
                     /db_xref="GeneID:62193583"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MSLVVHNDRRSSLQNRKLSALRLSNSRRTPIYTVKFNDNASLIA
                     SAGDDHDITIWNTDSIVPGDFSADFTNGTPVDYHYLPSVHKSAITYLAWSNVSPSLRL
                     FTASADSTAALLDLSKAQKIKTFKHSGSVNQLAVSKRDLLVTCSDDGSVKLWDIRSKF
                     PTAQISTKYPVLTCCVDYDEQGIFFSGIDPTIHCYDPRNMDKPLWEEMSQSNNVTSLS
                     LCPDSSEYLVSKSIDGSIKYFDSRFIALSSVHSRAKPYIFDGSEASPEDWLIRSLLVK
                     DGQGALRVISGSNDGCVYLWDFASRKLVARLDGHIGSSFDVDYNQKSARLVSCSQDGS
                     LILRDF"
     gene            <357140..>357697
                     /locus_tag="FOA43_000183"
                     /db_xref="GeneID:62193584"
     mRNA            join(<357140..357268,357560..>357697)
                     /locus_tag="FOA43_000183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920517.1"
                     /db_xref="GeneID:62193584"
     CDS             join(357140..357268,357560..357697)
                     /locus_tag="FOA43_000183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776445.1"
                     /db_xref="GeneID:62193584"
                     /db_xref="InterPro:IPR007648"
                     /db_xref="PFAM:PF04568"
                     /translation="MFARRALTNVTKRSPYRVMGVRFTSSEGATGSVRQNGSSDNFTE
                     DLYIKKQQAEQIAALKVQLAEQKKQLDRLEKQSQVDPQIETDKN"
     gene            complement(<358173..>363841)
                     /locus_tag="FOA43_000184"
                     /db_xref="GeneID:62193585"
     mRNA            complement(join(<358173..359476,359873..362327,
                     362481..362499,362715..>363841))
                     /locus_tag="FOA43_000184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920518.1"
                     /db_xref="GeneID:62193585"
     CDS             complement(join(358173..359476,359873..362327,
                     362481..362499,362715..363841))
                     /locus_tag="FOA43_000184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776446.1"
                     /db_xref="GeneID:62193585"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR011872"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="InterPro:IPR036317"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF00682"
                     /db_xref="PFAM:PF00888"
                     /db_xref="PFAM:PF10557"
                     /translation="MSNSDLTPSSTSKYEKENGLSPQKSSRLFQKPRQTARLKRSRSL
                     LRLDGPITPLNAAINADITQITPTSITSPQTVDRLHYLVSGGARYSNRGTTSREIRTI
                     PTYVLDRLSKTKDESLKGEEKQEEKNKVIRVDTIHQGNNDPFIQTFKDDTNTSKWQDF
                     LGTVRMPGSTVQNSDDSDTDYILNHYDLNGRWKGESRLVSYFQNSSNGDDDNDNDNEK
                     ERSSTDLESGSKTLQKTKHYKDRARYWIQENKKNWKPRLIESLLSNSYVPLVFRVITL
                     ILSLVTLGVGGSLIQLDASDGFTRSPSPIMTVCVQPIAVVYILYTTYDEFTSQPLGLR
                     DPTTKIRLILLDLLFIIFGSANLGLGYQELFASDGICINPAADVAVFEPSLNRIMSAL
                     TVPGEEDGVPASGISDAATVNDPFLERTWREIEPSIYIILGDDKNSPLDSRMYTQTYS
                     KVYNYCTTASSRRPPSVNKDHDGKGTVKLVGAELYYKLQEYLKYYLENLKQKDGETFL
                     QFYIRNWQRYLIGSTRLNDVLDYINRYWVAKERADGHREIYDILSLCLLSWRDYKFHA
                     NLPTLMSEIMEQIRLQRESKIDSVGNLSVAIKSFVLLGFDVNDLKKQNLSVYINDFEK
                     TFLTETYNFYAEESEQYIHEHGVVNYLVKAQERIDEELKRLEELNDHTRRPLNDVLNQ
                     VLITNHSEEIRAQLTSLLDQERITDIRRMTRLLRRVPMTIEPLLQDFQEYVKQKGLSS
                     AHKMKTDFELETRSQGYNSGSTSPGPHSTDSHPPRHSKRMKEKEYYDAQIYIRTLLSV
                     YYHFVGVVETAFDNNEAFVKALDSACQSFINKNEVVTPTLRSKSRTPDYLAKYSDQML
                     RNKGQTAELNSELLMTFFKFVDDKESFEVWYRRYLSKRLMSGHMSPEDEEREEEIIQK
                     LKTANSIEYTTKITNMFNDIRVSRELGNVYREAIADPRNRPAGLQFITDLEPRILDSS
                     SWNAIFRGSSESFILPKELISTQEKFESIYQERYSGRQLNWIWNRSRIELKVNNLSRP
                     GKPPYHFTVTLFQYAILSPYNERDGMNTYELLENTALPVEVFKANMIPLVRNKLMIQK
                     PAGEENMTNPTTHYTIVREYTSKRIKVNFAAGVRMVDTKNEDRETTEEVERRHHELLK
                     ACIVRIMKARKECKHERLTNEVYQIIDRFKPTVGDIKKAIEVLIDEQYLARGDDEGYL
                     KVNEEPHKKVLRNPYGPNPGDFLSNVTSFKIIESTLREGEQFANAFFSTEKKIEIAKA
                     LDDFGADYIELTSPLASEQSKKDCEAICKLGLKAKILTHIRCKMEDARVAVETGVDGV
                     DVVIGTSKYLRQYSHGKDMSYIAKAAIEVIEFIKSKGIEIRFSSEDSFRSDIVDLLNI
                     YKTVDKIGVTRVGIADTVGCANPRQVYELVKTLKSVVSCDIECHFHNDTGCAIANSYT
                     ALEAGAKLVDTSVLGIGERNGITPLGGLMARMIAADRDYVLSKYKLHKLRDLENLVAE
                     AVQVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPSDFGLSRYIHFASRLTG
                     WNAIKSRVEQLNLDLTDDQIKEVTRKIKELGDVRPLNIDDVDSIIKDYHADIHTPLVK
                     ATDGPTVDDREDVMLDNVKRPKLN"
     gene            complement(<365818..>366523)
                     /locus_tag="FOA43_000185"
                     /db_xref="GeneID:62193586"
     mRNA            complement(join(<365818..365876,365905..>366523))
                     /locus_tag="FOA43_000185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920519.1"
                     /db_xref="GeneID:62193586"
     CDS             complement(join(365818..365876,365905..366523))
                     /locus_tag="FOA43_000185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776447.1"
                     /db_xref="GeneID:62193586"
                     /translation="MNPTTHQIQLDRILYMDQKDDSPTHRAPYPLNFPIGEDKESIRK
                     RIQSTRYSDPFYYDTDTFTMAMEDRFLRWRPSSSSHFSGDALNGVHPYQLDCQDRQLD
                     DITTVKLVTPTTLVDKNDSLMKELESMYNDSTIRLILSLQRKELQGDDQNEEDVAENG
                     STAEDSLNILSEYCFKKSEYGSQLPPIDVTSAMIIPATPMNIYETEITKKPHTGSRGA
                     HGFVFDK"
     gene            <367244..>368395
                     /gene="PPH22"
                     /locus_tag="FOA43_000186"
                     /db_xref="GeneID:62193587"
     mRNA            <367244..>368395
                     /gene="PPH22"
                     /locus_tag="FOA43_000186"
                     /product="phosphoprotein phosphatase 2A catalytic subunit
                     pph22"
                     /transcript_id="XM_038920520.1"
                     /db_xref="GeneID:62193587"
     CDS             367244..368395
                     /gene="PPH22"
                     /locus_tag="FOA43_000186"
                     /codon_start=1
                     /product="phosphoprotein phosphatase 2A catalytic subunit
                     pph22"
                     /protein_id="XP_038776448.1"
                     /db_xref="GeneID:62193587"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="PFAM:PF00149"
                     /translation="MDLDSDVQMEDAIEQEDELQTNVPVSNKQESGGNRDGDDTVMSN
                     NLIAATEATDTADQENTGVGKPLQQVTISTTNPKTQINTLDGWIQQLSQCKPLSEESV
                     KELCDTAIDVLKDEENVQPVSVPVTICGDIHGQFHDLMELFKIGGPCPDTNYLFMGDY
                     VDRGYYSVETVSYLVAMKVRYPKRITILRGNHESRQITQVYGFYDECFRKYGSANVWK
                     LFTDLFDYFPITALVDNSIFCLHGGLSPMIETIDQVRELNRFQEVPHEGPMCDLLWSD
                     PDDRGGWGISPRGAGFTFGQDISEQFNHTNGLSLTARAHQLVMEGYSWSHPDLVVTIF
                     SAPNYCYRCGNQAAIMEVDENLNRDFLQYDPSIRPGEPTVTRKTPDYFL"
     gene            complement(<368675..>369271)
                     /locus_tag="FOA43_000187"
                     /db_xref="GeneID:62193588"
     mRNA            complement(<368675..>369271)
                     /locus_tag="FOA43_000187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920521.1"
                     /db_xref="GeneID:62193588"
     CDS             complement(368675..369271)
                     /locus_tag="FOA43_000187"
                     /note="BUSCO:EOG09343XMM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776449.1"
                     /db_xref="GeneID:62193588"
                     /db_xref="InterPro:IPR000406"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR024792"
                     /db_xref="PFAM:PF02115"
                     /translation="MTDDLEKELVPSDIPGFRMGQKKTIDEYTRLDSKDESLNKWKQS
                     LGLNTGKPLVVQPDDKRTVVVVSMTLNIKGQKPVVVNLEKEDSISLKSKKIKFKIKER
                     SVYHLVIRFRIQHDIITGLRYMQGVKKAGITVDRMDEPLGSYAPNTEDKPYYEKVFPE
                     VEAPSGLLARGSCNALSKFIDDDKTTHLTLPWSFQITK"
     gene            <369650..>370210
                     /locus_tag="FOA43_000188"
                     /db_xref="GeneID:62193589"
     mRNA            <369650..>370210
                     /locus_tag="FOA43_000188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920522.1"
                     /db_xref="GeneID:62193589"
     CDS             369650..370210
                     /locus_tag="FOA43_000188"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776450.1"
                     /db_xref="GeneID:62193589"
                     /db_xref="InterPro:IPR018020"
                     /db_xref="InterPro:IPR036778"
                     /db_xref="PFAM:PF09349"
                     /translation="MSLPSASSICQLPRSIQISSLNELFEPCPTLTSYIIPRVFQADS
                     IYDSYTQIVESIRSHLMVLRSQYQTNPTPDLKRIIDAIVGAHPRLGAPKQVLLSTNSQ
                     SEQNSLNGGDPNLTKKLTQLNDLYESTFPGLRYVVFVNGRSREVIMRNMKMRIQRHDF
                     LAEVVEAFNAMCDIALDRARKLGAKM"
     gene            complement(<370273..>372570)
                     /locus_tag="FOA43_000189"
                     /db_xref="GeneID:62193590"
     mRNA            complement(<370273..>372570)
                     /locus_tag="FOA43_000189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920523.1"
                     /db_xref="GeneID:62193590"
     CDS             complement(370273..372570)
                     /locus_tag="FOA43_000189"
                     /note="BUSCO:EOG093404KM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776451.1"
                     /db_xref="GeneID:62193590"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR036867"
                     /db_xref="PFAM:PF01424"
                     /translation="MTSKEADSPQPPSVALSKASSNVSTSASAASTEDNLATTEFIPI
                     ELSSSDPSQMMHELSSRHYVPEILVKSLFDLNSRNKSSDGRLQSNDREFILNLEDEIV
                     EFIVKPNVDSWKLTPLNSYYRLLTHKLAEYYNLGHILSNDGYSMVLFKINTSLVNADD
                     EIKKTAKFDQDGNIKPLDFRNLKFDPVEKLSRIKLAELYNAYKDSFHCVDTPHLQVSP
                     ETSTSMTNATAPELSETFRGLNISSSQLPPQLFMQDGDGHYSIRIMKRRSQNMVRSMP
                     RTMGSHSSSSHISTSAASATTSIHGIQEDRLDREQRYNQAKERIEREQGDDVDEDDAE
                     DSESSNSNDKNCSRNYTDSLVSDEEGPVNSSSSNNDGSFAPTEHRRGGYRGGSRQRDG
                     FHSYNYRNGGGQGSSFNNNGYGQPMYIPSPPPSAQQIQSQQQPSRSGMAPYPYFSPYM
                     YAYQYFPQPQSTTASAPGSPGQGPVGSQGPHMPQIAQMAQIAQLPQGSQLSPVPQVPR
                     VPQLSPIPQLSPVPQLSPVPQMQSAGNSPNSSTLYPYYYLPQPMPYAPAALPKAQFKQ
                     TKNTDNSNEENEEGGDENTERAQLQPPTASSEANKVGGINDIVSTNTPSTSPLPPPGT
                     QFQYFYPSPFMGPPGSGVPAGIPPAMGGAGPGGLQGPQQQFIPPFYYNNAIGPRYGSG
                     NNNSNKKGGHRHQQYRRYNNYGRGRGGNRGESYNNDNGVFIDRRSSRKGNHHDSTTNE
                     DVTPNDTSNVAKVVNASGASNEDAE"
     gene            complement(<373704..>376916)
                     /locus_tag="FOA43_000190"
                     /db_xref="GeneID:62193591"
     mRNA            complement(<373704..>376916)
                     /locus_tag="FOA43_000190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920524.1"
                     /db_xref="GeneID:62193591"
     CDS             complement(373704..376916)
                     /locus_tag="FOA43_000190"
                     /note="BUSCO:EOG09340BD0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776452.1"
                     /db_xref="GeneID:62193591"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019474"
                     /db_xref="PFAM:PF04564"
                     /db_xref="PFAM:PF10408"
                     /translation="MSSPEDIRAKRVARLGLLSQRSAKPEQSQNHEESKDPGHQASTR
                     NKDSKLDSVHHSPAPELHTTKPEKRTRKLRKQEDINEWTNNQLERILDATLSSSKATS
                     DKVFQLIGVIDGDSKSTNKLNYDLIDPALLEILTEQGVGRYFESPMEYLYSTWEKADS
                     SKRIIRSDDPLASQKLKVINEVLRLTSSYASIMFQVPDMFVDEIDLSKVIESIWRDVN
                     QHEVFLMDIIVRAVENDSTLDLLNATIPELTDKLETLEQNGNIDYLKILTVIQIFLSN
                     KAVASVFHQVDGYHPKGLKGVEFESKTILGRILRISPLLPAVAASNYPGSLSKTQIVK
                     THESLQTEHSLLVSRLFSVCDRLVRAGGEARQEFLAWMADVVNTNHLRRGEHADPEKV
                     ASDSLMLNLTLILIKFAQPFLGTGNLGRINKITQDFLIHSNKLIDLSDETKINATIGE
                     YNEYYTEDKMTEVPLNFVSECFYLLLTYLHYGLGGLFVSADRLNNYVKQLSQQLKKFD
                     DMMQQSNSNASNPLVKMLYDTKIKPLRRQMETLKARKLSIEMFFYNRNMQLEVFEIII
                     GCITFFMRLMDPENKYPEVPLKVPFHDYDDNTANMEDIEYTRKFAPIPFRFFPEIFIE
                     GIINYCHYVSRFNNNPMFHNEGQLDKLVEFAVVILRCPELVSNPHLKARLTEVLFFGS
                     LPLQNGRDGYMVDVFNNNEIVKKNLMVALLDFYVMVEKTGASSQFYDKFNSRYHISFI
                     LEKLWKFDYFKRDLKRISEKMPKLFIRLIARMLNDTTYLLDESLNHLHTIGACQREIE
                     DRERNKPPAMEESDEELKKKLEESERMAKSFVQLSNKTVLLFDLFTEETPQSFAIVEI
                     VDRLAGMLDYNLVALVGPKYNELKVKNPETFKFNPGELLFQLCSIFINLALKQEFVDA
                     VARDERSFRPKCFKKAIEILYKLGKVPNKEFEDKLTVFVRRAQEKKREEEEEELELGD
                     VPDEFLDPLMYTLMKDPVKLPHSKVSMDRSVLKAHLMNDPTDPFNRTPLKIEEVYEDV
                     ELRNKIQAWIKKRKADIRKEKQEKILSQTGKDVDGDVDMK"
     gene            complement(<377143..>377781)
                     /gene="RPL35A"
                     /locus_tag="FOA43_000191"
                     /db_xref="GeneID:62193592"
     mRNA            complement(join(<377143..377502,377779..>377781))
                     /gene="RPL35A"
                     /locus_tag="FOA43_000191"
                     /product="60S ribosomal protein L35A"
                     /transcript_id="XM_038920525.1"
                     /db_xref="GeneID:62193592"
     CDS             complement(join(377143..377502,377779..377781))
                     /gene="RPL35A"
                     /locus_tag="FOA43_000191"
                     /codon_start=1
                     /product="60S ribosomal protein L35A"
                     /protein_id="XP_038776453.1"
                     /db_xref="GeneID:62193592"
                     /db_xref="InterPro:IPR001854"
                     /db_xref="InterPro:IPR018254"
                     /db_xref="InterPro:IPR036049"
                     /db_xref="PFAM:PF00831"
                     /translation="MASVKAYELRTKSKEQLEQQLVDLKKELFDLRVQKLNRPSLPKI
                     RLVRKNIAKVLTVINGQQRQSVRAFYAGKKYIPKDLRPKQTRAIRRRLTKEQTNLKTE
                     RARKAAAAFPAKYFAIKA"
     gene            complement(<378658..>379203)
                     /gene="ARF1"
                     /locus_tag="FOA43_000192"
                     /db_xref="GeneID:62193593"
     mRNA            complement(<378658..>379203)
                     /gene="ARF1"
                     /locus_tag="FOA43_000192"
                     /product="Arf GTPase arf1"
                     /transcript_id="XM_038920526.1"
                     /db_xref="GeneID:62193593"
     CDS             complement(378658..379203)
                     /gene="ARF1"
                     /locus_tag="FOA43_000192"
                     /note="BUSCO:EOG09343WVT"
                     /codon_start=1
                     /product="Arf GTPase arf1"
                     /protein_id="XP_038776454.1"
                     /db_xref="GeneID:62193593"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF04670"
                     /db_xref="PFAM:PF08477"
                     /db_xref="PFAM:PF09439"
                     /translation="MGLSISKLLQGLFGRKEMRILMVGLDAAGKTTILYKLKLGEIVT
                     TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRDRIGE
                     AREELQRMLNEDELRDAVLLVFANKQDLPNAMTAAEITEKLGLQSIRPRPWFIQATCA
                     TSGDGLYEGLEWLSTTLKSSS"
     gene            complement(<380134..>381273)
                     /locus_tag="FOA43_000193"
                     /db_xref="GeneID:62193594"
     mRNA            complement(<380134..>381273)
                     /locus_tag="FOA43_000193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920527.1"
                     /db_xref="GeneID:62193594"
     CDS             complement(380134..381273)
                     /locus_tag="FOA43_000193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776455.1"
                     /db_xref="GeneID:62193594"
                     /db_xref="InterPro:IPR036424"
                     /translation="MVEKINLEEVKHNIAESNQINTNVSPNKLVKDQAQQLEKEGSLN
                     LEVGENGPIQCSAAYSNESFIASFNNIFKTLISPRDVGTRSKFFKEGEHPTYGQLVEF
                     YIYYLVLTIIYIFMSILRLFQYMSNRSKLRFFSVAFNSAADPEVINSDVNKLPKIPRR
                     ISTILNYKSEQEENGGLEGLCNDAAQVASWCLSSGITYLSIYEYHGVLKKRVPVLKKA
                     IYKKFIAYFGTENIPNFIIKIPHLNLTFPGSIDGKLVESESEAVNFPKNVQYNIEVTL
                     LSVVDGRPTIVELTRVMAELAKKGELKPKDITLKFMDQELQQLVGKEPDLVIMFQPFL
                     NFQGYPPWQIRLSEIYWEPDNDSTCYAVFLRALQKYSTCKVNVGR"
     gene            complement(<381521..>387599)
                     /locus_tag="FOA43_000194"
                     /db_xref="GeneID:62193595"
     mRNA            complement(join(<381521..384179,385387..385397,
                     385644..>387599))
                     /locus_tag="FOA43_000194"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920528.1"
                     /db_xref="GeneID:62193595"
     CDS             complement(join(381521..384179,385387..385397,
                     385644..387599))
                     /locus_tag="FOA43_000194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776456.1"
                     /db_xref="GeneID:62193595"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF00620"
                     /db_xref="PFAM:PF07690"
                     /translation="MSPAILVSPAMHSSSSSSSVCASTPASSSVSNKPRKLVFRPLTF
                     DKSRSSRHISISGPLHVETSNEYVLSSNSPMSSRSARSVSFPSSSINVRPRRAANPAI
                     TPTLTRSNDSISALFNKLDNELRKSHTHVTLDDHLALIVPTIVQKCVNFLESKDPVQG
                     VFRINGSIRKIKRIELAIHQKGIDSFDFDTFRLDGDDGPNCYDVAMVLKRWLANLENG
                     LITPQINSKLKRDRLSHLDSSFDEEEERELENYNDGYIADTDNDTTMADTSVATVLIH
                     ESLHPIEHAKSPEQEKETTNDTSSATCTSSHSSSAISSSFDHLVSEPHSLTICRLSKL
                     PTENLHLFLYLLGFLNRLSREPTVSITKMTASNLAKIFQLSFFKSDDLTSSHPIFTTS
                     ALAEESSESLLESYKVNEDLLHSWIDSYDEIRHGLESSVSSKDADFQELLSHPSDPVY
                     EPEARVPTNPLSSLDKVSKRRSMFGYRSFSNMFSSSSFSLASSRKSSYSSSCDEIDST
                     SVSCSPVENLKTGGASKSGAPVTSNGAKQHKESRSVSAPVRSSWGRKPLGEKSISSLE
                     SKQNVCVSSEKAKRINTPARRRPRSMFIERRLSSLFPTHDHHVQLDHHNQLDQHDQHD
                     NHDHHNHHDHHSSTSTDIENNMLATKHILQKLLSPVFINAGKDMTDEDNVRPQPEFSN
                     GMKDPDNLQGDRRSSQNSSVTEIEMDDLVEQQIHNDYERFFTQQQDSQSASLWKGTDS
                     TPVDLAADVSGNVNVNSNFSMSVDKAPSAVSTGSTEPSTLPHSLQSPGPTLSTNVPTS
                     FFSNESMPSLSSPSVSTSSPSTPSLSTLPPTTLPPSTMPPSTLPTYASSTSTASLPTA
                     PLPPTEEELKKIRKRSTMMAIYVGLMSALGELIYGYDTGVINSMLEMSYVRRHFPSNG
                     KSFSTTEVSVVTAILSVGTFFGALSSPLLSDRIGRKWCIVVDCSVIFNIGIILQVISD
                     AIPLLCIGRFISGFGVGIISAVIPLYQAETAPKWIRGSIISFSQWAITVGLLISSAVS
                     QGTHDMDSSACYRIPIGLQLIISCILSVIMCFLPESPRYYVKCGRLDDAIMSLSKLRR
                     LPPDDEFLIEELIEIKASYDYEVSFGSTSLLDCFRNSPGRVCQRKRMFTGIMLQAFQQ
                     CSGINFIFYYGVNFFVRIGIGQSYLISFITYLVNVIFTIPGIFFVEILGRRTLLLTGA
                     IGMTVCNYIIGIVGVETNSITANKIMIVFVCGFISFFAATWGPVCWVTVGEIYSLSVR
                     QKAVSICAATNWFINFIFAYATPYLVDTGSHTAALGTKIFFLWGSLNITGFVFVYFMV
                     FETKGLMLEEIDELYRVCKVASKSAAYKGRVNGISEQISLRQSGEGGDPTFPKEEEDS
                     NDTGNTSITPVTPIPSPALVSDDSIMIPPMHVTDDEVSQGNTDDGNGFNRSALLMDSI
                     LHIPNDQPPSIISEEEADDSHVDDDPLFPDPGRDSSLDVLAYGDDTFNSRPRGADYMY
                     TNQEDLLNFMQTLSSRVAQMPVESSHSSTAATQSDASSTSGSNSSSN"
     gene            <388659..>391154
                     /locus_tag="FOA43_000195"
                     /db_xref="GeneID:62193596"
     mRNA            <388659..>391154
                     /locus_tag="FOA43_000195"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920529.1"
                     /db_xref="GeneID:62193596"
     CDS             388659..391154
                     /locus_tag="FOA43_000195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776457.1"
                     /db_xref="GeneID:62193596"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="InterPro:IPR036887"
                     /db_xref="PFAM:PF04383"
                     /db_xref="PFAM:PF13606"
                     /translation="MAENLYSATYSGVQVYEFIHPRSSVMRRKKDGWVNATHILKVAN
                     FPKAKRTRILERDVQIGVHEKVQGGYGKYQGTWVPLPRATELAKQFGVFGDLHSLLEY
                     KQVNGSSSPPPAPKHHHASGGARGKSAAAKARRSATMPAGLSRIKRTTSLMGKEAGPI
                     PAKRSYSSISDKRSTKRKRTLKAPKRTLSNLNTPASIASIASIASISNPPASSASSTT
                     PHIQTSSDSEVSVNFESESDAPATGPSHNSSAPITHNLSEASSPEDFLSDADLDKALV
                     AGDNKRQTKSSNQIRQQIQLPEHETDPKKIYAQKLLEYFLSSEDNGNTPLPSFITSEY
                     GTYDLNQPIDKDGNTIFHWACAMGDLKMCEALLNRGCNARALNNKGEVPIMRSVMYTN
                     SYSRRTFAKMLDLLRDSLLDADTHGRTILHHIALSTSCHSNLPAARYHTEILLTKVAE
                     IVQPMERIINFINQQDDEGNTSLHIMSYNGARKCIRILLGYNARIDIPNSRNEYVSDY
                     LYNNNLLATSGDRPTGARELGASGPAGISVGAVGSSFTGSRPGQSLTGDSFNHLRPFN
                     PSFGAQRQLQPPGKSILSSNRNDVGSPSQLGSGFITSSYLTIPHYSEAAMQVTQQSGE
                     IVDKLSQLANSFDAEVQQEDSDAKELHVILLQLDQDITKTEMGIKEILQSVFENIEVD
                     PSSQASREAMNTVKERADAIRSEYQVKIDQLHKLIERSQARDLASIVQKEEKKDLNKI
                     EESDKSDKHNEQAANEEEDKEAIELVVELTQLQLIRKLTVNDLVGLYANASKNTETIN
                     NYRHLVSKLSGVPLNEVDESLDGIEECLKDDAA"
     gene            <391359..>393158
                     /locus_tag="FOA43_000196"
                     /db_xref="GeneID:62193597"
     mRNA            <391359..>393158
                     /locus_tag="FOA43_000196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920530.1"
                     /db_xref="GeneID:62193597"
     CDS             391359..393158
                     /locus_tag="FOA43_000196"
                     /note="MEROPS:MER0211610;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776458.1"
                     /db_xref="GeneID:62193597"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR026893"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PFAM:PF13350"
                     /translation="MPYELAPTEEQFIISTPTPGSLRYVACIMRTPRALVEDPYANNL
                     APATHRCAILMHGNNSHKNFCFAVKLAQDLSDKLGMYSIRFDFRNCGDSSPNGRDGRT
                     VEEDIEDIEAVYQYVKNGGFNNIKLMVDLMVGHSRGVVDMFEWALHHNDDEHYVPAMV
                     AASGRFIGQGLVNRIREKYPDFEKSGGHTQPAIIKGQYSKIWVPASETHNLGGYDMDD
                     VSEINGDTETLCIYGTRDEIIPLQDAAMYSNALSGRNKLVLISDVDHRYYGVTKISAE
                     DATDNSHPYCERSGVLDYNQDVVDIIIDFLNHESGRKRFYMKNKMIHRFLPRWKKVEG
                     VTNFRDIGGYLSTTGKHVRYNMMYRCADPGSITENGIAELKRLGITTVFDLRSTYERG
                     DSGMIDAEGITNIHVPLFGDQSLAPSEAMMFYTNLMTSWFTFVHVYSDILRVAAPQFK
                     QIFTHIRNHRGEPFLFHCTAGKDRTGVLAMLLLRLLGVPEPIVSREYEMTEYGLLPAR
                     PRMERKFMKSLEESGDYESRKTFYKVISKGRKNWSLQKDGFDNLLSARYEVMMETILH
                     LDQEYGSVDAYLENQVGLDHDDLAEIKMSLLVE"
     gene            <393448..>395289
                     /gene="LEU4"
                     /locus_tag="FOA43_000197"
                     /db_xref="GeneID:62193598"
     mRNA            <393448..>395289
                     /gene="LEU4"
                     /locus_tag="FOA43_000197"
                     /product="2-isopropylmalate synthase
                     (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase)"
                     /transcript_id="XM_038920531.1"
                     /db_xref="GeneID:62193598"
     CDS             393448..395289
                     /gene="LEU4"
                     /locus_tag="FOA43_000197"
                     /codon_start=1
                     /product="2-isopropylmalate synthase
                     (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase)"
                     /protein_id="XP_038776459.1"
                     /db_xref="GeneID:62193598"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005668"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR036230"
                     /db_xref="InterPro:IPR039371"
                     /db_xref="PFAM:PF00682"
                     /db_xref="PFAM:PF08502"
                     /translation="MFKRCRVVLQKALKDEVRGPNSSYSNMLKDPSTKYSGFQAIYLT
                     DRTWPNNHIKKAPRWLATDLRDGNQSLPDPMSIEQKQEYFKKLVQIGLKEIEVSFPSA
                     SQTDFDFTRWAVKNAPEDVDIQVLVQSRERLIRRTIDSLEGAKRAIVHTYLATSDLFR
                     NVVFGMSRKEALEKAVRTAKFVRSLTKDDASQQRTNWTYEFSPECFSSTPTEFAVDIC
                     RAVKDAWEPTLENPIIFNLPATIEVSTPNVYADQIEYFCRHIGDRDRVVVSLHCHNDR
                     GCGVAATELGLLAGGDRIEGCLFGNGERTGNVDLVTLALNLYTTGISPDLDFSDMKSI
                     IDVAERCNKIPVHPRAPYGGSLVTCAFSGSHQDAIKKGFTAQEKRRTEGDNSWQIPYL
                     TLDPQDIGRNYEAVIRVNSQSGKGGAAWIVQRNLGLDLPKPMQIDFSSIVQDTADGLG
                     RELKANEIISLLQSHYNVDNCANNSIAVKDYNFHKISEQSTHLDAIIDFDGTEIAIHG
                     EGNGPISSFLNALSKALGIEMEVETYAEHSVGQGSKTKAATYVKLSCNGVTRWGIGMH
                     ESITRASVNSLVSCANSLIKARALSEDSVKTEDGFAETIEKKVKAKF"
     gene            complement(<395367..>395942)
                     /locus_tag="FOA43_000198"
                     /db_xref="GeneID:62193599"
     mRNA            complement(<395367..>395942)
                     /locus_tag="FOA43_000198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920532.1"
                     /db_xref="GeneID:62193599"
     CDS             complement(395367..395942)
                     /locus_tag="FOA43_000198"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776460.1"
                     /db_xref="GeneID:62193599"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR036400"
                     /db_xref="PFAM:PF00173"
                     /translation="MPQKKDPRSRFTILDFVQFLGGVLALCCILSYVFTGTSTWGYTG
                     KYLNSQYYKFVVQHQLISHESILFTTDELALYNGTDTNLPIYVSVNGTVFDVSYGRDI
                     YGPDHGRYHLFAGHDYSRVFVNGCFHRKDQWTFDLRGLDEKEAEIKLQSWIKYYRKHP
                     QYWEVGQLQLPNLNNQPIPEECRDGLKLPSF"
     gene            complement(<396439..>396816)
                     /locus_tag="FOA43_000199"
                     /db_xref="GeneID:62193600"
     mRNA            complement(<396439..>396816)
                     /locus_tag="FOA43_000199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920533.1"
                     /db_xref="GeneID:62193600"
     CDS             complement(396439..396816)
                     /locus_tag="FOA43_000199"
                     /note="BUSCO:EOG09344ST8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776461.1"
                     /db_xref="GeneID:62193600"
                     /db_xref="InterPro:IPR005579"
                     /db_xref="PFAM:PF03879"
                     /translation="MAIGKQSTSKTAKKEVIEDPGRGARVSGKWWKKEKKVFRIRSLG
                     VHSSWKDREEQKLKDGQFKAKLKELKEEKEGERKAKIDRIKERREKQEEKERYERLAT
                     KMHRKKLERLKRREKRNKMLSER"
     gene            complement(<396963..>398768)
                     /locus_tag="FOA43_000200"
                     /db_xref="GeneID:62193601"
     mRNA            complement(<396963..>398768)
                     /locus_tag="FOA43_000200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920534.1"
                     /db_xref="GeneID:62193601"
     CDS             complement(396963..398768)
                     /locus_tag="FOA43_000200"
                     /note="BUSCO:EOG09341AUS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776462.1"
                     /db_xref="GeneID:62193601"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR036691"
                     /db_xref="PFAM:PF03372"
                     /translation="MHSLTGHPAIALNDISICILGSVGMGDIDIPSKFSNTSLRLVSF
                     NVNGVKTLKNYYPWNQRPGYDNALHFMKADIVTFQELKLQREDIDVSIANPTDYKAFI
                     TVPQSRKGYSGVGVFVRKPTDQDSDMVKRALTVVKAEEGITGYFHLKRARKSYRDCSI
                     DDKYKDMCIGGFPALEDPVDGRHLDSEGRCILIELAIGLVIISVYCPANSGLTEEGEN
                     FRLLFLRCLFERAENLMKMGKEVVIMGDINVSPDLIDNDDSINEGFIQGIIKKSETAS
                     EFENINKAQALSFKNNTEARRLLNSYLFDTTKLVENESKDKIIHDITREIQGRRLKMY
                     SVWNTLKNNRPVNIGSRIDLFLATSGIASCARNSDIWRDLYGSDHCPIYCDLELNTKI
                     IEQLANRNTYTTKCNCRHMEAKNYYSLGNSRGISSFFRKPEKHHQEDVVSGNQAKKTK
                     SGSSSVYVSRKRTVKSQRSLTRFFSIIKKTPTENDLYLPPSSSGLFVGDSDEEDEPDN
                     NQEKHKSSISATEFRDLLRTSSFSSAPLCSHNERCALRTVKNSNSGNVGKRFWCCSRQ
                     TKNETWNFDKKGLADDTGKQLDEYNCGYFKWVEKR"
     gene            complement(<398960..>399403)
                     /locus_tag="FOA43_000201"
                     /db_xref="GeneID:62193602"
     mRNA            complement(<398960..>399403)
                     /locus_tag="FOA43_000201"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920535.1"
                     /db_xref="GeneID:62193602"
     CDS             complement(398960..399403)
                     /locus_tag="FOA43_000201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776463.1"
                     /db_xref="GeneID:62193602"
                     /translation="MKFLTSPFYITKQSVQPSITTTYTMKFSTTAIISALFASAVMSA
                     PAPNADAVANADADADARWQWRSFERNRAIYKREADADADADADADADADADARWQWR
                     SFERNRAIYKRDTNSTAELGEDIVGFAVAFNDAGVPVDVVYAKSE"
     gene            complement(<401620..>403482)
                     /locus_tag="FOA43_000202"
                     /db_xref="GeneID:62193603"
     mRNA            complement(<401620..>403482)
                     /locus_tag="FOA43_000202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920536.1"
                     /db_xref="GeneID:62193603"
     CDS             complement(401620..403482)
                     /locus_tag="FOA43_000202"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG09343XWU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776464.1"
                     /db_xref="GeneID:62193603"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PFAM:PF00561"
                     /db_xref="PFAM:PF00782"
                     /db_xref="PFAM:PF12146"
                     /db_xref="PFAM:PF12697"
                     /translation="MDGTFKRKLILNAQNIKELQRKDDNSKLSLLKIAGKFYNDDLYS
                     DFDKEVLLMKPNDCAIVQKYSRMETFDLENHPRLEKLTINTMYSGHPLREFYRRSMLK
                     LELNDNVDSKGLENARNQIDIIKKLPIIVFIHGLGGQLSQFEPILQEFRNCADIFGID
                     LPGFGNSKPHLRCRSFSRLSSYTDEEIYNLESSLSKMTWDDFQFDAIVDIIYQILMVK
                     FPARRFIIISHSMGTHISIRLINKLPTDRVESLCMISPPGILDSNTTRVKLPLFTRVF
                     LELSSYYPRLFDLYRLFDRRGGLYSKSVDSYIYPEEDDLLKRLAQLRWNLDTNSKIFL
                     EYLKGFTPVSVEELLSAASKIHDSTDSKIPKILLCCGDKDKLTPVSSSSNICNTLKEA
                     GFAAELRVVKDANHSVFLDRPHLLSGIIYEFVVSLNLHIDCTWVLKVKALISGDKWSM
                     KNLEKWNKAVTLSKPLLNIASPDKPKCPLLGMKTLRETANQHNPKIFEQDHPEIFGIV
                     DIGSDTPSYDPNDFKRLQYIKFKTESKVTPDDVTIAKFLEIIDKLVAKKGPDQFIVVH
                     CHYGQNRTGFLISCYLVERLGWNVRESLDAFEHSKEPGIKHEHFKNALYLRYGE"
     gene            <404135..>405997
                     /locus_tag="FOA43_000203"
                     /db_xref="GeneID:62193604"
     mRNA            <404135..>405997
                     /locus_tag="FOA43_000203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920537.1"
                     /db_xref="GeneID:62193604"
     CDS             404135..405997
                     /locus_tag="FOA43_000203"
                     /note="BUSCO:EOG093417HS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776465.1"
                     /db_xref="GeneID:62193604"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MSQIQQRSDSMSHVWRCESGVPIYPLTYDCTPRSLPVKLANERY
                     RLVGGLGSGSFGSVMMAKVRRSALKIIKEEMSLSHDTLLEPIKESGKTSYDLVAIKIL
                     NRKLTNLQDYSKVKEVKFILSVTSHQNLVQVYDLFVDKASFKLHIVMEALDQNLYQLL
                     KARKGSLFSSGTLKSILSQILAAIRHIHRCHFFHRDVKPENILVMPTVSFYGSKESVP
                     PLMRKDSYVVKLADYGLARHISNTKPFTAYVSTRWYRSPEILLRNKSYSFPVDIWAFG
                     CVAVEAATFTPLLPGQNELDQTWKVLELLGYPEKTSSDDLDLLVTPPLGGYWEDAQLL
                     ASNLGFCLPKLPGSTIHNVLPRKDIERSERHELYKVIQSCLLWDPKLRGIAEKLAQSS
                     YFDCTVLRTEDAKLNKVRRDFQNSLTNLEVKFDNEESTKIPLPEVTSDTIFNDENKQE
                     PSEVWQTKLKRLPHITMDMFRIFKQKSESSNDVQRSISTEEESVPSLEEEPYEEFQGR
                     SEETGYFDLGINSSLKSRLSEALEFENTDGERLATTPIEKISPEDSAILREKHHLSNR
                     NESQLPTVDISSYNNEHDIIKGSRNQNLIDTLSYSYDQNLNEYENSFYDWTTTQ"
     gene            complement(<406081..>407247)
                     /locus_tag="FOA43_000204"
                     /db_xref="GeneID:62193605"
     mRNA            complement(<406081..>407247)
                     /locus_tag="FOA43_000204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920538.1"
                     /db_xref="GeneID:62193605"
     CDS             complement(406081..407247)
                     /locus_tag="FOA43_000204"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776466.1"
                     /db_xref="GeneID:62193605"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR036855"
                     /translation="MNKEQQLQQDLVKLKDGINSKRQEINKQLKLRQQELSKQQDILR
                     ERLSGHTAPKSTISKRKRISNSEKPSAASLSSSKKAQIEIRKLKALGKAKKALFKYIY
                     QNRIKYNYKNRILIKGLKYVPIHGLNSLALTSTENEDTHKELTSIDDLDLWVSYQGKN
                     YVKDYSGKYNLQSRDWIMNPPSEDCIYYMRAGHCENRKCKYLHDPDHVALCPNILLSQ
                     RRCTKSHCCMSHKPSQFNAPSCNFFQEGSCTNVNCIYSHKLENGSDIAICRPFSMNGY
                     CKMGRKCTYRHFFDCPDLQEYGYCIRGRGCHLNHSFLLKTGQESLEPIRNTDNDDVVV
                     YFDDNKDLDNPTDSLGDVMLRTLSTSDLSSKDGDHIQQDQVDTNFSTNADFVSL"
     gene            <407404..>408930
                     /locus_tag="FOA43_000205"
                     /db_xref="GeneID:62193606"
     mRNA            <407404..>408930
                     /locus_tag="FOA43_000205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920539.1"
                     /db_xref="GeneID:62193606"
     CDS             407404..408930
                     /locus_tag="FOA43_000205"
                     /note="BUSCO:EOG09342W0M;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776467.1"
                     /db_xref="GeneID:62193606"
                     /db_xref="InterPro:IPR009349"
                     /db_xref="PFAM:PF06221"
                     /translation="MSSYTLNEIKAYATQAIDEILPLDEQTISQMVNYAITELRTREA
                     VRQHFTNLLGESPKALDFITKLSNILFGDPNKLKIEKKLSQPSKNNTGWVNSATGSTL
                     SKGQHDQRLRNASVQGTSTSELIDQTPKAAKEVSMKKKDAQKTLDSLKDLDAALNELE
                     VSDETNRGESDRVVRVCNCNATRHPLFEMFPNCLNCGKIICAKEGFQPCSFCGKKLLN
                     NEERLQIVEVLNREKEEIEGKSNKNERSNNQDDNMRRRKNVIKISINSTGQNNYKVQE
                     MAFKRVERKRELERKKEELKQQKQEEVEEVQRELDYYSSLKDKDEELVRAQQQLDTLM
                     DFQLHGAERTKIIDQASDFDAPTSSNNLWATPLERALQLKRQQKQLRKQQEADDRRSG
                     RGKRVMDMSIRNGKVIIREVDAPTEIAEDLSDDEEIKGLQARVSDEKTKTLEENSHNV
                     WDYQSDASKWTKPVYMGEKGTKENKELKQSDTVTAKSKVVQLGDEEEQENTIFSMVGV
                     "
     gene            complement(<409433..>409834)
                     /locus_tag="FOA43_000206"
                     /db_xref="GeneID:62193607"
     mRNA            complement(<409433..>409834)
                     /locus_tag="FOA43_000206"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920540.1"
                     /db_xref="GeneID:62193607"
     CDS             complement(409433..409834)
                     /locus_tag="FOA43_000206"
                     /note="BUSCO:EOG09344OD5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776468.1"
                     /db_xref="GeneID:62193607"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="PFAM:PF03656"
                     /translation="MAHRLLVQIVFTGAKVFGRAFTEAYRQAAAATTAQQAAGSTGRA
                     RRTARDSEISLDESCKILDIERTDMSLDKMQKRYQYLFDVNSKESGGSFYVQSKIYRA
                     MQRIKDELQAQKEDAEADSSNPNDKGKESSP"
     gene            <410669..>413110
                     /locus_tag="FOA43_000207"
                     /db_xref="GeneID:62193608"
     mRNA            <410669..>413110
                     /locus_tag="FOA43_000207"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920541.1"
                     /db_xref="GeneID:62193608"
     CDS             410669..413110
                     /locus_tag="FOA43_000207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776469.1"
                     /db_xref="GeneID:62193608"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="PFAM:PF00628"
                     /translation="MSQPVQNATSEMGDKEAAGLLMLFSNQSQRYSRPVMPVSTVSSV
                     PGMIGTLQGPVPGTAQSILSGRGFSEGSTGAPVSPGTHEENSIRPANKQPTTHNMPYI
                     ESTDLNHVTSPGPAAAGLASGSGSNNKAIVAAQALAAAAATPLPLLIKNHQGEFPKTT
                     EIDAQNQSPKKRTQSQIDAAATAAAITHHLQKLQKGSRQQQQSKRQKTQPKIEDEDDK
                     PSRGRRPSTRSRTPSYAVDPNAGIIGCICGFGHDDGFTIQCDRCFRWQHAVCMNINNV
                     DEAPEKYLCYLCDRTVRIDFERARSIQEARINTLRQQQVSADTSVGESIGTTAATITN
                     LDTEKIVTPLEPANVTPTQESNRKSKRTIEDSTTKERKRTPEEERFALKRYETFYVNI
                     SHYEYSSSKIMELMKRMPNLIVGKEGVLSFRSIDEFSRKMVRPSTILVKLPPDVPKSK
                     FTGISKIGLRATRPMNQGQLISPMYGGLQLMQDYLEEKSNKYWILGCCKPNAFFIPHL
                     PLVIDERAVGNITRFARKSCRPNCEIRTVIIGGRICVFVLTASQSIAAGDELTLPWEW
                     DENHPINQIGGEVGNFKKLGKTARTKLINSFHAISSIACCACTDPSTCLLEKVNKLAS
                     AVVSKTGEVVISPTPNQTYDPIEDRLKSRENIISRSIVTRKKEANNEERPEPVRASTL
                     SATVCPGWKQTDADHMGFIHVPWESMLEMAMAPPKYQLMKQYLTRSLTKPTIKVKDAN
                     VPLYTPFPIKAEELDKLTIRNASQQVKTIPLVKGTKRSGISKLSKQDTNPTRPKVVKK
                     FSLADYKRKTKAATK"
     gene            complement(<414484..>430680)
                     /locus_tag="FOA43_000208"
                     /db_xref="GeneID:62193609"
     mRNA            complement(join(<414484..429109,429740..430138,
                     430430..>430680))
                     /locus_tag="FOA43_000208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920542.1"
                     /db_xref="GeneID:62193609"
     CDS             complement(join(414484..429109,429740..430138,
                     430430..430680))
                     /locus_tag="FOA43_000208"
                     /note="BUSCO:EOG0934005E"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776470.1"
                     /db_xref="GeneID:62193609"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR012099"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036465"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="PFAM:PF00158"
                     /db_xref="PFAM:PF07726"
                     /db_xref="PFAM:PF07728"
                     /db_xref="PFAM:PF17865"
                     /db_xref="PFAM:PF17867"
                     /translation="MKMDDNLQKLMQTDAFAKKLLSLTSLMDPYEDPNSQSEALNIII
                     SSPVYERVEEEENILKNTSNSTSESTSSDYTDRLVKQLLKYLWNMEDHVWCEYYSSNL
                     NRWVHLDCCENAFDNPLLYNQGWAKKMSYIFAISEHYIRDVTLKYIAKDLNRTIPRDK
                     ISQLNLGKVLALINLSQFSAIQDDDILLEVSSDLIHDYRNMNGSSITPQAMLPRQSGI
                     LTSAKEVANLVEYFLDSKRFFYALSQCSTSISQSELQTILLAFYRLISADRQKFIRFI
                     DPVLLHTAITTDSTSDINKYLAILLESSYLSIAEDVKLHNIEKYVDKSKLIGVFDKEP
                     SFNYEFISLFEGQRLSNLSKLPFLSECLESNGDVNCISFVTEDLSPGVRIIGGVLVPH
                     IRELENERLIKTPSEFIPIKKSVDSLRKLATHVRASDPVLLIGKTGSGKSFLVNEIAK
                     MLGVDTSNLIKIHLNHQTDPKLLLGTYTSGSKPGTFEWKNGVLTTAVKEGKWVLVEDI
                     DKAPNEVLSILLSLLETRELTISSRGDVIRAANGFQLISTICESSDSDEITIPDMIGL
                     RLWKTIILEDLNHSDLLSILKSRFPLLEHFIKPFITAFFNIKEIYESRKIINMNNGVP
                     PRPISIRDLMRFCKRSNKLLLDSEIKDSNDMVSDSLYDFIFQEAVDCFTSALSSNDAI
                     KLLTAEVGKSLEIPTSRIELQFQKTVPPFEEYEDSIRIGRAHVSKHHIIGIHKNGRNN
                     PGNSRFARTSCSLRLMEKVGVGISMCEPLVLVGETGTGKTTIVQEMAKLLNKKLTVIN
                     MSQQTEVGDLLGGFKPVSTKLIALPIQEDFEDLFSRSFSTKKNSRYLQLLSKCFNRSQ
                     WKKVVRLWKEAYKMTQVTYDGKEEGTSLDVNESGTKKKRKLNETDISVLLNEWSEMYQ
                     KVCSFEKQFKDTENSFVFQFVEGSLVKAVKNGDWVLLDEINLASTETLDSISDLLADE
                     ELQRSILLTEKGDVESIRANSGFRIFGCMNPATDVGKRNLPSGIRSKFTEIYVHSPDE
                     DISDLLMIIDNYIGKFSLSDEWVGNDIAELYLSAKRFADAHKIVDGANQKPQFSIRTL
                     TRTLLYVQDIIQIYGLRRSLYEGFCMSFLTLLDKKSEGILHPLIQKFTVSRLKNAKSV
                     LRMIPPNPDPSGEAYAQFKHYWIRKGQEIPVPQDSYIITPFVEKNLLNLVRATSGRRF
                     PVLLQGPTSAGKTSMINYLAKITGHKFVRINNHEHTDLQEYLGTYVSDDTGKLSFREG
                     ILVEALRNGYWIVLDELNLAPTDVLEALNRLLDDNRELFIPETQEVVTPHPEFMLFAT
                     QNPPGLYGGRKILSKAFRNRFLELHYDDIPQDELEIILRDRCQIAPSYAKKIVEVYRE
                     LSVERQTTRLFEQKHSFATLRDLFRWAGRDAVGYEQLAANGYMLLAERVRRPEEKLVV
                     RQVLEKVMRVKLNMDAYYTNLENKDLLLIKSSVIWTKAMRRLAVLVSLALNHHEPVLL
                     VGETGCGKTTIFQLLSRFIGKELIMVNVHQNTETSDLLGAQRPVRNRSQLQQQLIQKI
                     IEVSSRAGVDVSTIDSLSSALISWKENKININISDEDMKAVEYLLLENNALFEWSDGP
                     LVSALKKGCHFLLDEISLADDSVLERLNSVLEPERTILLAEKGPDDSLVVAADGFQFF
                     ATMNPGGDYGKKELSPALRNRFTEIWVPSMEDFEDVTQIVSAKLNGQVKKFTDTIVNF
                     SRYYGLQLGGGKTDTGVISLRDILAWIQFINFCHDDGIDDHVALLHGACMVFIDALGT
                     HSTSYLAENEEKLRDVKLSFVNKLSEFVKMDLAAIYSEKAVVTSGSDHLLCGHFKIGK
                     KMADSSISSFSLQAPTTAANAMRVARALQVRKPILLEGSPGVGKTSLITALASSTGNK
                     LTRINLSEQTDLIDLFGSDSPVQAGRVGEFEWRDGPFLRAMQKGEWVLLDEMNLASQS
                     VLEGLNACLDHRGEAFIPELDRSFVSHPDFRVFAAQNPQSQGGGRKGLPKSFINRFTV
                     VYVDTLKEYDLKLIATHLYPNIDLAIRDNLINFMSALEKQVVVERTWGSSGQPWEFNL
                     RDTLRWLSLLNSGSIANTVDPVDFFQLVIRQRFRTLEDRSRVDELFESVFGAHSPRDP
                     YFDLKPSYIQVKNEVIIRNAFTQYTADTRLVGLQSNIGALETLMRCIKMSYPCLLVGP
                     SGSGKSELIKYCASIIGSRVFELSMNSDIDSMDILGGFEQSDLNRSLAEILDDILVEL
                     LNTVSLQMSLDSCKEEAVRLALSIISIIVDANVTVDSLSSMITSLNDLSILIHSDGLA
                     QFVRRLSTLKIESEKPSSVNFQWFDGLLVQAVEKGYWLVLDNANLCSPSVLDRINSLL
                     ELNGRLVVSECTDDEGASRTIIPHKNFRLFLTSDPKYGELSRAMRNRAVEIYLQPLTE
                     RATTFDIQCLGLSSSQDSTISSRLGNMDLDQATGYRPITSFVSCSDSKTRDYALILDA
                     LNLTDGHFERLVLDFAGLDILNELPLLLDSCISLPEFEHSQMFSNTLDYLNFLHEKGI
                     PDQLFKVYERSLQSSQRLQNIQCSLASYQTFCASLNEFIQPLLALNFKFVSLSSEPHY
                     FVQDIMMFFDSTQYLQGVCLRAEKSKMVQLNPLERSAAMILGRDTKRPPKYPLYTLVN
                     SVYQFIGEALLQGSRADLIFMSPTYFQSIFYLELLLVRIIKASESFNESYVRVHQDEL
                     LDWLDHNSALYEPASINRLSTKVHSFASQMKLSRGLSMSLIWNSSRADYPTTSEAWSH
                     YQTLSSIGNRFDAVSQKQFPETYQTITKMRVLFVEMLKACKLESCSSDLLVFEEKAEQ
                     EVSVLEQITDGFLLQRNCSFTRLFDTLLAFTESGMLNAVRVIPLSESILTLSLLGARP
                     TIALTRYSDITDLFKPYPAIFDSLWSKSGDGKMKVDIVDDEFFRQLFRSANNIKNSPG
                     GQIENSLSDLSFMLTQLVSQSKFIIEDHISQFKNLAYKWIHYICSLHIKTLPIEVQEQ
                     AAKLFDESSYDDYASLMSANGLDSFVSIFRNYFLSSLTTTCDDFSSLGSAWVKLAFGM
                     ILLYVPNSTFDPATLEHATYEGYLELQNVVTGIHQSFEHFRRVAFGDSEIQCERFLPQ
                     VPDSKVPEKPQVYRFTNSSTEELSNEWTSFFDAYLDKNYVDMLVQAAEDLSASSISKV
                     NNFEINSSQFIMRLKDGYPLFSDLNDILVGYIYGLKFGFELLQKGASQKSFVLRSPLW
                     ITDPVALGTASIVNLSFEDSKSVCKNCSVNKSDADKTYFAYLRIANFHNDVAEQADSN
                     SFFNQSLLGLYYRWSMRNLKQEEKDSTQQGIYKFSDPTIDVEGDFESLFPEAGDLLDA
                     SVSRDSKQSDTWEDLYSQIASVYIDIFRGKKSSATEIFDGILALSPENLASFEAMTHA
                     TRSGGNSASALLLSTLSIYDELTKSFSQDGNDSGVDFYHGYSPFEIKFANGIVKTLQG
                     SVRGLLKKWPENATLQELFRISTEFLAYPVNTPVYRLLGKVEQIYTYVAQWEEYAHSG
                     VSLGDHASKLSALVVRWRKLELSSWKKVLENEEDRVVQLTGKWWFHLFETILLPAIKD
                     ELYEEERVQIVGAVNIFLSQSTYGDFGYRMDLLNAFAVHIRLMAEDSLISDSLFNVIA
                     FYRQFEGLSFENIKSVRTQLEKDVKDVILLASWKDINIDALKQSSQKSHRALYKIMRK
                     YRGVLVQPIRPLIEQGINLTSEKDNSAQLSSLASLSPVAIDADVMKLITPICAKLSSW
                     NERQARLRDISVVSKNMEIYIKNLNMESYPTLHDFADSIIEHASLLRKQTPEELTDDN
                     KTLCNSLKSAKRRLLSDTLRELKRIGLKLHLTTEITSALSSVTGILATCKSLPKKSFG
                     DDVDKYFFRMLDLLPRLRSAVRDSNPEFPPIAAHKCLAAAETLLSTLVVERDPIFEVV
                     KLSKYVDCWIEEISQITFSSDHRPISSSKSEFCQQASGAAESLLNGLPLVFEYAKKSI
                     SIAGSRTHETYDEKVFDDALMGLNHYDTIKKHLIYSVDNLNDLEQLGNFIESLRLNLM
                     KWKNSNENVAFIANYVLEWLAEQPFMKLTLARISDFKTTTLDEVEKSLRALCLSIMLC
                     IQEMSKIHSEKSTISSEEDKWLQHSQKRLVKYFKLLHSSLIIKQLRQFIIKLSSVEYS
                     DETSTIASALVEQALPLVYHYKNLISVIECKLTSNYVDLSTSVYDLSSLLFNLARDGF
                     CSPQKPSKAPAESGEMKDGTGLGDGEGANNKSNDVEDDEDLSEQAQQDNAEENKDDDG
                     MDEDNDDAVSIEGDMAGNLEELSEKEDEENDEKSGEEEDDEEDLDDEVDDIDDTDPGA
                     IDDKMWDENAADDSKEKESEKMPEDSKPESDEMQEMDEKNDDGREKNDNNEPQEKNET
                     ENDSEAEDEEDVGEQEDEVKQADDDDKLDDNVPEGDALNLPEDIDLDSSGESESESGE
                     EEEGEKWKDDLDEMTDDKEEDNAEEGEDQEQEDENNEGKDQEDNEADSEEKEEEGAES
                     EDVALSDNGVNDENGEESERDDVLMDVDEEKDSEEGKEESKENLEGVEGDQAGQEADD
                     DIDEDAAAQQQSGVQTEGAQAGIDQEEDNVGGDGGSANIGDQEKKDAEEKDEEKEEEN
                     DQHADSSREKASKSLKQLGDAMKEFHRRHQEIKETTDDDMVDQKAGENPDEFQHLESE
                     SAENETQALGSTSKDQLQTIDEDMAIDDEKEDEELEKETNETDEENDEDSGDTQGVHK
                     DTTAAENGIVSEEEDENALPKDNGTVVGERKKQEIDIDEDDESENLSDAMLQSTDVEA
                     SKSLRPYEEAQKLWMHADEATRDLTSGLLEQLRLILEPTLATKLRGDYKTGKRLNMKR
                     IIPYIASQFRKDKIWMRRTKPSKRQYQIMIAVDDSKSMAESNAVDIAFQSISLVSKAL
                     TQLESGQLAISKFGADSLLVHPFEKPFNTASGIQVFRHFEFDETRTDVKNLVAKSLSV
                     FNEARATGDSDLWQLQIILSDGVCEDHSTLQRLVRKAREEKIMIVFVIIDCINNQESI
                     LDMSQVTYEPDSNGQMQLQMNKYLDTFPFEYYVVVHNIKELPEMLALILRQYFSEILS
                     A"
     gene            complement(<431320..>432786)
                     /locus_tag="FOA43_000209"
                     /db_xref="GeneID:62193610"
     mRNA            complement(<431320..>432786)
                     /locus_tag="FOA43_000209"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920543.1"
                     /db_xref="GeneID:62193610"
     CDS             complement(431320..432786)
                     /locus_tag="FOA43_000209"
                     /note="BUSCO:EOG09342682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776471.1"
                     /db_xref="GeneID:62193610"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002307"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR036986"
                     /db_xref="PFAM:PF00579"
                     /translation="MKLLNDHGVNVSESDFKSDLKEALLAHLHRRKLIETCVNEEQLE
                     KAIQTRKLGLYCGADPTAKSLHLGNLLPLMILLHFNIRGHNIFPLVGGATGAVGDPSG
                     RNTERNAMSDNARLDHVKRIADQFLNFFSTALKYSQSRNPLIEYAETGSRQLKDNYEW
                     WKDMGMLEFLAMFGRYFRVNQMLARDSIKSRLLSEQGIGFNEFTYQILQAYDFYYLNK
                     NFGVDIQVGGRDQYGNIVAGIDLITRLGRHEENKDQGLELDLEQESKSNLESQPSCYG
                     LTVPLLTTASGVKFGKSAGNAIFIDRELTPSYEIYQFMYRTEDEDVQRFLYKFSMLPI
                     PVIDRIVQAHDTDRKQRFGQRVLAMEMCDLIHGDGEGYDNELISKTLYSKELNIKFDT
                     DELLRALKRQNMVTTLTRKQLAKTNATHLLFTLSKGAHSKSDFRRKIKSRAIIIGRNK
                     KEKINAVDEIIKRNRLIDDKLLLLRAGKEYYIAEVVED"
     gene            complement(<433009..>434486)
                     /locus_tag="FOA43_000210"
                     /db_xref="GeneID:62193611"
     mRNA            complement(join(<433009..434365,434482..>434486))
                     /locus_tag="FOA43_000210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920544.1"
                     /db_xref="GeneID:62193611"
     CDS             complement(join(433009..434365,434482..434486))
                     /locus_tag="FOA43_000210"
                     /note="BUSCO:EOG09342BLF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776472.1"
                     /db_xref="GeneID:62193611"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="InterPro:IPR035587"
                     /db_xref="PFAM:PF01207"
                     /translation="MFLTLRKICTPSIMTVTEKRTTLLPQPKEEELIERKSDIIFTTP
                     PVPKASGFQLFEKLGSPTKIVAPMVDGSELAWRILSRRYGAELCYSPMLHSRLFSENE
                     KFRKTILSPLDGKPGLDRPLIIQFCGNDPDTLLSAAKHVVGRCDAVDINFGCPQGIAK
                     RGHYGSFLMEDWDLVYKLIHKLHTELEIPVTAKIRVFEDWSKSLDYAKMCLSAGAQFL
                     TVHGRTRDMKGQKTGIADWNLIRYIRDNLPEGTIFFTNGNILYQDDVPRCLKETKCNG
                     VMSAEGNLTNPGIFWTQNENKDKLFPRVDKFVREYFEVVKQCGEGESKRCFKTHLFKS
                     LQTFLTMHTDVRAEIATINRKSSWDELERIVKMIEKVVEDIFKKDNIEELDTIKVENL
                     ESWGGRYRDVPYWRLQPHFRRINGVDGRSVIRQIVKQKDSKRKADEPADEEDSQNKVR
                     RSE"
     gene            complement(<434585..>438286)
                     /locus_tag="FOA43_000211"
                     /db_xref="GeneID:62193612"
     mRNA            complement(<434585..>438286)
                     /locus_tag="FOA43_000211"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920545.1"
                     /db_xref="GeneID:62193612"
     CDS             complement(434585..438286)
                     /locus_tag="FOA43_000211"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776473.1"
                     /db_xref="GeneID:62193612"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PFAM:PF00096"
                     /translation="MTSTAAPSTGINATSGLDPSPGSSPRPELSKKSSPDSSPSTTPS
                     SASPGYSLSQKKSSDVEKQEKARPFICPTCTRAFARLEHLTRHERSHTNEKPFQCAAC
                     GRCFARRDLVLRHQQKLHASLPTNNRANAPKRVRGPRVTPKDGEIVSDYLNDNINIVK
                     NNTSKQLPLPKKSKRRGVYLLDKKLDTTEPSDTDYNTPSMPKCKQVEISDSGAGSGSG
                     FKKRKKVLPVSPSQQQINSPAAGSIGSICSIGSRGSSGHDSLSSIQESAPSTFLNLPE
                     NIVHQVQNIPSELSHPSQESLQGLIDNNYDSLLMMDNSNLESHFRDQRHASFSAAASG
                     SYTGFPEHHARGAPLDALDTIEQEAPPQVKFSSPQMKHEADGHFGYLNFAELEQLENP
                     NFQGMDDINLDLSPSNLDTNTLLQGLAHENVHDIADHSLPDVSSEHMHLHPEHEYHSL
                     FSHKVTASVSLAHSVVTVPKQMKHNFESSAESSTASSAPGFRTVSTQTPITDSPFSPS
                     QQKAIDATIVEQLQKITSTSTTSDPTSTGEVTKKGPEDWLSEFINAPIEKDFPSVSDH
                     IGFGDSPWTNNTSNNDNSPSANNNDKNLSRYFRSRQLDLSKHISVTEPLQNSVIPRLC
                     SDKIRTYIVNTYHLKESQFPHLEDMNHYLSLYDSEFNKYFPFVHIPSMNVEGHLEEIP
                     LMLSMAAIGALYSFHARNSSTLFNFSRFLIHNFMETRLHLHEFNHVPLHITQALLLHL
                     FLGMFHNDLEVTKLTGRQLTSLVSLAKATRLDMPIESFFLPPALSADISTLNDGSDNS
                     HHQLKTCYDYFILAQSRIRTIHVLHYLSVLFGMFTGSKVELVAEDIRCGTFCVVEDLW
                     KAKTCNEWLNLIKNHDLIVDSKFSLIRLSDGTNSFRDLWHDLTNLTLDRDIGQRSLLS
                     LLMSLNSFIHDERLKIENSSYSEGAKIAKWRMDERPYIESLIKSWETSFVRNGGLLVP
                     KGQNLHVINRSSALKLILPLLSLAKIRKCVYISPVLSAVWTRDWDAMNIEIKKLTRDP
                     EALRDAVTYCLDIVNLWIEIISITKDAEKTSIRTPIFFLTCLFTSTLLISEYLYTSEV
                     WANRYMENEESHQYLATADRVLWLRAERVFKKVENSLLPSSANNTSYSEFLRIQAKGA
                     LDVDSLDDKIAMLALDPENVQHIAAIIISGRLSARCLSLGVRILADAPVWPIALVFAE
                     ALKARATAIHQHLSTFTPISSSSTGSIKS"
     gene            <439167..>441311
                     /locus_tag="FOA43_000212"
                     /db_xref="GeneID:62193613"
     mRNA            <439167..>441311
                     /locus_tag="FOA43_000212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920546.1"
                     /db_xref="GeneID:62193613"
     CDS             439167..441311
                     /locus_tag="FOA43_000212"
                     /note="BUSCO:EOG093406SH;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776474.1"
                     /db_xref="GeneID:62193613"
                     /db_xref="InterPro:IPR013943"
                     /db_xref="PFAM:PF08634"
                     /translation="MFGARRFSVCCRRLRAVEPTQNSLNSEQLENVIETIATKKGSHS
                     EQNSDLNRHLHHSTKGSKTRSGNSATRPFGKTLFRRRISNFDGMAQYISLANFNDSID
                     KVPNVYPELKNVIFSPGVHYMQDPRTKRINFSPSLLDIPHVDDFKFDKVNPFISPSHD
                     SKLLEVANAHNCSNTDADDSIRYYSSTSSLTGILRQFHLLLSNNRPLDTSFLSKSFPS
                     VTTMSPSSRFPVCSVVTPKQVGSESIFSIDSDRSADTELILSCLGNVIELMLTTDKDT
                     FSKYLKGSPDDPEASGRDSGSAYHYAKFGKFLMRSQLDAKDKELPGTGVFDLKTRAVC
                     AIRYDISHTDFFPTNYEINRTEGLYESFEREIFEMAKIVMFKYGLQARIGNMDGILVA
                     YHNVKNILGFQYFPLSVIDDIFFGHTDASDIEIYKTNRSKGKPDEEKVEKKLKGIVND
                     IGLHWQNKREALSSLMAKHEFKVSLTILQDLLDILTAKSKGKPFRMIVKYCNGDTASE
                     TSGDIEVIANIIDEKDIDRLTLLGDQKLQQDKEELSESQKNASNELLPSDRIKKMSRN
                     GNFQRKRFERLNGQILDKSYPNGTFMFQITCKHFFDGTLCQQKYPTPSLKILDKNDDF
                     EWEIQYKIDEISDKKFIKERYFKNVSRIAMHSFASASSNTAPTTVPTGLEEHYLDTNA
                     SFYQNVLRAYSDKAVKRSKLFKRSPFSKGRNA"
     gene            complement(<441417..>443657)
                     /locus_tag="FOA43_000213"
                     /db_xref="GeneID:62193614"
     mRNA            complement(<441417..>443657)
                     /locus_tag="FOA43_000213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920547.1"
                     /db_xref="GeneID:62193614"
     CDS             complement(441417..443657)
                     /locus_tag="FOA43_000213"
                     /note="BUSCO:EOG09341BS4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776475.1"
                     /db_xref="GeneID:62193614"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR035550"
                     /db_xref="InterPro:IPR036028"
                     /db_xref="InterPro:IPR036871"
                     /db_xref="PFAM:PF00018"
                     /db_xref="PFAM:PF00787"
                     /translation="MSSFFRRVSRDKDYKVSKSDLTNIRMGTPGTIGSTGTPGTTGSG
                     ISLLNAPTEVVQAVRAYIAQLPGELSFNKGDFFHVLSRPDETIIEVHDPVRNIRGNAP
                     VSAFKFFEKPHRAAGGRTDSVGTIGTTGTTGTTGTTGTTNTSGTTGTTNTSGTAGTNG
                     TNTSYGDPHTSQNSSTGSHSHQRGPMSFGQSELQPVPLPSARRGSSGSSLKHPAPLPS
                     LYGVVRYNFHAERPDELEVIAGDSVILCAHHEYEWFIGKFLNKIGEPGLIPVSYVQLY
                     DVNTKVPYTDVARNIIDNVQLPTVDEWKAIKNRHKASVRPVGPAATYDSATAAIAARQ
                     KPSQITPGVSFDSRRNQGSFPLNYSVLPGTSARLGSAASKSSATAPSTSQTSLYAQEV
                     NLESFSSTNGKYWFLVRVVLSDDSTRCLCRYYEDFFNFHQRILTAWPQEGGKFDTKDH
                     KERIIPFIPGPMMDVSENLCHRRMMDLDIYLGTLKQLPDYISKSVLVNSFYGLWEGDQ
                     QLSFNDVTQNSPIRPSRPPPNLIILGNSNNSGNSNNNNDSNNNAPASNESPGRPQPYF
                     PKQRSPSKNSQSQRDRASEYEHSRQGSLASRLSGLALNHHNKRMSSASSSSSVILNNL
                     GKTKTHSRSPTKLSIKSVHTPNSVVGGMGDSMNKLKLKFYYKDDIFAIAVPENITLTS
                     LKRLIIPRIDECKDPQIEDKLKVIPKDVNNVDMFEYLDEDILRSDNQLRDSQSFMDKG
                     KFLVIV"
     gene            complement(<444004..>444426)
                     /locus_tag="FOA43_000214"
                     /db_xref="GeneID:62193615"
     mRNA            complement(<444004..>444426)
                     /locus_tag="FOA43_000214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920548.1"
                     /db_xref="GeneID:62193615"
     CDS             complement(444004..444426)
                     /locus_tag="FOA43_000214"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776476.1"
                     /db_xref="GeneID:62193615"
                     /translation="MAFSKLKIAATAVDETNTNSNSNSMMSALGKNSSETSNSNDACE
                     ESSDDGLSISKLILLSKLKTSRSKTTVSCLPENDELKTVSLMVLYDYIIVRGDETADD
                     PMRVLTCKDAQDIYRTSKLQGDEWPEIRWKLDQLLETI"
     gene            complement(<444438..>445169)
                     /locus_tag="FOA43_000215"
                     /db_xref="GeneID:62193616"
     mRNA            complement(<444438..>445169)
                     /locus_tag="FOA43_000215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920549.1"
                     /db_xref="GeneID:62193616"
     CDS             complement(444438..445169)
                     /locus_tag="FOA43_000215"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776477.1"
                     /db_xref="GeneID:62193616"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="PFAM:PF01380"
                     /translation="MSFSSISSVALSRDASDISFHINDDSSPLLDDAMLTVDLVLSTQ
                     AKAIAYLTNQYRKSQWSRSQMKKSLRILNNGLNAGGKIVLSGIGKSYKIAAKIVATLN
                     SLSVQSALLHPSEALHGDLGIIREERGDVVILVSASGNTTELINLLNYIPGNVPVILM
                     TSSRKSQLSENPRVSSLLYAELPKRLSEKLLYGLSAPTISTTLCLTLLDATSIALAEL
                     YMNDLELRRSDLAIATLEVQLAQIQ"
     gene            complement(<445581..>447365)
                     /locus_tag="FOA43_000216"
                     /db_xref="GeneID:62193617"
     mRNA            complement(<445581..>447365)
                     /locus_tag="FOA43_000216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920550.1"
                     /db_xref="GeneID:62193617"
     CDS             complement(445581..447365)
                     /locus_tag="FOA43_000216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776478.1"
                     /db_xref="GeneID:62193617"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="InterPro:IPR039261"
                     /db_xref="PFAM:PF00175"
                     /db_xref="PFAM:PF00258"
                     /db_xref="PFAM:PF00667"
                     /translation="MARVLVYYSTQTDTSKLLGQDFGAVLNNTFGEGICKVTNIRDLE
                     GLDVLGEFELVCFFISSYGDGEQCDEGMEFYQTLMSADDGYFDKSLTHFTLFGLGSSL
                     YDLYQGAAKDFYGQLLEKKLDSLGQFGMGDDGLATLTDDYEGWKFDILPQISEYLRIP
                     YQVSEKYKGRYRVLELVEENQLHTHFSTANKPPYHSDKPYVAHIHGLKRLSAVNKDSK
                     TVIHATIDLDSSDSGLHYTTGDHIGIFPSNSDENVDDFLKIFGLYEKKDQHISIIPVD
                     RMSTKCFVPSHTTYRQICKNFLEINACLSRKILRQISELFISSEQTKQQLLELSKDRK
                     TFMDRVVSKHKTLASLLVKFDTDCSMIPFSFLLESLGPLKPRYYSISSSSVKQPQAAD
                     ITVSTVQSEGDNFEGVFSKNLMNMLDDKDQTFSVPIFLEQTKFRLPFDTTTPIIMICA
                     GVGVAPFRAFIQERTKSTPTKKRQTTNLYLYYGLRNISRDLLYRDEWESYSNDELVVK
                     FAESRPSKGLRKLYVQDLLQKDAGLITDLVCEQKASIYVCGDAKKMNRGVSKTLLEII
                     KEKKGGIKQADKFLKYQKILGKYQEDVW"
     gene            complement(<447442..>448548)
                     /locus_tag="FOA43_000217"
                     /db_xref="GeneID:62193618"
     mRNA            complement(<447442..>448548)
                     /locus_tag="FOA43_000217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920551.1"
                     /db_xref="GeneID:62193618"
     CDS             complement(447442..448548)
                     /locus_tag="FOA43_000217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776479.1"
                     /db_xref="GeneID:62193618"
                     /translation="MQSPVSGQLSPIFDDQFSRDQLLRAVQSQKFWKYHVMRLNPLEF
                     YITTNPDNRHKFMRRGPSYYIQVQLPDASDTKGKGKPVSHTAKGFRMVFSQQQWNSTA
                     ASPSFSVEKLPESQGGTYIAKGFFNEHEDGDKEIRNIEGKEQLQALNWQFDRISAPIE
                     YYGDEVTVENGYKIGSDLKVCTLKQKKKNYFFKNKIDGVKLAKEGATYFIDEKQLRKD
                     CWFNPVVAVYRPCKREMTSKIVKKVVTSSSKLSNLTSNSSVKLRRNAGSASPRSESDT
                     DDGDDDFRMEYTTYNDENTRVKYYMCKDGIKDRHPEDDSPNDYKLGWITIYDKEGYFK
                     QDTQRGSNWEVVLGMTFAYGVQSSLDRILRESSI"
     gene            complement(<448708..>449610)
                     /locus_tag="FOA43_000218"
                     /db_xref="GeneID:62193619"
     mRNA            complement(<448708..>449610)
                     /locus_tag="FOA43_000218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920552.1"
                     /db_xref="GeneID:62193619"
     CDS             complement(448708..449610)
                     /locus_tag="FOA43_000218"
                     /note="BUSCO:EOG09343AFI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776480.1"
                     /db_xref="GeneID:62193619"
                     /db_xref="InterPro:IPR019446"
                     /db_xref="PFAM:PF10354"
                     /translation="MAKKGRLARRQRRKQQKQEESIKKRRKLDHKGYVGGGQDTSLSS
                     KGPKGLSIPFDEKEKIILIGEGDFSYAVSIVEEGYIKPENLIATSFDTLEELKQKYPE
                     VAEANLKKLNELMVKKVVHGVDGTKLIKTLKLSWNPKKLDRNRNAMNGLKINLVLFNF
                     PHVGRGIKDMDRNIKANQEMLVSFFTNCKELFELLAQNRSQGGEKGNNEDLDKIAVTL
                     FDGEPYNSWQIKQLIRNTIGYKVRRSGTFDWKAYKEYHHRKTAGMHDTTKVAKERAAR
                     TYLFEPKRGGKRKRVEMESESESE"
     gene            complement(<449734..>451335)
                     /locus_tag="FOA43_000219"
                     /db_xref="GeneID:62193620"
     mRNA            complement(<449734..>451335)
                     /locus_tag="FOA43_000219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920553.1"
                     /db_xref="GeneID:62193620"
     CDS             complement(449734..451335)
                     /locus_tag="FOA43_000219"
                     /note="BUSCO:EOG09341FIZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776481.1"
                     /db_xref="GeneID:62193620"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="PFAM:PF10607"
                     /translation="MSITETLCSADFYLDLKGSQFKIPIELAKKNFKNLQKLIEKHRI
                     STEKYLKLLKDESLGKREKLRIVKKLIQLQEVFNKKLAFRVKQHNEFIDRLVCRLDRL
                     KQLEEMENRAKLAKKEKNESIDDSVISGKLTDFYKDEINLLIIDFLLRTSKSQNPLQS
                     LDSNAGYQLAKNMKLSQLIDYDVILQGLSIYNEIKFNHNLKLLVAWCTENKKALTQIR
                     HENNPQTTTNLEFETYFQKFLEKVKENDLYGALQIANKNLVNYADSVDGESSEESDNF
                     DKISMGAALLWYNFIKKDTKQMIFDNEDRDKQSVDYYDYGCQMVNQIKKNMLSYEELL
                     DDVKWSQLANYFLYNFNLLYGIDQRMPLLNMLSIGGAALKTRSCHNVYREGSEVSFGD
                     IIKIGDQEPEVQQSFSSNQCPVCSADLSRLMTILPYSHQVKSNIYENPVLLPTGNIYP
                     RNKLLLLNRNTLLKKMGDDEEEEEEEEEEEEEESGEKYEREQGNLLSNDTTNNRWNKL
                     KNLRLSDPATGDSFFGDELVKVFPT"
     gene            complement(<451567..>452703)
                     /gene="IDH1"
                     /locus_tag="FOA43_000220"
                     /db_xref="GeneID:62193621"
     mRNA            complement(<451567..>452703)
                     /gene="IDH1"
                     /locus_tag="FOA43_000220"
                     /product="isocitrate dehydrogenase (NAD(+)) idh1"
                     /transcript_id="XM_038920554.1"
                     /db_xref="GeneID:62193621"
     CDS             complement(451567..452703)
                     /gene="IDH1"
                     /locus_tag="FOA43_000220"
                     /codon_start=1
                     /product="isocitrate dehydrogenase (NAD(+)) idh1"
                     /protein_id="XP_038776482.1"
                     /db_xref="GeneID:62193621"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="PFAM:PF00180"
                     /translation="MFSQISRRAFVPFVQTSSQLSRRAMATTIREPSLTKKYGGVFTV
                     TLIPGDGIGKEITDSVKTIFKAENVPVAFETIEMSGLSAKDSTNTQQQIDEAVRSLKR
                     NKVGLKGITYTPTDQFHKSLNVALRKELDIYASLVLIKNIPGVPSKMHDVDFVLVREN
                     TEGEYSGLEHQSVPGVVESLKIMTQYKTERIARFAFDFAKRNNRKMVTAIHKANIMKL
                     GDGLFRRIVKEVGAAEYPDIKVNDLIVDNASMQAVSRPQQFDVMVTPNMYGAILSNIG
                     AALIGGPGLVPGANFGRDYAVFEPGCRHVGLDIKGKNEANPTAMILSATMMLRHLGLA
                     KEADRISKATHSVLSRGKTTTRDIGGSASTTEFTKAIIDKLSTM"
     gene            <453420..>456997
                     /locus_tag="FOA43_000221"
                     /db_xref="GeneID:62193622"
     mRNA            join(<453420..453426,453879..454049,455580..>456997)
                     /locus_tag="FOA43_000221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920555.1"
                     /db_xref="GeneID:62193622"
     CDS             join(453420..453426,453879..454049,455580..456997)
                     /locus_tag="FOA43_000221"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776483.1"
                     /db_xref="GeneID:62193622"
                     /translation="MNSVASDDGSGEVNGEGEGEDELDEDDAPGESNDGSFKELIADP
                     DNDAADDVDECEYRCLIQGSTEVWIFLGTSMVIYGVFLLSGGNEHISGIHTGTGTRSH
                     AGTASPLLGSTTSIYGSIGGSSAAPSTINIDQDMEDPEFTSIQQLTTPHETPSMYGDG
                     QSTVTSNGLAQNLTPSASLPVSSAPRSLSNANEFFTPLIKSTTENLHSAGRKVSGFFK
                     KSMDTFHTPGNTRISDEASLSRASSCSHRKSITCGSGSFRQTSPTNQGEVTKEMPEYV
                     SFGSIRDSSSFVNNHDGIADADIGHNEGDIGDPAVDTSISSGLNLLMSIRGRDKSSSQ
                     SPHKVVKHANSSQSLQADVYRSYSMFSQFGKAAADKLSPLKLISPSKQRNGLHIKTKT
                     SSNNAVDTSANANEDYNSNNMFNYSLSNTIDEIQNQMNTIDSKTLQISKGDLTPLIHS
                     SEGSALTSQLQPSQQIPSSLSTNNASEPSPINTRYQSLKRDERNILHKNRKVGRNFTT
                     GMLRGHSRALSFEQSELLSELKK"
     gene            complement(<457034..>457759)
                     /locus_tag="FOA43_000222"
                     /db_xref="GeneID:62193623"
     mRNA            complement(<457034..>457759)
                     /locus_tag="FOA43_000222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920556.1"
                     /db_xref="GeneID:62193623"
     CDS             complement(457034..457759)
                     /locus_tag="FOA43_000222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776484.1"
                     /db_xref="GeneID:62193623"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="PFAM:PF00300"
                     /translation="MTVTARTPRLIIVRHGQTEWSKSGQYTSYTDLPLTDYGVHQMRA
                     TGRMLVGYGVTNLVKPAELKVIISSPRKRALQTRDLLLEALPVSQKMGIRMEVDEDVR
                     EWEYGNYEGMLTEDIKAERKKKGLKGQDDWTIWEFGCENGETADNVTERVDRLIAKIR
                     RYHKKALDNNEFCDIMVIGHGHILRCLAARWVGKSINTNPQFMLDAGGVGVLSYQHHN
                     IDEPAIYLTGAFLVPVEEEGESL"
     gene            complement(458073..458144)
                     /locus_tag="FOA43_000223"
                     /db_xref="GeneID:62193624"
     tRNA            complement(458073..458144)
                     /locus_tag="FOA43_000223"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:62193624"
     gene            complement(<458393..>458947)
                     /locus_tag="FOA43_000224"
                     /db_xref="GeneID:62193625"
     mRNA            complement(<458393..>458947)
                     /locus_tag="FOA43_000224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920557.1"
                     /db_xref="GeneID:62193625"
     CDS             complement(458393..458947)
                     /locus_tag="FOA43_000224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776485.1"
                     /db_xref="GeneID:62193625"
                     /db_xref="InterPro:IPR019371"
                     /db_xref="PFAM:PF10241"
                     /translation="MPSEFARQSNPSIDGFQFMVQSDTESSIDTSAGTSYTSNDEDEN
                     PNPLEERAHHSDNEAGGMIPSASRFNAVDYLINSLYNSLDSVELDQSLVQQSQISGEM
                     NNTANEISKTIKELKQSLQEHIEKYEKLKKRIIPEIIANLNQSSKISKKLAVKMKTQY
                     PVEYSKSKDKVLNRLTDEEQDLYI"
     gene            <459184..>462024
                     /locus_tag="FOA43_000225"
                     /db_xref="GeneID:62193626"
     mRNA            <459184..>462024
                     /locus_tag="FOA43_000225"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920558.1"
                     /db_xref="GeneID:62193626"
     CDS             459184..462024
                     /locus_tag="FOA43_000225"
                     /note="BUSCO:EOG09340GI7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776486.1"
                     /db_xref="GeneID:62193626"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017105"
                     /db_xref="PFAM:PF01602"
                     /db_xref="PFAM:PF12717"
                     /translation="MSTSQMIARLRPFGINFDKSLEDLIKGIRANGNNPEKLAAFLDS
                     SIQECKNELKTSDIEQKSMAILKLTYLEMYGFDMSWCSFYILEVLSSSKFQHKRIGYL
                     AAIQIMQRQNNDDALMLMTNQLKKDLNSSHSVECGLAIGCIASIVTTELAHDICDDLA
                     KMLNHSKPLIRKRAVLAMYKVSLKYPEALRMYFDQLVDKLDDTDNSVVSATVNVICEL
                     AHANPKNYIELTPKLYGLMKDTNNNWMCIRLLKLFSSLSLVEPRLKHKLLPEIVDLMC
                     TTDALSLVYECINAILNGNMLGEEDVKVAELIVNKLLGFFKSDDQNLKYVCLLAFIKT
                     CRIHKELIKKHDKILLSCLYDVDLTIRETSLEIVNYLVSEKNIITIVTRLLLQLIPYS
                     EQQKRLKDINNISEEDRENLFLTEIQQPVVVSNTYKFRVIEKILEVCCLDNYNNIPNF
                     HWYMGVLRDIIKLNTENEISKVDEIVTEQFIDMSIRVPSIRPYLIETCLELCIFPVKT
                     DEELLMFRQGLSRCIWIIGEYYEDYWTFSDSGKEEEENEEDDDSQKLTIPFIISEISK
                     QDILMRLAEDESNTTVAKYTETVAKLFSKYCNILGIYWSRTDFESASQLCENVIEWLE
                     KFRTCTNFEAQERAVSFIEMLKLALDAISTDMEKMGDSTSAETPKFLTEGYNQMFEIA
                     QIKPISKTMQQRILVPSDLDLSSAVDEEAMSQFAYLLEKIQQEDAQLEDIIEEEEESD
                     EEGGIVTDESYRDESLGSDASVNDEKEAIEEDHRRKEREERMKDDPYYITEGKELTIG
                     PDQPAKIDVRTAKKNTKPRKIRREKVLVLEEEDSGINDARINIAVPETAGSKKRPKQS
                     KFMVDSSNLEKVDLHAEPESTPESVGFESYEIEQEVEELRKEFEKTSSHTSVVAPSAP
                     TAAGKNDKVTVTRKKPKKRKVKRTVPVIRDDS"
     gene            complement(<462076..>462963)
                     /locus_tag="FOA43_000226"
                     /db_xref="GeneID:62193627"
     mRNA            complement(<462076..>462963)
                     /locus_tag="FOA43_000226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920559.1"
                     /db_xref="GeneID:62193627"
     CDS             complement(462076..462963)
                     /locus_tag="FOA43_000226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776487.1"
                     /db_xref="GeneID:62193627"
                     /translation="MDLTKLYDHESPPKTETASPVSAAVPEVKTKRTSKEYKFLFYFL
                     LQKFENADWKSKKLKDDQDHCEKLVKFLQLRNFMLVDLLKYIDQNEELSPLSPLSRRR
                     EAEILKRIVNSRQELASVLKPLMELPDNESLKDPAVLKKSVESLHLRDELNHELYMLE
                     SNSMPDMYLDSDYNDLFDRVKRNRFYVHDTLRYADPKRKMTDLDDLETEVEPQRRKRR
                     SALKKEKETISEDLATAAGTSGVTSLHSQSPEAAHSVVLKFTNKQKLNDVMESSMLNE
                     ESLQEKEEDKPLQSQQISP"
     gene            <463224..>465299
                     /locus_tag="FOA43_000227"
                     /db_xref="GeneID:62193628"
     mRNA            <463224..>465299
                     /locus_tag="FOA43_000227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920560.1"
                     /db_xref="GeneID:62193628"
     CDS             463224..465299
                     /locus_tag="FOA43_000227"
                     /note="BUSCO:EOG09341BFH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776488.1"
                     /db_xref="GeneID:62193628"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF08159"
                     /translation="MLKSTNANGVSVYQVSGTNISRSLPDWMARKRKRALKYDVDYQN
                     RVELIQDFEFSEASNKIKVTKDGQYAMATGTYKPQIHVYEFSNLAIKFSRHTDAENVD
                     FAILSDDWTKSIHLQNDRSLEFQVNGGRYYKTRIPKFGRCLRYNDVSCDLYVGASGNE
                     IYRLNLEQGRFMRPFEVENDTGVNSIDINSVHGLIGAGLEDGTVEFWDPRAKQRVIKV
                     VINDGSGSQGEVSCVKFRNDGLNFACGTSNGMTMLYDMRTSLPLLTKDQGYGFDIKKI
                     IWLDNTGTEDNNNLIMTSDKKIAKVWNCHSGKPFAAMEPSVNINDVEYVPKSGMFFMA
                     TESISMHTYYIPELGPSPKWCSFLDNITEELEEKPSNTVYSNYRFITKQDVKKLSIEH
                     LVGTKVLKAYMHGYFINTELYDKVNLIANPTAMEYERENEIKKRIEQARESRTRTAGA
                     VTNTKVKVNKDFVGHLEKKFGSDVAENVVNDDRFKEIFEDPAFQIDTDNFDYQQINSS
                     SNKNGTGEVKPLTAAEESDEERLEEEEEEEQEAKESDSESESEKEEEEEIETKNIAKE
                     ARAEKIRQRLIKRKKQKKHEEGEKRKFLATLKTVDVNENGKSGQSKTVSFGKQVELQR
                     KKNQKVKESQEKVRIHKAPSGAAEITFSSHRKKHGGHNEEDKQELHGKKKQVYEGRRK
                     ASKNTFRGM"
     gene            complement(<465351..>466217)
                     /locus_tag="FOA43_000228"
                     /db_xref="GeneID:62193629"
     mRNA            complement(<465351..>466217)
                     /locus_tag="FOA43_000228"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920561.1"
                     /db_xref="GeneID:62193629"
     CDS             complement(465351..466217)
                     /locus_tag="FOA43_000228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776489.1"
                     /db_xref="GeneID:62193629"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR019496"
                     /db_xref="InterPro:IPR036855"
                     /db_xref="PFAM:PF00642"
                     /db_xref="PFAM:PF10453"
                     /db_xref="PFAM:PF18044"
                     /db_xref="PFAM:PF18345"
                     /translation="MDDYDYSPPESFGNHYGADDKSGKKRKLYFSSDAKTDDDDQYTP
                     PHGSYHSTSIELFPGLSIDLGDKTERNEDEIPEEESILSKQSSVQQAIAETANLDEDV
                     DLTEKNVSIQGTNIILESDEDIQKWVQERRKNWPTSRRIKEKQKQRTEEMRILAASSA
                     DSADSANSLQYSSGASSNRRICRYWQSTGRCRNGSKCKFLHEVRCNNGVRHLPNHKIK
                     IIHGVPVQIPQRFSPMVNKGKSLTSLLMESDHLKDENLKLLDVFENIVKSGLIKTDWD
                     SLKRKLQLDKKC"
     gene            <466424..>467332
                     /gene="ADE1_1"
                     /locus_tag="FOA43_000229"
                     /db_xref="GeneID:62193630"
     mRNA            <466424..>467332
                     /gene="ADE1_1"
                     /locus_tag="FOA43_000229"
                     /product="Bifunctional purine biosynthetic protein ade1"
                     /transcript_id="XM_038920562.1"
                     /db_xref="GeneID:62193630"
     CDS             466424..467332
                     /gene="ADE1_1"
                     /locus_tag="FOA43_000229"
                     /note="BUSCO:EOG09343C2M"
                     /codon_start=1
                     /product="Bifunctional purine biosynthetic protein ade1"
                     /protein_id="XP_038776490.1"
                     /db_xref="GeneID:62193630"
                     /db_xref="InterPro:IPR001636"
                     /db_xref="InterPro:IPR018236"
                     /db_xref="InterPro:IPR028923"
                     /db_xref="PFAM:PF01259"
                     /translation="MPLASTELDSILPLVAKGKVRDIYQVNDDSLLFVATDRISAYDV
                     IMNNGIQDKGKILTQLSIFWFDFLKEEIENHLIASDDKEILAKLPKELSQPKYRDQLA
                     KRSLLVKKLDMIPLEVIVRGYITGSAWKEYKKSGTVHGLPAPKGLKESDPFPHPIFTP
                     STKADLGSHDENISPEKAARLIGGNLAEKVGQKAVQLYTKARDYAKTRGIILADTKFE
                     FAHGENGDIILADEVLTPDSSRFWSAKDYESGRSQKSYDKQFLRDWLTAKGLNGKQNV
                     TMPEDILKKTSEKYIEAYEDLTGNQW"
     gene            <467546..>468802
                     /locus_tag="FOA43_000230"
                     /db_xref="GeneID:62193631"
     mRNA            <467546..>468802
                     /locus_tag="FOA43_000230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920563.1"
                     /db_xref="GeneID:62193631"
     CDS             467546..468802
                     /locus_tag="FOA43_000230"
                     /note="BUSCO:EOG09341V19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776491.1"
                     /db_xref="GeneID:62193631"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF07714"
                     /translation="MAFRDQFQDLGIIGRGSFGCIRKVRRKADGKVFVRKEISYMSMN
                     YNEIRQLASEFRILRELHHTNIVEYLNHEDVEDQQMLYIYMEYCDGGDLSKLIKRYKD
                     NDEYVPENLIWQIFTQVLLALYRCHYGADIEPVQSVFTSSPEIGPSTVANFHVVIHRD
                     IKPDNVFLLSDGYTVKLGDFGLAKCLSSASDFAKTYVGTPYYMPPEVIMDRPYDPVCD
                     VWSLGCVMYELSSLRPPFQAKTHLKLQEKIKAGVFSSIPEHYSHRLKMCISACLITDP
                     RERATVNQLLQDSSFKIYRKEWELVEREMKLKEKEKEVVVLEKGLKKYEKELDEQCRV
                     MNLKNEEIRNGYKREFNYVLDIELNKILSELPTPIRQQLMMKTKENQAPQRRSTSPPT
                     LASNKLKGPRDLQDYTNRIMRQPSRR"
     gene            complement(<468916..>472752)
                     /locus_tag="FOA43_000231"
                     /db_xref="GeneID:62193632"
     mRNA            complement(<468916..>472752)
                     /locus_tag="FOA43_000231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920564.1"
                     /db_xref="GeneID:62193632"
     CDS             complement(468916..472752)
                     /locus_tag="FOA43_000231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776492.1"
                     /db_xref="GeneID:62193632"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="InterPro:IPR037239"
                     /db_xref="PFAM:PF00023"
                     /db_xref="PFAM:PF00169"
                     /db_xref="PFAM:PF01237"
                     /db_xref="PFAM:PF12796"
                     /db_xref="PFAM:PF13606"
                     /db_xref="PFAM:PF13637"
                     /db_xref="PFAM:PF15409"
                     /translation="MSASHLDPEAPVITNAKKVADSILATDTSIGAVTTDQSSATVGP
                     SLNASLVKLKLLDCIRNDDSEKLSLLLEDISDSKDKQLRRLRKELLHYAVQVGPLSII
                     RRIVDSKLVHSVNYQDKDGNTPLHLAVMSARNDVIDYLMSLSSINDTILNEELKQPIE
                     CTSSMEIVQLMSDLRTRYVEKEAARLRRGFQSRDFSLLESVLSVARARELLDINGTDP
                     VTGDTVLLEFIKKDDVDLVKFILKHGGDPFKRSVSGRLPVDCTTSSSMRRVIKTACND
                     QSVIDSNSDHPAVGPPTFKGFLKKWTNFAGGYKLRWFVLAADGTLSYYKSPNEMDNAC
                     RGMIHLAKAQVRMDSSEKCKFELIIANLTGGSVKWHLKANHQIESNRWVWNLQNAIKY
                     ARDEQKASRKVNQVAYRKQKNGKLTSVQEARKPQSSHHNAFSSTDDSTVAHGGLKRSS
                     SESRISALASNPITRSTTSIAYGEHRTQPAQPQEEPQSLHSRSLSRDSASSSTSSHNS
                     VASTVARGAKNLYKKPIHKFNKLAHRSRDQLPQSSIQSEDSYYLNSEDSTVGTTSRED
                     EEDDDDDDDDDDDGDDVYMEMILGKRRPDNSKLTIIRNQIRMELKSFSEFLDHFKTDS
                     NISNEDVVTVSSRILKNLSQLYEKEEDVIQEKEFRLEKLFDRQTEISNIWESSIRQLE
                     LEIQDRESKICDLEDTIRLVRRSLRASVIIPAVSSPDIVATEPSSLSQKEAVTTKRDR
                     SSISSYREDPQLAKFLEQEDESEDEFFDAAEEEEEEKESKHVEEEILGTPEKEEAKQL
                     GNIIAEKERRKSEEAAEKSTQEVSSQEATSDNEEEIEEIVRKVKPTSGPFQPILVDGR
                     FFVDNYPIESEAQKARYVKILDDATFKGYEDPIRTTLAREDNRPKISLWSVLKSLIGK
                     DMTKMTLPVAFNEPTSLLQRNIEIMEYSDLLDKAASIEFSPLRMVYVAGFAASEYAST
                     VGRIAKPFNPLLGETYEYARPDKGYRVFCEQVSHHPPISAVVSESPYWAYYGESNVKT
                     KFYGRSFDIRHLGTWFCELYPSTLPIDKRTGKQTAMELYSWKKVNNSVVGIIIGRPTI
                     DNYGEMEIKNHMTGDYMHLHFKERGWRSSNAYEVKGEVYSADKTLQYQIAGHWNTKIY
                     AKSATDPSLQKFVVFSAKKRQDMLFHLTNFAAGLNAPQPHLLPVVACTDTRLRPDQRA
                     MENAEYDLASEEKNRVEEKQRAHKKEMEEKNIVYKPSFFVKDKHPVTGEDYWRFTGTY
                     WKDRKDGKLKDYKDIF"
     gene            <473285..>474007
                     /locus_tag="FOA43_000232"
                     /db_xref="GeneID:62193633"
     mRNA            <473285..>474007
                     /locus_tag="FOA43_000232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920565.1"
                     /db_xref="GeneID:62193633"
     CDS             473285..474007
                     /locus_tag="FOA43_000232"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776493.1"
                     /db_xref="GeneID:62193633"
                     /translation="MPSSKNRAALIISKLNRRYKHCLDDLLNYYGKVATQENEIEKIR
                     VKEIDFEQITIGFHHKMVDFEILKPLRYEDDRVCKNWNEVESTIQKMCYTAANAKNVS
                     PICLKKIVYPFSPINWLLIFGMSLLFIGHYNPDFIYNRLLGRISLIPPFKPWNDTILL
                     GAMITHVTESLTLLRPKMAYYRIPVDYKMEWYACSMLDGFASVNRLNNYVKSIEGRYF
                     DFSDDSESIDVKPVVDSDSELQ"
     gene            complement(<474486..>475187)
                     /locus_tag="FOA43_000233"
                     /db_xref="GeneID:62193634"
     mRNA            complement(<474486..>475187)
                     /locus_tag="FOA43_000233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920566.1"
                     /db_xref="GeneID:62193634"
     CDS             complement(474486..475187)
                     /locus_tag="FOA43_000233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776494.1"
                     /db_xref="GeneID:62193634"
                     /db_xref="InterPro:IPR007482"
                     /db_xref="PFAM:PF04387"
                     /translation="MPQYAQYPRFNYTQLYLLTADIARCILYLSVHMRFLILLPLTGV
                     RFLPGGIADFYLVVRAICAVVDCFDYVTIFGKIPRESQVVHPQLGNLIFTLLEHLVVS
                     LAILCYPKIAKNNAFTTLVYSESLVEVIRYYYNFYKVRTFDRRHKTLRFCKKLSYTIL
                     VPVQVLAEMCLLLDSLQFQSYYEELAEYDFGIKVGIRILLLFYLPAFYTVYKGKLYDY
                     YILAWVTSKEHAKKI"
     gene            <475349..>476383
                     /locus_tag="FOA43_000234"
                     /db_xref="GeneID:62193635"
     mRNA            <475349..>476383
                     /locus_tag="FOA43_000234"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920567.1"
                     /db_xref="GeneID:62193635"
     CDS             475349..476383
                     /locus_tag="FOA43_000234"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776495.1"
                     /db_xref="GeneID:62193635"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="PFAM:PF00226"
                     /translation="MQLIRLVSLLLSIFCVIAHAAQYSAEDLEIFAVQSKLVEDSKRT
                     DYDFYKFLRLPDGASSDAKTIEKHYRNLSRKWHPDKYRDAKTKHRAEKRFQKLSLIIT
                     ILRDHEKKQRYDYYLKKGFPQYDKATGQFIFGKRFKPNLILTLSIIVIVASLLQYLVL
                     KVNHNRSYKRVDRLISEIRSKSLPAVGNQDTPDFGNKLVLLNDKLFVVKVDRSIWYYS
                     GSFDTEDDLNEVVANLRKAYKIDADPSAHANRRQRRAVTKRSKDDQEDQDSIPLLPVT
                     TDDLEPVRVSSLLIVKLLMLPSLLVHKFISTKKCLDKHPEISSKINLIQEKNDKVKLP
                     NGKVAYKKHK"
     gene            complement(<476543..>480154)
                     /locus_tag="FOA43_000235"
                     /db_xref="GeneID:62193636"
     mRNA            complement(<476543..>480154)
                     /locus_tag="FOA43_000235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920568.1"
                     /db_xref="GeneID:62193636"
     CDS             complement(476543..480154)
                     /locus_tag="FOA43_000235"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776496.1"
                     /db_xref="GeneID:62193636"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="PFAM:PF04499"
                     /translation="MSGIWPFFNSSFSNASINKILAEIDLDQQKREQEDQQRRQQQQQ
                     QQQQQQQQQQQQQQQQQQQQKSKQTSAKSRGVSKSGKIDINEGSADPSSNTSSGTSGS
                     FSPSTNLTKSTARVSMTSAQAQSASTDQPTQSTTHQMAYSPTSRQFNLTASQLLHHIK
                     ENDINLAQSLGQPQSSKQQQPQQPSLLSAEKPTNSNISVSSSLDSSIKPAAPTAPTTV
                     VAPSTLTAPHRAISVSLLNKLLDQPNLMDEINLAKNQRLINYISQIDVIDVMIDYILY
                     SLELAKLDRDPNEVELQSEIFAEDAESDNKASKDDSSSSDEKEGSVTGEEKQEEEESQ
                     EQLSAFEKALQRASVCSEIMILPNTNILPNLMASTPLMTKLWRGFFDKDVSYFYKNFK
                     LVTAEAMDAEEEREVESSHIPETAATQSSHQLLDEEKYERSRFKDNHALLLFNNFLKL
                     VDDMATMNINELMNFIRFEQQHCPLTDQFLKFIPYSPTTCDLLVRLVSTDKPYNPNGL
                     INILIDQNLVLELFKMTKIYYLDHQVQDNLCNLLNGIVGISSNVGFWDDPSLANGGQQ
                     LNEFGEPIDQDQANIMRASNPNVGPNDLTRQLVSKQCVMEMLDIIINYGNYGLVTVVS
                     VIIEVIRKNNSDYDEFDWIACVEEQEITETEAENEEPKEPEDSTDDIVVATPDEEDTG
                     APLKRASEIAEVSEDSKSKIKHLPNSRDPIYLGVMLKLFSLHLAEIVENYLTNKYFDL
                     RKVTKLNTANGDMIEPLGYERFKVMELIAELLHCSNMILMNKSLKLDYLIYKRDLWRD
                     VKHTESLVKDALNDNINERETKDDKIMDEELLRRVQKMSLSNPLSDGLPLEERYVEIP
                     SDLSIGNFFKFKLLQTNSIPLIALKMHHFPWNNFMHNVVFDLVQQVFNGRLANWDEDQ
                     ASNQEETKYDDNLSLNKVLIWSLFGDFDKFDGDYVDDPSFPGFFNLPQYILYCFKLSE
                     EKEAETKFKLGYMGHLTLIAEEVHKFQNYVENFGMARDDQTFSLLKEESDSSSVFYLK
                     SSFYVFNTLFERIFESGKFDEWNRFVSSTLKDLNSMYNKVLGNPNDIGTGDENGSNDD
                     DSGVLITDDSIPISASPVNENAIILDNGDSEEFHKGVEVIEGEAQNNGSGEEEGSDIS
                     HEEYEENYKAGADEDVEGANEDNLGGGDLRPIKGHHEAETYETNDSNEPNDGASEAN"
     gene            <480928..>481728
                     /gene="PRE10"
                     /locus_tag="FOA43_000236"
                     /db_xref="GeneID:62193637"
     mRNA            <480928..>481728
                     /gene="PRE10"
                     /locus_tag="FOA43_000236"
                     /product="Putative proteasome subunit alpha type-7"
                     /transcript_id="XM_038920569.1"
                     /db_xref="GeneID:62193637"
     CDS             480928..481728
                     /gene="PRE10"
                     /locus_tag="FOA43_000236"
                     /note="MEROPS:MER0000553;
                     BUSCO:EOG09343HNX"
                     /codon_start=1
                     /product="Putative proteasome subunit alpha type-7"
                     /protein_id="XP_038776497.1"
                     /db_xref="GeneID:62193637"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="PFAM:PF00227"
                     /db_xref="PFAM:PF10584"
                     /translation="MTSIGTGYDLANSIFSPDGRNFQVEYASKAVENSGTSVGICCKD
                     GVVLATEKVVNSKLLVPGKNKRIQSIDRHIGVVYSGLIPDGRHFVNRGREEARSFRSL
                     YKEPIGLKGLIDRLGYYVQAYTCYNSVRPFGINAIVGGVDSEGSHLYMVEPSGTYWGY
                     YGTATGKGRQTARAELEKLDLPNISAKDAVKEAARIIYMAHEDNKDKDFELEVSWVSQ
                     SETKGVHQLVPKELFDEAVKYAEEEQDSDDDDDDDEGSENSDQDEEME"
     gene            complement(<481804..>483618)
                     /locus_tag="FOA43_000237"
                     /db_xref="GeneID:62193638"
     mRNA            complement(<481804..>483618)
                     /locus_tag="FOA43_000237"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920570.1"
                     /db_xref="GeneID:62193638"
     CDS             complement(481804..483618)
                     /locus_tag="FOA43_000237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776498.1"
                     /db_xref="GeneID:62193638"
                     /translation="MSSRIQEMSFEKSTDLSLAPSKTSARGGSFNGGMIDEKGTQFEV
                     DNVSERDKESNEGDQDNTKAGESLVEQFLSFNISEDPILELRGSDGTRDVTSDGVMGT
                     TNTFAGSIGTSTGSPAALRDKFIVRKRTQFLRSLPENRKAEEEANSSVISDIINRSMH
                     LPQLDLSSLDQNFRSGSNATETVQLRKELMNCRIQLRLQSDLLKEKYIEKVGQEELSA
                     SAHLSAVNDALRGELEDLEGSFHGVKVQLEKMHLDYEEWQAALGKVMTKLRESNDKKV
                     QKVLLNCKEESDMKNKLDIVDSGVGLLIEDRKNEGISMNNKLKSVLDELKSEREQFEV
                     LSRNLEDYKSSSKMASESDEVGKLRDELGTKEDAYRQVKEELKASEERVGRLLDEQRE
                     TAGEIDGLQEQLNNFKKMKTELESEINDLKVQNDDLANQTSDAEGNSRVDAILATDIN
                     FQTHAIKILSRLLDKKSIREAAEKVLQLANRDQLELKNGPVRQLLAAVYDYLLAGIQT
                     VVMSRLEMTREANDQIERDRKIIDNVQKELKEKPGKLLEDATSSTSKLRIDELTKRWK
                     TAEEALSFERKQSKKRLDELEQENSRLKAKVDLTSLQT"
     gene            <486977..>489447
                     /locus_tag="FOA43_000238"
                     /db_xref="GeneID:62193639"
     mRNA            join(<486977..486985,487153..>489447)
                     /locus_tag="FOA43_000238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920571.1"
                     /db_xref="GeneID:62193639"
     CDS             join(486977..486985,487153..489447)
                     /locus_tag="FOA43_000238"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776499.1"
                     /db_xref="GeneID:62193639"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="PFAM:PF04082"
                     /translation="MRSPQLQPRTQLESRPDPQLPKLPELPVQRQPLHMLQPLLAPLQ
                     ALQPQPSANSDLPGGKNKAPHISSLPSLQLLVNSSGVAATSLRCVSSLPPFLRRSRSQ
                     SQKPDVSSTNTSATNSATNSSANIANMSANDSTNSSSNSTICIYSMQQQQSALRGNPA
                     ACRSSVTALATKGLPLPQLSPVPSPSTAAVQRTSSMTASVDSATFSGQANSSSIASSV
                     SSGTTPPIQGNGAQGKALCPFQFTSSTSASTSSAPLVSLAPLTAINNTAIAKVTSSPT
                     PIASAKKNLRTLSNTPSLLYTSIVKSFLEDSGEFSFGRNRSPGYSLADSAASISSQGI
                     ISAALDAYFVHTQREYPFLTEKDVRSHARKLDISDNTSNVNAASVEVLMVLAIGCRVL
                     ESAGAASKTQQYPHFFFIHARDIMAKGVVLTGLQAARLMTLLCAFFIYGDNTSKCWMV
                     LGSLLRLTVALNLHHARRNKLAVPQSLSHKSSHNKDSSDARSRLFFSIYSLDRTVSAT
                     MGRPVGISDDDIDVSLPERAPCESQADIEISRRLIEMARVEGLLIQNIHAVRAVESFR
                     STDERAAIYTALRGEIEAWYSRCSGYRAQLAAKSSVGLPGAARMPLQNPTAWFNSEYY
                     QLLILFYKPSDLIVHPLPENLEMLAKCAMQGLSFMYSLYTSNWFPNSWTVFYRFISLS
                     RALLYCLCHECIDLLQVKTNLPLAREMLDYFAVTWPYASQLASVLAKVSDSLNDATNL
                     RRLSTEFQQVLDENVVDLWKDDVRHMI"
     gene            <492983..>493831
                     /locus_tag="FOA43_000239"
                     /db_xref="GeneID:62193640"
     mRNA            <492983..>493831
                     /locus_tag="FOA43_000239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920572.1"
                     /db_xref="GeneID:62193640"
     CDS             492983..493831
                     /locus_tag="FOA43_000239"
                     /note="BUSCO:EOG09342KCS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776500.1"
                     /db_xref="GeneID:62193640"
                     /db_xref="InterPro:IPR010684"
                     /db_xref="PFAM:PF06881"
                     /translation="MTERRAGALPLVNLARLRCLQNSHLINDIGCTPYHLIEPILKKK
                     TAKSLHIIEEHSPQILPYSDPLWRSLIQRDFFDRPLEQYQVKNGKRSSVPARDLYEKY
                     AEERELQRKQATMTFKQLTRTLNMRKNKRKVKTLDHVIHSSRGPRGTLQLQHSQQHSS
                     VFKSSLLEKARHQNKIRSQFLSEGKRVSNLSIKTKQPQITTGDKIVRSRASSHVPSLL
                     SYPKMVTKQGFIRTPRVMLSAIRVSSPPVKRRIDISTKGNSKRPKPSPELGRHTSSNV
                     YIYDAK"
     gene            complement(<493917..>494852)
                     /locus_tag="FOA43_000240"
                     /db_xref="GeneID:62193641"
     mRNA            complement(<493917..>494852)
                     /locus_tag="FOA43_000240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920573.1"
                     /db_xref="GeneID:62193641"
     CDS             complement(493917..494852)
                     /locus_tag="FOA43_000240"
                     /note="BUSCO:EOG09343K2F"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776501.1"
                     /db_xref="GeneID:62193641"
                     /db_xref="InterPro:IPR002738"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="PFAM:PF01876"
                     /translation="MICDLNVVYPQTDFLVRPTARDLAKLKGCLAVLEQLGYTHIALN
                     FEPQWATGSLNKQIPSDIRLLNPINIETDFAEFEGRLKLYSRITLKVDDPSQCQNLTR
                     FQQVFDLVAVEPQTERALQLAITNLEIDIITFNYKERLPCYLKHKTLGSAIEKGIHFE
                     IKYSDLLESDSHARAQSISNVKQLIRASRSRGLICSSGISSPDISRLRSCSDIANLLN
                     LIGLDHNRSEQCFKDWSLKTLLSGRLRIKSYKQVVAVSGDESLIDNSLENKNWQASQK
                     GVSVNAKMDVSSYKKRKADTAVDRVTKKSKPETTV"
     gene            <495144..>496019
                     /locus_tag="FOA43_000241"
                     /db_xref="GeneID:62193642"
     mRNA            <495144..>496019
                     /locus_tag="FOA43_000241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920574.1"
                     /db_xref="GeneID:62193642"
     CDS             495144..496019
                     /locus_tag="FOA43_000241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776502.1"
                     /db_xref="GeneID:62193642"
                     /db_xref="InterPro:IPR035896"
                     /translation="MTTIHEEQGIMDIGKHCSVCHRLDFLPFTCPKCHMSFCGEHRAD
                     FNSHKCIVEMNLKKNRIPPVNTRNLPPASSLFPDLDKLREKANERAKRQNGGDHVLGS
                     EGGNKYRDDSTNRALSSAEHALSRLKVLLGGKKEAANRGAKLSILHRFSSKSTLQIVE
                     LAKLKKAAKGDPKVSSTQRIYIWCVYVEDFQKSNSVSEKTELWVSKAWPIGRMLDSCT
                     EQMKVKNLNNRVTDKSQRLTVFRKRRPNERASNDAAGISDAEFVYLSTAGRVSKEIRD
                     NDVIYLVRGAKRELK"
     gene            complement(<496415..>496993)
                     /locus_tag="FOA43_000242"
                     /db_xref="GeneID:62193643"
     mRNA            complement(join(<496415..496832,496986..>496993))
                     /locus_tag="FOA43_000242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920575.1"
                     /db_xref="GeneID:62193643"
     CDS             complement(join(496415..496832,496986..496993))
                     /locus_tag="FOA43_000242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776503.1"
                     /db_xref="GeneID:62193643"
                     /translation="MFAGNGTPGLLPSVVSPLLTPQFVPKGSISFPAYTCITPNTTKS
                     QQIRILSYESPMLSCTTYREGCASDLDSNKLDLNKLDLNYSVNGGVSSFGIKYNNNSS
                     NSNRNSDGLTTTNTSSISNVSNILDSCASENYKKWLSSH"
     gene            complement(<497907..>500567)
                     /locus_tag="FOA43_000243"
                     /db_xref="GeneID:62193644"
     mRNA            complement(<497907..>500567)
                     /locus_tag="FOA43_000243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920576.1"
                     /db_xref="GeneID:62193644"
     CDS             complement(497907..500567)
                     /locus_tag="FOA43_000243"
                     /note="BUSCO:EOG09340DM6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776504.1"
                     /db_xref="GeneID:62193644"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR017852"
                     /db_xref="InterPro:IPR037671"
                     /db_xref="PFAM:PF04987"
                     /translation="MVGDGQKAETTFAWSHHPVTGEDEFLAPYLRNVIINEGTYGVSH
                     TRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSTHTYSFGSPDILPMF
                     AKGASSVDKVDTWMYGPEFEDFTHSSIDVDKYVFDHLDSLFANSTREPALDTQIRQPG
                     NVFFLHLLGTDTAGHSYKPYSAEYYDNVKYTDSEIEKLVQKVNKFFGDQDTAFVFTAD
                     HGMSDFGSHGDGHPNNTRTPFICWGAGCKKPVRIDAKENEYLKDSYEAEQMNAWHLDN
                     VKRHDIKQADITSLMSYLIGANYPANSVGKLPIDYIDASEDDKIHGLYLNALSILEQY
                     HVKLAEVSSNQVDFKPFPTFEKKSIEAYQSEIESLLKKVKHNDEYEKETVGAIHDFIH
                     AILDGLDYLQKYNWMMMRTIVTLGFLGWIVYSYTMFLEMYVLNARKDTSEGYHPIVHA
                     ASLAIYCAIASVFAYQKSSLNNYLYAVFPVFFWDQIISKKNHLIKGTTVFFEGVSRLS
                     MILIIVSIFCFFEAIAYGFSNRRIFTVMFLLLSVYPAILDGKTHRISAKKHAFWFVLC
                     VALSYFPSQNPIKTENLPLIIGSGILMIVVGFLGFADAPTSMSRYTKSVILLQLALVA
                     SSIYSTSIAIISLQNKEGLPKVAQYFNWFNLVVSLIVPYPLHHLKPNHNSEVRYLIIY
                     LTFAPTFLILTISFEALFYVLFAVMLHEWINIESKLTDTKESSSKWLQLLRVSIIGFF
                     GLQIAFFGTGNVSSVSSFSLESVCRLLPIFDPFPMGALLMLKLIIPYGLLSVALGLMN
                     VKLELKIFSISSLLISVSVILSLNFFFMVKTEGSWLDIGLTISNYCLAILSSLFMLLL
                     EVVSHLLLDDVTIATTTTTTQIEKQKMVRT"
     gene            <501246..>501564
                     /gene="ACB2"
                     /locus_tag="FOA43_000244"
                     /db_xref="GeneID:62193645"
     mRNA            join(<501246..501272,501328..>501564)
                     /gene="ACB2"
                     /locus_tag="FOA43_000244"
                     /product="Acyl-CoA-binding protein 2"
                     /transcript_id="XM_038920577.1"
                     /db_xref="GeneID:62193645"
     CDS             join(501246..501272,501328..501564)
                     /gene="ACB2"
                     /locus_tag="FOA43_000244"
                     /codon_start=1
                     /product="Acyl-CoA-binding protein 2"
                     /protein_id="XP_038776505.1"
                     /db_xref="GeneID:62193645"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="InterPro:IPR022408"
                     /db_xref="InterPro:IPR035984"
                     /db_xref="PFAM:PF00887"
                     /translation="MVSELFQQKADAVSHMKNRPTDDEMLQLYGLYKQATVGDNGTTK
                     PGLFDFKGKYKWESWDELKGMSQEEAEKKYIELVDNLLAKYDN"
     gene            complement(<502271..>503020)
                     /locus_tag="FOA43_000245"
                     /db_xref="GeneID:62193646"
     mRNA            complement(<502271..>503020)
                     /locus_tag="FOA43_000245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920578.1"
                     /db_xref="GeneID:62193646"
     CDS             complement(502271..503020)
                     /locus_tag="FOA43_000245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776506.1"
                     /db_xref="GeneID:62193646"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MSLKGKSAIITGANKNLGQKTALAFAEEGCDLLVHCHNPKFKKD
                     LDSFAEELKKDYGIKAVSFQGDLTQEAPNKEMFELASSKLGKIDIAINNVGMVLRKPL
                     AEVSLDEYNAMFDINTKAAFLFLREAANKLAENGSVIMLTTSLLAAYTDGYSIYQAAK
                     SGVEFMCKALSKETKKQISFNCISPGPMDTPFLYGQETKERVEFFKTQASAGRLTKVE
                     DIIPIIKFLAKDGHWITGQNIFCSNGFTAPK"
     gene            complement(<503391..>505730)
                     /locus_tag="FOA43_000246"
                     /db_xref="GeneID:62193647"
     mRNA            complement(<503391..>505730)
                     /locus_tag="FOA43_000246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920579.1"
                     /db_xref="GeneID:62193647"
     CDS             complement(503391..505730)
                     /locus_tag="FOA43_000246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776507.1"
                     /db_xref="GeneID:62193647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR015280"
                     /db_xref="InterPro:IPR021661"
                     /db_xref="PFAM:PF09197"
                     /db_xref="PFAM:PF11626"
                     /translation="MRPETRTHHSIRAAKKQGEVNMDDNIKFVSKIEGKALNGIHSEA
                     HGPTHPDTNAEDEEAIEEELSRLEARTGNDESDESIGANEASLENSNVAAAALAVASE
                     EATQRDSQRNIKGGDRGDKKDREESWVQKQEVSKGQKQSKGQQSTGSEGDVIPKYVST
                     PLYELFKDRRFTVYGQSAAADDVRQMVKNLGGETVSEGTRGAIALVRSASSAIPNNVQ
                     DAFSFDFVYYAHSKGVIPDLESFKIRKPPGLPSNFKINVGELAAGGEAGPKEPLGARE
                     TPTTGARSENTTSMALEKHLEKPVMGAMPHSVFPTPKKRSSKFTAQEDAAILDLIRRN
                     PYLRSTHSFYAQIAQLPLLSNHTGNSIRFRFRKVLSKQLDWVYKVDPETNDIQMNPET
                     NEPLKIKELPGLLKSQYTAEEDYDLCKCVTEFRENGGGMTRKRKMDSGSIPESIFQGL
                     AEKHPRHSAMSWRDRYRKFASVYGLEKYISYYEECLASNEKPSPMRNLSSRSGLKTSS
                     KRRRTVKAVDAETDLNSAKLTDSSQQVPMDLGAVKIQELARASVESKSTDEMKEKRDA
                     NGGSEVKGETKDDNATGATGVEAVGAAGAAGDVAATRSTGSESPSQSANLFEDADEMK
                     ALNIDITGTISSHGSLLGNMSVEALRKAEPQPLTERSKANSEEILKDIEELFGDFGSD
                     ITSSAELFKTIHDKTGLSVAWMNYWFDCSCGMFNVFIDAVQNYLKTGQLTMEDHRGFW
                     TAEHDKMLLNQHKLPQLYKLHGEDSVNKRKATIMGPPNE"
     gene            complement(<506316..>508529)
                     /locus_tag="FOA43_000247"
                     /db_xref="GeneID:62193648"
     mRNA            complement(<506316..>508529)
                     /locus_tag="FOA43_000247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920580.1"
                     /db_xref="GeneID:62193648"
     CDS             complement(506316..508529)
                     /locus_tag="FOA43_000247"
                     /note="BUSCO:EOG09341G00"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776508.1"
                     /db_xref="GeneID:62193648"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="InterPro:IPR035969"
                     /db_xref="PFAM:PF00566"
                     /translation="MAISFPPGKGRVLYAKSKVYVHMTSSKRDNIAGYLVIVKPFVDS
                     PSTDLVVAYIPESDLSEDDKASLEYFDLYGLDGESHDFFGSGDGNSTSSSSLNKPKVA
                     RFINRPRMSSMSSFAFGLAISNIFSIQVRPKTTTLWEGSIVLHPKDLLEKVPALFFHD
                     EESAGTKREQKLKSRRFDPFAENSKGDLYWGGDRFISCMKNYCVLEESTLEKGMYLVN
                     PSKDDTINFIPDVLDKPQMNPGESVGDAVNDFISDAKWKMLTGLASVTKFAKKQFSGI
                     VENEAIPAPIRQLLGKPQVRVIGDEFDSANVYLAKWALAVQEEADKSRKQIVGNDFYR
                     ELMESEFGGDTTVTLTPQEVAHARRLKPITEVEWESMFDKSGRLQITVKEVLDRIFHG
                     GVEAEARREVWLFLLKVYPFDTSIEEREQLVKSLYESYVEYKNSWKGDLERQKKDDYW
                     RDQKVRIDKDVRRTDREQDIYKGGDPVNMDITGNEDPDDDAGFKNPNLLVLRDILLSY
                     NELNVNLGYVQGMSDLDSPLYYVIRDEPLSFWAFARFMEIMERNFVTDLSGMKDQMLA
                     LTELVQFMMPSLYQHLDECDSGNLFFFFRMLLVWFKRELTFEDTLRLWEVLWTDFYSS
                     QFVLFVCLAILEKHSKIIMSTLNKFDDILKYMNDLSGTLEVDDLLVRAELLFLKFKQM
                     VEMIDRRNAGIGFGGTVSEDQGPKRIPISKQLRLLLSRKTIIQKEKPRDPEAPFG"
     gene            <511273..>512811
                     /locus_tag="FOA43_000248"
                     /db_xref="GeneID:62193649"
     mRNA            <511273..>512811
                     /locus_tag="FOA43_000248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920581.1"
                     /db_xref="GeneID:62193649"
     CDS             511273..512811
                     /locus_tag="FOA43_000248"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776509.1"
                     /db_xref="GeneID:62193649"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MSDFSSIHKNPERVEINEMVSPQPSLAPKIDKEIDLGAKYLSEN
                     KEYARYTEKEAKRVLSKIDWHLMPIMTICITLAAADKIVISNAALYGMTSVLKNKSEY
                     SMLGSIFYIGYLVGELPANLLLQRLPVGKCIITSFFFWNTILMLMATGNNFGSLAALR
                     FLMGIGETFLLPGCTVITSMFYKKSEQGLRCAIWYSGFSFLITGILSYAIGHADVNIA
                     NWRLLFLVFGSITLFFTFFMCFLVPDSPMACRWLDERESYIAEDRTKENRTGTKNTSL
                     KKEQVIEALTDYKSWLVCLFVLCFNIPNGALVTFAAQIVSGFGYSPLRTTLLGMPTRV
                     FMTLSSFVIILPTLKIPRKYKSIAIALVGLGPLVCGILIKELNHQTINKNGLLLTYYL
                     FYFYWGPYVGVLSLSMANTSGYTKKTIVNAMTFISYCVSNIIAPQFFKSSQAPGYEMG
                     FNAILGFVAVGITTIIAYAIGCIMENRKRDAKYGPPSGEYNLEEDGLDLTDKQEEAVF
                     RYSW"
     gene            <513598..>514263
                     /locus_tag="FOA43_000249"
                     /db_xref="GeneID:62193650"
     mRNA            <513598..>514263
                     /locus_tag="FOA43_000249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920582.1"
                     /db_xref="GeneID:62193650"
     CDS             513598..514263
                     /locus_tag="FOA43_000249"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776510.1"
                     /db_xref="GeneID:62193650"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="PFAM:PF00660"
                     /translation="MVNTSTLFALASVLATTAQADLILALYGDIKSNAAEYLSLVQSS
                     SSELAPMLSLYAAAETYTDDSFTTLISPALSSSISNIVTGFPWYSSRILPNEGVVSET
                     GSDASSSASASGSSSADASSSAESGSASESGSASDSTESGSASESGSASESSSAASSS
                     KASSSSKITSAASSEASSSGASSSSAAASSSAGAAILAPQGSGSYALAAGLVGLISGV
                     ALL"
     gene            <514298..>517026
                     /locus_tag="FOA43_000250"
                     /db_xref="GeneID:62193651"
     mRNA            join(<514298..514305,514650..>517026)
                     /locus_tag="FOA43_000250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920583.1"
                     /db_xref="GeneID:62193651"
     CDS             join(514298..514305,514650..517026)
                     /locus_tag="FOA43_000250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776511.1"
                     /db_xref="GeneID:62193651"
                     /db_xref="InterPro:IPR013986"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR034739"
                     /db_xref="PFAM:PF00580"
                     /db_xref="PFAM:PF13245"
                     /db_xref="PFAM:PF13361"
                     /translation="MLDQYRALVSPTSDVLQVLAGPGTGKTRVITARVAYLLCVEHLA
                     PEDIIVTTFTKKAANEMKRRLNEMLVDYSPKIQLNNLFIGTFHSICVRILRVFGSKIE
                     LDSRFKIADETDSKQLIKRVLQDKYSDAPGASTTLVVKVTDKDINEYKYFISACKSKA
                     LFPDEVPLDLTDKAFEDHIYTYKKYQHSLRTNNLIDFDDCLLLAYKLLKKYPTCLHDI
                     KHVLVDEFQDTNLVQLELMYLFGLNSHNRVTVVGDPDQSIYGFRHAEANNFYRMENYY
                     VERGAKVMKVQLDENYRSTSNILSFAETVIDSKQKSKREPKKLKSNTKKENLPVYFDA
                     YVNNKEEARRIAEDVRTLDYKYSDIAILIRSAFLSRMIEQELIHANIPYIIVHGRSFW
                     ELREVKLMVDYLRAIASNVDWLGYSRSMEFVITGLGTKSLQSIENDFESRRGKGHAGN
                     VYKIIKSIVKEDRKGFSTKAREGLRKYVKTIHKARHILKNESKEMPKRLNKMFDLVVE
                     QSNLIELVCSKKSKAKSEEEARNDITENLNELKNQLITFAPAEQVLPEDTDKESERLS
                     EESKDSSDILTQFLDSIYLYEQTHYKQSKENDNSEGKVTITTIHGAKGLEWPVVFIPG
                     LADGIFPSKYVLNEPNSKKRNATMDEECRCLYVATTRAKERLYLSYFVEAESFWQDTE
                     KRTVSSLIKGRPMKLVEKRKHSNYGRAVGFASANKKAADFEKFKSRNARMVVQAYKEF
                     SHIPTAVPVVFTTAKKRISRITGLNPVTGAPLNKKVKRKRLGMGRPMKPYPLGK"
     gene            complement(<517058..>518863)
                     /locus_tag="FOA43_000251"
                     /db_xref="GeneID:62193652"
     mRNA            complement(join(<517058..517682,517782..>518863))
                     /locus_tag="FOA43_000251"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920584.1"
                     /db_xref="GeneID:62193652"
     CDS             complement(join(517058..517682,517782..518863))
                     /locus_tag="FOA43_000251"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776512.1"
                     /db_xref="GeneID:62193652"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MSLSSRSSLETDHSGLDLENNEIAPIQSLSSSLSHPAYRVRSFG
                     SSLASKVSRVNTLRRNISTNIRSAAERIQDDSAKHAKDEAIKRSTRLGRGMSNLGLEE
                     AIRIATYRSENQLSLSPENKEEEADLEKVVTGEVSGENVPPQDKGYAWVMAGCGFMLL
                     FATWGANGAYGVFLSYWINNQTFPGGTAKDYALIGSMVLCLSQSLAPLAQMLSAIVGI
                     RPVMIVGVILQFLGFILGSYAKTLTQLYLTQGFILGLGVSLVFNPMNTLMPEWFDKKR
                     GISSGITVSASGVGGVLFSLASQSLINDTGNFRWSLRMIGIICVVFEIILTILTKPRI
                     PKRRLKTVHEIRTRASVMFNVRIVKLCQQVGSDMTAIFNGCQAIGRLAIGLCSDYTGR
                     VNLALILNVVMIVLIFAMWINSFSYTCVLMYSILSGLTFGSASTLNQPILADQVEPEL
                     FPSAWSFENFFMGIWSLVVEVITLGLRDEGKKRPFIRSQICAGFFSVGGLFFLIPIRE
                     LKIRLFLEKNLNKTDQTLAKDIDLTTEDTALLEKRKAHYNKMLQPGIHAYFKRLIHPI
                     AV"
     gene            <519604..>521127
                     /gene="RSA4"
                     /locus_tag="FOA43_000252"
                     /db_xref="GeneID:62193653"
     mRNA            <519604..>521127
                     /gene="RSA4"
                     /locus_tag="FOA43_000252"
                     /product="ribosome assembly"
                     /transcript_id="XM_038920585.1"
                     /db_xref="GeneID:62193653"
     CDS             519604..521127
                     /gene="RSA4"
                     /locus_tag="FOA43_000252"
                     /codon_start=1
                     /product="ribosome assembly"
                     /protein_id="XP_038776513.1"
                     /db_xref="GeneID:62193653"
                     /db_xref="InterPro:IPR001632"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF08154"
                     /db_xref="PFAM:PF12894"
                     /translation="MSTQIPPASKRQKRELQKPRDVAIIPKDVPNVLIKFQASDTGES
                     VGGSIRVPGSITEKQLEELLNKLNGTTDDSIPYIFALENGDDQVEIKDNLYISVLKPG
                     IKTTEDFMTLVYTPRAVFKVKPVTRASATIAGHGSTILAVQFAPNTSAKMVTGAGDST
                     ARVWDCNTQTVQYTLRGHTNWVLCVSWSPRGDIIATGSMDTTIRLWDSKTGEPLGGAL
                     KGHRKWISSLCWEPIHLVKPGQNPRLLSGSEDGTIKVWDTTRRQCAMTMSGHKSAVSC
                     VKWGGSNLIYSSSHDKTIKVWDANNGKCLQTLRSHAHWVNHLALSTDYALRIGAYDYK
                     GQAPKSAEEEQAKALENYEKVAKIGGKVIERLVSASDDFTMFLWEPSKSTKPLCRMTG
                     HQKIVNHVAFSPDGRYIASASFDNSVKLWDGRTGKFLSSLRGHVAPVYQTAWSSDSRL
                     LVSCSKDTTLKVWDVRSRKMMCDLPGHSDEVYAVDWSVDGKRVASGGKDKTVRLWMH"
     gene            <521247..>521882
                     /locus_tag="FOA43_000253"
                     /db_xref="GeneID:62193654"
     mRNA            <521247..>521882
                     /locus_tag="FOA43_000253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920586.1"
                     /db_xref="GeneID:62193654"
     CDS             521247..521882
                     /locus_tag="FOA43_000253"
                     /note="BUSCO:EOG09343CIH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776514.1"
                     /db_xref="GeneID:62193654"
                     /db_xref="InterPro:IPR001796"
                     /db_xref="InterPro:IPR017925"
                     /db_xref="InterPro:IPR024072"
                     /db_xref="PFAM:PF00186"
                     /translation="MHMDRPEVSIIVAALLPSHGIGNRGKLPWRLKKEMKYFREVTTK
                     THDPLKKNMVVMGRNTYESIPVKFRPLKGRVNVVLSRDLDSYRKKMEQEVAANGSMLQ
                     LAGSLDQALLFVDPTKIEEIFIIGGAQLYKTALDKASHMVDRILLTEITSLEQLQLDT
                     FLALDSTQWEKRFETELSSYLVSKGLADEFQLTGNHEGNFQYDFTLWKRKT"
     gene            <522231..>522775
                     /gene="RPL33A"
                     /locus_tag="FOA43_000254"
                     /db_xref="GeneID:62193655"
     mRNA            join(<522231..522249,522471..>522775)
                     /gene="RPL33A"
                     /locus_tag="FOA43_000254"
                     /product="60S ribosomal protein L33A"
                     /transcript_id="XM_038920587.1"
                     /db_xref="GeneID:62193655"
     CDS             join(522231..522249,522471..522775)
                     /gene="RPL33A"
                     /locus_tag="FOA43_000254"
                     /codon_start=1
                     /product="60S ribosomal protein L33A"
                     /protein_id="XP_038776515.1"
                     /db_xref="GeneID:62193655"
                     /db_xref="InterPro:IPR001780"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR018266"
                     /db_xref="InterPro:IPR038661"
                     /db_xref="PFAM:PF01247"
                     /translation="MAESHRLYVKGKHVSYQRSKSVTKPKCSLIKIEGVDNKEDARFY
                     LGKRIAYVYRAPKAVRGTKIRCIWGKVTRSHGNSGIVRAHFKHNLPPKTFGASVRIML
                     YPSNI"
     gene            <523124..>523639
                     /locus_tag="FOA43_000255"
                     /db_xref="GeneID:62193656"
     mRNA            join(<523124..523168,523241..>523639)
                     /locus_tag="FOA43_000255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920588.1"
                     /db_xref="GeneID:62193656"
     CDS             join(523124..523168,523241..523639)
                     /locus_tag="FOA43_000255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776516.1"
                     /db_xref="GeneID:62193656"
                     /translation="MIPWEGLLPYGFIIAFFGAAGAGMNAISISSLTRNAQGPNHESN
                     FTTPTEKKDWIRPRIKTDQWDKNMAVRDLRLTGSFRGTKADPEADESFETNSIVFASS
                     TAKPWVLRKHIIMKNSPSKWMKKYNSDRDQHWETVKEEYLKGMQK"
     gene            complement(<523750..>526401)
                     /locus_tag="FOA43_000256"
                     /db_xref="GeneID:62193657"
     mRNA            complement(<523750..>526401)
                     /locus_tag="FOA43_000256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920589.1"
                     /db_xref="GeneID:62193657"
     CDS             complement(523750..526401)
                     /locus_tag="FOA43_000256"
                     /note="BUSCO:EOG09340QK3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776517.1"
                     /db_xref="GeneID:62193657"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MLSTASPIIGDASTATLMASAVKTTTTNTNSAAPSFSGSSGRSA
                     VSAKRRGPREVRFGVYVLGATLGEGEFGKVKLGWRKDNQQPSQAAIKLIRRDTIPHGS
                     EKESKIHREINALKRLRHPNIVRLVEVLQNDKYIGIVLEYASGGELFDYILEHRYLKE
                     SMACRLFAQLVSGVDYMHSKGLVHRDLKLENLLLDKHKNIIISDFGFVNSFHTNDLMR
                     TSCGSPCYAAPELVVSNQPYQGAKVDVWSCGVILYAMLAGYLPYDDDPQNPDGENIAR
                     LYHYITTSSLTFPEYITPTPRDLLRKIIVADPRHRISLHQVRAHPWLAPHAPFLSVTP
                     EEWDRNYKAARMLFSQSDKAHRRYSLMENHTSASLMLNKHSIKSYSTHNVSQALYSNP
                     AAPQTSRTVAISASTSSFELKAGDNNSSSNTNSIAVNISIPSNTVASSPYETYRASHH
                     RRNGSSASIALQAVVEADNAEHSRRNSLSDVSITNIVHSNLPSARSRPFQRPTTFAAT
                     SQETPSASFVPLDTLIGTTETQVNSGIETIVEGTENSLPFTTVSSRPPRTSSKLNRPR
                     PTSYHPGLISSSHVSAHDFAFLMPSSRMDTSSVGDISRYRERSSATNSRSSSPIKDSQ
                     SKRNSWCQPKISEPALDMSLANGVLTKLSEPSRSVVPVEQNYINSSYEKRRSIALDSL
                     SNAMENLSVSSDIPKEEVKREPEEKPPEGCPEHSERAKNTMEISADSSQHTRHHHRHH
                     QKNIENTATNGVGRVITSSSEKENHISLSTSVTNKFKRFSLLSFYTKDSIYETATSTL
                     KKRSSYAGGNSSHAKHSRTSSRTASRTSRRPLEPSNLLPMTAEESVENSANNSRVASN
                     SSNKPHTREPSTAKRVMDFFRRRSIRI"
     gene            <527771..>530380
                     /locus_tag="FOA43_000257"
                     /db_xref="GeneID:62193658"
     mRNA            <527771..>530380
                     /locus_tag="FOA43_000257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920590.1"
                     /db_xref="GeneID:62193658"
     CDS             527771..530380
                     /locus_tag="FOA43_000257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776518.1"
                     /db_xref="GeneID:62193658"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008046"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="InterPro:IPR031327"
                     /db_xref="InterPro:IPR033762"
                     /db_xref="PFAM:PF00493"
                     /db_xref="PFAM:PF14551"
                     /db_xref="PFAM:PF17207"
                     /db_xref="PFAM:PF17855"
                     /translation="MEEVNEAVDALYGERVRKFQEFLDSDDNDTDYKDTIKTMLQRGN
                     RRLTVSVDELREFDSEYAKGIMNQPADYLPAAETALKDTVMAIYDPYEFSESEINADT
                     DFYLGFRGAFGSHQLTPRTINSSYLSKMVSVGGVVTRTSLIRPKIIKSIHYCENTGRF
                     HSREYRDQTTSFNPITTVAIYPTEDPEGNKLTMEFGFSKYRDHQTITIQELPETAPAG
                     QLPRSLDVILDDDLVDKVKPGDRVEIIGVFRSLGSGQNNAVGFKVIILGNSVYPLHER
                     STAVRAIEHITDYDIRNINKLAKKENIFEVLSHSLAPSIYGHEYIKKAVLLMLLGGVE
                     KNLDTGTHLRGDINILLVGDPSTAKSQMLRFVLNTAPLAIATTGRGSSGVGLTAAVTS
                     DKETGERRLEAGAMVLADRGVVCIDEFDKMNDVDRVAIHEVMEQQTITISKAGIHTSL
                     NARCSVLAAANPIYGQYDTFKSPQQNIALPDSLLSRFDMLFVVTDDISDEKDRKISKH
                     VLNMHRYIPPGYAEGEPIKEAPTITLAVGDEPVNEEDNENGGSEVYEKFNPMIHGIEM
                     DEEAIAASRTSPKIVSIPFLKKYIQYAEQRIKPVLTKNATNKIIDIYSDLRNSDTNKN
                     SRTSPITPRTLETMIRLSTAHAKVRLSQTVEVKDVSVAEQLLRFSLFKEVAKKTRKPK
                     SPRKKRKTRSLDEEEEEEEEEEESNAAGNGDDMEMTDLKIPPGHRMTTRSQDTASIRE
                     DPEDPEVEEVSEGISKLATETKEVKDTVETAETSESTDNALKIKIPQEENKSFLEGAI
                     SESRYSLFKKTMSSVFREVQDVSFKFEHLVSLINQKLQQEDQFGREEAKAALNKLEDE
                     NIIMLSENNVWRI"
     gene            complement(<531299..>533248)
                     /locus_tag="FOA43_000258"
                     /db_xref="GeneID:62193659"
     mRNA            complement(join(<531299..532983,533242..>533248))
                     /locus_tag="FOA43_000258"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920591.1"
                     /db_xref="GeneID:62193659"
     CDS             complement(join(531299..532983,533242..533248))
                     /locus_tag="FOA43_000258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776519.1"
                     /db_xref="GeneID:62193659"
                     /translation="MAASSRPMGPQLADILAGGLPKLKHVGNAHTSSSNAPRAPAIPT
                     FPSIPSSRPSKRSSMSFSRAAQAQQANQFPPAPPAPPIPTFSVSSASSVPSAPPIPGS
                     APPLPTSLGVPQSSLSHSRRASSDSVSSIASTKSKPKQPSQRPHRKSSAPSVAPPLPG
                     SAPPLPGAAPPLPSAPPPLPNTAPPPPVAYPLPSLTSAPSTRPTHQLSQLPPPPPAPT
                     TRAAPPPPAPPPPPPLSSFSSPPKHKLLTHSATPSSTPVLSGLPFLAEINQRRDDSHV
                     VDSDHATKKSLQRSTAPAITNTVKAPAQDSVESPPQDSFLSAIMNRQHQLAEKSASHS
                     SPAASSVFSAAPPTSNSISAEVQQTLAIPSIPPPPISLAPRAPSTPVVSASHSPSHVP
                     PPPPSFSSPPPPALAPSLASMASRDRSSSVTSSMRSKRAPPPPPPSVSSAPISDNLYT
                     ETPAEILEQEPVHKIFGYGLRHTVKSNDAKINRQQDVGSGLRKIDISAYTITGSGVSA
                     GSSSSKGSKIIIDDSRFKFINSNELPKPRKFTGKIKLYPSGRGSSVPLDLALYKE"
     gene            <533474..>534100
                     /locus_tag="FOA43_000259"
                     /db_xref="GeneID:62193660"
     mRNA            <533474..>534100
                     /locus_tag="FOA43_000259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920592.1"
                     /db_xref="GeneID:62193660"
     CDS             533474..534100
                     /locus_tag="FOA43_000259"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776520.1"
                     /db_xref="GeneID:62193660"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MLNRWTRNLSTGLRNFHNFAPLLLNGTGLPDRTLLLNRLAFDLT
                     EDEIEKAFAPIGGISSVHIECDDKTSKSRGYGRIVFEDANRAKRASVEMQGLVIHNMP
                     IKVSVKSESRYKGLDEKKYEILYIKNLPYDVTEDEVLHLFAPYEALRCGLSRAPVTKK
                     NLGYGFVRFGSKETAYNALQKTRDITLRDRKIKVAFAQPKVNNYRYIV"
     gene            complement(<534193..>534912)
                     /locus_tag="FOA43_000260"
                     /db_xref="GeneID:62193661"
     mRNA            complement(<534193..>534912)
                     /locus_tag="FOA43_000260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920593.1"
                     /db_xref="GeneID:62193661"
     CDS             complement(534193..534912)
                     /locus_tag="FOA43_000260"
                     /note="BUSCO:EOG09344D94"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776521.1"
                     /db_xref="GeneID:62193661"
                     /db_xref="InterPro:IPR000740"
                     /db_xref="InterPro:IPR009012"
                     /db_xref="InterPro:IPR013805"
                     /db_xref="PFAM:PF01025"
                     /translation="MQRFSALSRSVVRANIFASRRAISVGHRAFSSTPRYMYAEAKEG
                     KDAKKEDTIKDEGKKDAKDSKETRTTKDDVDAQLDETNKSLEELKKQNAELKDRYVRA
                     VAEFRNLQATTQREMKKARDFALQKFSKDLIETVDNFDHAIEAVAREELKSNNSLSSF
                     YDGVKMTKDVLEKTLEKHGLKKIDPLDKEFDPNKHEAVFQVAVPGKEPGTVCMVQQPG
                     YELNGRVLRAAKVGVAKAADN"
     gene            <535541..>537220
                     /locus_tag="FOA43_000261"
                     /db_xref="GeneID:62193662"
     mRNA            <535541..>537220
                     /locus_tag="FOA43_000261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920594.1"
                     /db_xref="GeneID:62193662"
     CDS             535541..537220
                     /locus_tag="FOA43_000261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776522.1"
                     /db_xref="GeneID:62193662"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR021605"
                     /db_xref="PFAM:PF04818"
                     /translation="MNSRPIIESLTSLALENTEAATDIAKAVEKRINKAIPSQKLYAF
                     YLLDSICKNVGVPYPSLFGANIFKLFSQAYSLVDDPTRVKLIKLFRTWKIPNAVTGLS
                     LFDEDQIELIDKFLIRATAANRPPEQQRQIDLSNSKATKSSLLREIDDLTNLVNSRIL
                     QMPDDSKGRERFQLLQKLRTILSQPSSIPQQQLDFTKKQLQSIREDELLRLNAFKQQQ
                     QPASKQMPQLSVNQLQGLLNLPSGNNNNFPSYQAPFGKPQQQPPNQLNNANAQALFSM
                     MSSILNQDQKRQQQQPQFQVNNGEFNAKSSKSSSKDPSDNSNESSLGLTNLEFLKDIL
                     RKSKAGVKVPPMKGNAGIIRVNEKDPVHVKKNETPEVILTRFELNQNFINNHEPTEEE
                     IALIYTIKDNQCSNCSKRFFSTPEDAKKKALHLDWHFRTNKKLKAMSKQIHNRSWFLS
                     DQQWEQFQEDEIVGGNDNYDIGVGLNNRINEKPVLTEKEMNKKVVTIPDDAENEVICG
                     ICRDKLVGVFDDDSGEWIWRNAIKQRGRVYHYSCWIETKGQGDRDRSPERR"
     gene            <539710..>540735
                     /locus_tag="FOA43_000262"
                     /db_xref="GeneID:62193663"
     mRNA            <539710..>540735
                     /locus_tag="FOA43_000262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920595.1"
                     /db_xref="GeneID:62193663"
     CDS             539710..540735
                     /locus_tag="FOA43_000262"
                     /note="BUSCO:EOG093410UO"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776523.1"
                     /db_xref="GeneID:62193663"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR036867"
                     /db_xref="PFAM:PF01424"
                     /translation="MVDVSCSCGRREAQIMCFEHAKGKKLECDDECLREQRNNTLFAA
                     FNLGDSKTEGPLTLVSPELLAQRLAVDNTYTPEVLALYSKQPVWCTSIELIFSNLVLG
                     KLSRNSHHFSPMKMVQRQFVHELADAYNVFSESQDPEPKRSVFVKTSKESRRPTLSLK
                     ESLTVMRQVKQVEEEKAKHQQLVYALSERQNSQPPEEREHYNALAIRDVFFGITRDKL
                     EEATNDLWQDRTVLTKIQNCELKWIPDNTFVFYSDSYQEKSRVEEAELEILCDLFERR
                     LKERNLAMRCCLARIDDTASIVYEFKGENNRERRTLKNDHDGYDDEAPSELQDEKPID
                     KSSFDWW"
     gene            <541087..>542505
                     /locus_tag="FOA43_000263"
                     /db_xref="GeneID:62193664"
     mRNA            <541087..>542505
                     /locus_tag="FOA43_000263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920596.1"
                     /db_xref="GeneID:62193664"
     CDS             541087..542505
                     /locus_tag="FOA43_000263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776524.1"
                     /db_xref="GeneID:62193664"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MLTFVASISGFVFGFDTGYISSVLVMIGKDLDGRYLTIEEKEWI
                     SSSTSLGAFFASLFAGIMADTLGRKPSVMLCDLLFAVGALIQFFCGHISWMIAGRFIM
                     GCGVGIGSLTAPLYISELSPSKFRGRLVTINCLAITGGQLIAYAVGAGFSHTTSGWRY
                     TVALSLVPCILQFISLLFLPDTPRFMIMKKRYSDAFSVLRRVYPSSSNDLIEANIKEL
                     SDLNSSVPGNSTWRKIVNGNRMLFLVPSNRRALFIGCSLQAVQQFVGFNAIMYFSGTI
                     FEMLGYRNSISVSCVIAGTNFIFTVVSLFAIDKVGRRNILLITMPFLFSTQLLSAFSF
                     KHLNIDVTTNKADTLSGWDYMVMLALIGFVASYATGLGNVPWQQSELFPQSVRGLGSS
                     FTTGTNWFGSMVVSASFLTLMRWLTPSGTFLLFASVTAISFVVIYFTYPELGALQLEE
                     VEQLLSDGYNVTKSIKLHEARK"
     gene            complement(<542592..>544844)
                     /locus_tag="FOA43_000264"
                     /db_xref="GeneID:62193665"
     mRNA            complement(<542592..>544844)
                     /locus_tag="FOA43_000264"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920597.1"
                     /db_xref="GeneID:62193665"
     CDS             complement(542592..544844)
                     /locus_tag="FOA43_000264"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776525.1"
                     /db_xref="GeneID:62193665"
                     /db_xref="InterPro:IPR006597"
                     /translation="MSHFPRFQQKEQLTDVSPLEQLELSSRRQAADHRNSVTQAIADR
                     SYSSSSTVDTTLSSNSTTTPSSSNSDTFNGSFNLKNVSRQSLSSLLSTESSSTTGGLL
                     AKLRLDDAEWEAVYDGEDDNISLTRRSTLQQPSPIDPTSISIPASQFRSLRPLLNSLK
                     RKKFVNSAANSAKAMGNTVNRVRNDAPVLVSRADVQSIHIMRVSDGEEENDEDDDSFL
                     PSPQATSASGDDTISNSTEMDERDTLFSSINDTEVTQSTPFYEHHDITSSSPAVAPIT
                     PPRNGLQKPVRGFGHMHSFSNPVDTTTLVKRKASCPDSPLAKTFHHKFYHATAPSPIT
                     GISDYCSSGKQAHSDTVLTPTSQGPIVLHSREAMDQMKAKIVIDNLNYQRERANSLLR
                     TPSVPSLFNMSLDVAPADPSPKPPHASQSDPLGSSAKSSPLHVYRQLIHPSSSPSRMH
                     TANASHSFPIPLPDVRSQSRLPRLPVSPFRPLFLTNTLPPLVSFSPATSLHKPERSVD
                     SHHSAYAQSNNVSLSTQTISKEPLVQPPPIPISPLAMRNSCPSTMQSQTKTNSSLTPE
                     SRVSMAIALRKSGQSKEAAYQLQVAANQGNAEAMFLFGLSLRYGYGVIKDKRLSFLWI
                     CKSGGIVADKAYHFKVNPKIILDELGKGGTLLRPKEPQSSIFFEIGQAYLHGWGCRMD
                     TKQSLQFFELSGSLGYCDAMCEAGKMWTNKRLNGVKRDLFRAASWFRLAECCGAELIG
                     SEWIRKKKYD"
     gene            complement(<545221..>546780)
                     /locus_tag="FOA43_000265"
                     /db_xref="GeneID:62193666"
     mRNA            complement(<545221..>546780)
                     /locus_tag="FOA43_000265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920598.1"
                     /db_xref="GeneID:62193666"
     CDS             complement(545221..546780)
                     /locus_tag="FOA43_000265"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776526.1"
                     /db_xref="GeneID:62193666"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="InterPro:IPR038271"
                     /db_xref="PFAM:PF02133"
                     /translation="MSETNMEKNAHGNSLSDTDKTYFSQQTAEVVVCNDESKSGFSSV
                     SRSFKAFSAKLDALGAEARGIERVPPEERDYNMSKLNMFFLWCSGTGSLTSASGFFLG
                     PILLGLSLKDSMISGLFGACFGALVAAFTSTLGPKSGLRQMVGSRFFFGWYFSRFCSL
                     LNFISVCGFSVINCVFGGQILNAISHGKCPIEIGIVIISVLSGIVAIVGIRFVHKCEK
                     YMSVPLLIFFLLTFICAGKDFDNFTPSVGDSVTVAGNCLSFFAVCFGINAGWGSIASD
                     YYILFPEKTSSWLTFSVTFVGIFVPSAFVGSLAICIASAWLSNPAYQTAYDNYGNGGL
                     LKQALSRWNGGGDFILVILFLSLFTNNILNLYSMPLSVQVIHSFFFRLPRWFLTVVGF
                     IICLVCSVCGRNTLSNYLNNFLPMIGYWIIIFGTIIFEEMIFRGSKSNFNWADWNTKD
                     KLTHGYAASFAFCCGAAGAVVGMCQAYYIGPIAIKIGEYGGDVAIWCSLVFTGVAYPP
                     CRILEKKYFKR"
     gene            <547202..>548548
                     /locus_tag="FOA43_000266"
                     /db_xref="GeneID:62193667"
     mRNA            <547202..>548548
                     /locus_tag="FOA43_000266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920599.1"
                     /db_xref="GeneID:62193667"
     CDS             547202..548548
                     /locus_tag="FOA43_000266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776527.1"
                     /db_xref="GeneID:62193667"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="PFAM:PF01979"
                     /translation="MAKTVLTGGDILTLDEEDSILTHHCIVVDQETGLIEKIVPEDQY
                     TAADDDTVVDCTDQVVMPGLVDMHFHSAVARGWNDFMPLKEYLEECWYPSIRALDDES
                     CYWVALASYLEAIKSGTTHVNDMYRFVGSLAKAAQEIGIRATLCNDVALPENEIDTLD
                     DARESITKYNDLANGRIKVRVGIEWLPLADKQMLVEARELADELHTGIHIHLNESPVE
                     VEIVKKQSGGLGPAELAYEAGILGPDCIAAHCVHLSDREIGLMAKTHTFISHNPSSNA
                     KLGNGIARLFEWQKAGVTVGLGHDAAECNNSRDMFEVMKFCSLIHRANLQDPTVLQAK
                     QVLKMCCINGNIGLNYTKNKDEVPVKIGLLKEGYKGDIITLDIMNEKFIPITRGTDPE
                     HYYSNIVFSCNGSVVRSSVIDGQLVMKDRKMTNINERQVIEKANYYFNKIKNTIHK"
     gene            complement(<549132..>551345)
                     /locus_tag="FOA43_000267"
                     /db_xref="GeneID:62193668"
     mRNA            complement(<549132..>551345)
                     /locus_tag="FOA43_000267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920600.1"
                     /db_xref="GeneID:62193668"
     CDS             complement(549132..551345)
                     /locus_tag="FOA43_000267"
                     /note="BUSCO:EOG09341RN9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776528.1"
                     /db_xref="GeneID:62193668"
                     /db_xref="InterPro:IPR012955"
                     /db_xref="PFAM:PF08172"
                     /translation="MSETRNPHTKLVESTAVFDKALESWSIIDLPGLQKQLDKYALEF
                     QDYQKQSLLDRKHLASKTKSFKKLPSEEKVNEIKPLLKSYQKEIDDLAKKNKNVDNAF
                     FQFYRVIVEAPDPKSLLQMSLDAVSSMPELEKVKEENRQLEEKLLGFADYEQIKANNA
                     KLEEELIKAGISKVKAKDDEWQVILEEKQKNWDEEKKDYQRNVDVLKKQIEDMKINEE
                     MMKLKIDNKNKALRELDEDYEAGEEVENWKESKYVEVEDGNASTSLSSSANVQQRAAS
                     NIEIQILNRDVESLKLRIMELEKRNEELRREASLAKSGTANEKTIQAIKKRTSELESE
                     NSVLTARLEHERQVVDRLTANITAVNDTNDKNVQRLMTELDWLKNYKSQTRDYDEIKK
                     ELEVLRQIEFGDEDDVRQKEDQDPASVTSDASSGVDSAIVQRNKKLNKEVIEYRSENE
                     DLHKKYDELSSQLKDSVDQLKESRQINEKLENDLENLDSSASAAGNKDRWETMSMISS
                     IASSPMGDNGKISPATSIARGLGGNAGAGIMDPNRSLQDSSILPIITQQRDRFRMKNK
                     ELEEEAKKQFGKIVDLKREVRTLKSDNKDLYERIRFMEYHQATLKGADQVDTGSIDDV
                     ENRYKESYETQLHPIEKFRRMESKRISSRLSPFERVFIQVTKLILSTKYTRWLFAFYC
                     LGLHFLVLILTVSLMANTTSSMLPAKSIVSGSTGGIANGVVDRISGRSKLDSKQP"
     gene            <551661..>552176
                     /locus_tag="FOA43_000268"
                     /db_xref="GeneID:62193669"
     mRNA            <551661..>552176
                     /locus_tag="FOA43_000268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920601.1"
                     /db_xref="GeneID:62193669"
     CDS             551661..552176
                     /locus_tag="FOA43_000268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776529.1"
                     /db_xref="GeneID:62193669"
                     /db_xref="InterPro:IPR006001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031322"
                     /db_xref="PFAM:PF01202"
                     /db_xref="PFAM:PF01583"
                     /db_xref="PFAM:PF13238"
                     /translation="MSRVIFVGGPSGTGKSTISILLSKKLDCPFIEGDEFHPQANIDK
                     MSQGIPLTDEDRWGWLSILCQAAISVVQGGENTVVVSCSMLKKKYRDYIKETIGTKAQ
                     TQLFVLYNDFSTIYKRMETRSNHYMKANMLKSQFDDLEVPELEDHVYKVFCGTKEPEQ
                     IFVEILKYINL"
     gene            complement(<552246..>553808)
                     /gene="SSN3"
                     /locus_tag="FOA43_000269"
                     /db_xref="GeneID:62193670"
     mRNA            complement(<552246..>553808)
                     /gene="SSN3"
                     /locus_tag="FOA43_000269"
                     /product="cyclin-dependent protein kinase"
                     /transcript_id="XM_038920602.1"
                     /db_xref="GeneID:62193670"
     CDS             complement(552246..553808)
                     /gene="SSN3"
                     /locus_tag="FOA43_000269"
                     /codon_start=1
                     /product="cyclin-dependent protein kinase"
                     /protein_id="XP_038776530.1"
                     /db_xref="GeneID:62193670"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MAQPVPNAKGLPDQQLSFSYMQQKGQVPGLKSVSNSVSSSHNQG
                     DAQHLPDFTMPVPQTLRQPAQTQRSSRTQPLSQTGARSSQPTNSQQAIHPNRQNFAYG
                     AVGSKPTRVASNDFFTIGPYRKRKDQSRVSVVERYDILGYIAAGTYGKVYQARGKLGA
                     FKDNLYAIKKFKTDSKDNEVAHYTGISQSAIREMSLCKELNHKNISKLSEIILERKCI
                     YMVFEFAEHDLLQIIHYHSHPEPRPIPQLTLKSALYQILQGLSFLHQNWILHRDLKPA
                     NIMVTSDGIIKIGDLGLARKFNNPLQGLYSGDKVVVTIWYRAAELLLGARHYTPAIDM
                     WAVGCILAELLSLRPLFKGEETKMDNKKQIPFQENQLLKILEILGTPTLEKWPSLNSY
                     PEYPQLSRFTLFPSNLKAWYHTNGGTNKNCLKLLSQLLEYDPSKRINALEALKHPWFQ
                     ENPKPVANIFEESKFEYPQRKIQKEDIDILGKGQGQGPYNRMQHYGVHHGKRAYPVAN
                     GAEYELNRKRLR"
     gene            complement(<553954..>554667)
                     /locus_tag="FOA43_000270"
                     /db_xref="GeneID:62193671"
     mRNA            complement(<553954..>554667)
                     /locus_tag="FOA43_000270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920603.1"
                     /db_xref="GeneID:62193671"
     CDS             complement(553954..554667)
                     /locus_tag="FOA43_000270"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776531.1"
                     /db_xref="GeneID:62193671"
                     /translation="MLPLFSFQAKCLLVGGPSRVFYTPSIYLLCGNHSTGNRAQSMIR
                     YFSSTRSYNLIYQPKAKVSKQKEPVAIDTKKKHLSISDAEDAAKDACLLKNKYYLRCP
                     KILRPYLKEVMVRPVGFGFSIVILQQVFVVVPFLLLWYYYFQVGVEPDQSNENLKKGL
                     DTIKKGLVNLDMDDESKLKMAIAGAASYALTKSLLPVRVPVCVALAPWFDKWCIRPII
                     RILTAVFKKNAVVKPRPRK"
     gene            complement(<554788..>555373)
                     /locus_tag="FOA43_000271"
                     /db_xref="GeneID:62193672"
     mRNA            complement(join(<554788..555328,555369..>555373))
                     /locus_tag="FOA43_000271"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920604.1"
                     /db_xref="GeneID:62193672"
     CDS             complement(join(554788..555328,555369..555373))
                     /locus_tag="FOA43_000271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776532.1"
                     /db_xref="GeneID:62193672"
                     /db_xref="InterPro:IPR004313"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR027496"
                     /db_xref="PFAM:PF03079"
                     /db_xref="PFAM:PF07883"
                     /translation="MNQAQFYYYDEESDKPYTDDHNSGQAVDEKQLANLGVFYKHLRT
                     LEEVDILARKRDYKNRDTINLKEEGFPGGKNALDAKLDMFFQEHLHEDEEIRFILDGE
                     GFFDVRDINDRWIRAKVFKHDLLIIPAGIFHRFTLSNSKYVKALRLFKDEPKWQAFNR
                     TTPGIGENPYRKQYLDQVLTK"
     gene            complement(<555520..>557781)
                     /locus_tag="FOA43_000272"
                     /db_xref="GeneID:62193673"
     mRNA            complement(join(<555520..556070,557205..>557781))
                     /locus_tag="FOA43_000272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920605.1"
                     /db_xref="GeneID:62193673"
     CDS             complement(join(555520..556070,557205..557781))
                     /locus_tag="FOA43_000272"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776533.1"
                     /db_xref="GeneID:62193673"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /translation="MTSKITETIHDKLPDGTDVTILPYNSVDEASEELVQSLQDLMNE
                     VIEEGTTYVQDQTFDRQGFLNYYFSYFVAVMVEGNVRDAQALDMSKNRLLGCFYIKPN
                     YVGRSAHICNAGFLVPLNLRGRKIGKTMGKNYIKIASRLGYKYSVFNLVYATNVASLK
                     IWDDLGFQRIGRIPNAGQMKGQGYVDAIMFGYNSDTDSATESDADFDSNYDLDMPNSC
                     LFSSQLEKNERSNIMSLVVLITSNQINKKTGSTSKNLCNFLTDMVRRSHISLDQYMTN
                     LVIMQRLFANDDTADCQFFNDTRKLILYSFMLGSTTSSNIDFDHWCEVTGLSKSQLAS
                     ELVELGHALGGLHTIKTVSLEDLQVMKDSLKSEVKKYVKVI"
     gene            <558095..>559711
                     /locus_tag="FOA43_000273"
                     /db_xref="GeneID:62193674"
     mRNA            <558095..>559711
                     /locus_tag="FOA43_000273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920606.1"
                     /db_xref="GeneID:62193674"
     CDS             558095..559711
                     /locus_tag="FOA43_000273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776534.1"
                     /db_xref="GeneID:62193674"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR018287"
                     /db_xref="PFAM:PF10297"
                     /translation="MSSPSISPRVPDNSDIITSLRRVTSLAGRNSVNVVSSRPITQIV
                     TSKTWVLPPRPKPGRKPSSDIPSTKRKAQNRAAQRAFRERRANRVGELEQQLMELERD
                     NSVKEGVLCNTVKTLQSENCGLKKQVEEMKNTISRLTDEVKSLTQEKSKAVHSDPVSP
                     AEYHVSAKRRKGSGVRSMNNSSLSVSSDSEPLTPPRTETLSKSHNSTEIAEAASVMIN
                     FKNSGSVPSSLSVKTDKCGLCSRDECMCKDAGLRESRNSSGSLSDILNGFKPMAAVPL
                     KSGTSSEIDFTTKSKSNLMRKMPTLSNVVSAVKASSMSSSSTSSSSFLDHAAANSSDG
                     VNYEESVISPDEKCGFCSEDTPCLCREIAEQKKLRDDSKSKSSLEALSSSILSPERLQ
                     QIKKQIAMCTGSPGSCPQCQKDPMSTLFCTTIAATSGVRFQEAPVLRKSNGKNKAGTI
                     LPAPRALIEQKKNADRSQIPSLVELELSNPGKHYVPCADAYRTLSRHANFRRAGLSSV
                     INNLNTNGMFVEVESIVKCLRQLDSQFGSN"
     gene            <560454..>561548
                     /locus_tag="FOA43_000274"
                     /db_xref="GeneID:62193675"
     mRNA            <560454..>561548
                     /locus_tag="FOA43_000274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920607.1"
                     /db_xref="GeneID:62193675"
     CDS             560454..561548
                     /locus_tag="FOA43_000274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776535.1"
                     /db_xref="GeneID:62193675"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PFAM:PF00153"
                     /translation="MNTGTGLPQRNELTTINGNNARGAFQRFRLSQSQITSLAGAMAG
                     FCSGVAVCPLDVAKTRLQAQGSYLEHIKGLETKTIAKFDQCKYRGLIHSMSLIWKEEG
                     IRGLYRGLVPITLGYFPTWMIYFSCYERCKNIYGKFIEDDNISYFMSAITSGAVSTTL
                     TNPIWVVKTRMMLQMDNGKTIYDRLPMEKISLEKAGSKTLTQWYNGTFDAFGKMYREE
                     GIGSFYRGLLPSYFGLVHVAIQFPLYENLKKWFNIQDYMSPSVKERDLTMFLKFALAS
                     SLSKMIASAITYPHEIVRTRLQMYSNSFLGENQLVGVVKTISSIYYNEGLRGFYSGFL
                     VNLTRTVPASAITMVSFEYFKKVLQRFSKN"
     gene            <564429..>566533
                     /locus_tag="FOA43_000275"
                     /db_xref="GeneID:62193676"
     mRNA            join(<564429..564432,564465..>566533)
                     /locus_tag="FOA43_000275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920608.1"
                     /db_xref="GeneID:62193676"
     CDS             join(564429..564432,564465..566533)
                     /locus_tag="FOA43_000275"
                     /note="BUSCO:EOG093411ZR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776536.1"
                     /db_xref="GeneID:62193676"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR022192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF12513"
                     /translation="MKSQLIRETSMIGADDVHHSTDERRVLNDFITPHESNAPYLIDY
                     VAKHKNDLNDIPWHIPASVPKEEVPQRVVDGIVERLVYSSMKPHNLQFVYNDSSNNQN
                     FNNNLTFNIMDIDNPYEWFPEARKLKRKFIMHVGPTNSGKTYHALQRLENCSKGYFAG
                     PLRLLAREVYDKFQSKGIRCNLVTGEEVIVDVDESGNKAGVTSGTIEMLSLTENYDVI
                     VVDEIQMIGDQFRGSAWTNAILGARAKEIHLCGEASAVPLIKRLVAMTDDELEINEYN
                     RLSKLVVDDETAKMNDLRKGDCIVCFSKTSILDMKLQIEQQTNLRCAVIYGALPPETR
                     AQEAQRFNDGYYDIVVASDAIGMGLNLKINRVIFTTTQKFNGRQNVSLSPSNVKQIGG
                     RAGRYGMGDSVGHISAISEDELVNVTKGIESPIEFIDRAVLWPPDDLWVRYYSMFTKD
                     TDALTMYRKFETDLSKLYRSTRKMKRDFKVESLDEKKVMSEFLHREKLKKNFNIADQL
                     RCISAPTTLTTNPNQPLKVVLNYILKEFIQNIIKRTKKSLFDFDAVPFYLLSTENLIN
                     SGTSRNKVLSKRNSPLIEAEPIPAGIKNKILEKLEKEELEHFRSRKSYVKRLNPIEDR
                     LMKLEQFHKMLSSYMWLSYRFPQNFIDIESAMKLKELAEFKISEMLGNLRSTSTMNSR
                     RFKTFSKH"
     gene            complement(<566602..>569523)
                     /locus_tag="FOA43_000276"
                     /db_xref="GeneID:62193677"
     mRNA            complement(<566602..>569523)
                     /locus_tag="FOA43_000276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920609.1"
                     /db_xref="GeneID:62193677"
     CDS             complement(566602..569523)
                     /locus_tag="FOA43_000276"
                     /note="BUSCO:EOG09340F9S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776537.1"
                     /db_xref="GeneID:62193677"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR007810"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="PFAM:PF00637"
                     /db_xref="PFAM:PF05131"
                     /translation="MNDEIESYSGHEAGPRFSLEPVQLQFQIASRIKKLLVSNNFLYL
                     VLIDGLVYRINLDSPETVDKIAIELSGATVKQAYLDRKGYHLIVQSTKDSFYYLHYQS
                     THYKELSKMRELPVVSISFFDKYSHKNTTGPMVVSTSTGIVYEVNIESKKERIMKQIW
                     KSRDGIKYTCVSSMTQSKGSYVVYRVLCALTNNKIVQFCCTLPDTVSSSSSSLQSSFE
                     KGPISFNFNSLIHITSNIDTVAFLDVSEEDSSYQITYGRVDFKSKKELSHLKLDSATG
                     SAVASISLTKYYIMILTTRNELLVFNQLSGKEVSKQNLSTTGNRFIGFSSDKLLETYW
                     LYSSEAIYEVLVENENTGIWRLMMEKKMFDEAISTLKNPHTSDAEKYHTIRINQGKFL
                     LKKGSFNKAAKILAETSEPLEEITLKFIESNQLKSLRIYLSNKLKALPKTFYMQKVII
                     SSWLVELYVEGLNQLDVEMGRSRSNSIIDTAEVIDEQIAQRKEKFLREFYSFLDESKN
                     DLDKDAVYQIILSHNRKDELLYFANSIKDYNFVLNYYINLQKWEESLKVLSLQKDKAL
                     VYKYSTLLFVNYPVKTCDTWIRLIDDLEYLKLLPALLTYNQTVVKARRIRPNKNQALR
                     FLNFLIEERKVKDRIVHNSVLSILIRYPNLKNEDPILKYLEGQHKSKSLFTSDKNDFD
                     ISFDPDYILRLCLKYHRYQSAIYIFSMMGEYEEAVDLALDHDLIEYAVLVTDKPAESS
                     IAVRKRLWLKISAKLIHSLIEHDKSLDEYRQLLMIDENILTKGGEIKCLLKYLMSKCE
                     YLKMKDLLPLFPDFMVIDNFKEEVVKSLQDMSSEMSNLSLEMTESIAQSSKIGQLIKD
                     FKKDNFQIIEPYESCMICRKILTTRKFIVFPCYHSFHQDCLVKDILRSNDYKMKSEVY
                     KLQKRIVDNSGDKKALGELRAEIDNLLSRKCCLCSDIKINEIEEPLVGLDDKEEDDWK
                     L"
     gene            complement(<570197..>572005)
                     /locus_tag="FOA43_000277"
                     /db_xref="GeneID:62193678"
     mRNA            complement(<570197..>572005)
                     /locus_tag="FOA43_000277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920610.1"
                     /db_xref="GeneID:62193678"
     CDS             complement(570197..572005)
                     /locus_tag="FOA43_000277"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776538.1"
                     /db_xref="GeneID:62193678"
                     /translation="MSSGTISGSDSTGNSGSASANSKDNLKAGSSKAGSSKGSSGKGS
                     SGKGSFGTEASLGNTSPFKAGVASTRSGASSFFKEKANRLSLLSSYSGVVHNADVDTI
                     QYVVSKSPTRETSVLSNAFSELRTVTSGNTPTIPQSPSNSIRHSLTLKNINKALGESA
                     QDCTTTPTIYTPPVSEVGSIQVPLILPTTPKTYHQNDMSSNKTPDREQTMDLEIPIPA
                     RSAKRPNSVYLDPSLVSPSNSLKDFNADSVTLSLTPKKKSRINLMGPRSPPPISPLPS
                     PTKDNFITELALSDKGHKRTSTVDTTGTLGTMDSMTSKRSEVIGGKLDDIMQQVENVR
                     CEIDGKAQPVNIRTPTTPVSLVSNSSGKMGVESHSILTSTESFHTAQSFDSDWVDDEE
                     EEKDNENDEQESLQTSTLPNVQSSLDRASISTLQNPAYVSRASTVTARDKHQSGTHIS
                     PQGYTTSRDWFNKTSTGGNRALPGTASSSKYSLQQPNIPRPSENAASEYPSSSIVDSP
                     SFRASVLGKTKKKNNKRVKSFSYDTLARLLNATDGIVIGQEFANLGMPNEEKYLIEKI
                     VTSLSRLTANMMINPNRYDQSCTRLENVLNMLEGFD"
     gene            complement(<572296..>574908)
                     /locus_tag="FOA43_000278"
                     /db_xref="GeneID:62193679"
     mRNA            complement(<572296..>574908)
                     /locus_tag="FOA43_000278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920611.1"
                     /db_xref="GeneID:62193679"
     CDS             complement(572296..574908)
                     /locus_tag="FOA43_000278"
                     /note="BUSCO:EOG09340X60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776539.1"
                     /db_xref="GeneID:62193679"
                     /db_xref="InterPro:IPR019167"
                     /db_xref="PFAM:PF09770"
                     /translation="MSFFGFDPKGSPDHQNDSQNNKHDGKVDIDRFQNFEDQLNSDDE
                     DALNDETFGTESGKIGADFDFSSGFGSKPASSSKGGLKAASTPARSSNISYAQAAHTT
                     GRGTENSSLKPMESLWNDQNQGIAGASAPINSQEIGNTAEPEKKVFSLEEIEAKLRAQ
                     PPISQPQMAPQQQLPPGMNPFMLPPQAQQQILASAVASGRFPDMQTAARAMSQMLMAP
                     PPPMQQGMMPPQFMGFPQMPMQPMPMHVPPIPQGPQLQQVQQAPQQPIRTAPPMQATS
                     QPSQPIDEAPIHRVDQSARAQTAEDKTDSNSFSSIDAVQSDENQSQSTQNSSSFSSRS
                     SPPSSQQQQYQRRPQHQQQFHQSGFQGYRGGNNYKGHHFYNQQQRQYQHQQQMENMSP
                     EERAKFISRQEKVNRITRASGFMNPRDKDFVTRFQLSQIVTDDPYNEDFYCQVYKVLN
                     SSVEENSMNSLAKKYLEQSGHRLGGRSKRADIALQRMQQQVSRAVSVAKERGQRTGIL
                     SKEGALGKVSFATGRQPRQMLVVNSEETEKTQEIDDDNLLPKEYKFSKSSRSFQLSII
                     EKVYSEVLKSESRERENEKSSDADLWKSLHLNDKMQTSTNEMIDPFISVLSFDKMMKV
                     FGRVFHLLTAEHQIGVVELIFSNLQKIDVILKGSYKNYVQENYQIPEEVNNKIGLFQV
                     TILKSLVLYLSESKFALVIHFLQCVVENNNVLFLSTAKIGLSLVTVLISRLELIKQEY
                     AKDLSAQDLSQWQQIYDSLFQCLEGRLVSVFPPYFSNDEQKMVRNDESKGDDSYIWQF
                     LASLSLAGQLSHQRVIVDEVRNEIFGAMGAAKKLKEEEKQERAEKYLNNLNLFLNVMG
                     LKASENDITELSDN"
     gene            complement(<575156..>576157)
                     /locus_tag="FOA43_000279"
                     /db_xref="GeneID:62193680"
     mRNA            complement(<575156..>576157)
                     /locus_tag="FOA43_000279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920612.1"
                     /db_xref="GeneID:62193680"
     CDS             complement(575156..576157)
                     /locus_tag="FOA43_000279"
                     /note="BUSCO:EOG09342UTJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776540.1"
                     /db_xref="GeneID:62193680"
                     /db_xref="InterPro:IPR007188"
                     /db_xref="InterPro:IPR034666"
                     /db_xref="PFAM:PF04045"
                     /translation="MLLLQPENLLIEKTFTKALAVGYVPMTLDRIVTDFDFTAYHIST
                     PQEKTGILLSVAIKCWNDLVAHGTTELLDTIYSKYSAFLQILSEDNAEPGYNYSLYIQ
                     LDKANLATEEEKFTLIKDLSLLKRNSFAAPFLEAFKKYTELAEEQPADPNNIYGEDSA
                     TRSDGKVIALNYRDRESIFIKPSNDRVTVIFSTIFSDETDRVFSKIFLQEFSDARKRS
                     IQKAPQVINSHHEIPLEIQSLEKENNDNKSYITFVLFPRHLSTEEVQWNTITQIGTFR
                     SYFHYHIKIVKCYLHQRMRFRVQSFTKVLNRARREVSEEEHKAERKTASGRRFEQRN"
     gene            complement(<576441..>580520)
                     /locus_tag="FOA43_000280"
                     /db_xref="GeneID:62193681"
     mRNA            complement(<576441..>580520)
                     /locus_tag="FOA43_000280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920613.1"
                     /db_xref="GeneID:62193681"
     CDS             complement(576441..580520)
                     /locus_tag="FOA43_000280"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776541.1"
                     /db_xref="GeneID:62193681"
                     /db_xref="InterPro:IPR032675"
                     /translation="MVTDKSSAQNDQQHKKLRQRLEDELSFRNSELEAADYDWFVRSS
                     GSSIAPLNSLKPPGVTDGASQKAAPSVSANRSNATSLSVGLKRSKTNDLGSLPSTEDH
                     KEHTDPAALSKLTRTATNVTLSDVSTPTGHSGILGTSTGTGRPRSRSTNPDIGYPFPL
                     SEDSHPTQHRKEAKGSFFKRLFGKKEETKHFSSSRKPSLVISPTSAITPISIPSTEKR
                     ASISSVPSKLSPSSSATITGSGAASEDMASDSSVLSIQGRKIASNSESSSTIQSADSS
                     AAPSSTSETLSDQYKDIDPLLARYLRDIEAASNDSSLHKCISSDLSRIFRPGAHFHLN
                     YKGGVIPPHPDQPKLSSAFSMNPRFGGSIELELFEKSKRERAQSKESAGVFGSLLRRQ
                     KSNPTENALMRVMCNESEASPPLNFKHVPYVKPPPKVELKPPMEPLRDVKPLKKVAFA
                     TTTFVNDPPQQIPSRHPRKGNVEIGPSGELIIHKITAEDKAHSTCGIVVGGSGHLKLM
                     SEMNPENNPDNENREVADKISDSESSTSTSPAAPVMSRTPSDHTIREEDKILAAEKAL
                     QNAGAHADENTEGNLRKDKIMIDTPMVRRRRQMEKPVVTLKIDELYTRCCHLREILPI
                     PATLKQIPKGSTDPIPVLRLRNPKPSMIEILSFTDFIRIAPIICLSLDGVSLTHEMFR
                     LILSSLLYKRYLEKLSLRNTPIDGDGWKMLCWFVSMNKALKRLDITQCPALSVNTQKV
                     HKHKKKPNVAELPRMICNMEDRGDMDWPLLTASIIYRGGIGEMILSGCKIRDNRMFRS
                     LLHLGLSHTRKLGLAYNDLNLSQCEIVAQWMHENKDCTGIDLGYNDMSNNLRPFIDYA
                     QSARLHDQLWMLSLNSCNLIDSPEAEQMFNSFSKLQHLKYLDISNNSKFFRTFVNKLF
                     AYLPLFSELVRLNFDDNGLDSMSMIKLCECLPLMAHLNYISIRGNNMDESVCIALCRS
                     LQSSTSIFTLDFDRDSVPERFQRRFGLLTMKNMERTLYDDNKDNKSTFLGILGETEAD
                     DIRKSLNIPDGVSFGEALIDVIKKGDSLPPGEVGKYVSVAARLRVKMKEMISELMKLH
                     VIGKLSIEGKELLIRLINFDSSISKGIELTDSVHFGKKKSADTSSMAAKELFDRMFEN
                     ERTLPSSSPGARENEAIEIKSDDTDLPTSMSPEAVEASSAMISAEARAFKAHADNGTL
                     GFKDKVKSAVSAYYGALSPENKEKYKRVMMHTHDAFEVVRLLNGLKAKGVCLSDLYRK
                     RPDNTVVNTKANARKSGMTVVENKNAASGEETDEAKEEEDGAFGDGLSDMMNADESFE
                     HHDDMMVLYDKVLKDLVDEANKRRQGNAEKTALAATNSD"
     gene            complement(<582082..>582816)
                     /locus_tag="FOA43_000281"
                     /db_xref="GeneID:62193682"
     mRNA            complement(<582082..>582816)
                     /locus_tag="FOA43_000281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920614.1"
                     /db_xref="GeneID:62193682"
     CDS             complement(582082..582816)
                     /locus_tag="FOA43_000281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776542.1"
                     /db_xref="GeneID:62193682"
                     /db_xref="InterPro:IPR036291"
                     /translation="MSKACDKFEKVALINNANSPIGKEITKLLAKRSVKVYAVDRDSL
                     FYIDELLKNNPEMESNISPILLSKNKTVTDLSDLLTREGTANVHIVVDLNLSENELVT
                     DDFKFVSNLIDSSLVGESCVFCFGNVNAINSPSVLKAANEFIDVVQNEVEAKLGEQHS
                     AVINLFDPRALSRYNPEDIASFYINSLIRCSYRVSRIGNLKDVLYTAMYYGLPLNAYK
                     YMEETGQMLEDWTSPNLNDVGEPELL"
     gene            <583778..>585241
                     /locus_tag="FOA43_000282"
                     /db_xref="GeneID:62193683"
     mRNA            <583778..>585241
                     /locus_tag="FOA43_000282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920615.1"
                     /db_xref="GeneID:62193683"
     CDS             583778..585241
                     /locus_tag="FOA43_000282"
                     /note="BUSCO:EOG09341TZ7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776543.1"
                     /db_xref="GeneID:62193683"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00155"
                     /translation="MTLPRSGVPAPKLFDTDLNPNILKAKYAVRGRIPAKAEELRKQL
                     IKDPGSLPFKKIINANIGNPQQLDQKPLTFYRRVLALLEDPELIENEEIVNCFPSDVV
                     LRAKKILDATGSVGAYSHSQGVPYVCQSIANYISRRDGYPSNPEDIFLTAGASTAVKY
                     IIDLLSLGPKTGFLIPIPQYPLYTATIALNNTHALPYYLNEDDDWSIDSSELIRVIED
                     AIAQGIKPRCLVVINPGNPTGAVLKKDSIVKLLDVAAKYGTFIIADEVYQENVYKGEF
                     ISVKKVLRELQATDKTGYYDNVQMASLHSTSKGLSGECGQRGGYMELVGINSSVKTQL
                     TKLTSISLCGPVISQALMSLMVNPPKPGEPSYELDHQQRQKVFNDLSTRAHTLYTAFN
                     EMEGVSCRNPMGAMYCFPRFDLPGGAFKAAEKAGLSPDVFYCERLLLETGICTVAGSG
                     FGQAPETWHVRTTFLPPGTDWINYWKVFHADFMKKYR"
     gene            complement(<585332..>587314)
                     /locus_tag="FOA43_000283"
                     /db_xref="GeneID:62193684"
     mRNA            complement(<585332..>587314)
                     /locus_tag="FOA43_000283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920616.1"
                     /db_xref="GeneID:62193684"
     CDS             complement(585332..587314)
                     /locus_tag="FOA43_000283"
                     /note="BUSCO:EOG093412WM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776544.1"
                     /db_xref="GeneID:62193684"
                     /db_xref="InterPro:IPR007246"
                     /db_xref="PFAM:PF04114"
                     /translation="MALLEIIQNKITKFGLVPRLVKSLPKVSVFLVLSSILWLVTLPL
                     NGQFRETYISENALMPSQAYSFFRESEWNYLRGYRDEIYQHKLDPIEDRNDMLDDWLK
                     EIGYKTARLNYTEPQTGEFKPTLYAIYHAPKGDDTEAIVLVAPWHTSDGIINLGGVPL
                     AISLARYFHRLSIWAKNIIVVFPEDGQDTLRNWINAYHTSMDQTGGSILSAIVMEYAS
                     GGDGIDYVEVDYAGLNGQLPNLDLVNSAVMISDHEGLKVSLHGAPRGQLWADDFSSRL
                     TMILHAVFDYALTGLLPPAGKGGGNGCEAFSGWNIQAITLRAVGDGDHDVTTYGRVVE
                     AMFRSVNNLLEKFHQSYFFYLLLGPSSFVSIATYLPAAVLAASAFAIASASSLLGNHN
                     VSNAKFQFSPSFVAPSSSHSAIAALIGFVTALSVSVFAGLKLQSLSQTSPYNNETMRL
                     YSMITYKVCVIPSFIITLWPVISSYTISLKKSRVTNDTVRLLNAFSLFYFAFTLIALL
                     VLHFSLSFVISLVSLPLVFVRYGPNNDKKTRWCSSLCLLMSCPFMWICILGVFSKTNF
                     QLDRIRNLLQYFRIDLLRKEIQSVIDWSDAVDLGQLLQGPVDLFYGLISGYPRFQNWT
                     WLFLVISWIPAWISTLLVSGIDVESSDLQVEKEKDE"
     gene            complement(<587514..>589463)
                     /locus_tag="FOA43_000284"
                     /db_xref="GeneID:62193685"
     mRNA            complement(<587514..>589463)
                     /locus_tag="FOA43_000284"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920617.1"
                     /db_xref="GeneID:62193685"
     CDS             complement(587514..589463)
                     /locus_tag="FOA43_000284"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776545.1"
                     /db_xref="GeneID:62193685"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF12678"
                     /db_xref="PFAM:PF13445"
                     /db_xref="PFAM:PF13639"
                     /translation="MSATDHSITQQERLASRGIIEMPSGRLRLPPVIIQYADGTTQNL
                     FLEVGHQNGELAAYSTTLLTDFLLSRGQRASMNGFPGVNGANGVNGASQTGATSSGTA
                     SGSSFTSVAPIPITATTPVHSNPTSTSHPRGIRGIDYPAFDVSREGIYGEERRNRSDF
                     MNEIMGPIQRALESADSANTANNATATGNDDHSETSRNIILTVNYIYGQSPNAAPITT
                     TNNGNAANNSDGITGSLILHVPSINENDEENLQVLVRLATIIALRTISSSIKKASGVP
                     DQVFEDFKLPQLSCIEKSDRQCPICYEEYQSSQEEDKLNDNGKRPMLTENSPSKKRQK
                     TVTGVKHTKSTGTEPDAESKEKRQKYSHVPVEMPCGHLFGRTCLYEWLKTNNSCPLCR
                     DKIRHTKGSESGYATTVVLPNLAQVVSDSREVIDGFNSRHLAFLLPDSNGNISEPNGS
                     PDQETALPVTLPFRFPTIVALHPEANGRGISAVAGTAGALGATGGVSITDPAVRPNQS
                     VMGIVRNLIQNINERLHHPIRLSNDAGTTAAISNGFLDHMPIVRTIRRNPRTFQARRS
                     SSQLRRRLDRSRAAAQSTSAAHESLFPMGVMSRRVEHGVITSSINSRSAEENDEQESE
                     NGPQQDTLNQDDTQSAEPHSHSHTD"
     gene            <590018..>591493
                     /locus_tag="FOA43_000285"
                     /db_xref="GeneID:62193686"
     mRNA            <590018..>591493
                     /locus_tag="FOA43_000285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920618.1"
                     /db_xref="GeneID:62193686"
     CDS             590018..591493
                     /locus_tag="FOA43_000285"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776546.1"
                     /db_xref="GeneID:62193686"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR036063"
                     /db_xref="PFAM:PF01713"
                     /db_xref="PFAM:PF02845"
                     /translation="MGKDNPDLELRSKLLQLSEMFPDIPLGYINETLVLNKGDAARTT
                     DELLNYKVTETEKTVQAKNYGVPSDTDNESDHSVSNNNEIYDDKMSVKELKEWIRRID
                     FVEEVLDLLKLEAKYKPWVEYYSEQHNYKLLDTVSKMIENFDPDLPPEKQQTISYRTL
                     ATVSKMQDHSDDQNSSRIPVDQVELSPDPIIQKQSAAHLLAKVKATTYSKIQGGYTVI
                     RPSAKQQKNEIVAKSVKVDMGSESMKELIAIRESNVVLLRLPMSFYVNGMRFFENSVE
                     AVIYVASVVAPLAPFAPETPIPDKLYSKEIMATAAPKQPPKSDCCWSNRHPVISERGP
                     SFDNLLSSAKRMQSKAAMCNDKKIKPIYASTASEKYREAFNSLQSGQAREIRAKVEQS
                     KQTNQIDLHGLLVDSALQCCKEAVSSWWQDEINARVIHGDSLRPEKAVHVEYFRVVTG
                     RGMHSAGGVPRIKHSVRKYLTRSHYIFEEESSALIVRGKRH"
     gene            complement(<591557..>592138)
                     /locus_tag="FOA43_000286"
                     /db_xref="GeneID:62193687"
     mRNA            complement(<591557..>592138)
                     /locus_tag="FOA43_000286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920619.1"
                     /db_xref="GeneID:62193687"
     CDS             complement(591557..592138)
                     /locus_tag="FOA43_000286"
                     /note="BUSCO:EOG09344L38;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776547.1"
                     /db_xref="GeneID:62193687"
                     /translation="MLSRIGYKPTGYKLVRLYVTGPIKIPSALPERPVKKIRIGKARP
                     AIYYKFDTLVELSDGSVIRRRSQFPKDEIRMISDQRNNPIWNASKPDMSILDAEAKGK
                     LSKFKSKFSAFEDSGKTQEELEAESKKAEEERHIKLMTGAAPKKTKEDHDDWLDVLES
                     NYTEQKLGGKVAQKVRTKKKKAADVDDRAAPKK"
     gene            <592408..>595242
                     /locus_tag="FOA43_000287"
                     /db_xref="GeneID:62193688"
     mRNA            <592408..>595242
                     /locus_tag="FOA43_000287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920620.1"
                     /db_xref="GeneID:62193688"
     CDS             592408..595242
                     /locus_tag="FOA43_000287"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776548.1"
                     /db_xref="GeneID:62193688"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="InterPro:IPR031468"
                     /db_xref="PFAM:PF15413"
                     /translation="MIQLLWYVVFYIVGGVTLAPLVLVSLWISSPKAQITEEDKARDE
                     TKKSENESQRKGNPKGYSTLKSTEVYYDEDLDVKAEFEGWLTVTHEFYTLPEIQADQY
                     RSNASFNGNPTENTSDSSSNGTGFIRMVKEIGNNSSKDPQPDVGGSDAHQLKQVRKRS
                     RFFAVLKHKNLFLYRDETRKDVQHVIVLNSYFVTMWPRNLVDARLFTKYTAICLLKKQ
                     VSQPTNNKPKPLSTKELLYLLHKGSQNTALPAGSYFLYGDTNHDKEDWYFAILRATSV
                     ADSVSNGTDDDLLNSTLNAKPLFFNTSHMIDLLQTINSTEGQLSTKWINALIGRLFLS
                     VYKTDAFKQGFKKKFDEKLRRIRTPGFLDELQIGHINVGKSAPFITHPRMKHLTPEGD
                     LELEMVIDYSGGLTVEIATKVFLNLGAHFRQREFDVNLKVILRKLHGDLLVKMKPLPS
                     TRIWYTFKSMPEIDLEIEPVVSSRTVNYNLVTNILDKRFKDAIRTTLVYPFMDDILFF
                     DTSKEIFRGGIWDHSQTASKSKAISKNVELDQASENAPTSSSNTTEAFVEIAADFGNH
                     ESTGPTSTSVSGTDDSNTVTTPFAEAPPPELVIENEDGDADSVSNASMHSHSPSVTSS
                     FQKYTTGGKNIIRKYSSFGSNSDSHTDTEKSELSQAAVQIKNGVNTSVSKFRQWYSKK
                     TSSETHSRSGSSENNYNPPEMITSRRKRDSSLSSSIISMEGSESITGNQAQINISESP
                     PSPEMFISENLRRQRHDPDEYMEVLGSQSVVSPVLDDKTIDAKSTDTLQSFSVHNVQD
                     TIPAQAGMSVWENSLKTAEKLHHAPDIGDSATTETITAPENTEYVAVEPFASADTTTM
                     TPLKKVIPPPLPQRQVPTLEKINTPPKLPSRSLTTHRKPPPATMPSTLPASSTGEPQE
                     ALNSSNAGSSPNSLLDVATLPKAPDPSTVL"
     gene            complement(<595338..>599978)
                     /locus_tag="FOA43_000288"
                     /db_xref="GeneID:62193689"
     mRNA            complement(<595338..>599978)
                     /locus_tag="FOA43_000288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920621.1"
                     /db_xref="GeneID:62193689"
     CDS             complement(595338..599978)
                     /locus_tag="FOA43_000288"
                     /note="BUSCO:EOG0934061P;
                     MEROPS:MER0026493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776549.1"
                     /db_xref="GeneID:62193689"
                     /translation="MSIALEYPLVSSRVTPRTPRHHHHHEADNFPAQRFKVGYQKVIL
                     DIDLAEQTIYGETEITALPLEASLKEVKLDCHGIQIKSVIVNQRCARFSYLDFGQNDE
                     YMNDTDNSVLADYKYDSYVDTNSTTSSVEQHHFYRGKHYPLYSDQNNASHPSSSYPQS
                     SSELVIKIPESIKLRLQTTTNTTSTNSRQNFSSPVGSARSINGTPATANGLVNSDKVY
                     TPLNIKIIYTVRNSRNGIIFHGGRHTDIPKNRWFCYTFNNALNCSASSWVPCVDNFHE
                     KPAWDINIVVPKTVGDIGETKIVGTKEAEKAFRKIQLEEMDEDDAEDAVKKVAEEDEE
                     DDGQEFIDESTPIVVAVPDLVSSKETPQQFDLGKKVVNFQFYNPICAHHLGFAVGPFE
                     KTPLLDLKPGTDRILPSTTLLNSLDDASDEAIELSVEANSNKVPTMFYYLPGMKRDVI
                     NTTIFLYKALDFYSKEFSSFPFTSYTLVFIEDFPCDACSFAGITIASDSLLYGPELVE
                     PIFKTTEILAVSLAEQYAGVNVLPRTLNDIWCTVGLSKYMALQFLKKLFGLNQYKYMI
                     KKQSDLLCKLDVGMRPLANQCFRFPLLFDQDLEFIRLKAPLILYILNQRMTKTDRSFG
                     LSRVIPKIFLQAMSNDLPGGNCLSTSHFQHVCEKVAHHKLDEFFYNWVHNTGVPIFSI
                     TQKFNKKRMFIEMSIRQIQRSSTPRDNDDVLSTELREDKISDFRRRHFVDEAGRYVTK
                     EPDFEPQNAFTGPVTIRIHEADGTPYEHIMYIRDGYTKLDIQYNTKYRRAKRKKEGVW
                     EEDEEKEGRKSKDEEKKDSSLGDVLMTATEAENWRLKEDDSSDDNSFSDPQAYAFEWM
                     RFDADGEWICQKRINVTDQMEESKLRQDRDVEAQLEGVIHFGDSLRPKLHYANVLLRT
                     LIDKRYYFGVRTEAVRGLSKISKEENDHIGMRYLLRAFKNLYCYNGETNAYYDEFDPK
                     EYLPVPNDFSNFTDLFVMKAIVKGLSQIRNKDGDIPIELKRILLNIFKYNDNMDNEFD
                     DCFYVCDLLGSLSNLIIHSNKVIANHNISALDASDTDVGGDDRFSQETLMEMNRAVKM
                     DEWSPSYHDCVERKVFQEKIRMVRCGLINMPFQELVSYTGAKHNPDIRILAFEGLLLL
                     GGLKNGHVLELFFTTLKIDPSVYVRYHLMRIFEKAIGVAAFDDTPSILDDEEFAEAKL
                     KEQIQKEQEKKKMSINGNGPSSANSNGLAGNGMVIVEESSSGDLMQFRRDQIARKTIS
                     GAIALLRRDYAVGNGLQKHIWEAMHSCMLSIGAKRELLDIAIILYRARNTFVVRLDLP
                     TDKKIIAVIEEKSVDQSDPNTGKFVIGMKREGRLMIQIPTIKLKNTYTTSSTLAAAPV
                     QSSIGTTSRPLLRLHSAGKERSSARTLTPKVGSKSVGLAVKVAVKSEPLGAVEIPPTA
                     QPQVKDVHVQVDAADGKFTIRLKFKKGISLPGAPKKAKCHVTKTSSILPIRYVKIRLN
                     EKEIWLSDADNFGIKAPSKQEVLVPKGKPTKLVSLKIVPEKLAKFTSDSLDK"
     gene            <600376..>603429
                     /locus_tag="FOA43_000289"
                     /db_xref="GeneID:62193690"
     mRNA            <600376..>603429
                     /locus_tag="FOA43_000289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920622.1"
                     /db_xref="GeneID:62193690"
     CDS             600376..603429
                     /locus_tag="FOA43_000289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776550.1"
                     /db_xref="GeneID:62193690"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021601"
                     /db_xref="InterPro:IPR036940"
                     /db_xref="PFAM:PF00454"
                     /db_xref="PFAM:PF11522"
                     /translation="MTDTQTAIVSSDPDVDLWNVIQSPEFNIYQCIDMLRQYSENVGI
                     QYQLCKRASIYPITELRLFVPEFLQLLITVETQSMALEEMVKTLCNKDAHFSLITFWH
                     LQALLQQLGAEPESIGFQTCKRLINELQYQLFNYFSRPGGGSLAATSTGFVSRHDVNQ
                     NFRENLAPSIVLQTSLLAGVTVPEVTTYVEPVVKIQGKRVKTLVFEVLKDVKKSLTKN
                     LTLKNTLKNARSGGNGRVADSSPDVRRTKSVTLNRDVASTAGSASATRLRRSDDLELD
                     MVDSYAEIHLPKLRRPSLKSGKFAPRTENAIYGHSATTMMSLNKPGVSRVAAKGSGPP
                     ANNIDHLVASMPNLHTSLTADNFGLHGSYASSIRNSFEFRNSSELESLNGEDSGVVSS
                     LSTYRVPLNKAQQVKLLKSNYFKNTTQFVIAFQSISIRLSKVPREARLSTLKAELALL
                     NNDLPCEVDIPTLLPKNKRGKHHKICHIAVNESAVLNSAERVPYLLLIEYFSDGMDFN
                     PDSPDNQSLLYDLQQSGDDGKYKFDLAYRDSVRTDHIINPGSSSWASTVSSGRQTSSC
                     GKRIPSSEVAGTAVVEESDLGDVSVVKLTNNIDDKDALMFPTKSFFSEDQSLHNQIHS
                     IKMSLHDHMKDSSEHDKNLAVQLRIAGIMLRQLESSSTTLSTSQAQQIRSRIVDSMKS
                     MQNSFESVGISNDNDDGAGERKLSNDLKVAGLSYLGEDWNKKKERIRKQSKFGQYENW
                     DLFSVIAKTGEDLGQEAFACQLIQAMANMWYKDGVRVWVKRLRILVTSSNTGLVETIT
                     DALSIHSIKKSLTEYMVNKGEIQNGLIVSLKDHFIRLFGNEDSPRYKIAQQNFCSSLA
                     AYSIVCYVLQIKDRHNGNIMIDSEGHIIHIDFGFLLSNSPGSMGFESAPFKLTQEYVD
                     VLGGVDSYFFQQFKFLTKQAFKSIRRNADSLVNIVELMQTDSFLPCFSAGENTSVFLK
                     QRLQLHLTDEEIDAFTEDFLINKSINSAYTRLYDQFQMLTQGIYT"
     gene            complement(<603624..>606344)
                     /locus_tag="FOA43_000290"
                     /db_xref="GeneID:62193691"
     mRNA            complement(join(<603624..606310,606338..>606344))
                     /locus_tag="FOA43_000290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920623.1"
                     /db_xref="GeneID:62193691"
     CDS             complement(join(603624..606310,606338..606344))
                     /locus_tag="FOA43_000290"
                     /note="BUSCO:EOG09340O7W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776551.1"
                     /db_xref="GeneID:62193691"
                     /db_xref="InterPro:IPR007857"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="InterPro:IPR035075"
                     /db_xref="InterPro:IPR035247"
                     /db_xref="InterPro:IPR035248"
                     /db_xref="PFAM:PF05185"
                     /db_xref="PFAM:PF17285"
                     /db_xref="PFAM:PF17286"
                     /translation="MQRRVSSNAQTSNSIVDSESSEFDSFSSIITPNVKIGIKPLPLT
                     SALVKSDRTLVESLNSLGYDCVLLPVTNARYKENCKAYFLEFRQRFNGSVPSSSDFTL
                     STISDVGKLLGSQASDSLGRSDDKIDLVMHDSEVDAPVNESAEAVNHNQNSEENEQKS
                     ELDDDDNDYDLNSLMVPHPKLNEINIITGPHIVNTIGLLSSWVELDNESRLINEFSLQ
                     VIINEVSYAQYTGISTLLIAPPKNINNLQTYADNLNTILQMYPNIELSISLPICEDTK
                     QDPITGETMPMIDPFSTWDIWNSIRIQCNYNSKLSISLGSPKTNVPQSVVNRWLLEPV
                     RFYLISSYRFIPNSKNYPVLNKFNQLIIWKFIQRKALSPPTLLLHGVDKENMTISSRV
                     PDSTVTSISSSSVTSRGTSGKRNSVIVTVDGKHVSLGDLAYLEYIRYLIAVSYRNNQL
                     LPFENFTLNSFLRLNLRPDQIYSPESLQTPLQPLSSNLDNNTYRIFEQDHAKYETYQK
                     AITAALVDLSNTPRFHHLKGSNAHGSSALPLSTGVDSSQVTDAGSEENSRNCLLKILV
                     VGPGRGPLIERLFSSIRLLDLNLKHIRIVGIEKNTNVMLYLKGRNKDHWNGKVQLYNC
                     DARFWEPSSSQETGFNLIISELLGSFGCNELAPESLDYIAQFCDHQDSVFIPSEFSTF
                     VAPVISPALYSKVIKLYDSAKFDRPFLPLWDEFDMLSSKYARVWTFRHPSRNLGGQKT
                     YNGTRGSFENKHNRRQAHVILKCHRKGTIHGLIGYFSAVLYKDVVLSTCPTGNGPTPR
                     NLVSWLPFYLPIEQPIHLTDEQELSIFIKRECQDGRVWYEWSMEAFMYLLLPGRTSGL
                     RNDSNTDSEMDVDNDGSQVRVRTGVTRIHNAYGSHYSMKLC"
     gene            <608427..>615686
                     /locus_tag="FOA43_000291"
                     /db_xref="GeneID:62193692"
     mRNA            <608427..>615686
                     /locus_tag="FOA43_000291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920624.1"
                     /db_xref="GeneID:62193692"
     CDS             608427..615686
                     /locus_tag="FOA43_000291"
                     /note="BUSCO:EOG093400P7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776552.1"
                     /db_xref="GeneID:62193692"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012993"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR036940"
                     /db_xref="PFAM:PF00454"
                     /db_xref="PFAM:PF02259"
                     /db_xref="PFAM:PF02260"
                     /db_xref="PFAM:PF08064"
                     /translation="MAEQIKQLSEVLDALLKQKSSGKEQDSNSLNALLDTVLPSYLGR
                     SLSQEEVHVVLKIFQALRLLLSRSPSLIIENEIYKKLLKYIKVFYDSIQYPKELSDSA
                     NLTLVQVISAAFTGGKLRNNKYLLAIRNDLIETLEVNLKQLLRSILSTSNNNDNTSSK
                     GVIMYANEIASENDRKFSKLSVSIRILQVLLNPTLRNIFMLHLQCSMLLDNFIRRTWF
                     CMNNIVINLDLKREEGEGVTGDSDLGVAYLSQTSVPSIAYKFDQLFAVLLNSTVGYFN
                     DDDDCQMNILDLALSQCKQLLNWALIAKFPSLQVVLAESLMKLLLKCRELGTCVYFWN
                     KTDLCFDKRIFIVGYMNGDLHQDLYITINLLLVLNASSKGITARESSMVIVDRAIKPY
                     VNRMLDSIRERLLRSFASDDVSMNLDFLLRLTDGKSLLYLNHSYSQMSLLQIVKGDPT
                     SGYSARQTLAKWLHSLESLLNTSPDSILGSSIGKHYLINSLGRFACILNDDFDFTRKC
                     CERCDSCLDERHYNPDLVDVNRPSYKDDSIMYSAYKILEDRFMVEKPLLDDEQLVLSL
                     LISLGRIFRTYRPPPLSKGTVLWSFIQKCFVSVVREIRMMTVRLLPLILYCPEGAQYH
                     SDLDHILGFLSSFAPSRSTSYIFEGIIVSWGELLCISKLDSKYFVLLNPLIQFMGDND
                     EFRSNLALHEIRIVASTRRVTPWKLVEPFIPVISCDLLTKQITNPGLLLNFCECIEMN
                     VSAFLNRTQDYTIPRLIQYFDSDPIGFIAKQLEQSKTRLVSANLCKCSALLLVSEDVI
                     SPAKITKILSIFIPRYKKASLQLILRELNVLELIWELMSLYNCTPELLKRIRNAIVCV
                     CVARRASDIPINGEQEESSLLDDQMKLTVLGLAQDFSDIIHNNKGSKPFIEKVQAIRA
                     IWCLTELSPRFDACLSQIMTCLQLALESFELQYEGLECLRVIVSRLKYLQLSIIVDLL
                     ISYLIQKYTDFNMKCRSIAKAILKDIFQKDPRIIKEHPSYVYSLASSNTDLSEIVTCN
                     FWTRNILVEFSRRLRADNKWVVSLVLRDLLTFFDIRQIDVQKTYISDVVLVGPLSSLI
                     SALLGASNRFSVTCTDIPKKCSLVLSMIGALDPSKFGSFFHRHTKNLVLVTNLTKERE
                     IEEFSIYFLNNILMKCFIASSDPQKQLYLAYTMQQYLKILKLTDEKIKERGSKENIFW
                     SKLSNLSQTVLKPLLVSRYTKNMSTHKLLMYPTYKETKKHSKWLTDFTEDLTFRAATA
                     ERMPRMARQIFESCTVIIRDQDLSICEFLLPYLALLLVVYGENDTYANIEIEITTVLT
                     QDIEDLASDFAVESLKSCYRTVFSIIDYFREWISERKRDRKHLRSTSAVKEREIVEQF
                     LADLPTEILAKRTAQCNSYERAIFNLEQSYQTEKMSENEFFNTIRHMYAELNDMDALQ
                     GVLKKFSANSLNDKLMQFQYSEDWEVTHESLAAIAEAEYPNIGGTLVSADREALRRQD
                     KSVRITSLLKCLDDHCQYDQVLLELGRYQSLTLGSHWIDSKDMFLCGLQASIFTGELN
                     QLCKWVRLSEQSTSITSPGSELSIYYEFAQALIRLHENDISCCLDHAERASSYVGLAL
                     SVSKEISHTKIADYMVLLHCLYDFSLLAKLKSGPSLETSFKLLRYRQGNTMKDFRTRW
                     KIQSLKKAIVKLHPIEEVRQQLSSTLVESSQLLREYGRLDLATKNITHALTLGTDNSF
                     VNFEFAQLLWAQGGHRQALKTLKSVIDSEKIKSPEMALQYTQWLENSANGSSDEIIKG
                     YRSVAQDNKNLEFCGKAQYYLGRYYNKLLDAQEIETPGLKRLEKDFYGDLEFNVIKAY
                     MRSASFSTEYLFEVLPKAVTIWLDYSTKYRDSKLLRSYSSEIIMAKRNDNYSGILKFI
                     TMCINDGETYKWYTVLSQLISRMIHGDKDTETLILHIITQMAMKYPQVILYSVYSQVQ
                     SDSSERRKRGQKICASLQNARDEVLVNQVQSAFELLEALKGICQARTSKEGKVKLWED
                     LKFSFRRGSECLSLALPIRANFDRLHSPVLTTKSKSTKHHNIDNFITFSKFEPEVSIL
                     SSMQKPRKIYVIGSDNKRYSILCKPNDDLRKDSKLMEFATVMDRLLQTDIESEKRSLS
                     ITSYAVVPLNENMGLIEMVDNVRTIRDIMLMYLQWQGNRFDYAKMKTLMGDPALSLSE
                     KLHNYEKLKTYYRPVLQLWFADKFPNPVNWYEARNRYTRSCAVMSIVGYLLGMGDRHG
                     DNILLNEITGQILHVDFDCLFDKGKKLQVPERVPFRLTQNMVAAMGVNGYEGTFRKAC
                     EVTMRLIRQNENILMNILETFLYDPILDWKKTSKKRRGVDHNPDSSSKLQPQVALNTI
                     RRKIKGILDPRDLDTGAKDSGGLSVSVNAQVDGVIQQATSDENLAQMYIGWMAFL"
     gene            complement(<615813..>618881)
                     /locus_tag="FOA43_000292"
                     /db_xref="GeneID:62193693"
     mRNA            complement(<615813..>618881)
                     /locus_tag="FOA43_000292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920625.1"
                     /db_xref="GeneID:62193693"
     CDS             complement(615813..618881)
                     /locus_tag="FOA43_000292"
                     /note="MEROPS:MER0026495;
                     BUSCO:EOG09340G1D"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776553.1"
                     /db_xref="GeneID:62193693"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR013953"
                     /db_xref="InterPro:IPR029148"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="InterPro:IPR036005"
                     /db_xref="PFAM:PF00557"
                     /db_xref="PFAM:PF08512"
                     /db_xref="PFAM:PF08644"
                     /db_xref="PFAM:PF14826"
                     /translation="MSEVKIDEAAFRRRLHQLQKNLTTSDYFKSVNGLLIMVGSSDDF
                     NPYQKSTILHTWLLGYEFPATGIYITSKKILVVTSVGKAKYLSPLKSSPNGSYTMTIL
                     CRNKDPEHNRKLFAEFLEEIQKSGKRIGILPRDHYQGKFMEEWNPIWEGAKAQFDLVD
                     ASVGVSKTLELKDEEEQRNLRVASRASTNMMSYFTDEMGRIIDEELKITNSQLVEQIE
                     NKIDDVKFFKRMETDKAMKRLGNNFDLNNLDWCYKPIVQSNGKYQLKFSVESNDEKLG
                     GNVIMSSLGMRYKSYCSNVTRTFLIGPTKEMERNYDFLLRLQSKAFSLLKDGAIASEI
                     YKAVADYINKERPDLDSHFLKNMGSLIGIDFRDSNGVISPKNGRRLNEGSVVNLVLGL
                     HDLHDDKQGDYGLMIADTVRITGEEPIILTDSPRLRKFIAFYFDDEDEDTRDDAKVKS
                     EPGTTKIKKEVKRSSDAKITSSANTRVLKAKQRAKQKSSEEDQLQIQREIQKELHERR
                     QKEGLERFNSEAATEDIEKKLVFKKYESYVRESQIPTNVRDLKIHIDSKNQTIILPIC
                     GRPVPFHINAYKNGSKNEEGEYTQLRLNFNFPGVSSSRRLELPYETGDDKQFIRSITF
                     RSKDGARMAEVLKKITDMKKEAVKRDTDKREMADVVSQANLVEVNRPRRLDNVFLRPT
                     PDSKRFAGYVAIHQNGIRYQSFGRGDHRVNVLFSNIKHIFFQSCKGELLVIIHCHLKT
                     PIMIGKKKTYNVQFYREATDASIDETGSRKRRYRYGDEDELEQEQEERRRRAALDKEF
                     KQFAEHIADASHGLLDLDVPFRELGFQGVPSRSAVLCVPTRDCLVQLVDLPFLVITLE
                     EVEIAHLERVQFGLKNFDLVFVFKDLGKPVAHISTIPMETLEDVKAWLTDVDIPYSEG
                     AVNLNWPTIMKTIQADPYQFFVDGGWSFLSSESDSESDGEESAAEPDFAPSDEDPQDD
                     DEEDYSDADDADADDDESDFDDGDDDDDGDADDDSNLAESDNISDEVFDD"
     gene            <619264..>619929
                     /gene="YPT32"
                     /locus_tag="FOA43_000293"
                     /db_xref="GeneID:62193694"
     mRNA            <619264..>619929
                     /gene="YPT32"
                     /locus_tag="FOA43_000293"
                     /product="Rab GTPase ypt32"
                     /transcript_id="XM_038920626.1"
                     /db_xref="GeneID:62193694"
     CDS             619264..619929
                     /gene="YPT32"
                     /locus_tag="FOA43_000293"
                     /note="BUSCO:EOG09343RTZ"
                     /codon_start=1
                     /product="Rab GTPase ypt32"
                     /protein_id="XP_038776554.1"
                     /db_xref="GeneID:62193694"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF08477"
                     /translation="MSDTADDYSYDYEYLFKIVLIGDSSVGKTNLLSRFTRDEFNPDS
                     RATIGVEFATRTLEINGKRIKAQIWDTAGQERYRAITAAYYRGAVGALVVYDISNSDS
                     YESVSRWLKEMKEHADANIVIALVGNKSDLEHLRAVPTEEAKNFAAEHNLLFTEASAL
                     NADNVEFTFHQLIKSIYEMVSKRKFDMDGAEGSGNRDLNSKTITLTPAPKDKKVSKNS
                     NCC"
     gene            complement(<620011..>620451)
                     /locus_tag="FOA43_000294"
                     /db_xref="GeneID:62193695"
     mRNA            complement(<620011..>620451)
                     /locus_tag="FOA43_000294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920627.1"
                     /db_xref="GeneID:62193695"
     CDS             complement(620011..620451)
                     /locus_tag="FOA43_000294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776555.1"
                     /db_xref="GeneID:62193695"
                     /db_xref="InterPro:IPR019098"
                     /db_xref="PFAM:PF09649"
                     /translation="MSDEEKKDISREKSTEEVSPELTESKEVESFKKRQLEEDNKKKH
                     RKRHHRSKYRDLPTEDEPEEQSEEEDPDDDVADDKLIVEDDEEDDLSEIDTSNIITGR
                     RTRGKVVDYSKVSAKLATESGKGEKSEEKNEDDEDDIDFKLVEK"
     gene            <621006..>622883
                     /locus_tag="FOA43_000295"
                     /db_xref="GeneID:62193696"
     mRNA            <621006..>622883
                     /locus_tag="FOA43_000295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920628.1"
                     /db_xref="GeneID:62193696"
     CDS             621006..622883
                     /locus_tag="FOA43_000295"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776556.1"
                     /db_xref="GeneID:62193696"
                     /translation="MSTEVLPYTDPLLELLKDPNLNKEKEKTQELVEYIEEIKDSSLK
                     SWCIESFEILRDLEKIEVKLNNWEFQTLDFNISVDSIMMNEKDVKRRKFNLELAKRVS
                     KHCLDLHNLLGDLSVEIDELSSFSKRLSPIQKISDPGTILTELNLRVIRLQNILTDQI
                     SIHYSRARLVNMGISLEDLVHNSSKEEEFPSESSGINNATVKNYKQFVNNLLQQLNKC
                     VSTNDTIGAMECIAIVNDVEKMFLTMKAQRQEETQRKIEDRERKQRQKETDQYELQRE
                     LTPPSSTGEEEEKLKNESHRMEPVLEESPATEGEASIDSDTDLNKEDSAEISFNVDER
                     RKRRLNNDKMSVNLEDSVLHKTTLAEKLPFLMSAFDEAKAAELGLKEVVSHQYDDTKT
                     VNKKSIPLVNKKAAHKSYLEEKEEENREEEGDYLDEESLEDSNEPTMNIPSYLPPLGK
                     PSILNAFFQPKIMDPIYISTSQQTEVEQKAAQAKHSRYMRRLTGSAVKEKLLKYQQNE
                     QLRDLSLSTDKLTSIEVGRGRVKETVKEIEQQLPTGALPPSPVRASDSQGNTIGVTTS
                     GSEGDADVAEESVPTEIKPIRRALFIESLRPQTLRWGLGNQNQGEKLSDNNINIEDTV
                     D"
     gene            complement(<622964..>623344)
                     /gene="MRP17"
                     /locus_tag="FOA43_000296"
                     /db_xref="GeneID:62193697"
     mRNA            complement(<622964..>623344)
                     /gene="MRP17"
                     /locus_tag="FOA43_000296"
                     /product="mitochondrial ribosomal small subunit component"
                     /transcript_id="XM_038920629.1"
                     /db_xref="GeneID:62193697"
     CDS             complement(622964..623344)
                     /gene="MRP17"
                     /locus_tag="FOA43_000296"
                     /codon_start=1
                     /product="mitochondrial ribosomal small subunit component"
                     /protein_id="XP_038776557.1"
                     /db_xref="GeneID:62193697"
                     /db_xref="InterPro:IPR000529"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="InterPro:IPR035980"
                     /db_xref="PFAM:PF01250"
                     /translation="MLYELVAIARISDPLALHTEAKELASTIGKLVIQNKGVVREIVS
                     LGAKPLPKIMKKANERHFQGSHFLMLFDSSSAVQREILRSLKNDPRVIRANVIKVDDS
                     TDMSPGSSVSRVMSALKDTGYEGL"
     gene            complement(<623517..>624203)
                     /locus_tag="FOA43_000297"
                     /db_xref="GeneID:62193698"
     mRNA            complement(<623517..>624203)
                     /locus_tag="FOA43_000297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920630.1"
                     /db_xref="GeneID:62193698"
     CDS             complement(623517..624203)
                     /locus_tag="FOA43_000297"
                     /note="BUSCO:EOG0934447F"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776558.1"
                     /db_xref="GeneID:62193698"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="PFAM:PF03357"
                     /translation="MFQWIFGKRLTPQEQMRRNQRQLEKTQRELEREKMKLQQQEKQL
                     IRDIKKNAKVGQVATVKVQAKDLIRTRKQMVKFDRMKTQIQAISLRLQTMRSSTQMTT
                     SMKSATRILSGLNGNLNLNQLGRITQEFQKSMDVMDQKQEMVDDVMDDMMDDELEEDD
                     EEEVDEVVNQVLDEVGVGLHDKLGESAVPEGGIESKSTEAIQNKPQLVGADGGSADDD
                     LQARLDSLKR"
     gene            <625142..>627229
                     /locus_tag="FOA43_000298"
                     /db_xref="GeneID:62193699"
     mRNA            <625142..>627229
                     /locus_tag="FOA43_000298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920631.1"
                     /db_xref="GeneID:62193699"
     CDS             625142..627229
                     /locus_tag="FOA43_000298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776559.1"
                     /db_xref="GeneID:62193699"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MPQRADTSKVNGSKHDNTASTSSLHPEIPAPRPLGEAADSTPPH
                     TSSPATSLNYKAMTEVHSKLSINTSLQRERASTLSTRLSSSSPRLGLPSINDYKPRNH
                     NKMTYNPYGLSALGTNSPSRVSTSSSIRNSNHGGVFDSSDDDSNVVPYPVDLPNDHLP
                     PELKEDHQNLFDDYQFLEDKSNIGTGASAFVKKVSRIGHPRDLYALKKFVLFKGEKSE
                     DFYRRASREYIIHHNLNAGLHIATCHSLVKISHQRSLTRGWGLILELCKADLFDIVSR
                     NSFNHVSSSEKMCLFKQVAYGIKYMHECDVVHRDMKPENILLTADGVVKITDFGVAEY
                     GHEIPGDFSSPVAMSTQLVGSPPYQPPEVEALKGVPNDKRVPYDPFRMDCWSLGLILF
                     VLFYGNVPFDDCSKQSASFRDYEHSVKEYSTRINPDFKKTSIKGPGMEYRFARKFMDI
                     GIARIAWRLGDPDPETRYTLFDLFSDRVFQQAELCIHENDHACSFCHRPECRDEAFKY
                     AYGSDINTSSLQVRSVSSSSSISTHIGRSRGNTNASLPLPSAASTADMGKVRSMIDIA
                     VEAKHSELVKSVVPPPKLDEADEEIDNDESELGEHKQDEQESDEKEDSSQEQLLLGKI
                     LQIDSESTQSSTRGLASYGLAVFPELLDNLCTSDGLKKIVLEDGPLKLVPSDVIRKCG
                     QCRVKSHNHMPKW"
     gene            complement(<627603..>629510)
                     /locus_tag="FOA43_000299"
                     /db_xref="GeneID:62193700"
     mRNA            complement(<627603..>629510)
                     /locus_tag="FOA43_000299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920632.1"
                     /db_xref="GeneID:62193700"
     CDS             complement(627603..629510)
                     /locus_tag="FOA43_000299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776560.1"
                     /db_xref="GeneID:62193700"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR031675"
                     /db_xref="PFAM:PF00149"
                     /db_xref="PFAM:PF16891"
                     /translation="MGNTSSKDESSGSSSAVASGGNDDPDPSPSARRNFQYTNNDRTG
                     VYDQVTMNGNEYDNNNTNDNANTNFNLKSNNDNKKNKQAKVSKRNHESDHDDDKASQF
                     HLGLSKADADNSLSVSISSSSTSTASSSSSSYSSSLSDVPLKASVLQMTVTDATVGSL
                     SNSFESNLDSCFTSNSVSSGSSGTTPPSSRDKSLYPIKEHSVLALNSPQKAVFHQEDL
                     KSPIFSKPTGHHHEEISERVKSFKELLTADAAKHVVSCLDKGQRKEVSVLASPVTSKH
                     SSRHGKKHFANVDSIIERLVEAGLSKRASKKFIISVDEIRFICAKTRDIFMSQPMMLE
                     LAAPVKIAGDIHGQFHDLLRIFKLCGFPPNANYLFLGDYVDRGKQSLETIILLLCLKI
                     KFPENFFMLRGNHESAGITRMYGFYDECKRRSSLKSWKMLVDVFNTLPVAATIAGRIF
                     CVHGGLSPQLTDLNQIKKIQRPTDIPEEGLLSDLLWSDPQVSGATEEYLSSRSEKSLN
                     SGASSSSLSSLPLYSPSPTDSSLPHSSQHFLNSHHIGDWTENDRGVSYCFSRRVVNRF
                     CQRFDLDLVARGHMVVEQGYEFFAKRKLVTVFSAPNYCGEFDNWGAVMNVNKKLMCSF
                     ELLKPSRIKRD"
     gene            <630494..>631525
                     /locus_tag="FOA43_000300"
                     /db_xref="GeneID:62193701"
     mRNA            <630494..>631525
                     /locus_tag="FOA43_000300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920633.1"
                     /db_xref="GeneID:62193701"
     CDS             630494..631525
                     /locus_tag="FOA43_000300"
                     /note="BUSCO:EOG09343QMU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776561.1"
                     /db_xref="GeneID:62193701"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR034148"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MSSLGEFDTTSFKNSTFRLDRPSAYLVNKARRDEANGYSNLKKS
                     MESATVYIGKLSFTTTEEQLFELFSDCGTIKQIIMGLDKNKLTPTGFCFIIFQKANSA
                     LNAVKFLNKSKINGKPMDIDLDPGFEEGRQFGRGLDGGQKQHVLQRRRLKRRYRERYD
                     DRGSRGDRGDRDNRGNWGSRGNRGDFGDRGDRGGDRNRGYRQSYRGGPRRGYRAERGD
                     RDNYHGDRERRYNDGLQYNRRPQNIDSHQYNDRPQYDSFTSREPEQDFRYASTREREF
                     QHETYVPPDADHREHTEQGSGFAGATGSTRVTGAPGDKDEYVPDDGRSDFHGDNDKET
                     QELPPHLQH"
     gene            <631950..>634175
                     /locus_tag="FOA43_000301"
                     /db_xref="GeneID:62193702"
     mRNA            <631950..>634175
                     /locus_tag="FOA43_000301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920634.1"
                     /db_xref="GeneID:62193702"
     CDS             631950..634175
                     /locus_tag="FOA43_000301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776562.1"
                     /db_xref="GeneID:62193702"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR032460"
                     /db_xref="PFAM:PF11935"
                     /translation="MSSSVPTEEHLNAQTHQIEEATKLAFDDSKYFDQVLDTIATISI
                     SQPIDNYIIQSHCLEFVYQAYYLRKIQSFELRCNNSTKIIDMLSRLIMVEESDQVHNR
                     LPKYKITERCIEILSSTYDLMFYRFIDHPDKPLWATLCKTRDFVVSQWPSAYPLLSYN
                     RDADWYRSISCKNATIRLIGKVIATHLPPASSSRDKKVKDMNDISIALVDKDHPFLYN
                     SNIGSQGQALLDRLFSTVNDDILIPTAVFSAVVSVLMTLFRLRPNVVSSKFLSFILGY
                     EAQLKRDPKFEADKLKLRMNRRFNDRLDKIIISLLLNRGFINKDPSLKARFENKLRYL
                     VDKTAELRKKSILEDSEDDEDEDEVQRLRKRRKLADKDNKMHEPIDFYNECRIARAND
                     YKSIYSLLKPGDALENFDMSTISPDMLSKMVIAALSKVDIQKLAKGLGLASDRYIEIM
                     TRDDYMFAGNADLGDENEGDDTYDPSAVVKSESKIPSDDDDEDDVFSEEDVYSVPLPK
                     TLDINQKKVQIKSIIDNFIRLASQNVDDNTDEPISGNNLSKVAISKWKSDSWIKILSR
                     LATRGTILNEEISNYIREAIFEYFQVDIKDGLTGVIEWLNEEYYNESIKSEDAGNEET
                     HTTYTHYTGKVLDTLIPFLDPSDRKVFIRLLSELPYLSKEMILKIRSVCADPARSKLG
                     FQSVLYLMMFRPPLFQGCIDLLKEMYVEADNKNNEQLKNSCLKYLKKYAPKEIPATDG
                     S"
     gene            complement(<634220..>636287)
                     /locus_tag="FOA43_000302"
                     /db_xref="GeneID:62193703"
     mRNA            complement(join(<634220..635788,636279..>636287))
                     /locus_tag="FOA43_000302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920635.1"
                     /db_xref="GeneID:62193703"
     CDS             complement(join(634220..635788,636279..636287))
                     /locus_tag="FOA43_000302"
                     /note="BUSCO:EOG09341COZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776563.1"
                     /db_xref="GeneID:62193703"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="InterPro:IPR024598"
                     /db_xref="InterPro:IPR031590"
                     /db_xref="InterPro:IPR031774"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PFAM:PF11931"
                     /db_xref="PFAM:PF12171"
                     /db_xref="PFAM:PF12874"
                     /db_xref="PFAM:PF16837"
                     /db_xref="PFAM:PF16958"
                     /translation="MLIELDLIESSITKRIRRNPDIYIPSITSKDHGILGRKKRISPS
                     ETLLQQHEIKHFIDRYKIQVKKLSKLSSEMDADLTDELKVMKSEEAFEIFVKLYKKSI
                     EEDKNQAFLKTKKDWQIYDMFSSNDDYLELRQRFDGQKTNDKEISKKKRHLYRVLSEF
                     CKDMTLSSIFSRTEEFGKYLDLHTQYKKWLVLPRIKPINTDKIPGYLEYLGEITKFDD
                     DLFNKSDQYYEYLMDLSAYIERYWIKINPLMRPERSLVSIKNRFTEMHFKEPREQGIY
                     CMACKKTFAKDTVYNSHLNGKKHRKSVTENRRGEVLKLEYFIKEVLTTLLADQMSKTQ
                     SETERFNLLTVRERQMELTKIQDISLYEIDYFATDSDDDVVGADAEAYGSNANGNIED
                     DEDGHGQNYNPLNLPLGPDGSPIPYWLWKASGLGLEFGCEVCGNIEYHGRRAFSNHFS
                     EPRHVNGLQMLGVTEDFSLYKDLNKIDDVLKLLGNLQKRQREIIHLKESGEEVEDEDG
                     NALSKKAYQQLKKQGLL"
     gene            complement(<637060..>638295)
                     /locus_tag="FOA43_000303"
                     /db_xref="GeneID:62193704"
     mRNA            complement(<637060..>638295)
                     /locus_tag="FOA43_000303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920636.1"
                     /db_xref="GeneID:62193704"
     CDS             complement(637060..638295)
                     /locus_tag="FOA43_000303"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776564.1"
                     /db_xref="GeneID:62193704"
                     /db_xref="InterPro:IPR035189"
                     /db_xref="PFAM:PF17235"
                     /translation="MDFIWFIFSIPSVIDTFLTSRHAANSIDGPSDIDKINESKLAEE
                     AIQRSSGYRAVNIPSYFTGELEDSIDLQIKSLLYDYRRLKINALSPFLKQDPTSGGYD
                     FDYVHSSYTKPSDTKEDDFIHNKRLDTIYNLTRFKEELLNNPYRVLIDYIKNRFRSLL
                     ILSDSPDQMHQLPELNTAQHFEFLVLRPNDSEEKYVDVLVNKSGIYNEHGVNKKLRMQ
                     ILMKVMNRQRDLCGPNTFNKDDRASIIKCYLENLGLHIQVERIYRATLKSKRKEACEA
                     LIKLSGDKSFETSTNLKRRRSQMVTQDITTGNCLHINEEKPVVVSTNLFDETTPHTNN
                     GRPVTLGCSAEKFENIYISETTSDTHLRASDSESQASSSASSCSTSKFFSTEEKLLFY
                     EQSKMAVRIRIERERLYLI"
     gene            <638924..>640354
                     /gene="TPS1"
                     /locus_tag="FOA43_000304"
                     /db_xref="GeneID:62193705"
     mRNA            <638924..>640354
                     /gene="TPS1"
                     /locus_tag="FOA43_000304"
                     /product="Trehalose-6-P synthase/phosphatase complex
                     synthase subunit"
                     /transcript_id="XM_038920637.1"
                     /db_xref="GeneID:62193705"
     CDS             638924..640354
                     /gene="TPS1"
                     /locus_tag="FOA43_000304"
                     /note="BUSCO:EOG09341XN0;
                     CAZy:GT20"
                     /codon_start=1
                     /product="Trehalose-6-P synthase/phosphatase complex
                     synthase subunit"
                     /protein_id="XP_038776565.1"
                     /db_xref="GeneID:62193705"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR012766"
                     /db_xref="PFAM:PF00982"
                     /translation="MSQELAKHHGNVIVASNRIPVTIKEDEDGNYGYSMSSGGLVTAL
                     QGMKRPFQWFGWPGMSVDDKDEAAVIEKDLKEKFNCFPVWLSDEVADLHYNGFSNSIL
                     WPLFHYHPGEMNFDDAAWAAYIQANKQFCNEIIKRVHDGDLVWVHDYHLMLVPTMLRE
                     QLKKKGLKNVQIGFFLHTPFPSSEIYRILPVRAEILRGVLGCDLIGFHTYDYARHFLS
                     SVEKILKIRTNPQGVYYDHRQVTISADPIGIDVDKFLTGLKKDSVQARIQQLKQMFGP
                     DTKLIVGVDRLDYIKGVPQKLHALDVFLEAHPEWVGKVVLIQIAVPSRGDVEEYQNLR
                     ANVNELVGRINGRYGTVEFVPIHFLHKSVNFEELIAVYAASDLCLVSSTRDGMNLVSF
                     EYIACQEKGKGSLVLSEFAGAAQYLNGAIIVNPWNTEELAEAIYEGLTISEEKKASNF
                     RKMFKYIRKYTASYWGETFVKELSRV"
     gene            <640626..>641909
                     /locus_tag="FOA43_000305"
                     /db_xref="GeneID:62193706"
     mRNA            <640626..>641909
                     /locus_tag="FOA43_000305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920638.1"
                     /db_xref="GeneID:62193706"
     CDS             640626..641909
                     /locus_tag="FOA43_000305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776566.1"
                     /db_xref="GeneID:62193706"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR036457"
                     /db_xref="PFAM:PF00481"
                     /translation="MGQLLSQPITEKNITFVQHDHISHSIGEMQGYRLSMEDAYCDIN
                     DTLPIKIRDPKLMKIVHELESKSISDSGVGVKSEGQRTTFKEPHEDLNDGHRHGKAER
                     PQIPRHELNGNMLLKDHLHTDYVMKRVKFNIYGVFDGHGGSNTSRYMAERLPSVLTRG
                     LKGEIQKLSDEQKWKLIRGEDVLELINFPKVMKDAYMRLDSMYYHAPNNDSGSTGVVA
                     LIFQGYFIVANAGDSRCVLSTSGAAKNMSLDHKPKHLGELMRIHNDGGYVAANRVNSI
                     LALSRAFGDYNFKMHNSKNHGKFALVRSKQKVKLTPPEEYQVTAEPDVFIRKITTQDE
                     FLIVACDGVWDCYRPQDLVHVIRHELSLGKKLTDVNELVLDSCIGMANTVTGIGFDNM
                     TLIIVALHQNYKDLNDWYTHMKNKILDEKFGQLER"
     gene            complement(<642083..>646702)
                     /locus_tag="FOA43_000306"
                     /db_xref="GeneID:62193707"
     mRNA            complement(<642083..>646702)
                     /locus_tag="FOA43_000306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920639.1"
                     /db_xref="GeneID:62193707"
     CDS             complement(642083..646702)
                     /locus_tag="FOA43_000306"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG0934011U"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776567.1"
                     /db_xref="GeneID:62193707"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="PFAM:PF00501"
                     /translation="MSLDFTVPRNLQPEVERSLFRLVSDFQEGYLTEKGYIKKRHEIL
                     ESLNLNVHNIPNVRGDSRVDPRHNSTLSRISTSAESTFDHTAAQDFYYSPSETQVDGS
                     TGSPSEAHISGLDADAYEYYKSHAKSENSGVPKELQRPLDPRVLEQYIQTATFDNLAM
                     LLRKRGTVYAKDTAIIIMDQRGKETQTLTWDKLYLRAEKVAKQIKTKAALYPGDRVCI
                     IYQNIEVIDFLVALYGCLLSGTVAVPMNSGLPVKDMVKIMTDTQSHLCLMSESVYKHF
                     EKLTHKRKTPLWPKGVEVWKTSDMGTYQPSKKEGPPPLKVSDLAYIEYSRGSTSELRG
                     VAISHRTIIHQMTSLASILSSNPDIKNGTLIRPASQFTRLKHMLLSTLDVRESIGLII
                     GALFTIYSGNTLIWAHQRTTEVPGLYAHIISKFKVSILLSDYLSLKQVAYNYQSFPQL
                     TRTFNKKVKVNLSSVKWCLINTMTVDCEFDDKLSDRWFKPLGHPNPRKIIAPMLSLSE
                     HGGAIISIRDWIGHEDHLGCVFQKPMTDEVIANDENEDGTMTEQLSEVLIDKESLTTN
                     TVKIVSDRPPPTSSTYDDESSKYIRVGAFGYPVPDATLAVVNPEGKMLSGTMEVGEIW
                     VDSHCISGGYWGLPEETQSIFQAECSDYEGILNLNFVRTGLLGFIYSGNVYILGLYED
                     RINQDVTWYDKYLEIQSHNQKSTSTVTTEPNTEATTTPEEKSVELQTHITPGVTQYRY
                     HYASHLVRTLVRNIPEVTDCSFFNVKINNEYLPVAIIESSSVPLSKEKNPIPKVNETA
                     LNDMTSQAFMFIESVHKVRLFCVMITAPNTLPRIIRSGRLEIANMLCKRRFMEGRLFP
                     TFVRFNFANSLATIHHGDDLTGGIWSRYSSQIRVDALSYAQLQYSGIDMRDNCTDDRK
                     NMELSGYKSLVDILKVRVSQQPDELAFALIDGGSIKELKPLSWKKFENRVFAVCSYIL
                     EKKNLMAGDNVILVYHMSEEYVICLYACWFAGLVVIPIPPLDATRADEDTKSYTDIIK
                     EYDVRAVFVSGDIEQSMKSKPISAKLKQLVNGKRMELPKYRNTSKHTKSNISSKSMLV
                     KLENYRKRLRKTKRQECLLWITWNADHTYKGARLTFGSLLSLAMNLKETCQMSSLKPI
                     VACVRHTAGLGFLQAAVMGIYLGCTTYLFSSVEYGANPTAFWISLSKYSVENVFVTSK
                     MLVYATRTVISKRCDLSNLKNLMIGWEGRPDSKIMDRFKEAFQQSNLPSTALSNIYQH
                     LLNPLITMRSFLSFEPVNLWLDPLALAQGYISLVNPQDYPDSIEVQDSGIVSINTQIA
                     VVNPETRQLCKVGELGEIWVYSQSTLSGLSGSANTRNTNDITHGTIENWNSEVSYLRT
                     GDFGFLHSVHKNVTQGDNPVELQLLFNLGKIEESFEVLGLQYLSSDIESTLEQFRVIL
                     KACVFKTGNYVVAVLETSMKKNHCSIVPLIVMRIMNKFRLIIDVVSFVASGRMPISRL
                     EKVQRTTILKRWMDGTLRLSSSYGINFGEGSTVKTLKLMEETNKV"
     gene            <647055..>647384
                     /gene="ECM15"
                     /locus_tag="FOA43_000307"
                     /db_xref="GeneID:62193708"
     mRNA            <647055..>647384
                     /gene="ECM15"
                     /locus_tag="FOA43_000307"
                     /product="UPF0045 protein M15"
                     /transcript_id="XM_038920640.1"
                     /db_xref="GeneID:62193708"
     CDS             647055..647384
                     /gene="ECM15"
                     /locus_tag="FOA43_000307"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="UPF0045 protein M15"
                     /protein_id="XP_038776568.1"
                     /db_xref="GeneID:62193708"
                     /db_xref="InterPro:IPR002767"
                     /db_xref="InterPro:IPR029756"
                     /db_xref="PFAM:PF01910"
                     /translation="MPRIPVKLNCIADVCLLPIGTGAPSVSNYVTAAEKMIRDSGLKS
                     TLHSAGTTIEGEWSEVMDVIGRLHEKVHSMGVLRIQSDIRVGTRTDKAQTAKDKVDTV
                     ERKLKNL"
     gene            complement(<647426..>648928)
                     /locus_tag="FOA43_000308"
                     /db_xref="GeneID:62193709"
     mRNA            complement(<647426..>648928)
                     /locus_tag="FOA43_000308"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920641.1"
                     /db_xref="GeneID:62193709"
     CDS             complement(647426..648928)
                     /locus_tag="FOA43_000308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776569.1"
                     /db_xref="GeneID:62193709"
                     /db_xref="InterPro:IPR010102"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="PFAM:PF00171"
                     /translation="MSSSKEIQDFAEKYGIKNIELVQTGALLNGKWYNDTENNFAVNN
                     PAFNQPILNVYDTPLDKIKQCIEDAQVAFEKFSKETTGRARNTILMKMYELVTENTED
                     LARIITAENGKPLAESRGEIKYAASFFQWYAEEAPRIYGDMIPSASGSKRILTMKQPI
                     GVVGILTPWNFPAAMITRKLGAAIAAGCTAVIKPASNTPLTALAIAYLAEKAGLPKGV
                     LNIFPTAHNKSREVGSIVCESPLVKKVSFTGSTGVGMALMSQSASTLKKLSMELGGNA
                     PFIVFSDADLENAVNAAMDCKLRQSGQTCVCANRLFIQEEIYDRFAARLVERVKATKL
                     GNGMDPETTHGPLIHEKAVSKVSSQVKDAVSKGAKILTGGRVATELGPNFYELTILSD
                     VPTTADVNIDETFGPLVPLIKFKTEEEVIGLANDTEYGLAGYFFTKDYTRLFHVAEQL
                     NCGMIGVNTGAISEAALPFGGVNWSGFGREGSKYGVDDYVVIKSVVIGNL"
     gene            <649923..>651170
                     /gene="ARG1"
                     /locus_tag="FOA43_000309"
                     /db_xref="GeneID:62193710"
     mRNA            <649923..>651170
                     /gene="ARG1"
                     /locus_tag="FOA43_000309"
                     /product="argininosuccinate synthetase"
                     /transcript_id="XM_038920642.1"
                     /db_xref="GeneID:62193710"
     CDS             649923..651170
                     /gene="ARG1"
                     /locus_tag="FOA43_000309"
                     /codon_start=1
                     /product="argininosuccinate synthetase"
                     /protein_id="XP_038776570.1"
                     /db_xref="GeneID:62193710"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018223"
                     /db_xref="InterPro:IPR023434"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="PFAM:PF00764"
                     /translation="MSKGKVCLAYSGGLDTSVILAWLIEQGYEVVAFMANIGQEEDFE
                     AAKIKALAIGATKFVCVDIQEEYVKKVLFPAIQVNAIYENVYLLGTALARPVIAKAQI
                     AVAEQEGCFAVTHGCTGKGNDQVRFELSFYALQPDIKVITPWREPSFFKRFAGRQDLL
                     DYATEKGIPVHQTKSKPWSTDENMAHISFEAGILEDPNHTPPKDMWKLTVDPLDAPDE
                     PEDFTIQYKQGIPVKLTLADGTEVSDPVKLFLTANAIARRNGVGRIDIVENRFIGIKS
                     RGCYETPGLTILRSCHVDLEGLTLDREVRAIRDSYVTPTYSRLLYNGKYFTPECEYVR
                     TMIAPSQKTVNGVVRARCYKGSLSILGRYSSTEHLYDATESSMDELTGFEPVDASGFI
                     AIQSIRIKKYGQSARKDGGSLNL"
     gene            complement(<651685..>653280)
                     /locus_tag="FOA43_000310"
                     /db_xref="GeneID:62193711"
     mRNA            complement(<651685..>653280)
                     /locus_tag="FOA43_000310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920643.1"
                     /db_xref="GeneID:62193711"
     CDS             complement(651685..653280)
                     /locus_tag="FOA43_000310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776571.1"
                     /db_xref="GeneID:62193711"
                     /translation="MGHFVSSRMMSPISATPKPGLTQVPVLIPIRNAAISSSQPPTQT
                     FQPYASRILADESIDSVKSNERYPDNEHSYLPQPDFSNIYLPVADPMSGADSVPAEDT
                     PELYMSSTTNYTGANGSFADGLDHTKKKQSSQFASNDHKSSLEECAAIKSVHPMFLSR
                     KTDLSYVEDLKIPKGLLSYTFFSDVTMKLHFYAMNTMPFRICLDPSNRILIVEITKFA
                     PLYDFMYHSLLAVSLLDLYYQKVLTGTDDVLDLDKSVYLMLGDYHMSRSMRELVEEVK
                     VEEDVKKCVTLILTTMMHIFYATGCPHQKIASKTYYTLGKNLGILFTRYALIYKGCSC
                     FNRACARYCLNDFSRSPLIYSPTFLYGLLDVFYPHSDQSSGKLRVKPLDKEEVAIFTS
                     LIDRLDREYRAYMNNFEIPNPLRSVRYVTLEGLSSTPVGSPVLDGQGQHSFEFDMYGT
                     LSRYIVDIPDRFIEMVDLGDPRALILVAYNILILSVRVYEYWPKSVFGDEIIYIDHRL
                     DKVENSELWKSWLSVAYLSVNSR"
     gene            complement(<654067..>655134)
                     /locus_tag="FOA43_000311"
                     /db_xref="GeneID:62193712"
     mRNA            complement(<654067..>655134)
                     /locus_tag="FOA43_000311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920644.1"
                     /db_xref="GeneID:62193712"
     CDS             complement(654067..655134)
                     /locus_tag="FOA43_000311"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776572.1"
                     /db_xref="GeneID:62193712"
                     /db_xref="InterPro:IPR028012"
                     /db_xref="PFAM:PF14616"
                     /translation="MPEHEFTLSKSGVSEEDAEYRQTYIGKKLRIPRIMPSYQLEHVF
                     PISAVRKERETEGLDPPRLLLPRDMVYSIQPPHAPGSIFSLPSIRASTSDFHTPVSPS
                     CIVNTMPPHTPSVRPVSTSPIPQAVLPARIRAPRKFSRRVTISELIERFDVSTADKFF
                     NIYGQTLLPFISPNGLSLKHFRDNEEYVYRANRKQHAKTLPIRYSGMSDVNYYEPLVL
                     RYKKSSMGRGMDGGGEGLCPYCPLPMGEQDSAFYDRKDSNYLHHVTKLHGVYSNGIEM
                     PFPYFVGKAIETKTLKTRGEVANTVNAVKCTKCKQMLKIQPLDSIITSPGNKFLAYFR
                     HMLIHNQKKNYGKTKGYQPEA"
     gene            complement(<655363..>657636)
                     /gene="MES1"
                     /locus_tag="FOA43_000312"
                     /db_xref="GeneID:62193713"
     mRNA            complement(<655363..>657636)
                     /gene="MES1"
                     /locus_tag="FOA43_000312"
                     /product="methionine--tRNA ligase mes1"
                     /transcript_id="XM_038920645.1"
                     /db_xref="GeneID:62193713"
     CDS             complement(655363..657636)
                     /gene="MES1"
                     /locus_tag="FOA43_000312"
                     /note="BUSCO:EOG093411B2"
                     /codon_start=1
                     /product="methionine--tRNA ligase mes1"
                     /protein_id="XP_038776573.1"
                     /db_xref="GeneID:62193713"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR023458"
                     /db_xref="InterPro:IPR029038"
                     /db_xref="InterPro:IPR033911"
                     /db_xref="PFAM:PF09334"
                     /translation="MSSLQIFSDRGSKIPSLVRNLKIGIGAAVFQPSVKLVADTDNEE
                     YNLTLVDKKSGFQLIEANAIVKYLAATSKKGSKDAFKVDPVELVLDDILKKRKFNDSI
                     LPLVKPFSQADATSIPQIFAFATLYPVLTKTAHKNEGFEDLKSWFNAFAALPEVIEGV
                     KAVTSLTHLERSKEKNTGKRNVIVRHEVVKPEGKLAPKEGERNILITSALPYVNNVPH
                     LGNIVGSVLSADIFARYCKRRNYNALFICGTDEYGTATETKALEEHVTPRELCTKYHK
                     IHKDVYDWFDIGFDYFGRTTTAKQTEISQKIFLELHKNGYLEEQSMKQLYCPVHKGYL
                     ADRYVEGECPKCHYEDARGDQCDKCGTLLDPFELINPRCKLDNATPEPRHSNHIFISL
                     DKLEPELKEWVKKSSTEGHWSKNAKTITNSWLREGLKPRCITRDLVWGTPVPLKGFED
                     KVLYVWFDATIGYVSITANYTDDWRAWWQNPEHVKLYQFMGKDNVPFHTVVFPSTEIA
                     TREPWTMLHHLNTTEYLQYEGGKFSKSRNIGVFGNNAKETGISPSVWRYYLTSIRPET
                     QDSQFSWEEFVTKNNSELLANLGNFVNRIVKYVNAKYNGVVPQFDVKNCEDYAKALQD
                     FNKLIETYNEDLDSVHERKGLETAMLTSARGNQFLQDNKLDNSLYNDHPDKADAVVAI
                     GLNIVYLVSALISPYMPEATSLIEKILNVPELRIPDKLELWIQGGHCIGKPQYLFSRI
                     DEKKVEEWRAKYGGQHA"
     gene            complement(<658256..>658957)
                     /locus_tag="FOA43_000313"
                     /db_xref="GeneID:62193714"
     mRNA            complement(<658256..>658957)
                     /locus_tag="FOA43_000313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920646.1"
                     /db_xref="GeneID:62193714"
     CDS             complement(658256..658957)
                     /locus_tag="FOA43_000313"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG09343WSJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776574.1"
                     /db_xref="GeneID:62193714"
                     /db_xref="InterPro:IPR013248"
                     /db_xref="PFAM:PF08229"
                     /translation="MISYQQLLPIGSLMMISTCSFMLGIFFADWPYDYYTLWDSSHGE
                     EFFTKALDHYKTLATQPTVIISSLAGIMSIGFIGSFIKIFKPSEDTKYFEYGSLIALV
                     SAVCIYLTNVRTGQMSALFGEWGEVSQNVGLSVIAASQVMIVVLLLGVVVLQCGLFYA
                     EYSDYKAKTDFYMKELGEQFISAEEAKQRGSKSKPSETKTKSKPKSKPKSKANARAKT
                     TGASSKETSTKSRKA"
     gene            <659268..>661625
                     /locus_tag="FOA43_000314"
                     /db_xref="GeneID:62193715"
     mRNA            <659268..>661625
                     /locus_tag="FOA43_000314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920647.1"
                     /db_xref="GeneID:62193715"
     CDS             659268..661625
                     /locus_tag="FOA43_000314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776575.1"
                     /db_xref="GeneID:62193715"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR007582"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="InterPro:IPR037264"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF04494"
                     /db_xref="PFAM:PF08513"
                     /translation="MASNQVSSQQQGQQQPQEQQQQQQPQQQQQQQQQQQQQQQLQNA
                     SRQQQARHFTQADMNRLVLEYLNKKGYHQTEATLRIESTKIPGQPTIPLTPGNSNFEK
                     PKTIVSDRSNLQFQQQQFIQQQKISRQRQYDENPSMYGRAYSMFRTWCENSLEMYQYE
                     LDKFLYPLFVYLYLALIQRSESAESRSFYERFKNDHLLQHGYEVRGLGGISLPSHIEQ
                     NQVASIFKHNKYRIYVSTTSMNLVLGFLNENQGIGGGILVRTINNNMEVVTQIEVTTA
                     AQDETEALEKAEGIPAVYQLINSGEETLAEEKQKEKDRANPAELLNGKSLKLGQIPND
                     SDFTKEVEAELKQRDDVEKDKNGDKPPEKTLMQEYSENFNIESTADESPSKDVLPLPQ
                     KNVYDLKREIIKVQDSRAKIRLNAVQAHLPSVCMYTFHNTNNDMTCAEFNDDSTMIAS
                     GFQYSFIKLWSIDGSPLRSVLKHDEFNETADDGLAINNSRRLIGHSGAVYGLDFSPDN
                     HYLLSASEDKTVRLWSMDTYSALVSYKGHNAPVWDVKFSPLGHYFVTGSHDQTARLWS
                     CDHIYPLRIFAGHLNDVDVVEFHPNSTYLFTGSSDRTVRMWDIARGESVRVFIGHTMP
                     INALACSPDGRWLATAGEDSVINLFDIASGRKLKSMRGHGGGSIYSLSFSRDGSVLVS
                     GGSDNSIRVWDVKRGTLDSNNPRPEKFTYESVINAKDSDETTRVDNIAGDDKRPNDAA
                     DEIKRRKEFAATQDHMAVFFTKKTPVYKVHFTRRNLCLAAGVYMG"
     gene            complement(<661646..>662767)
                     /locus_tag="FOA43_000315"
                     /db_xref="GeneID:62193716"
     mRNA            complement(<661646..>662767)
                     /locus_tag="FOA43_000315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920648.1"
                     /db_xref="GeneID:62193716"
     CDS             complement(661646..662767)
                     /locus_tag="FOA43_000315"
                     /note="BUSCO:EOG09344761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776576.1"
                     /db_xref="GeneID:62193716"
                     /db_xref="InterPro:IPR009450"
                     /db_xref="PFAM:PF06432"
                     /translation="MAFLSHSYRRNSISLPELQATKGSRFFRKQTTWKKLLWVKQDYD
                     DDYTDSSFLSQLKRNSTVVNYSYWKLFRDFSLVNLHLSVIMCVILVFYGMYMLRWDPV
                     RPIILSSALTLLGFIVYVVTLKIRRNKELIRLQHWKILQLTSSRESGSAAAHLDLEKY
                     ITEPASPGLISAFKSSMLILLHLLTLSPVLKSLTNSSASDSIWAISAWLCLLNVLFND
                     YVIDFPQKQRFPELGAVATTANAAPVLPKIGSHSNMSKNIALSNAIVLASRLNSNLSA
                     FCFILFSIELCGLFPIFNNFTRRCQFWVFHWLQVGTIVFGVSYAMYRIFGTGWCICWL
                     SLHLLIVVVGPLYFIALQKYKDELQGPWDPAHPVVKSIQ"
     gene            <662923..>664050
                     /locus_tag="FOA43_000316"
                     /db_xref="GeneID:62193717"
     mRNA            <662923..>664050
                     /locus_tag="FOA43_000316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920649.1"
                     /db_xref="GeneID:62193717"
     CDS             662923..664050
                     /locus_tag="FOA43_000316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776577.1"
                     /db_xref="GeneID:62193717"
                     /translation="MFTKSRDRSESHGSKDSLNDFLTGSRSSLELRPVSTVRRNHGDS
                     MDEGSLKSSATGSSSIPELAVPLSTQSTKSKTRNGHSYSASIDTSLSQGSNESNTDLD
                     ALDTDSTDEFHSIRDMEVYSDSPSGKDNDGDHSDSRIASGNNYIDHRRMVSPLTSLEF
                     LPVGSSRNTESNEKNSSESVGEGITSEDSEDETDDIDTYDGEGDDAPGADHIPLFGEK
                     KIGDEMPSVSQKVDNQDRLYETLNILNDVRKLREMKFFDAKYNEKMIDLKKAQVGMMV
                     DMIQMNENSFREFYEVWDALEDRGEEEEREVEEEKEQKKHKFRKKKSEHQDKPLVHLD
                     INESALFGQLGERNEVVSQDIDKIKDSVKQIDEYTKGLWDS"
     gene            <664658..>666298
                     /gene="PGI1"
                     /locus_tag="FOA43_000317"
                     /db_xref="GeneID:62193718"
     mRNA            <664658..>666298
                     /gene="PGI1"
                     /locus_tag="FOA43_000317"
                     /product="glucose-6-phosphate isomerase"
                     /transcript_id="XM_038920650.1"
                     /db_xref="GeneID:62193718"
     CDS             664658..666298
                     /gene="PGI1"
                     /locus_tag="FOA43_000317"
                     /note="BUSCO:EOG0934173C"
                     /codon_start=1
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="XP_038776578.1"
                     /db_xref="GeneID:62193718"
                     /db_xref="InterPro:IPR001672"
                     /db_xref="InterPro:IPR018189"
                     /db_xref="InterPro:IPR023096"
                     /db_xref="InterPro:IPR035476"
                     /db_xref="InterPro:IPR035482"
                     /db_xref="PFAM:PF00342"
                     /translation="MTSPVNLPAWKKLQELYGSYGKTYSTKEAFAKDSDRFNKFSHTF
                     ENYDGSKILFDFSKNLIDENILSALIELAREAKVETLRNDMFSGKHINTTEDRAVYHV
                     ALRNRSMKPMYVDGVNVAPEVDAVLKHMKKFSEEVRSGNWKGYTGKEITDVVNIGIGG
                     SDLGPVMVTEALKPYAHPRIKVHFVSNVDGTHIAEALKQCNPETTLFLIASKTFTTLE
                     TCANAQTAKNWFLKTVQNPKHIAKHFVALSTNATEVQKFGIDIKNMFGFESWVGGRYS
                     VWSAIGLSICLYVGFENFDKFLKGAEAVDKHFVSTPIEENIPFIGALLTIWYNNFCKA
                     QTKLVAPFDQYMNRFPAYLQQLSMESNGKSVSKDNKFVNYETGVVLFGEPATNAQHSF
                     FQLVHQGTKLIPTDFIMAAKSHNPIENNKHQKMLAANFFAQAESLMLGKTSQQVAAEG
                     TDENLIPHKTFSGNRPTTTILCQKITPATLGSLIAYYEMMTFVEGAIWGINSFDQWGV
                     ELGKKLAKVILAELQDEKKVENHDASTRNLINQFKKWE"
     gene            <668883..>672036
                     /locus_tag="FOA43_000318"
                     /db_xref="GeneID:62193719"
     mRNA            join(<668883..669543,670084..670236,670667..>672036)
                     /locus_tag="FOA43_000318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920651.1"
                     /db_xref="GeneID:62193719"
     CDS             join(668883..669543,670084..670236,670667..672036)
                     /locus_tag="FOA43_000318"
                     /note="MEROPS:MER0114503;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776579.1"
                     /db_xref="GeneID:62193719"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR006031"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR029030"
                     /db_xref="PFAM:PF00635"
                     /db_xref="PFAM:PF00656"
                     /db_xref="PFAM:PF02162"
                     /translation="MQVSPKILEFCSPFTKQQTQEVTVSNDTSSYLAFKVKTTAPKIY
                     CVRPNASTVAPGESVTVHIILQGLAEEPAIGTKCKDKFLFVSVPCDDTVDPKLVSNEW
                     ASLQKAVGGSSKGIKMKVSFNYGAAINPIQEEEKEPEDAEISEVPEVPEHAKETTSDA
                     AAADAVASAAAATGATATTSSTVLRHVKGSKGSSDSTETEKTEKKAPSSINSGSHTKV
                     ASNVPPAPKRQRRSVLPPPGSEMVEISSAEEKDDTEVSDTESSDDEVVIIGSDGVFTI
                     VMFPGRSSTTYSSQQKKNSSRPQAEYSIQEVSAQSYPPQGYPPQGYPPQGYPPQGYPP
                     QGYPPQGYEPPPAYSDDRPQAGSSAATSNYERPACPTPQNLVPGKLYENQNSRAANTV
                     NGVTYENPDEPPPMPSQSVMSYQINGETVQDFEYSQCNGVRKALLIGINYIGTGNQLR
                     GCINDANNMRRFLLTNGYPSENIVMLTDDQKDFMSIPTRQNIIRAMQWLVKDARPGDS
                     LFFHYSGHGGQEDDLDGDEADGKDDCIYPVDFKQCGSLIDDIMHDIMVRPLPAGCRLT
                     AIFDSCHSGSALDLPFVYRAQNGGLKEYNVWKESGGDAVNILMGYASRNPMEMFSGAK
                     SIYKRFAANTGGNQEAIKQQKMSAADVIMFSGCKDSQTSADAQEMGQFTGALSFAFIQ
                     VLSQNPMQSYLTLLQNIRAVLSTKYTQKPQLSSSHQIDPNIRFIM"
     gene            <672146..>673687
                     /locus_tag="FOA43_000319"
                     /db_xref="GeneID:62193720"
     mRNA            <672146..>673687
                     /locus_tag="FOA43_000319"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920652.1"
                     /db_xref="GeneID:62193720"
     CDS             672146..673687
                     /locus_tag="FOA43_000319"
                     /note="BUSCO:EOG0934150P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776580.1"
                     /db_xref="GeneID:62193720"
                     /db_xref="InterPro:IPR000417"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR022998"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="InterPro:IPR034291"
                     /db_xref="InterPro:IPR036206"
                     /db_xref="PFAM:PF02110"
                     /db_xref="PFAM:PF02581"
                     /translation="MNRNDFDLSVYLVTDSGMLPDGVSFVEQVKRAIDNGVTCVQLRE
                     KSIETKDFIERARAVKKLTDAARIPLIINDRLDIALAVDAHLHIGQDDMDARTARKLL
                     GDDKIIGVSVSTVEETEKAIDDGADYVGIGLCFNTQTKITTKMPKGPRGAQDILRAIY
                     NKGSNMKTCLIGGISQSNIQQVRYQSGIPENRLDGVAVVSCIMKQDDAAKATMELARG
                     WNSVPKWCTTIRKVNLTHKQLTQNVRNSRPIVHHITNNVVKNFSANVTLAIGASPIMS
                     ECIEEFDDLAKFTGGLVLNSGEISQCDVPLYISALRAYNEHNKPIVYDPVGCPASVYR
                     RNFTKMILMEGYLTVIKGNQDEILAAAGMDLGVSGGCDSVSNIRFSKLSEIAKQFALS
                     TRSVVVVTGKTDIVADGIFSGQTDLVDCDVQNQRFECLEGGSEMMSQITGTGCSLGSV
                     ICSFVAANREDPYQATLAACMLYKEAGGLAGQLAKHKGPGTFQYLFLDALNQCSLGNC
                     VDSEF"
     gene            <673730..>678219
                     /locus_tag="FOA43_000320"
                     /db_xref="GeneID:62193721"
     mRNA            join(<673730..673736,674273..>678219)
                     /locus_tag="FOA43_000320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920653.1"
                     /db_xref="GeneID:62193721"
     CDS             join(673730..673736,674273..678219)
                     /locus_tag="FOA43_000320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776581.1"
                     /db_xref="GeneID:62193721"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029295"
                     /db_xref="InterPro:IPR036427"
                     /db_xref="InterPro:IPR038718"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF00439"
                     /db_xref="PFAM:PF04851"
                     /db_xref="PFAM:PF07529"
                     /db_xref="PFAM:PF14619"
                     /translation="MNRVMIELQSGLIEHQSSDFAKSLGTDANGTVTSADSFAIARSA
                     DSSSAPASPISDEPKGVIPLEIPMPESSDALQQLLRRYRELEASRTHEPEKLGILKVL
                     RKINRQQQQYEKDLSEENKLWRKNHEHVNLGLLKKQIAGFQLLSRDLDLPLGLQLQLD
                     EKKVKEALMEYSKQPQQPQKSDGSQIRLPIDDYEKKASLFGIKSRRLTAESALDAVGT
                     DFAEQQLRTKIQMRVTELESLPSNLGVYDGTTLSNDLKHTNDDVIDGIDNLKIQAILE
                     LKALRLLPLQKQLRNRLVVSSTRNRIIVDESLNKNSVFKTWKRTYCIRNKQRVAQTAR
                     LAEKLQEQQKKELTEQMRMLRQNRLQGLIEVITEAQNEVLARKSLRISLGKSVHHLHL
                     QSEREESRRMERTAKQRLQALKANDEEAYIKLLDETKDQRITHLLKQTNSFLDSLADA
                     VKMQQQESKIMERIEKGDVETAIDTESKPTDEEKDSKVDYYEVAHHIKEEVNAQPHML
                     VGGTLKEYQVKGLEWMVSLFNNHLNGILADEMGLGKTIQSIALITYLLEQKNETGKFL
                     LIVPLSTITNWTMEFDRWAPTVKKIVYKGSQQQRKAMSYSVRSGDFTVLLTTYEYVIR
                     DRPMLAKFKWAHMIIDEGHRLKNTHSKLFQTLTQYYHTRNRLILTGTPLQNSLPELWA
                     LLNFILPKVFNSVKSFDEWFNTPFANTGNQEKLELSEEESLLIIRRLHKVLRPFLLRR
                     LKKDVEKDLPDKVEKIIKCKLSALQTRIYKQLLDHNALFIGSGSVGANKAGLRGLNNK
                     IMQLRKICNHPFVFEEVEDLVNPSRLTTDLIWRSSGKFELLDRILPKLQVTHHRTLLF
                     FQMTQVMDIMEDFLRLRGVKYLRLDGSTKADDRQDMLKAFNAPHSEYFCFLLSTRAGG
                     LGLNLQTADTVVIFDTDWNPHQDLQAQDRAHRIGQTHEVRIYRLITEDSVEEVILERA
                     HQKLDIDGKVIQAGRFDNKSSAEEQEAFLKRMLESEKQKAEERQTDEMDDEEMNEILA
                     RSDEEKILFEEMDTERHNSERGNKLPRLMTDEELPEVLRMDMDMQLEPDHEEIHRRRN
                     RKRVIYDDGLTEEQWLQALDDDNDTVEAAALRKRKSLHKRRSRRSARSTGSGTPSENE
                     STTDFDVNESDDYQDEEEPTAKRKMRPPEEHLVEGYDQVSDDASAEPDQELFVSMGLE
                     LLKELREMKDERGRKLADLFMTLPPRKIYPDYYEIIREPVAIREIKNKLKKNRYESFD
                     DFKLALETMFKNAKTYNQVESMVYDDATKMQKFAEEKFAEIKQKLVKREDKMITE"
     gene            <679999..>682578
                     /locus_tag="FOA43_000321"
                     /db_xref="GeneID:62193722"
     mRNA            <679999..>682578
                     /locus_tag="FOA43_000321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920654.1"
                     /db_xref="GeneID:62193722"
     CDS             679999..682578
                     /locus_tag="FOA43_000321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776582.1"
                     /db_xref="GeneID:62193722"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF02257"
                     /translation="MPKSFDAQKFDQNKRSIGVQGELPIQRAFQDLNSETLRYRPQIE
                     LDTTFQGLALPSGGDSPNIKMDLQKVPVQRRTSLPGQNSQGASDMQDQEQQQQQQLQQ
                     QLQQQQQLQQLQQLQQLQQLQQLRQQQQPQHQLPAPSSNYSQQQMSQQVQRQSLFPLQ
                     QPQQSSANNGYYYSQMENSPMGASTPSYSTIAETFANWPDYARQSQGYQDNAVSHVSM
                     GTSQHDGSPFQPIAEPPYNEHTAIDNVNRNHIHSQDHQQSTRQQLQQQPEQPPEQPLP
                     PLQPQQRLAIPQLSQTQPISMSIQSEIPESEIRWPQSIEDTITTGSSSPANSTRHDLR
                     QELGGTGGKRTEMKIKEKPSQKSITNSKKYKKFREKLLQEVKETTERYISLADLGKYY
                     KMNTKSTLKEKENFKSIFSIRCLMEIAYPTDKNERGTEVLRSSLYLIYHTISEFLKVE
                     PIGPSSIGKLIRITFPKIRTKRLGIRGQSKYHYVGIKLKEKYLRLVERLDDGDSNLKF
                     NQLLVNNLNMRQRITHLSNVSFGDVLKAQAEVGSNGMGAEVRLEEDLMKMDEETQATY
                     VAFVKRLFVEKDIAGAVSYLLGNSQIIHYSNELRIYNNLVACFRDMVYRQPLERFVSL
                     FRNVADNYISEYMKQLRHVELESLDYRKRMNLAKLFARSVSRLSELNKFTGDLDVILA
                     NSCGELLQDLEDFDILGKAQKIFAHNLDLYSEDGELLQTCRVMISKLTQLFRTQKYTP
                     TIISHLPDPVELRILVPELAHLAMYSEIGSVHRLSDFNRDCMLAFKDYSVRKVRATMM
                     KLFDELLRHLISHCADPARIRNWLIIKNWVNDWWEFTEFWIFTRYLLYENFLDAVEGE
                     EET"
     gene            complement(<683600..>684508)
                     /locus_tag="FOA43_000322"
                     /db_xref="GeneID:62193723"
     mRNA            complement(<683600..>684508)
                     /locus_tag="FOA43_000322"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920655.1"
                     /db_xref="GeneID:62193723"
     CDS             complement(683600..684508)
                     /locus_tag="FOA43_000322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776583.1"
                     /db_xref="GeneID:62193723"
                     /db_xref="InterPro:IPR018464"
                     /db_xref="PFAM:PF09496"
                     /translation="MKAEISLLQTEIDQLSERYERLQKESNKANKDATAPEQLPIEEH
                     PDLTNHQYFEELINGIMIKGITEQERLDKEKLEGHYKRRKLAREKNVKDYEALKSQFL
                     DKVQLESCYRLGGITAFPVNDPSADDEDRFLGIRFDTYDVYSGKYTTPHYIILKKRVK
                     TNDWYVFKTTVPNFIPVNALSTQFLNTEMFKFVSEIRRHLILLQVKKSVFGVLSLKLQ
                     TPSRLDSDLSFTKVNINVQNKFEIVLICGEKSISSVIVIGDKDQSGGLLTKVTRRKLE
                     LAFRGCKYSGFEKQFFEILKNCQISI"
     gene            <684699..>685391
                     /locus_tag="FOA43_000323"
                     /db_xref="GeneID:62193724"
     mRNA            <684699..>685391
                     /locus_tag="FOA43_000323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920656.1"
                     /db_xref="GeneID:62193724"
     CDS             684699..685391
                     /locus_tag="FOA43_000323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776584.1"
                     /db_xref="GeneID:62193724"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="PFAM:PF00383"
                     /db_xref="PFAM:PF14437"
                     /translation="MKEALKVAQSALSSKEVPVGCVYVYKGHIIGRGFNKTNLTLNGT
                     RHSEFIGYDEIRQTFKDNFREVFKETDLYVTVEPCIMCASLLRQLEIRRVFFGCANER
                     FGGNGSVYQVNTDVCELAEQYHVHTGKTYVSYPGILSREAVILLRNFYILHNDKSPIA
                     NDKKHRRLELQNFPILNYSKHLSRAEFTEMFGEQYGFIYDNNDLMTFNDNGRLINKVT
                     DKTMNKRQKVCS"
     gene            complement(<685393..>687228)
                     /locus_tag="FOA43_000324"
                     /db_xref="GeneID:62193725"
     mRNA            complement(<685393..>687228)
                     /locus_tag="FOA43_000324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920657.1"
                     /db_xref="GeneID:62193725"
     CDS             complement(685393..687228)
                     /locus_tag="FOA43_000324"
                     /note="BUSCO:EOG09341GRO"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776585.1"
                     /db_xref="GeneID:62193725"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="InterPro:IPR036871"
                     /db_xref="PFAM:PF00787"
                     /translation="MADQFTSVSWDKEESKANVGEVDINAEDSPKVVIDSSSEPPPLE
                     SLKEENDQTIEDKEDQDGPDNESGLITSKMVLAANAENNAPEGDKALDVEADVKNVNE
                     TGNSSESKAELQSDYAPDNVSGSSQAGAFSSLASSAPSYQIETIVGEPLTEHDSSNAF
                     VSYRIIVKTQDPAFPQKEFQTRRRYSDFFFLYQCLMNDYPTLLIPPLPNKQRLEYIKG
                     GRFSDEFTTKRSISLSNFLYRVCYHPILQKSDVLHIFLADTDHWNTYKSNLKIPPASG
                     LDTTNSASQNLETVTEFIMNSFKKPIVEPHDKKEFQDIQDKVSRLQENLSKIDSIYGK
                     VLHRQHNIADDISKFGDEFSKLTLLLSNDLDGSHSEPEDLDGNTKRLVKQFSDFSGNL
                     SEVSENIYHLDHRIEYNYLTALKDLEHYILQLKNLLKLKDAKALDFDMLSNYLDKAKQ
                     EKEHLMNGGSITVTTEGTLSFLTRKLESVTGLGSRQAGNLTNERIDKLDERIDMLAKE
                     KEKAKKIYFQYERDILTEYEYFNKIKNREIASSLEQLGKYYLSFYSKATEELKKLDIN
                     VASEAFTFDNKLTQDGKLFSGNQVQKNGEIIADDIQKIDNMTNGN"
     gene            complement(<688003..>690222)
                     /locus_tag="FOA43_000325"
                     /db_xref="GeneID:62193726"
     mRNA            complement(<688003..>690222)
                     /locus_tag="FOA43_000325"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920658.1"
                     /db_xref="GeneID:62193726"
     CDS             complement(688003..690222)
                     /locus_tag="FOA43_000325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776586.1"
                     /db_xref="GeneID:62193726"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF05383"
                     /translation="MSTVLSYAHAAGAANSSYDLKENQESSKEESAFLPSENTSDSVS
                     VPTTSELLTPSISSKSSKSEHVSEEASAEPELTSKPTTKDDTENFVLTPVAADNDDDD
                     KKKKVVENLKFEPKQESDDSEGPILSEKIPETKETKETKETEEIKETKETKKFDEAED
                     INESKETKVTKETKETTESRETTESKETKESKETKETKESKEHFKRAKLAPAPPPSTN
                     AWGTTPKANPTSKSPIIETILSENNTNLSSSRFKAPAGKEKWVPFKASVVIASAKSGA
                     SNSSSGSGKSASGKKKNKKKSRDQDKRGSKRQSQPQQQQQQKSAAPKQHNKTQINEKA
                     IAGAAAVEATVKAATETVEKIFDSGLEASPESATTSAADADPSIHSFSEGTPDESVVE
                     QGKKHGNLYNQESPNNYGSHEHYQGKQYSGAGNKGFSNNNRPYNKRSGNNGNGSASQN
                     GNTYQQRSYRSHNSQNTDQRYGNGAVPYLPYNRQYFVPMMYVNGNGSAAPVNGSVTAP
                     VASTTNVPSDSSNSTATTDSGSVTDAATASNMSVGSNGRHHNNRHGRRNNFVSPYMMQ
                     SLYPPMGYMPYGQSYGPIVSAQSPVPYAAEDGKSSKEAQLESLARQIDYYFSPQNLIK
                     DIFLRKNMNDEGFLPLSVVAGFYRVSAMSYNNVDAVIECLDRCQNLEYGVIKNDKDEK
                     TYKLRPIENPYQWVLSEDQRTVAGRDNVTPKTQLKSESSRATETVGEDAELTSEEKR"
     gene            <691433..>692551
                     /locus_tag="FOA43_000326"
                     /db_xref="GeneID:62193727"
     mRNA            <691433..>692551
                     /locus_tag="FOA43_000326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920659.1"
                     /db_xref="GeneID:62193727"
     CDS             691433..692551
                     /locus_tag="FOA43_000326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776587.1"
                     /db_xref="GeneID:62193727"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR020843"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00107"
                     /db_xref="PFAM:PF08240"
                     /translation="MTYPDTFEGFAVFNPSPETWSTVKKYEFTPKPFEDHDVDIKIQT
                     CSICGSDVHSATNGWNKTNAYYPLVPGHEIIGKVVRLGPKVTDFKLGDRVGVGAQAQA
                     CLKCKICKSNNEIYCPHLVHTFGGVYQNQDGTETHSQGGYSNYARINDYFVFHIPEEL
                     SNEEAAPMLCAGITTFSPLVRNIPKELPEGQSKPRVGIVGLGGLGMMGIQWAHALGCE
                     TFVFSRTSRKKADAIKLGADQFIATAEDPDWVKKVEFDLDLVVCTANSAEGFDLNTYL
                     RSLKIGGKWVNVGLPETPFTVSPRSFMANACFMGASHLGSHVEMIRMFKLAVEKGVRA
                     WVEKIPISSDGVKEGLERCRYNKCRYRVALTDFDKAFA"
     gene            complement(<692587..>694626)
                     /locus_tag="FOA43_000327"
                     /db_xref="GeneID:62193728"
     mRNA            complement(<692587..>694626)
                     /locus_tag="FOA43_000327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920660.1"
                     /db_xref="GeneID:62193728"
     CDS             complement(692587..694626)
                     /locus_tag="FOA43_000327"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776588.1"
                     /db_xref="GeneID:62193728"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="PFAM:PF04991"
                     /translation="MEVMAQWEYHNPPNDIDAEDILKVLALSQKRIATLNLGYSNLPL
                     SGYQKPGEKNTMFDPRLPAALYIAKMSQHIEEQQSDLLDVDFKLQFSWKDWTDFDKRL
                     LPSEEYLQWHEGYPIQDCEQFVSETGFSVSPNCVDLSPSEIKHLFNPMYPRFKMTRPA
                     DPRIARDARVLIASTFLYHSFDAPERILFVDSGRDSVVSIRTTDSTNRMSLLKQMSYE
                     YLNMDSTVSETAGISLSEQVGRLFSDLEKCKLVSEADELDEFRIIKISDEKLNQPIEL
                     PRATFDWEKDTSKLQASIDENLSQFEESCKKTPNAPECDPDKAVGIKMTHHIKDALVK
                     YGNNKFPKHFHEAGYTPKGNDNGAHFDWRFIGSRALSEYESTSGLHKLMRSWLRMTRI
                     LGVDTWIAHGSLLGFYFNGLILNWDFDHDVQVTEESLILLGRDFNQSLVVDISPGSSD
                     QPQLSDMGTGEFFIDVGSSIYHREKGNGNNAIDARFIDIHTGMFIDITALAITKSKPS
                     SKSMGNNLSKEYAKFLIQNKLTTNDYGDFLSDRNNHHYSMNEISPLIPTLFEGEQVFI
                     RQGIMNILSREYMNYKKNTGFQGHTWRTRYRSWISDEICNHLDHEGNSCSTNPEVLLD
                     DRFQRNYISLHMKEKQILDQADHEEIRREPATIKAYPEVLRPDAVLMKIAKERLH"
     gene            <696196..>700872
                     /locus_tag="FOA43_000328"
                     /db_xref="GeneID:62193729"
     mRNA            <696196..>700872
                     /locus_tag="FOA43_000328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920661.1"
                     /db_xref="GeneID:62193729"
     CDS             696196..700872
                     /locus_tag="FOA43_000328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776589.1"
                     /db_xref="GeneID:62193729"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="InterPro:IPR034001"
                     /db_xref="InterPro:IPR034003"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF01061"
                     /db_xref="PFAM:PF06422"
                     /db_xref="PFAM:PF14510"
                     /translation="MLSEEKDTNQPSTAVTSNAAAGLTNNDSLSEASSVVSYQGDPED
                     NDDERQAISHLHETVTRSITNDPNSNVLTRLSSLSQTLSHLSYAGMKSFKIDPNDFDL
                     KRVLKFIANRNSEQGIKQKKTDIVYEDLTVIGKNSSAAIVKDVGSALFPFLVLLKQKL
                     GREQKLDLSRMSKTREIIRGVTGYGIPGTMTMVLGRPGSGCSTYLKAIAGETQTYIRV
                     EGDVHYDGIPRDKMVSHFKSQLIYVPELDDHFPYLTVEQTLKFAIGCKTPSIRVDNVS
                     RGDYINTIKDLYTVLFGLDHVEKTLVGNDFVRGISGGQRKRVSIAEAMATRGTVYCYD
                     NATRGLDASTALEFVEALRTSTNITQTTSLVTAYQASESIYELFDYVSILYTGRQIYF
                     GSTSKAVDYFQRMGYKKNSRQTSSEFLTAVTDPLERKSLPGFETKVPSSASEFEDYWR
                     NSPEFQEVKEKIATLRLESNPEDTTKTFNDVHVMERQKWTLPRSKYTVNYFEQLKLCC
                     SRAFYNIINNKAYTVTQLCVAVVQSLVVGSLYYHIPSTTLGAFSRGGVIFFAILYFVI
                     MSLAEISALFQNKPIMNKQRGYTLYHPSAELLSGQLIQLPVLVTAITLFTIVLYFLSD
                     LKRQAGAFFTFLLLVIVAVQTVETWFIFIASLCPTLSAANGITGIMMMMMILYSSFMI
                     QRPSMYWWFKWFSYINPVLYGFESLITSEFHGSWMQCAPSQLIPSGPSYKNLPSGSQV
                     CAFVGAAQTSQKYGTSNNEVEGDVYLSISFEYFYSHCWRNLGILFAFIFGVLAINAVL
                     VEFYNPIVASSDKLLFVRGGRIPSDITALTGTSEDPEKGDSNSEHKRNGSTNVAASST
                     SPSDGSKSNDDIEKSDTEEHLTFNDKLGSDDIFMWRHVNFTVPYEGKQRKLLDDIQGF
                     VLPGTLTALMGESGAGKTTLLNVLSQRVDVGVVTGDFLIDGHPLDSSFERRTGYVQQQ
                     DLHIAELTVRESLLFAARLRRPMSVPDFEKVEYVEKIMRILHMEEYADSIAGQAGYGL
                     NVEQRKKLSIATELVAKPTLLLFLDEPTSGLDSQSAWAIVQVLRQLAEAGQAILCTIH
                     QPSATLFEQFDRLLLLKRGGQTVYFGDIGKNSHTVINYFETHGGRVCDAKENSAEYIL
                     EVIGAGATASSHDNWSDTWLQSEEYQKFSVEVDNLIASRARKEADHSEDLSELQSKYA
                     TPYIYQFREVFKRTWYQFFRDLNYIMAKLMLMVLGGLIHGFSFWSVKHTVVGMQNALF
                     ANFMAIVICAPLTNQIQARAMQSRELFEVRESKSNTFHWSTLLLSQFLVEVPYAVLFS
                     TLYYICWYFPIQFPLNAPIAGMWWFTYCIFFQLYYISFALWVVYFAPDLPSANVISGL
                     LFNFVIAFCGVVQPPSLMPGFWKFMWRSSPFTYFVDSMMSISLHNRPVVCSAKEMNYL
                     DPPNGETCGEFLKPYFTTHDGYVYNPDAASNCGVCQYSNGDQYLASLGMAYSHRWRNV
                     GLFCVYICFNVFAMLSMYYLFRVRGMSLPKINLPFSKKKSLQDKSEEKSIEKQPEEQH
                     VAELSE"
     gene            <701144..>701602
                     /locus_tag="FOA43_000329"
                     /db_xref="GeneID:62193730"
     mRNA            <701144..>701602
                     /locus_tag="FOA43_000329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920662.1"
                     /db_xref="GeneID:62193730"
     CDS             701144..701602
                     /locus_tag="FOA43_000329"
                     /note="BUSCO:EOG09344PK6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776590.1"
                     /db_xref="GeneID:62193730"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="PFAM:PF01423"
                     /translation="MAIGQIPRKAKLATLLNFKVRVTTTNSSQFIGILVSFDRYMNLV
                     LSECEEFRLTKKSQMQLRKQSNQNKKIIDESGIKEQKRLLGLVIIRGEGIISVVVEAA
                     PSSSSRPELNLKKGKGTVKPLIKTLNNNGGLNAPLKAINSGIGKPGSRRS"
     gene            complement(<701644..>705447)
                     /locus_tag="FOA43_000330"
                     /db_xref="GeneID:62193731"
     mRNA            complement(<701644..>705447)
                     /locus_tag="FOA43_000330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920663.1"
                     /db_xref="GeneID:62193731"
     CDS             complement(701644..705447)
                     /locus_tag="FOA43_000330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776591.1"
                     /db_xref="GeneID:62193731"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR025696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF08148"
                     /db_xref="PFAM:PF13234"
                     /db_xref="PFAM:PF17911"
                     /translation="MSNKQNVEVLLKEIRKLDDDDDTHLPLDPNLKTKFQFTDPSRSE
                     IDDQIRSRYLTPRNELTWDLLDEFQNVPDVDTHITKHFYRSLLYLPPLADRTCIRFKR
                     QGIEGSIVSYDEQFDISLLESSMSASNSLSVKRKFTSKSQALRGTSTNLPFQPGGIMS
                     SHVLQDATKYLHRDSHGLFDIPQGFKRGLKLPLEDDQQDDELKIEQLNDHPDERVDNE
                     NSEIVVDDENDEQSLFESNDKSSELDDVISRIIPPGSIVRPSSVTSAGTTHSKRNKEW
                     THMIRLDHKIENFDELVPNPARTWPFKLDVFQQEAIYHLEQGDSVFVAAHTSAGKTVV
                     AEYAIAMAQRNMTKVIYTSPIKALSNQKFRDFKESFDGMEVGVITGDVQINSDANCLI
                     MTTEILRSMLYRGADVLRDVEFVVFDEVHYVNDVDRGVVWEEVIIMLPPHIKMILLSA
                     TVPNTYEFASWIGRTKQKDIYVISTPKRPVPLEIDIWARDRPFKVIDSNRKFLEKGFS
                     GHVGKLTLSKASKKEESGKGERGGRGGRGGRGRGSRGGRGSETNGFRGGGNRSGGSNG
                     NRRSGYDGPTRNTWPTLINYLRKHDLLPAVIFVFSKRKCEEYADTLSGINFCSSKEAS
                     EVHMFIDKAVSRLKREDRELPQILKIREMLERGIAVHHGGLLPIVKEVVEILFSKSLI
                     RVLFATETFAMGLNLPTRTVVFSSLRKHDGTDFRYLLPGEFTQMSGRAGRRGIDTLGT
                     VMVMSYNMPLDRVSFKETTMGTPTKLSSQFRLTYTMILNLLRIEALKVEDMIKRSFSE
                     NSAQAMLPETQLEVVKSEKELEEKYKVTIDADEYAVLKKFYESMEAYRDTYRELIEEE
                     DASRLLKSLFQTTRLIVYRDADGYSGPAVTTSLINNDSTVTCFGVNMRKKGKQSFNMA
                     FNPKFGHKYITDYFAQWKDVKSYRTENISLDSIEYVSSIKLDVNKNGLLRKRHDAFED
                     FRKQLDYHFEKRSSWSEVNWKKHMNASVLELITDHEMQEREIIHQLEDPHVVSLLEQR
                     SKYDQVFRRMNAVKKIESMKLSMSEENLKLLPEYQQRLGVLKELGYVDIEQMTVSLKG
                     RVACEINCGWELVITELLFTNFLGDFSSEEIVALLSCFVYEGRGKKNEEPAEISLSTP
                     RLERGKNKICAIVSRLTDIYVQKKITMTSEEETFLENNRFGLVNTVYEWSRGQSFKDI
                     MVNSNDADESEGTIVRVITFLDEICRQVKNAALIIGDSDLHMKMTDAQEGIKRDIVFC
                     ASLYL"
     gene            <706071..>707375
                     /locus_tag="FOA43_000331"
                     /db_xref="GeneID:62193732"
     mRNA            <706071..>707375
                     /locus_tag="FOA43_000331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920664.1"
                     /db_xref="GeneID:62193732"
     CDS             706071..707375
                     /locus_tag="FOA43_000331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776592.1"
                     /db_xref="GeneID:62193732"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="PFAM:PF00300"
                     /db_xref="PFAM:PF01591"
                     /translation="MVGLPARGKSFISQKIRRYLSWLSVPTESFTQSSFRKKRAESLK
                     FMDDELFDPLNEKGKKLRLLSHQDCMGAILNWFSNHQSGVAIYDGANITRDIRKKIKE
                     TLSSSDVQTLFLESYCDDESKVRANIQDINQTSPDYMDKTVEYTLADLKKKIRFYDSF
                     YEPMNVEYEGDCTFIKVLNLSSEILINRIESYLQSRIVYYVMNLHVKPRYIWLSRHGE
                     SQYNLEGKIGGDADLSERGWKYARRLKDMAEKYIPNHGSLHVWTSTLTRTQQTASFLP
                     YPKKTWKALDELDAGSCDGLTYEEIAERFPEDFKARDDNKFEYRYPGGESYRDVITRL
                     EPIIMELENQENVLVITHQAVLRCIYAYFMNVHQEESPWMSIPLHTLIRLEIRAYDTL
                     VTRIKADIPAVSTYKEKGTSKLGETRDNSKILAGDVISTGKS"
     gene            complement(<708052..>708960)
                     /locus_tag="FOA43_000332"
                     /db_xref="GeneID:62193733"
     mRNA            complement(<708052..>708960)
                     /locus_tag="FOA43_000332"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920665.1"
                     /db_xref="GeneID:62193733"
     CDS             complement(708052..708960)
                     /locus_tag="FOA43_000332"
                     /note="BUSCO:EOG0934397U"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776593.1"
                     /db_xref="GeneID:62193733"
                     /db_xref="InterPro:IPR007849"
                     /db_xref="PFAM:PF05176"
                     /translation="MQIGSLFRIQRRNISLFGNLGESISHILPKDHVYFKVKRPIGFH
                     DRPVHIADAPQDSRFTKENLNIPKRMWDFYFDGVTRKTRVRKIQKEMAYGGMYDFHVY
                     NKTKGRLFAAPPSYFRQDKALFFPNFPVKTITGDQTELIDLFRSCKATVLRVFSTQTG
                     AKMTNDYFQIPEAQDSYLSNTGVQNLHQTYPNAQIVEMILSETWPKYLMHTHISAGKL
                     KSTIPESQYDKFLFAMRDDVLEREDREKLLMTNLYSGYVYVIDNSSKIRWIGSGWPDQ
                     HEVEGLWKAVRGVSKEININSAKMAK"
     gene            <709151..>711781
                     /locus_tag="FOA43_000333"
                     /db_xref="GeneID:62193734"
     mRNA            <709151..>711781
                     /locus_tag="FOA43_000333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920666.1"
                     /db_xref="GeneID:62193734"
     CDS             709151..711781
                     /locus_tag="FOA43_000333"
                     /note="MEROPS:MER0043119;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776594.1"
                     /db_xref="GeneID:62193734"
                     /db_xref="InterPro:IPR012985"
                     /db_xref="PFAM:PF08192"
                     /translation="MPVNKLFRRKGYNSGKIGNEYAGDCASGTAGSTPGSTFGPTQTS
                     SASPTSEGDERPAEASNISGDSSTYKSFQYSYNSNTNSLFSSKKTVSTGHSTQPSSSY
                     RSYKKSHLQPLSNEQNTQVQSVGLPLRVVHEEELEEDDEVSVDHISSLRQSSTQRKRS
                     DLAADDPHSTKIDRERLSSANDAGGNSSIASSHSAGAVTSQITEYELQKLIEFVLKQL
                     KQLSIAVSNVMIQVSQSVINLTKASITISENIEKTTQTMSANEFLPYLPAYQFSTISS
                     VGLRRLIKYVLFLIDNIITEDVYNNSKSLVLTSLYKLLLRLKLIEPSPADASGINSCL
                     SLLSPEFFPIGATIQDFPDQDKVAKIMQSMTSKPKRELFSDQDGSFIAPVLRGFNNEN
                     LAVITFIFGFPEPTREYRDVIKYFSTNSEDMHFMVIKDLIVPAANTHRIRTDATLQFK
                     SPYRTLNHDSDYFPISMSIACNNALILSGTLGGYLYPKVSKNCSNEKLLKYRNSIFGL
                     TCAHVVLNETTLSENNGDPYPLVSVPSPVLINLYKDALSAERLNYNVNSAEYKAYDDA
                     VRNLDEQFPTEEIRIKGKRYRRNLPHEDFGQIVWGERIIDDDKLSDLAIIRIDACKGK
                     KYLNYLGEDLHLNQFDPSLILSNLYVKEVVSLNNCKNGMLNHANLRVFKVGSTTNFTT
                     GHLNGMKMIYWSEGSLKTSEFVISSSNKKTFASGGDSGSFVMSKLADLHDNNLERSLN
                     IHEDSTVHPPGLARKSVLSAFIESFIPSFGSHKVMDGDNQQTTEIVSSQEQHLTGLGL
                     VGMLHSYDGELKQFGLFTPITDILERLKEVTGLAWGVVGCEDDDDENLSDENVSVDSR
                     EHVVPIKSEISSSGTADSID"
     gene            <712759..>714204
                     /locus_tag="FOA43_000334"
                     /db_xref="GeneID:62193735"
     mRNA            <712759..>714204
                     /locus_tag="FOA43_000334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920667.1"
                     /db_xref="GeneID:62193735"
     CDS             712759..714204
                     /locus_tag="FOA43_000334"
                     /note="MEROPS:MER0037714"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776595.1"
                     /db_xref="GeneID:62193735"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR014311"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="PFAM:PF01979"
                     /translation="MTAEKDYFDGIHARCLDPAPFAVYYGTFAHTPELGVLEVHAKTA
                     VGVDPEGTIQFIETETTEDPLDIGARKFQIPKDRVKVVNISGSEDRFFFPGFIDTHIH
                     APQYPNNGIFGETTLLDWLNIYTFPLESSFKDLAFAKEVYHIVIEKTLEYGTTTAAYY
                     ATIHSAATKLLADMALRMGQRALVGKTCMNANSPSFYTESVEQSKASTLEVIHYIQKR
                     DPTGELIQPIITPRFAASCTDSLLGWLGQLRESTNYHCQTHLSENKSEIEWMRELFPQ
                     YKSYTDIYYQNKLLGRRTVLAHCIHLSDDEKDILVKTHTGVSHCPTSNSSITSGEARV
                     RWLLNSGLHVSLGTDCSGGFTPSILEVARHALLVSHHLVMRTHNDKEKLSVKDVLYLA
                     TMGGAEVLEMQNMIGSFEVGKKFDAQLIGLCARDSSIDIFDFQRPKWGAIKPEESQKR
                     FENLVCKWLFNGDNRNIIRVYVNGRPIVYKE"
     gene            complement(<714246..>714917)
                     /locus_tag="FOA43_000335"
                     /db_xref="GeneID:62193736"
     mRNA            complement(<714246..>714917)
                     /locus_tag="FOA43_000335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920668.1"
                     /db_xref="GeneID:62193736"
     CDS             complement(714246..714917)
                     /locus_tag="FOA43_000335"
                     /note="BUSCO:EOG09343O7C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776596.1"
                     /db_xref="GeneID:62193736"
                     /db_xref="InterPro:IPR006811"
                     /db_xref="PFAM:PF04722"
                     /translation="MTLDPLKFCTVCASNNNRSMEAHKVLKDHGYLVRSYGTGSAVRL
                     PGPTIDKPNVFLFGTPYTKIMEVLNSQDLKMHKMNGVLEMTERNMKIKKAPERWPYLN
                     QPSQMLDTEEHPGFENELDFQVVITCEERCFDAVVEDYLSRNYFDPGKTSKLVYCFNV
                     DIRDDHESARQGGQAILELAKMLDTTYKADSSEMPLQDKIPEIIVQWQKKYPSLPILH
                     ALCYH"
     gene            <715293..>717305
                     /locus_tag="FOA43_000336"
                     /db_xref="GeneID:62193737"
     mRNA            <715293..>717305
                     /locus_tag="FOA43_000336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920669.1"
                     /db_xref="GeneID:62193737"
     CDS             715293..717305
                     /locus_tag="FOA43_000336"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776597.1"
                     /db_xref="GeneID:62193737"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="PFAM:PF07738"
                     /translation="MSSSVPTPPLSSLADNLSLEIGASMINTSFHKTTGLTDSEYMVN
                     QSSECDTRQTHRTTTKDILNDQLKNLTGALESNDSSIKLTDEEKSYFITFEEWKKQKV
                     ARKSQELQLKHIEEEEEEKESRQQRIRSSEVGSGSLNNLDGPVGEEMEFDSSLFTGDE
                     AAPLEEGMAYKGRFNYASFDCAATIVRTNEESKGSNAVLNENKDTYLLNQCKAPHKFL
                     DIELCEDILVDEVMIGNFEFFSSVFRDIRISVGDRYPTTDWKVIGEYEAENLRKLQRF
                     KIEDPMIWARFLRIEILSYYGSEFYCPISTIQVYGKTMMEQFKEENHETSFSVQTEKE
                     DPLDASIEFNVDLNNDSEVLDLKDIENDDVSCVIVPHVGLEQFLEGHKQEEQDLCTMN
                     TTVVFGESNTNISTQYISLETTSSSSSQESIYRNIIKRLSLLESNATLSLLYIEEQSK
                     ILSEAFENLENRQKSRFDKLIGQLNTTIHFQVTHFRKLNTDMAVNFEGLLNYQNHRFE
                     SFMSSYKQRMDSFQSSLSFQKRMNFFNFVVIIFLLTYILSLKDNLDVDYYHGIDIGAQ
                     HVTSKNIQRSSSDTTVDSIFSSSVSVPDVLESKIKDKITVSGSSNDDKGDKELLKAID
                     GKGSPDLVISDIEVDTKSMKQSSPVVEKKNDTASKVLREIAPSSSR"
     gene            complement(<717548..>719050)
                     /locus_tag="FOA43_000337"
                     /db_xref="GeneID:62193738"
     mRNA            complement(<717548..>719050)
                     /locus_tag="FOA43_000337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920670.1"
                     /db_xref="GeneID:62193738"
     CDS             complement(717548..719050)
                     /locus_tag="FOA43_000337"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776598.1"
                     /db_xref="GeneID:62193738"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR036915"
                     /db_xref="PFAM:PF00134"
                     /translation="MVTKHSYGPPKRAVPKPYSSKLESLENLRNYMIANEYLPSIIKH
                     LKDLEAKSIINPSMIDLQPEVKWFMRPYLVNFIIQMHSSLRLKPQTLFLCWNIIDRYC
                     AKRIAFKQHYQLIGCTALWIAAKYEDKKSRVPSISELCMMCSNVYEESMFREMEVHIL
                     STLGWSVGHSSLEDTLQLCVKFADPDGKETLQRPIDEYRGNSQTVSAILAVARYLCEL
                     SLYERDYLMFPPSLIGIVAFLFSCSMLGLNYGSKSMSRIYHEYRINMARKAHAARGSI
                     SKAATVMSSSVPPSLGQLPTPVTPNKNTDFFEEENNYDSDSENKDPTNEHQYGPFLSG
                     FEGLASINRLRTISILFLKSMLNPSEVLVEKYTPLGVIAVVKNFVTENNLTELDMKDL
                     NVNSKSITGPVNDFVFDLSNLLLNFESNLEFVTEQAMQYIIPTYQSPMASKASYSPFN
                     SPSNLSSFSSASSQTTYDSCYEEIPIKGDESTGGGMKRSYPNSSPIVDSN"
     gene            <720985..>721407
                     /gene="HAP3"
                     /locus_tag="FOA43_000338"
                     /db_xref="GeneID:62193739"
     mRNA            <720985..>721407
                     /gene="HAP3"
                     /locus_tag="FOA43_000338"
                     /product="transcriptional activator hap3"
                     /transcript_id="XM_038920671.1"
                     /db_xref="GeneID:62193739"
     CDS             720985..721407
                     /gene="HAP3"
                     /locus_tag="FOA43_000338"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="transcriptional activator hap3"
                     /protein_id="XP_038776599.1"
                     /db_xref="GeneID:62193739"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="PFAM:PF00808"
                     /translation="MTRHVIHEQDQWLPITNVSKIMRKALPSYGKLSKTAANCMQECV
                     SEFISFLTSQAAEKGSIEQRKTLNGEDILYSMYSLGFENYAETLKIFLAKYREYEIEE
                     SESRREKYLKRKERKRLKMLQENEKDIPLVEHSPSEIT"
     gene            <721688..>722797
                     /locus_tag="FOA43_000339"
                     /db_xref="GeneID:62193740"
     mRNA            <721688..>722797
                     /locus_tag="FOA43_000339"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920672.1"
                     /db_xref="GeneID:62193740"
     CDS             721688..722797
                     /locus_tag="FOA43_000339"
                     /note="MEROPS:MER0000358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776600.1"
                     /db_xref="GeneID:62193740"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR034193"
                     /db_xref="InterPro:IPR036852"
                     /db_xref="PFAM:PF00082"
                     /translation="MNTQLLLVFIFFTLSAVSCLKVILQLSAKTDLLRFSEKILISEY
                     ECIEIGNFKAIMGEFDTNFVKSLFFDESVEAISIDRQVQIANLHHQQSAPKHLVRLSQ
                     AGPIVKQQHLDFIYNGTGKDTRVFILDTGILSNHSDFTGRVQTFDPKNTTHCDVNGHG
                     TAVASLVGSELFGVSKEVTLIDYPVLHDNGIGVISNVLSALDKIVKAGVPGVILMPFI
                     GKKSVLFENALREVVTAGFPIVVPAGNFARDACKYSPSGAEHVITVGSINSYTDTIAK
                     FSNYGPCVDLFCDGVDIVSLAPFNEMITVNSGTSMSAALVTGVVATLMGRSSMDILAS
                     LKSMAIRGGIRPMDFLVQSATDNLIASNIKFNETE"
     gene            complement(<722835..>724643)
                     /locus_tag="FOA43_000340"
                     /db_xref="GeneID:62193741"
     mRNA            complement(<722835..>724643)
                     /locus_tag="FOA43_000340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920673.1"
                     /db_xref="GeneID:62193741"
     CDS             complement(722835..724643)
                     /locus_tag="FOA43_000340"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776601.1"
                     /db_xref="GeneID:62193741"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF13639"
                     /db_xref="PFAM:PF13923"
                     /db_xref="PFAM:PF17123"
                     /translation="MGQSLSHSSPLSSSSPPIFHPYTSSSLNDTGTSDVPSVSTRSRR
                     LSSFSLKFSRKHKRNHHFFNPLRRSSHRNSLQEQLSRSELPHIASRVDYIPLQDSDSD
                     SRSPNRSSQASSTSSARRNTVPLNQGLYPPPAGSQTPISLPDLGDSRRHQLAGQTLRQ
                     LQESTATTSTISASDNSNIIPNDDTPPSNEYYEHLRRAILDPDPGFDGLRHSRRRHIV
                     NEQYENVVRDMDIGMVVQFQTLSTLLESVTISTLRRLLQNDPSAANSETETLSQDEIM
                     SRYNGTRIDRTNLTDEEDDANVEDTTFAEFLVGLNSEHLLQRELGSQAGQGQNLSFFR
                     AFQFSSSSVPRNETAVVPAMIVGLISVNSQNWRHSNDVNADEDNDTISADSIISHVTN
                     PFEAAGIPLSGSAAPPSRSSSNYSETASTPTQPEEHSLPPNTYRSWIIIVMAHHYNAN
                     DSMLGAMPLFISLLTNYVRGHNTEDDTDNIFDTTSVGGGANGLDEFRSSLFRVMTKNC
                     HLTVHELAKHTRSMCIFKQASKFDCSWKEKTDEMRDEEQYAYYDVGERCPICMIGYQE
                     GDPGRKLKCKHAFHRECVDEWLINDNTCPICRAKAL"
     gene            <725292..>726569
                     /locus_tag="FOA43_000341"
                     /db_xref="GeneID:62193742"
     mRNA            <725292..>726569
                     /locus_tag="FOA43_000341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920674.1"
                     /db_xref="GeneID:62193742"
     CDS             725292..726569
                     /locus_tag="FOA43_000341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776602.1"
                     /db_xref="GeneID:62193742"
                     /db_xref="InterPro:IPR036028"
                     /translation="MNSNKLVLTGVNIVAQDEITTTTTTSTTTVTQWSRVPIKGHIYR
                     RELAELANPSSTLTSYTGTSTNSLASSTDLNGILSDNTAGHISKAPLIIAIVIPLCVA
                     VIGIAALLYWYFYCYRKRVKKHSWNDSIIHNYNNYHVTGEKFQEFATKDDPFSLENAE
                     WELPQKCKGSNKYSTAGSATSGSLSTFSLRSKVPSLPCRTSAAGKGEKLEEMSTNYRI
                     KNMTAVPHKLIQTPTSAIKKFFNRKSMAATIENQRTSLSENLPKPKRAALKSLTLVDR
                     LNDMMRKRITPKTLKADVSTTDKENLRPQIVTVRQISKVPILCDPSKGRKMSDQRRRK
                     EKQEKAAVSYKSFQMSLETLTSDPTEIYIVVLEYEAHLPDEMDLELGEHCVVELKHQD
                     GWCLAAKIDNDRHAYKKGVVPVLCLQLIDDQGS"
     gene            <727229..>730462
                     /locus_tag="FOA43_000342"
                     /db_xref="GeneID:62193743"
     mRNA            <727229..>730462
                     /locus_tag="FOA43_000342"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920675.1"
                     /db_xref="GeneID:62193743"
     CDS             727229..730462
                     /locus_tag="FOA43_000342"
                     /note="BUSCO:EOG09340NBG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776603.1"
                     /db_xref="GeneID:62193743"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="PFAM:PF00169"
                     /translation="MQKLRAFSRNSGFGSHSPSPEPSQYTSPSFDDSEAPGSPTPMTM
                     EGKGELSPEMAPIVTLLSAQANRKYHEGFFMLLKDLNSAGQPADRRWVEVYAILIGNE
                     LSYWDASIMKNGDLNTENKPSYINFSDAVIKPMVSLPSSQGPMANVIIVSTTLKNRFI
                     LQFSSTEQFRRWHSALRLAAFEYKSLQEAYTAALLSARGSLLSNIRVILAETKFAHED
                     WTSVRFGTGMPWKRCYCVIEPPKKRSKKHKTGDKFQGHAVFYESEKKNKKLIMATIMS
                     AESVYAVYPRNYTVIDHSTMLKLDGEILFEKSEGSKRCSIFMMPEQHSAVPGYDTLIR
                     FLIPLMDAFKLYGRPQRMNADKTDPHSLLFALPVLPNVHYLETQDIMQLTSSASSLAW
                     DIPQWDTSIKQIIQVKMSKGYTGCGSADGVIGAVNFLDASKDMASGKIRTISASSTAA
                     RPKMLSSKLSLMSSSQSSIGTSFATSSETAEKFDHATVPRIQLGDDGNNGDENNSVVQ
                     TKSILSTHPLPNLPAFDMYPESGEREAQQFESMYPIESGKPNLESPDRKLDTKHHYQT
                     TQHSPTASDRSSLDARASYLSSQEGTRASHSRASGEGGKIVSIYKKYAQLPPPGDKTL
                     TNLTGALSLDSKGDASKDAEEEDLYPQDESSPDIPAEWKQSDQFGGPSSADKYHSPNR
                     LYPENRESAESSGSNGASDDSDFQLPVLKSNQTGMLSPFTEFHESFNHSMKDNLKYPN
                     NFNRIPASIGAATSLHSQILPKQQRSEGSPGNAAPSRQSAQQMQELRSAAKHKLQRRA
                     PPSMEGRAPAHNVAPQSIVYEKPRNPYLKTTGNGSSSSLGYHTPVNQQQPPSNPPPLE
                     QEAPGHNLTAEARNLRMPPLFDNYSGDADPRYNHTTGPSPQSGSYGRANQEPSRNRNY
                     WPSAKQQEQQMQQPRLDNNGLVQAGHVYNDNSPRLQQRQAQAQAQAQMEVHSQSQQLR
                     QQQPSQQYQHFQQNPQQHEKQNYQYQDPHQVQYPDNPYMQSPGTPHHHNHHVQNPYDS
                     PQRLATQQVQQSSTQQKAYTAGGKGPYAHANFTNNASQGYTKNPYAG"
     gene            complement(<730591..>733215)
                     /locus_tag="FOA43_000343"
                     /db_xref="GeneID:62193744"
     mRNA            complement(<730591..>733215)
                     /locus_tag="FOA43_000343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920676.1"
                     /db_xref="GeneID:62193744"
     CDS             complement(730591..733215)
                     /locus_tag="FOA43_000343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776604.1"
                     /db_xref="GeneID:62193744"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="InterPro:IPR036887"
                     /db_xref="PFAM:PF00023"
                     /translation="MEHNSVVSGKLQLPSISSSLPQHEDVQLQAESQLPNGSIASIDK
                     DSTIDAGSISSIHLVKPSESQTNSQISTNQLQAELQLQSESQSQSSSQHQLHPKSYLP
                     PEVQSSAKHNGDESQPHAPIISTDATYHVTPVYRAAYSGIDVFEMEVNQCPIMRRVKD
                     SFFNATQILKLVGLDRSRRYKLLETEIYQGPHEKVQGGFGRYQGTWIPYDRAVSLSRR
                     YDIYDVLKPLLLYNPVVSEVQTFSKIQLSRSYSTMTEADADVTSGNGSGHTASKQPSS
                     DSPTKRLKFSHDKPSPLHTFDHDTRLANPNAPFALKPASETLVDEKSKVILSSLFLPN
                     QKDVTLLEIVGGDESQLNGVNIDTPIDDNGQTALHLAATLGRVPLVKDLVQRGANRLR
                     GDDDGQTALVRAVHATNCYEAVCFDKLLDYLYPVITVLDHKGRTVLHHIAYTCGRKGC
                     SDACKYYLETLLEWVVKRGPMLPGNQALSLTKFMQDVVNIPDRNGDTCLNIAAMVGNK
                     HIIQQLLEVGADPTKANKAGVRPVDCGISVRWPLTTTTTYRGDSNGESDGDDDDDGNN
                     SLKPQQNHSISQEQNNDKMDSQTMLEQSEMNQKSYPETSNSLRILESIRQFVEKLGED
                     FQDEMKEKTKQINGLHPTLREKTLKLSERRKQYEQLQKLVRTITDLKTKVGNLDGAIQ
                     EEDERFSEDVKSLPLNSSNFSGNFDADEPFTVWPVFTEVERNIEQLLTEKKQNEESTQ
                     NGHISAYEEGNSDAIGLLQSMKPEDLLNVVKNKMDENRKSGAPVDLPPKVVLRARIDA
                     YKKNNQLLIERTKARRSSSQELEQQFKRVISLCIGSKPDDIDDKLLGSLLLSVENDPD
                     PEIGQVKKVLEIVNDMEK"
     gene            <733669..>734844
                     /locus_tag="FOA43_000344"
                     /db_xref="GeneID:62193745"
     mRNA            <733669..>734844
                     /locus_tag="FOA43_000344"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920677.1"
                     /db_xref="GeneID:62193745"
     CDS             733669..734844
                     /locus_tag="FOA43_000344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776605.1"
                     /db_xref="GeneID:62193745"
                     /db_xref="InterPro:IPR023175"
                     /db_xref="InterPro:IPR039431"
                     /db_xref="PFAM:PF04652"
                     /db_xref="PFAM:PF18097"
                     /translation="MSEQQELPKDIRKVVGPYIKRANELERFQPIIAYFAKMYSAQII
                     LEGQYHLKSQEVANYTESLLNEIESSRNELEKTSDQIADVLADKEKSFKMVLGFSNVI
                     FNKADKQVQTHNCSKQTALDFKASIDFYNLLQLWSELFEAEREGIEKRIKYAKFQCAR
                     ILKSMKMDEDPNEYVTADDEAELANMENNSRNTSTVDSSATTPETTTSQLDLLDTPSV
                     IRNETEKPFASELTLTKVNLELPKPPADIEGEINLPVAPVLIKGEKNSLGLPSAPIYR
                     SPKNNLDHKSTTSKSTNEDELESPSKQKPNVKSDATERKVKLAHPHNTSGPAIISTPV
                     QAVHPKSKDDVDEIWQQEEVISHAQKRARFAISALNYEDISTAISELEAALKLLRGS"
     gene            complement(<734905..>740582)
                     /locus_tag="FOA43_000345"
                     /db_xref="GeneID:62193746"
     mRNA            complement(join(<734905..740558,740579..>740582))
                     /locus_tag="FOA43_000345"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920678.1"
                     /db_xref="GeneID:62193746"
     CDS             complement(join(734905..740558,740579..740582))
                     /locus_tag="FOA43_000345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776606.1"
                     /db_xref="GeneID:62193746"
                     /db_xref="InterPro:IPR010472"
                     /db_xref="InterPro:IPR010473"
                     /db_xref="InterPro:IPR014768"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF02181"
                     /db_xref="PFAM:PF06367"
                     /db_xref="PFAM:PF06371"
                     /translation="MNSVKEIEQMFEEVMTSRDFGSLPEKARHQMENYSPDRKWMLIR
                     QHKLAEFKKQKMKQQEEVAFMPPKRYSTMSTSGSSRKSKLLYQQQQQTESLIRHSDPT
                     FYVGQLISNEISLQQLKELDICLSSEEITWTEEFLHQEGALCLCNVLNNLYKTYPTLP
                     KDEEIVKPEQPADNSEHISRKLFTNISEEYAIILEKEMRLFRCIKVIADLTIGIEDLK
                     KSDIFIQSIFGGLFSGKPQIRKWATDIITYFYHKTSYSDTIYKTMSRPMNKNVHFRFI
                     HDLYVESGNLGILDQRSQYILTNRDKIKRYEVWLWGVLRLLQGRGRMGSKVGAYQEFR
                     YSGTVNNTFLAEYALSTLLLINTLIQKSGALAQRTRMRRLFISSGLREIFECFRGLNN
                     AEVNHSIASIEAAEQEDQAELRQMEEFRNDNIEFNDPVSLFVSMWKKNRGSDVGKYLL
                     SIMQNMFVSQSGNLTEADPEQVSRNLKLVDNFINNITMVSGDDDTDMNISINKLIASY
                     HTDELARKAMSEASEAKKRVEEAEAEKDIALQQLNEGSKGVVEDMKKELTERSLILTR
                     LREKLDDRDKEVSELKRKRILDKHQQEMEMREMLLLLHSYQGINGGQVPLASNQSALS
                     VSPSGNAPTPESSIPYSGRSSTVTELEKRLKTRVDKSKMESRRLGSTGVEPSARLRDL
                     RLKMDLLEREARDLENMDFEEFSEQIPEPPVKTGRETDLETLTKLRRKLDLLQKDANK
                     VIKVQGDLAHREDMKLHKVEALDRLTKLQQYMEDLRNTESEDEERSSHMTLDPKYHKP
                     KEHSAQLNQELDTIEGLCQKLKEQLATAGDDPAALSSTYNLLSKFEDKYSKGKKVQPK
                     ADYSNSTGSLLSISAKKMDKESMRPFLGELERKVARQAAIGEAGPSHPQENAPKFRLP
                     ISAVPLNPAERASQIRNTKQKSMDPLSVSSVPVNAKFTQGVNASTNMSSNADASRDNS
                     GVKILSNHSKQNKVGIPAVSESSGANHSKSYISGRNSHKTSKSSSSAGHFNERSLSAV
                     TDDIDTSFAFDADENEVGVDVRVPSGAHTMTGRESDYTGNDSSKIASQHKVSEKVRHK
                     LNNASISLEYLSSESDEEGDDSTTHTTGPASTPSRYRHHHHHHHHHHDIQPKKTVQVL
                     PSRRSGSSDSSTASSSYSAPLVSAKSSPVKCVVKKEAALPPPPPPPLPSMFTKKVDEE
                     SPTAAKISSTPPPPPPPPLPLSLDSSSTRSSPIPAPPPLPTGKPRTPTPSPSPIVETG
                     PFDMLPRPKKKLKQLHWEKLEDTEDSFWANMGSEEMARQLLHNGVFDEIEIIFAAKEA
                     KRIARRKKEEANKITFLKTDISQQFGICLHSFSSLSDKMVVLKILRCDLDVLDKPALL
                     EFLAKPELNDISVNMTKNFEPYSTDWQSGQPQKPDKDPADLARADRIYLELIYNLHHY
                     WRSRMRALNTMLTFEKDYDDLVVKLEKVDLALDRLEKSDTLRRVFDIILIVGNYMNDT
                     SKQAMGFKLSTLQRLNFLKDGKNTLSFLHYVEKIIHKNYPDLEQFVSDLKPTFAASKI
                     SIEQTRADCQMFITTVKNIDSSLQNGNLSNPDKFHPEDRFLKVVLRRLPTARSKAELL
                     NDRMKIVLDRFDTVMRYFGEDPGSDEFARNTFFSKFSEFVESFEKASKENREAEERNR
                     LYEISMQRMNDEREKEKKLEQEGGLSKNSDMEKFLEQLRQTGPLRSEPTSAKIREWAK
                     KHSAKSQVGASAAASLPLSPVETDTGMSLGVEDASPVELSSEDKEEENIRNRTHDLLM
                     KLAQQNHTVSPTASNSDLQFRLSDFKLSDRMKRRLQQSSRASSVSSVELDSISRSGSY
                     YTSKSRLDLDSSPVVEEGSESDEFKKESGGEDAEFNDAPESFE"
     gene            <741505..>743082
                     /locus_tag="FOA43_000346"
                     /db_xref="GeneID:62193747"
     mRNA            <741505..>743082
                     /locus_tag="FOA43_000346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920679.1"
                     /db_xref="GeneID:62193747"
     CDS             741505..743082
                     /locus_tag="FOA43_000346"
                     /note="BUSCO:EOG09341CHE"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776607.1"
                     /db_xref="GeneID:62193747"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="PFAM:PF01490"
                     /translation="MPDHYKPIEQDLGELISGDFNGWENTSKDHEGIVDSIKDHGEND
                     QSKDAQLRNQGDDGRDSQLDDDIFVGASQEFDNSTDASFEQFDVEEGHYDAHPFVIAN
                     QSSAGNLKSAFFNMTNSIIGAGIVGIPRALKNMGLLSGIVLLIVLALLNDWTLRLIIL
                     NTKLSGAKTYTGFVTKNFGRIGKIVVLLSQGLFAFGGSVGFAVIIGDSIPHVLRSLFS
                     EATKNSKFVDFILSRNVIIVFCVVFFSYPLSLVRDISKLAKASGLALISMLIIIIIVV
                     IRGPSMPSNIRGTISGADWFIQNGLFKGISVVSFAMVCHHNTTFIYDSIRKPTLDRFN
                     ALTHMSCLVSSVLCAIMGLSGYLTFASKTKGNVLNNFPADDWVVNIARFCFGLNMLTT
                     FPLEIYVVREVVKDLMTIYGQIRRRDPSYKIEKLSTSQHVAVTSLVSFLPMVISLFTC
                     NLGAVLELVGATSASMIAYILPPLCYDKMTKRNKTFVQRIPPIACIVFGFVVMIVSSI
                     QTLSDSFSGKDRSHCVE"
     gene            complement(<743133..>746948)
                     /locus_tag="FOA43_000347"
                     /db_xref="GeneID:62193748"
     mRNA            complement(<743133..>746948)
                     /locus_tag="FOA43_000347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920680.1"
                     /db_xref="GeneID:62193748"
     CDS             complement(743133..746948)
                     /locus_tag="FOA43_000347"
                     /note="BUSCO:EOG09340ERY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776608.1"
                     /db_xref="GeneID:62193748"
                     /db_xref="InterPro:IPR006906"
                     /db_xref="PFAM:PF04821"
                     /translation="MSIVDRRTNVKLKSDESLIDSDVDIEEELERDREDTSLSEVDED
                     ADNEESINKTEQPRVVTEDRFSQIKNYKKSTRVLTAAEQTLQSQILLLCSALGGTDPT
                     SENKREYILGVDALACLKDLKRWIKAVDDATHMWHVAAACHENELVENDLIPIMIQIP
                     KRANNSDSNYMQNILLSALELLVALTRPLVLDVEVASPAQIDLYIKLKKAHVKCKDKI
                     LNFDNGRCLKSVVGVALPILAFPKEKRTNRDSTILNLCLNFFRNVIRIGPADFTVSKK
                     KSSSKTQQVIDNMPPGITRDDISYDNLIYKFKKNRVLMFVQTITAGLGTEFDSEVLFS
                     ACLDIYFYITYGIEPELLFIASAEPKNPTTSSPAEVTTHLTPQSETGARLADLMAQEK
                     EIKKQLFSNNITRHANFGTLLSIKEGSDDAALTVGTQRSFLRSDPIEELDSGVSKKVA
                     STRYANRSKESTKSDFDTSFEAPAKKFTNSRTSSILKEFCSDFTEAGFSVLGTEIRRQ
                     VTSNGVSLNAFTEFHYFQVMAWILKFERILRDDSNDGLSFKRFGYIMMCLEEQMIRML
                     LVGSLPQYLQNREFNLLRAATNCFKEILLTTIDIHRLDQKDNTNLNDEDKEELEGYIT
                     VSEAVLRNIFANEEVIDVLFRIPQDARKVSLNYAVDMTDFTYVLFKTLHYLSKLKVPI
                     VLAKKIRQTSKRYYGENHDASVIGSEDESDAEFDVADPQKLKRFQVLDKEIYSRFEER
                     LFNERIVDTYIWVFSRFGELNEKQVRRCMSYFNRLLLKWKDHFLKLTRLDFMLILHDL
                     KNARFSVHTMNDLSKMLSYFMRILERLYKHSKTILLETLTDHQEHEIDVKLYLLGGDL
                     TTVREKRFQSRAEDLKFSEGAMSHSYKISVLVSLLCYADKIDLVQELIQKLTDYRDQK
                     VSWEAKTVMEDGITGLPSSPVSFKERLELPDKMMREEKRDARFRLLLHTIGFAGNVLI
                     NRTASDELNQTISLIDVALKNPMESFELEGKVIPEYAEPDEPPHESDVIIQKSGPNEK
                     GLEPLEDTEREARDETDKAAVKHNIYGTDIIDYSGSEGSVDDLGDGNGYVEDNIDLME
                     ARLDANEKRIKGRALKKKNMRSRKRRHKHIDPEDDDPLPFSKKTGGSKKRKKNASIPM
                     HEGVEKVQKEKISEPKKHLSSKFIDSDEDESDGEKKTAFFEREKRLLKLVHDNENKPL
                     TPEQYNALFNLDLAKDTSSESEGDDLNFSEEKEMENDGDKEEVEKEEIISNELHQHRA
                     VIRDSEDEE"
     gene            complement(<747119..>748831)
                     /locus_tag="FOA43_000348"
                     /db_xref="GeneID:62193749"
     mRNA            complement(<747119..>748831)
                     /locus_tag="FOA43_000348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920681.1"
                     /db_xref="GeneID:62193749"
     CDS             complement(747119..748831)
                     /locus_tag="FOA43_000348"
                     /note="BUSCO:EOG09343MP3;
                     MEROPS:MER0013559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776609.1"
                     /db_xref="GeneID:62193749"
                     /db_xref="InterPro:IPR005078"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="PFAM:PF03416"
                     /translation="MANNFGGLQHVIEYIWDNPSLNDDFTNSLVVLGNSYNPQKPDNR
                     ADKDDETRKDEDDDKLANPINFRGEIKSFFDKLTNDVNGNAFGGTLPWQSPMALVSTV
                     NHPWPKDFLDDVKTRIWFTYRSGFPIIPRDVNGPSPLSLGSLFRGTLDLSTVNQGFTT
                     DAGWGCMIRTSQSLLANALLNIHVGRDWRYHEGEYDERFDKQFKVVALFADTPSAPFS
                     IQRIVDYGSKNCNKKPGEWFGPSAAAQSIVYLCERSYKTCKLKTYLTGVIGDIYEDEF
                     LKVAQHDKSTEFTPVLILSGIRLGVKNVNQIYWRFLKKLLDLNQSVGIAGGRPSSSHY
                     FFGYQGDYLFYLDPHMPQKALLLDSDTEEHLKLDFIPSVHTAKIRKLHLSEMDPSMLI
                     GLLIKSRQDYEDLRKSIAEFDTTERFLNIYPKRPELLSSSSAGSALLDEGDFIDLGSN
                     DNECAISSDREPEVDEEDTLHELVHDRKFSQPVIINHEDTIILPNSQAQTVHEIAHKD
                     EIEFDKEASIIDQNDTTENFEQIDKKESYVRPESENGIGMFEEIQRDELRTEIRNGGT
                     ETSA"
     gene            <749271..>751250
                     /locus_tag="FOA43_000349"
                     /db_xref="GeneID:62193750"
     mRNA            <749271..>751250
                     /locus_tag="FOA43_000349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920682.1"
                     /db_xref="GeneID:62193750"
     CDS             749271..751250
                     /locus_tag="FOA43_000349"
                     /note="BUSCO:EOG09341H52;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776610.1"
                     /db_xref="GeneID:62193750"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR036867"
                     /db_xref="PFAM:PF01585"
                     /translation="MVELYSGDFNNVGEMAINSMSFGGKRPSKADKRKARMAEIAEYT
                     GRHHQDTLRKELRKIPIQFVMAEEVYNPAEDMVQNLILREGQELSQPNDEHEGQTHDM
                     LLERATEMIKESMNVSNDFMDGVNRLSEEEEEEDQVVSDVPDTSPHTEVVSLKSESEI
                     ESDEEDNGDDMEFVDDNEDDDYHGSDNEKENDSDGFELYDYDSGLENEKSSSEREDIV
                     IGKFSGPLKRGEDGDYYVDLPKAGRRSRRNFGFEELKTSSSSSVQLVKPRLSLDGEPD
                     VMISDDEPSEFGFLPEDYVSFDVTQIRIDSIRKGAGDDAQYHVSAPILFGFEDFTWTS
                     QEELKESMVSQGLPEKRFGAFIQYATKELREDSDDIESELSDEMLEGIDDMIAFQSNR
                     LRVVNDPIDIGTHSLSVHGKGRHRQLEVPDDVDGKTREQLIKQFENKIEGKRLKRVRN
                     YTDDETSEDTFLHSSDSYYLLKKYPYEMRIEDFRVELEDFVTDKSRNSMRFPPMDSHG
                     CMTLRDLSKAYHIKARKFGNSPESYVVMIKTSVAKRLKPDYKEVDKLMQRRRIFFRSD
                     TGLTKLEKQQLKRLLSDKDTSEQKRKKERKGAFTYKEGDVVGENASEIGPESIGRQLL
                     VKMGWQKGEALGAEGNKGIIEPIMAVVKNTKAGIR"
     gene            complement(<751778..>753367)
                     /locus_tag="FOA43_000350"
                     /db_xref="GeneID:62193751"
     mRNA            complement(<751778..>753367)
                     /locus_tag="FOA43_000350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920683.1"
                     /db_xref="GeneID:62193751"
     CDS             complement(751778..753367)
                     /locus_tag="FOA43_000350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776611.1"
                     /db_xref="GeneID:62193751"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PFAM:PF00096"
                     /translation="MAGEQQQKIVDNIIVPTPTLQEKRESDRPYKCPICGKAFHRLEH
                     QTRHIRTHTGERPHRCTFQGCNKRFSRSDELTRHLRIHTNPTVRKKRGPRRKNSNSNG
                     IVASKKGNQPQLKGMIQGQNGPTAAVLMPIGYDLQGQPMYPQPVPIYILPPGTTIPVS
                     GNMGYQMAGGDQQGRQLNQQNQQNQQNQQQPQIIHLRQRSSTDKFGPQIIQQPSIQIS
                     QPVPQNMIVSNPPNNPFVSSSTAQNHFFGSQEVKRPFKFQSMSSLSNYFTPKNTVSAA
                     LSMGLSPPHSDLSSRTNSTNSLKSLDSGGNSSSTTTLSSFGNVKNSLTSLHKLTPLRR
                     AKSSRTSLISRAHTTVSLSTLVNEEDYPCDKDEQPKKKSRPNSPITSSFGFTSPSEVR
                     RPAAVFNITSPLETPFSTPLQSPTLKPWSMSSVPLHDLLNNKSSNNGSTSSTNSSNSE
                     NSNCAHAPIHTQSEVQLPSLQTMLGPMDELDSKLSDKSVRDDPDERVKNILNRSMSHD
                     NLSILPRKGRSDLNLSSLSER"
     gene            <755427..>756524
                     /locus_tag="FOA43_000351"
                     /db_xref="GeneID:62193752"
     mRNA            <755427..>756524
                     /locus_tag="FOA43_000351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920684.1"
                     /db_xref="GeneID:62193752"
     CDS             755427..756524
                     /locus_tag="FOA43_000351"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776612.1"
                     /db_xref="GeneID:62193752"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="PFAM:PF01151"
                     /translation="MQLSPSPKFNAPHFQGSSASNLISFGALPDSGIFSLPDFDLPFP
                     DYPFNHKNDFLVNRFYPFSLKLTTPLLFSLAYFSSVHFLNHVVFRRQVDAYTRRHPKA
                     KTLPRKLVSAPYWFSKTRLFKALVILHNIVLCIYSLTTFFGLVYTMRMNAREILPALF
                     GNYFASSELRPTHMFWQSVCNIDNGIWQTHGSSIRGLSFWAYLFYLSKFYEIIDTMII
                     LLKGRQASLLQSYHHAGAILCMWAGVRFSSPPIWIFVVFNSFIHSIMYFYFTLSCFKI
                     KVSLRFKQCLTTLQIIQFVLGGCLAVLHMFVRYKDIITGTTQSCINTGEDALAIFMNV
                     AYLTPLTMLFAAFYIDSYKKRGLTTKAKKIN"
     gene            <756833..>757930
                     /locus_tag="FOA43_000352"
                     /db_xref="GeneID:62193753"
     mRNA            <756833..>757930
                     /locus_tag="FOA43_000352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920685.1"
                     /db_xref="GeneID:62193753"
     CDS             756833..757930
                     /locus_tag="FOA43_000352"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776613.1"
                     /db_xref="GeneID:62193753"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF01408"
                     /translation="MSSPFVVNWGVMGPGRIATLFVNDFLNSKDPLRKSVLDKTIEHR
                     LVAVASSSSVDRAQKFKDESIHQSSNEEIKCYGSYDEIYDDPKVDIIYIATPNMTHFK
                     LCYQALTHGKHVLLEKPFTINHRQCEILTRLAKEKHLFLMEAYWTKFNPVYREICDYL
                     FGSKECDIGTIERVISDLSMVFPRNDPGMERIYKPELGGGVIMDIGIYALYWALGFLD
                     KDNKQAIPQITSFAHNADTGVDISTAAILKYGNGTLAVSTCSGIVKNEGHDVLINCTK
                     GRVIVDQASHPTEYWIYDNENKQLVHKKFEFDGEAMYFEADHVAECLSKGLTESPLHT
                     MAHAARMSKILDTIRKQVGNVYSETLESVGV"
     gene            <758340..>758921
                     /locus_tag="FOA43_000353"
                     /db_xref="GeneID:62193754"
     mRNA            join(<758340..758345,758364..>758921)
                     /locus_tag="FOA43_000353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920686.1"
                     /db_xref="GeneID:62193754"
     CDS             join(758340..758345,758364..758921)
                     /locus_tag="FOA43_000353"
                     /note="BUSCO:EOG09344BFI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776614.1"
                     /db_xref="GeneID:62193754"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="PFAM:PF04707"
                     /translation="MVHTFHHDFETVTLAYFNRYPNPYSNHVKSIDTIERHIDSDGKL
                     HQTKIIHKSGRLPVWVKPFLGKINSSWIVERTIVDPIHKTMITYNCNMDHTKLLRIEE
                     STSYRYDFNRSVTDSDATVKFSSGFRKFGFGGLNLRDRIENWSKARFAEHSKTSRQGL
                     KIVMDTVRQKMAHRIQSQRIQGQSYGM"
     gene            complement(<759052..>761916)
                     /locus_tag="FOA43_000354"
                     /db_xref="GeneID:62193755"
     mRNA            complement(<759052..>761916)
                     /locus_tag="FOA43_000354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920687.1"
                     /db_xref="GeneID:62193755"
     CDS             complement(759052..761916)
                     /locus_tag="FOA43_000354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776615.1"
                     /db_xref="GeneID:62193755"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF11951"
                     /translation="MGTMATQKHDGSPSLDQAQILSLPLMELNDSDDSNLTPATGPNM
                     HFSQGLRNQPDIEHKVHTMKLRKRSKQGCITCKLRKKRCDEQKPICGDCKRLNRRCEY
                     ITDDMIPEEASRLKHEMELIEEESKLRHRKKKTPVLSGTESDDASNATDEKADKSRKA
                     AHKFIRSKKFRNSNAVGDKVVFNPLSIDISSVANTNWLQGMGATSDSLGNLSNPQEVQ
                     DLQTRSAASIYSASSIPLAPLAPLAPLASSAPSLLSTPATTAAPSSFGTRGYASFSPA
                     LSPYFDNQVIQRQHQDETNVPLHRIHPLSLDESQTITINSPGDQFSEMFSPGFSKALQ
                     DHLRVAELSTSLAQNNIVDQSLLNSMLTIGQVEELFELSPNVGNNGDQKWISQTNDDN
                     DRASPAGNGPHFVRNNSIMGSVPAEQSGHSVIYMNPSIVTSTTLASLTPIGKQLYEYY
                     RDKLSLVASSAPKEENMYLHTFLPMALVDQSVLYGILAWSAFHMGGTKMEKQGNYYIQ
                     RAIQGFAKRPILDEDNLNYYKDVATYVDDTDTDIIREDTSPFHEECTATLSMLSKDDM
                     INLRLASFLILCGVEICRGDVSRWSKYLEYGAKLIKLKGGLQKFNDSKDEHFLATNYA
                     YHDITAVAVSKVRPLHFDLKEYEQMWTASNDLGFLDPLHNISSPIFNILAEINKLVST
                     SRRLYRKIRRLRSLGSGSVDCSDDEEFMAYAAEELAGVTDSSPHVSSETASTNLYSNV
                     SLSPDAGIFSQEMKVAREEATRDAQDETERNNGCDGEDEEDDSLDSDYSLSEKYSEIM
                     DQCQDIEKRLNEAKPRQHIMSRLKPKDLELQLTIFECFQLTAKIHLRQSVLRMTPSSL
                     EIQYLVNQLIKSLDVLLGSDIEAALCFPMFIAGMNSIYPKDRKEMNQRYNEFIKRYRW
                     KNVLRCQIVMKHLWKLNPLGNKFVDWYNVVERMGWQLSFA"
     gene            complement(<762135..>763311)
                     /locus_tag="FOA43_000355"
                     /db_xref="GeneID:62193756"
     mRNA            complement(join(<762135..763249,763308..>763311))
                     /locus_tag="FOA43_000355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920688.1"
                     /db_xref="GeneID:62193756"
     CDS             complement(join(762135..763249,763308..763311))
                     /locus_tag="FOA43_000355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776616.1"
                     /db_xref="GeneID:62193756"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="InterPro:IPR038635"
                     /db_xref="PFAM:PF04153"
                     /translation="MSAWGNVTDDLDKRPGISYKAAAGASGGIRRNLDSTSFNEQFPA
                     LDSHVIGNANNLDNNAKIPLLSQQLQTSSSSQTLPSQTKANAQAILNAVKQASSLANR
                     NNSGENINSNTTGLTSSQSATNILNSLTNAAAAAAGVATGISATESGITNTPLNGSHS
                     DTPTPQLPPGLIQGKLEPKQAAATTTTATTAAVEEVILTEDIDKFGLKGLLPLLRMEP
                     SDQATIATGVDLNMLGLDLSNNDPNYKISKTFASPWLETSRSEVEPLFSCPNSFLIPD
                     KELTNIESRINTFNDETLFFIFYSKPRDTLQELAARELNNRNWRYHKDLQVWLTKDSS
                     VEPVPNGPGSERGTYVFFDPTSWEYVTKEFVLSYQSII"
     gene            <763576..>764142
                     /locus_tag="FOA43_000356"
                     /db_xref="GeneID:62193757"
     mRNA            <763576..>764142
                     /locus_tag="FOA43_000356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920689.1"
                     /db_xref="GeneID:62193757"
     CDS             763576..764142
                     /locus_tag="FOA43_000356"
                     /note="BUSCO:EOG093444T5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776617.1"
                     /db_xref="GeneID:62193757"
                     /db_xref="InterPro:IPR020618"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF13238"
                     /translation="MSLPNTRRKLPNIVITGTPGCGKTSHAEQLVQQCPELTHINVSE
                     FAKKNNCIEGWDSERDTSIVAEDKLLDLLEPLADKGGLVLDWHCCDLYPERWVDLVVV
                     LRCDNTVLYDRLKKRGYKESKVQENVECEIMQVLLSDAKENYDSQIVIELQSEQVDTL
                     DDNVDRITQWFTKWKQDHSQGVSNKLPS"
     gene            complement(<764829..>765380)
                     /locus_tag="FOA43_000357"
                     /db_xref="GeneID:62193758"
     mRNA            complement(<764829..>765380)
                     /locus_tag="FOA43_000357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920690.1"
                     /db_xref="GeneID:62193758"
     CDS             complement(764829..765380)
                     /locus_tag="FOA43_000357"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776618.1"
                     /db_xref="GeneID:62193758"
                     /translation="MTPQPSQKSNNAPTLPMTIKKRRKSSFNSSDSPYARRRSFLSKS
                     MLENDNFQTYELSYYATLSPASSSPSGSLRMARIPSFSINLTESQGFIWNQDLFASSY
                     QQARAGLNPNSFQGDSQPVEVIDIVVDSSDEMDDEACAKTNLRGENTTPASANYRKSC
                     QREVSMNDDIFDNGAELMYDDDY"
     gene            complement(<765702..>767267)
                     /gene="NOP56"
                     /locus_tag="FOA43_000358"
                     /db_xref="GeneID:62193759"
     mRNA            complement(<765702..>767267)
                     /gene="NOP56"
                     /locus_tag="FOA43_000358"
                     /product="snoRNP complex protein nop56"
                     /transcript_id="XM_038920691.1"
                     /db_xref="GeneID:62193759"
     CDS             complement(765702..767267)
                     /gene="NOP56"
                     /locus_tag="FOA43_000358"
                     /note="BUSCO:EOG09341K3E"
                     /codon_start=1
                     /product="snoRNP complex protein nop56"
                     /protein_id="XP_038776619.1"
                     /db_xref="GeneID:62193759"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="InterPro:IPR029012"
                     /db_xref="InterPro:IPR036070"
                     /db_xref="PFAM:PF01798"
                     /db_xref="PFAM:PF08156"
                     /translation="MAGLDYVLHEEPTGYAIFKVKLQQDDVGARLKDVEQAAQDLAKF
                     SKMVELVSFAPFKGAAQALENMNDITEGLVSDYLKSIIELNIPKGSSKHTINLGISDR
                     NLGPSIKAVFPYIDCYWNEVVQDLIRGIRYHGIKVLKGLQEGDLERAELGLAHAYSRA
                     KVKFSVQKNDNHIIQAIATLDQLDKDVNTFAMRVKEWYGWHFPELAKIVPDNKTYCQV
                     MLFVKDKTSLTPDSLHDLAALVDDDAAVAEKIIDAARISMGQDVSEQDMNNMESFAEK
                     SLHMIEYRAGLSKYLNDKMHVVAPNLSELIGEVVGARLISHAGSLTNLSKQAASTVQI
                     LGAEKALFRALKTKGNTPKYGLIYKSSFIGKAAPKNKGRISRYLANKCSIASRIDNFA
                     DDPTNAFGKVLKKQVEQRLQFYEDGKPPMKNSDAVKEAMNLGGSDAAQPEEQGKSEKP
                     EESDDTEDEEEEKPAEKKEKKEKKEKKEIREKKEKKEKKSKKEKKEHKHKHHDKKRKA
                     EDDSEHKKKKSKH"
     gene            complement(<767498..>768395)
                     /locus_tag="FOA43_000359"
                     /db_xref="GeneID:62193760"
     mRNA            complement(join(<767498..768340,768393..>768395))
                     /locus_tag="FOA43_000359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920692.1"
                     /db_xref="GeneID:62193760"
     CDS             complement(join(767498..768340,768393..768395))
                     /locus_tag="FOA43_000359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776620.1"
                     /db_xref="GeneID:62193760"
                     /translation="MLKPFQELATPRHILQDSQPDDNSNPLLEKPTVLPTITLEHHHP
                     HDNSNYFLVIPEVLSVLTESIFELKGISIKRISTIKVTYPDTNDSDNDTLDFDEATQL
                     YNVKDNYILEQDLKDIPVYCLKTPSCKVDFVTIPSFRNKIIYNLLANTILSSYDVHRL
                     ITFGTCELCEEETVRKLISKDYHDSPTVLHKISDMVPPNIVTGIAGSFSSRAALVNIP
                     FATIGVDAEGAFSLDMEKLNLDAVSTVAPVLNEMFNIDSTGQFLKFIESKLDLKRASN
                     GGLYM"
     gene            <768561..>768920
                     /locus_tag="FOA43_000360"
                     /db_xref="GeneID:62193761"
     mRNA            <768561..>768920
                     /locus_tag="FOA43_000360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920693.1"
                     /db_xref="GeneID:62193761"
     CDS             768561..768920
                     /locus_tag="FOA43_000360"
                     /note="BUSCO:EOG09344HYI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776621.1"
                     /db_xref="GeneID:62193761"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="PFAM:PF01920"
                     /translation="MSSSIEQLSKSYNKLQAELSELVSSRQKLETQYEENKIVKEEFD
                     KLKKDTKIYKQIGPVLMPQDETEAKMNVDKRLEFIGGEIERVEKKIEVEQVQFSKARD
                     ELVKARTALMQPAAKAS"
     gene            complement(<768999..>769751)
                     /locus_tag="FOA43_000361"
                     /db_xref="GeneID:62193762"
     mRNA            complement(<768999..>769751)
                     /locus_tag="FOA43_000361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920694.1"
                     /db_xref="GeneID:62193762"
     CDS             complement(768999..769751)
                     /locus_tag="FOA43_000361"
                     /note="BUSCO:EOG09343J1B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776622.1"
                     /db_xref="GeneID:62193762"
                     /db_xref="InterPro:IPR012762"
                     /db_xref="InterPro:IPR013718"
                     /db_xref="PFAM:PF08511"
                     /translation="MLSLGQRFSIQAKRCLVRSFHSLYHTEPPIADPSTLENKILSKA
                     YTDFVPKEGFTEEAVNHAAAAVGTNPSTLGAIFNFTTPSRDMAMELALYHMKFARQEM
                     YEQNKEAAGKMFNEKDRLQFYMTKRLLLNEPIIQHYHQALGRMILPSNVSESLKELHN
                     LADDMSYYAGDKSTDFAWYSKRFAVAGAIIQSELFMLSDHSKGFSDTIQFATDRLQEV
                     NTAGRIYNSFEEWIIFNGISTLNMIRSQVARG"
     gene            <769956..>771116
                     /locus_tag="FOA43_000362"
                     /db_xref="GeneID:62193763"
     mRNA            <769956..>771116
                     /locus_tag="FOA43_000362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920695.1"
                     /db_xref="GeneID:62193763"
     CDS             769956..771116
                     /locus_tag="FOA43_000362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776623.1"
                     /db_xref="GeneID:62193763"
                     /db_xref="InterPro:IPR019193"
                     /db_xref="PFAM:PF09814"
                     /translation="MSSVLGPSPPSIQYFSEFLPRLKTISVCIKYPENVLPKALHTNE
                     QGDMIILVDNDGKQLQLKIPVRSIPNFNVSVTGENGMLSFKLPSDPKDTQVESIERFR
                     DIDTLTDKDSLPWSAKEMASFKAHDDSFVCLKCHRTLIPLKSVRRIDPMPSEFWSEMM
                     EFWHCHKPATDSTNSYNSINDRFNKFHPGDYNLIVGSHYIVLNPAQFAMTTIGESCNC
                     AGCNFQLGIKDTSTGNYKVYMWNLGHRVAGSSVISTFHPYLQAFSLLIDSISATAIRF
                     YVVKVKQSKDDACSRSSRLLVWCFSFGLEVVIGNLLLHNSLKVMFKNSDTEIDEFVRQ
                     SKSSSVQYDTIELDKICYDDFASELLETHQLLPDQQNSFNGWDIGYIPERNS"
     gene            complement(<771128..>772246)
                     /locus_tag="FOA43_000363"
                     /db_xref="GeneID:62193764"
     mRNA            complement(<771128..>772246)
                     /locus_tag="FOA43_000363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920696.1"
                     /db_xref="GeneID:62193764"
     CDS             complement(771128..772246)
                     /locus_tag="FOA43_000363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776624.1"
                     /db_xref="GeneID:62193764"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR004097"
                     /db_xref="InterPro:IPR038222"
                     /db_xref="InterPro:IPR038763"
                     /db_xref="PFAM:PF01368"
                     /db_xref="PFAM:PF02833"
                     /translation="MSLTAFLKTSKANLIETASRLSKLTLVTGNQSSDMDSVVSAIAY
                     SYFTKPSDTPILPLLNIPRADLGLRRDIEYALKLIDIQAEDLIFADDLHFLPRNIRLN
                     LVLVDHNKPEGENEEMILKAFNTHVTAIIDHHDDEHLFLHAEPRLIQVTGSCSSLVLG
                     HFQKGVLNAKLDLATVKFLVSAILLDTGFLTDKYKTKQTDVDILNHIKAQYPELSDEE
                     LSQENTILHKQKKSVEGFNFKDILRKDYKEYNCGKLKTGISSVSGSLDQLEATFGYQN
                     MVQDLKELKGQRNLSLMVMMASYNSKSNNVHCRQMVLVGDANSALSSDTAAALENKLQ
                     LEVKVSSSSEEIKAFEQLNTAASRKQVAPLITEYLKSV"
     gene            <772817..>773866
                     /locus_tag="FOA43_000364"
                     /db_xref="GeneID:62193765"
     mRNA            <772817..>773866
                     /locus_tag="FOA43_000364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920697.1"
                     /db_xref="GeneID:62193765"
     CDS             772817..773866
                     /locus_tag="FOA43_000364"
                     /note="BUSCO:EOG09342W3B;
                     CAZy:GT15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776625.1"
                     /db_xref="GeneID:62193765"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF01793"
                     /translation="MGQTIDEPKVDNLVKPPEDPASYERANATFMILARNQDSSDVVH
                     TIKQIEKHFNSKFHYPYVFLNDAEFSKHFKERVQKEISSDAYFETIDPKEWNQPDDID
                     KERQNKGMQELANENVAYARQLSYHNMCRYYSRGFYNHPRMKQFKYYWRFEPKTEYYC
                     DIDYDVFKFMRDNHKIYGFTLALYDIHQSIKSLWPRTMEFIEQHPEYVNRNASFSWLV
                     NDLQNPQKAQYANGYSTCHFWSNFEIADMDFYRSNAYSEWIEYMDQTGGFYYERWGDA
                     PIHSVAVSLFADKSNIHWFRDIGYNHIPYTNCPNSNKCTKCSPGKFSDANLRSENCLT
                     NWWNLEMDEAARNMY"
     gene            <774086..>775168
                     /gene="HOM6"
                     /locus_tag="FOA43_000365"
                     /db_xref="GeneID:62193766"
     mRNA            <774086..>775168
                     /gene="HOM6"
                     /locus_tag="FOA43_000365"
                     /product="Homoserine dehydrogenase"
                     /transcript_id="XM_038920698.1"
                     /db_xref="GeneID:62193766"
     CDS             774086..775168
                     /gene="HOM6"
                     /locus_tag="FOA43_000365"
                     /note="BUSCO:EOG09342NDB"
                     /codon_start=1
                     /product="Homoserine dehydrogenase"
                     /protein_id="XP_038776626.1"
                     /db_xref="GeneID:62193766"
                     /db_xref="InterPro:IPR001342"
                     /db_xref="InterPro:IPR005106"
                     /db_xref="InterPro:IPR019811"
                     /db_xref="InterPro:IPR022697"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00742"
                     /db_xref="PFAM:PF03447"
                     /translation="MAGVNIAIIGAGVVGSELISQLTSLKGYIEYNVVILAESKHVLR
                     SEDYSPLNMSSWKQNLAASSKPPMSPAQIADFMKKSPLPAILVDNTSNQTIANSYPIF
                     IKAGISVATPNKKAFSSDIKLWNSIFDYAGKPGYGLCYHESSVGAGLPLISPLKEMIL
                     TGDEVLKIEGIFSGTLSYIFNEFSAVKPSNTKFSDVVKIAKQKGYTEPDPRDDLNGLD
                     VARKVTILARISGLPVESATSFPVQSLIPKELESVSSGDEFLQRLPEFDDQMESLKAE
                     AAKEGKVLRFIGTVDVPSKKTSVKILKYDFSHPFASLKGSDNVISIKTKRYPNPLIIQ
                     GAGAGAAVTAMGVLGDVIKIAQRIAH"
     gene            complement(<775200..>779813)
                     /locus_tag="FOA43_000366"
                     /db_xref="GeneID:62193767"
     mRNA            complement(<775200..>779813)
                     /locus_tag="FOA43_000366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920699.1"
                     /db_xref="GeneID:62193767"
     CDS             complement(775200..779813)
                     /locus_tag="FOA43_000366"
                     /note="BUSCO:EOG093402YZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776627.1"
                     /db_xref="GeneID:62193767"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR027244"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF00610"
                     /db_xref="PFAM:PF12257"
                     /translation="MPHRARIQFDLSQVRNRTSQRTNEASLVVGRRRTGNELVSTVET
                     NFGKADQISTQSSRKISLHSAESNLTLRGTPIPIGSNGDTAFAQQASSHIDKPEATSL
                     TVKFHEARTCTDNVIIDPLCVSGAREGSIGEMRCVEGTSKRLYFVFKKPQLHAMTLST
                     SNTITTTNAGAIPSVSGTASIKLGPIQELMNLKPRTPVLVEVKPQEDVEADVVEIYIK
                     DLHLSRGDMWNLSGMLLKECLYRTQKLSFLQGSIRGDVHRIYRRGKKVFSAFIGKKTK
                     IVFRSESARLVVFIQISLEMWHFEESGQQMFYKLVNALFPRVFKRWKELGTHHLITIV
                     LFTSVDLDEERHLKYQAGERPPNKQDYYRVVVDQVSILLWNEIMATLRLEFSNFKRDI
                     LLGENCHRTTKNPQKDTITGQFLPAVKGNLLEAINLGMSLVSDDFRDPDLHQTTNHFI
                     IVTPGTGLFDVDYDMLVQTGKLLATVDSTIDVICLSQPPLHIVPLFRYLDSQNKPHHC
                     IPNFMDISFWSDSDSARAVHQWLPRCKIYELQMMGVMENELTSININELNLGNFTSSI
                     DAMDDYDNATFRTPLDQRRRAKIENRKKKKLRYMKSASFITSSESSGAPHLIPRRAIS
                     DKSQFDMQESKGFQPSELVTVKASTPTTSNAIGVTTTSKSNVSAFSSLLSISKTATRQ
                     MNVPKALDFVKRIMSSPLQGPTSPRIAPNSSRNGTSSQILDDIKSLSLSRDPSHNDNI
                     HGADVREAYKESSSLPAPPEISSKTASISPASIRRNQTSTSAPSVTMSANTKKSNDGK
                     GNPWNSYWTAVENPSKVMASELLGLVSYGRWQFVFPRNVRRRIIKWTSLASPAALPIM
                     TPFFPSVEDFNQNFTFRIYDVLLNQNGINENRSSDTLMRSMISLRLSLGFQICVGEEV
                     KKVEDQRKPNGNSEQLIEYLDKEHYQGSRIYLSLSDEIHRVSCDYNGLVNVQVYMRTA
                     GADGVEMNAPIHDYVENIRTRYSLNYSPVTIHPSQGEPRNYNWNQLDQILAGYDDSID
                     SHTKYHRLKFVILPTNVPENSFKLASEKLIPEEIRLEGIRSLVAIINKNRYRSAEEKK
                     LRPKKTEIIPEINFYTGNLFKFLDEQASLEFTGDITQSQLFSAPKYSKTISLNRLASI
                     LQSDEGIEIIDRKWHMITHNYCFIGTDFVSWLIENFEDIDNRDEAVDYGNQLMERGLF
                     RHVNSRHHFLDGHYFYELNKEYVKNTGGKARSNPMAALTLRHLGAQTLSPSSSHTETV
                     KSLDTTTSTNSETKEPKKRKVVLSRKVLYDLDPNQISWQSELIRVHYDIVHNPEHCFH
                     VRIEWLNTTSKLIEDTISSWEKHCERYGLELVEIPWDELCTLPLSNPLHSTVDISLAL
                     NPWKDEEFSKYQSILSKNKYFYHLYLLEKSEFMLDNRTANFFSDDRFDVMYSWGRPRF
                     KFAQFIHTTGAYIAELRGNGNFFLAPNNAHIARVNLSIGQLQGGKKGTVYFDSQGVML
                     DFRSICNDKRKLRLIFREAIKSYELSRDVEVTLFGDECEETEN"
     gene            complement(<780176..>784337)
                     /locus_tag="FOA43_000367"
                     /db_xref="GeneID:62193768"
     mRNA            complement(join(<780176..784213,784275..>784337))
                     /locus_tag="FOA43_000367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920700.1"
                     /db_xref="GeneID:62193768"
     CDS             complement(join(780176..784213,784275..784337))
                     /locus_tag="FOA43_000367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776628.1"
                     /db_xref="GeneID:62193768"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR039462"
                     /db_xref="PFAM:PF16755"
                     /translation="MNTLCDTTNMPYTEIDNLELEEFGFQSRRPVQLFGVDQMDALRK
                     GYLNCLAVSYKHQMIIAAFGDKIKLIRISELSHVLESDTEDKETGSSPAIDFTDKTTI
                     KLSASVQQIYLNADEQHLVILFDGCHRIGVVELGKVINGQWTGSLTKIRLTKMPGRIV
                     EASFSKTNPNLVLLLLDIDELWLMDLQQKDITTSTKLIKKEVTAACWTQDAENQIYIG
                     SSLGKNISVINIRGETLSSIKFEDTSLEEIFKPLHITQMNEDTTLVIYGISREVKDVN
                     PEFRSFVFTKGSFTKEVKDVCMLFAEFHQNIAFYETHLNHWCKDFPYLTFTIASNSTD
                     FNALTPECQIIELNDSDRAQMPLDPETNADDTPIGFIMDLQASEQVKQPCMTLDSSGP
                     LPRFIILSHRGQLLTWNIWYTKAIKAQEDDLSAALSCVLKAPQEVKLPTHTQVQASSP
                     AIQKATNLDFPKSDSIFSKHEMGNPFGSTSNPFGSGKDCVVPENVTSPLIKTARSPKL
                     QGNMDTTSYLHEKPAPNNPPNASPVFGKSGIQNSTRFSLSARAGSDAPNIKNSTNSGF
                     SAFASNGSSPFGAFASKDQTSPFGVIAAKGAHTSPFGDSFKLGAQNKKSSMLGFGQSS
                     GKMDGDNSESPFKFKAKSDEASPIVKLLSSKDKSQPVFGINTSHKSPFEKLAESSGKS
                     TGKAFNFAGFALSMSEKNSNNRNEPDESEEESDNDKVDQDEYDSEFDFDRDDESDNDT
                     KLNEERYAPFVPLQEEKIEDSTSVTVPEDAERIQVEREIFNQREKMKKTTSGEDSELN
                     GLEEKVGNSLPGTEGEQQGSKEATEKSVQTKEEFEESTKKSTEDDTKGFEFPSHENEL
                     IKKFKHPTLANDLLSSRYADGESVQTNQLEEENKAVDIRPESAEKDEVKSEDEMSQLR
                     KASGSEYLIPMAQTNLEDDKAVEKEENSSKMEPNSSDVEVETAEAGSSASSEESYERI
                     DKREVEEQADHIQEMKQSETTSDAAVVPSSTDAYLTSGTREDKAATDQAKLVRQATDT
                     PSLLNTEKVETETMEYKDEKIEVGNQHYADFKVESFEDEEVYLSKLALPPSVPPLLTV
                     KIVEYPNEDKPAVEKEMLEVVYDTETDLEFLQRNINQLNLFLSKHMDDSVMHTLEKSI
                     GFSDFWRLNEVGTVEAGIQNTTKTLTNMMAQLRDVITRVTKLNEEVASCMRRTPAIKE
                     SLLIEPQAVVISRKGGLTFDSMQRCHKINLLVNKVKSMDSQLQSKLLILNSLVHPEAL
                     TEHPQNMDIVISAMDSRFQQLLDGLYDIKKEYDSVATMRQYKDSDNTISDLFDNPKNS
                     LKAFIKGDRTENETIRVSSIISAVGSRSRLGKMFHDRAFHPRKVTL"
     gene            complement(<784613..>785701)
                     /gene="MPG1"
                     /locus_tag="FOA43_000368"
                     /db_xref="GeneID:62193769"
     mRNA            complement(<784613..>785701)
                     /gene="MPG1"
                     /locus_tag="FOA43_000368"
                     /product="mannose-1-phosphate guanyltransferase"
                     /transcript_id="XM_038920701.1"
                     /db_xref="GeneID:62193769"
     CDS             complement(784613..785701)
                     /gene="MPG1"
                     /locus_tag="FOA43_000368"
                     /note="BUSCO:EOG09343A5M"
                     /codon_start=1
                     /product="mannose-1-phosphate guanyltransferase"
                     /protein_id="XP_038776629.1"
                     /db_xref="GeneID:62193769"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF00132"
                     /db_xref="PFAM:PF00483"
                     /db_xref="PFAM:PF12804"
                     /translation="MKGLILVGGYGTRLRPLTLSIPKPLVEFANKPMILHQIKALADV
                     GCTEIVLAVNYKPEVMVGTLTQYEKQYGVHITFSVEDEPLGTAGPLKLAEDILKKDDS
                     PIFVLNSDVICEYPLQELLDFHIAQGGEATIAATKVDEPSKYGVIVYDRDVANRIDRF
                     VEKPVEFVGNRINAGIYVLNPTVLDLIEMRPTSIESETFPLLVEKKQLYSFDLPGYWM
                     DVGQPKDFLTGMCLYLTALSKNHPEELSKGDYVYGGNVLVDPTAKIGKDCKIGPNVVI
                     GPKVVIGDGVRIQRSTILKNSEIKDHAWIKSTIVGWDSTVGKWARLQGVTVLGEDVNV
                     KDEIYINGGKVLPHKSIKNNVETPQIIM"
     gene            complement(<786356..>787735)
                     /locus_tag="FOA43_000369"
                     /db_xref="GeneID:62193770"
     mRNA            complement(<786356..>787735)
                     /locus_tag="FOA43_000369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920702.1"
                     /db_xref="GeneID:62193770"
     CDS             complement(786356..787735)
                     /locus_tag="FOA43_000369"
                     /note="MEROPS:MER0031645;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776630.1"
                     /db_xref="GeneID:62193770"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PFAM:PF00561"
                     /db_xref="PFAM:PF12697"
                     /translation="MDFILNFEDEDQLSQDRLLKNEIPYYRNYQGFSSPKGLSAYNVK
                     TIIDSKGNYINEIRVENNSEEEDMLLASNSVNESHPKHLVMIHGYGASCGWFYKNLHG
                     LICANPNSKIHALDLLGFGLSSRPEIKYEHDTSSEANLDIIYDQSEVVKNIPKTSNEK
                     KRKNKKTFATPKHFKVRSQDVLKYIKNQRDLVDEVEGTYVDSLEKWRLNNGIEKFDLL
                     GHSLGGYLAVAYCLKYPNHVKRLVLVSPGGVERSPFSVTNPRYLALQKLSEDRTDTIP
                     EYLESVTSHWPGDYSFLGRYTSVKESFKLIWQTRTSFFAMLRWMGPLGPKKLSERNIS
                     RLTRSGYFNDWKEIDLFIKYIYNTGLKSSFSETSIMRIFDASVVAKYPLLDRIDKLQV
                     PKSLWIYGEHDFMFTDCGHAAVNKLNSKPGFEAKFDLVSNAGHNLYLDNYKEFNQKVL
                     RFLGWHEAR"
     gene            complement(<788172..>789983)
                     /locus_tag="FOA43_000370"
                     /db_xref="GeneID:62193771"
     mRNA            complement(<788172..>789983)
                     /locus_tag="FOA43_000370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920703.1"
                     /db_xref="GeneID:62193771"
     CDS             complement(788172..789983)
                     /locus_tag="FOA43_000370"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776631.1"
                     /db_xref="GeneID:62193771"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="InterPro:IPR018553"
                     /db_xref="PFAM:PF00643"
                     /db_xref="PFAM:PF09418"
                     /translation="MADPYKKNLSELLDGKIDPEDDEEATKNSSQDAVDPALCIDCQR
                     MPKELFCEDCDEPFCRVCFQFAHRGGRRKKHNVVVLVEEEKPEYEETEEEEVEEQDNI
                     DPENSLLQSKVSSGGMFSGIFGTKDPSKLAAEKRIMLGIKRSVKFIPMRLSYAERQHF
                     RLLEAALNVSEYTDRVDVISYKSKARRIVQQLRETCSVLAGLVVSSDMKVGQKLIEDK
                     NFADNAQWYKDIFEIGRRYKIMNPERMRDTYGKLCYMVMDSMLPEIRQTMEFDLYKPV
                     KTVYSALKEGGEGCMNILMDPLIIDATAEVRPEDNTRRMINRMIKQKESAIEKLASRY
                     SSPDGIGKEEIRVILYSIGDFNAYTNKNRLPVLRMLKRLDIYKDAGSTKYSLGIRNGS
                     GGARLTHDHEKQYLYVKQALALWSGVMRDLVELWAYADDDLFDGNRYQIADTGQGFNR
                     IKSCPKVYKKMYNILGEVQRKFEYWVGIPVIHLGDDAVPNALFFLDKYIQIPSILIPI
                     DRTVREIQKMASNDDHVRKYIESQFDTADNLRKTILCDYFKHGFDGSGADNYYFAGSC
                     VDATSTSSCEFCNQINKKNYYNFFLLAGFTNFNGDGY"
     gene            <791562..>792749
                     /locus_tag="FOA43_000371"
                     /db_xref="GeneID:62193772"
     mRNA            <791562..>792749
                     /locus_tag="FOA43_000371"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920704.1"
                     /db_xref="GeneID:62193772"
     CDS             791562..792749
                     /locus_tag="FOA43_000371"
                     /note="BUSCO:EOG09342G3Z;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776632.1"
                     /db_xref="GeneID:62193772"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="PFAM:PF04433"
                     /translation="MSHTRQIDGCLTPTNDPATLKHIYGSSSPMDTKASLGSISFSGN
                     VMHVGPSRTPLVRPPSPMDTIPSPPLSPHTRNFDESDTRFTKLLFPKASKPLRSDILS
                     NEKEITLMKQPKETKLVKEVKSMTPLSELSTVSARKGPFPVESMMGATLYINPFDDMK
                     QSGYKKRQFSFLAHYNLTQNKPAVLPKSSSSRHPFAGSHSSIRSSYSTVSKSRYDHHS
                     SSSDYERPITRKRYVSSPLEKLLHNSSSVENDVAAPPKRRRRKPTTRKANSATTRYDY
                     DYTKLVDYSPALSTLPDNPRCLKAEWKGQAMDLSDDPLVEKLHPAEVLLASTLRLPCK
                     VYLDSKRRIFAEKMKRLKSHLPFRRTDAQKACKIDVNKASRLYAAYEKVGWLNESTFT
                     KYL"
     gene            complement(793232..793305)
                     /locus_tag="FOA43_000372"
                     /db_xref="GeneID:62193773"
     tRNA            complement(793232..793305)
                     /locus_tag="FOA43_000372"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:62193773"
     gene            complement(<794021..>795286)
                     /locus_tag="FOA43_000373"
                     /db_xref="GeneID:62193774"
     mRNA            complement(<794021..>795286)
                     /locus_tag="FOA43_000373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920705.1"
                     /db_xref="GeneID:62193774"
     CDS             complement(794021..795286)
                     /locus_tag="FOA43_000373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776633.1"
                     /db_xref="GeneID:62193774"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="PFAM:PF00487"
                     /translation="MSSVTVTGSNYEKESTPIVSKRNGNIAGFSRRTTTEGLIAKDTL
                     ANDFKVPDYTIKDILSVIPKECYERSWYKGMAYIFRDILCCVLFGYAATTLIPQVPSQ
                     MLRGFLWTGYSLLLSLPYTGLWVIAHECGHQAFSPYGLLNDTVGWILHSYLLVPYFSW
                     KYSHSKHHKATGNIDRDMVYVPSTKDEFVKSRGAINFSDIAVDAPILTLYTMFLQQFG
                     GWWWHLLSNASGQKYPDHGKFEVSHFNPSSPIFEKRDYWYIVLSDIGMLCQSFVLYQW
                     VSRFGFFTCFIHWFLPYIFTNHWLVFITYLQHTDMSLPHYENSEWTFARGAAATIDRN
                     FGFIGPFFFHDIIETHVLHHYCSRIPFYNARIGTKAIKKVMGEYYRSSDENMWKSLWK
                     AFRYCEFVEGDNGVLMFRNHNGCGVPVND"
     gene            <796740..>797666
                     /gene="YHM2"
                     /locus_tag="FOA43_000374"
                     /db_xref="GeneID:62193775"
     mRNA            <796740..>797666
                     /gene="YHM2"
                     /locus_tag="FOA43_000374"
                     /product="Mitochondrial DNA replication protein yhm2"
                     /transcript_id="XM_038920706.1"
                     /db_xref="GeneID:62193775"
     CDS             796740..797666
                     /gene="YHM2"
                     /locus_tag="FOA43_000374"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="Mitochondrial DNA replication protein yhm2"
                     /protein_id="XP_038776634.1"
                     /db_xref="GeneID:62193775"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PFAM:PF00153"
                     /translation="MVSSSPTTVQKKPISWSNIFVGAALNLCEVTTLGQPFEVMKTTM
                     AANRSMSLPGAIRHIFSRGGIKGYYQGLIPWGWIEGATKGAVLLPVSSEAEYRLRLLG
                     AMPFLAGIGGGMAGGVAQAYLTMGFCTCMKTAEITRKKDIGPDGKPPKTTLQVFGEIY
                     KNEGIKGINRGVNAVALRQCTNWGSRFGISRLAEQLIRKFTNKKEDDRLAAHEKILAS
                     VIGGGLSAWNQPIEVVRVEMQSRSPNPNKPKGLSVLGTLKYVYKEAGMKGLFRGVTPR
                     VCLGIWQTVFMVCFGDYAKEYIADRSQKAKKL"
     gene            complement(<797756..>798502)
                     /locus_tag="FOA43_000375"
                     /db_xref="GeneID:62193776"
     mRNA            complement(<797756..>798502)
                     /locus_tag="FOA43_000375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920707.1"
                     /db_xref="GeneID:62193776"
     CDS             complement(797756..798502)
                     /locus_tag="FOA43_000375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776635.1"
                     /db_xref="GeneID:62193776"
                     /db_xref="InterPro:IPR004853"
                     /translation="MLGVMLSCIKPDGLTHEDDSYFHTGCIFAFISMLIFVSQNIFAK
                     KFLTYEAHNHNDAFGTADDGFVNALNIQITKSESAATTPILPVSLSFDEKKELSSNRP
                     PSFPVTPFYGNSSQSLNEMVKDSDRRLDKISVLFYCSVVGLSFTFPFYIISEFTNPVF
                     SLSLINKHIIGLMLIYGIAHFMQSIVAFQILGLISPINYSIANIMKRITVISWSIFLE
                     GTQLMAIQWAGLVLTFSGLYAYDRWGRSKE"
     gene            <798504..>800896
                     /locus_tag="FOA43_000376"
                     /db_xref="GeneID:62193777"
     mRNA            join(<798504..798572,798871..798958,799839..>800896)
                     /locus_tag="FOA43_000376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920708.1"
                     /db_xref="GeneID:62193777"
     CDS             join(798504..798572,798871..798958,799839..800896)
                     /locus_tag="FOA43_000376"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776636.1"
                     /db_xref="GeneID:62193777"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR036869"
                     /translation="MGKSVQYVVALNRLLNMSRYTKTVIWTQKLVKKTSDGEYAYRQR
                     KESRLCEQGSYQHRYYATPVDGQPNEQQPHPSTDNPELIELLHSYPVEHGSSPYVVMG
                     FKSEREFQLGSLKKRFHQLAKIYHPDSSAFDGCSLSKHKFFTTNGERKSEESKLTDPV
                     KEKRFKRILSAYTLLRNPLMRSNYDNYQIGWEDNSQLLHRSPDPNFHSPNSAFYQHMH
                     HQRYNSHGNTGTWEDYWDTRGATYGFQGDKTWQAEGETFYEQFYNNRKNIFISMTLFV
                     AAYAALQATHLYLFEDYIGQNSSETFASEELQEKSEKDLADAHINFGLGLTKDDRINR
                     FLWFRKISTLLSLGDLNEIMEHLRDQRLLIRDEETGRVRMREYHNEKLAKQRRQKVAR
                     DNADVARPIDAK"
     gene            <801070..>801846
                     /locus_tag="FOA43_000377"
                     /db_xref="GeneID:62193778"
     mRNA            <801070..>801846
                     /locus_tag="FOA43_000377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920709.1"
                     /db_xref="GeneID:62193778"
     CDS             801070..801846
                     /locus_tag="FOA43_000377"
                     /note="BUSCO:EOG09343JE6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776637.1"
                     /db_xref="GeneID:62193778"
                     /db_xref="InterPro:IPR008238"
                     /db_xref="InterPro:IPR036263"
                     /db_xref="InterPro:IPR037039"
                     /translation="MDFMKPETVLDLANIRQALQRMEDSIIFNFIERSQFHTCPSVYK
                     ADVFPIPNFQGSFLDWLLSQHERIQSQVRRYEAPDQYPFFPDSVMPTFLPKIDYPPIL
                     ANYAEAISINAEIKKIYTEAIAPGISSGEGNQMENLGSTAMADIDSLQSLSRRIHFGM
                     FVAEAKFRNERERFTKLIKERDIKGIEDAITNKIVEDKILQRLLEKGKAYGIDPTLKF
                     TEHIDSKVKPEVIVKIYKDYVIPLTKKVEVDYLLRRLDCN"
     gene            complement(<801914..>802825)
                     /locus_tag="FOA43_000378"
                     /db_xref="GeneID:62193779"
     mRNA            complement(<801914..>802825)
                     /locus_tag="FOA43_000378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920710.1"
                     /db_xref="GeneID:62193779"
     CDS             complement(801914..802825)
                     /locus_tag="FOA43_000378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776638.1"
                     /db_xref="GeneID:62193779"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PFAM:PF00153"
                     /translation="MKQQATVAMDGASQVPQDSYRALKDIVAGTAGGIAQVLVGQPFD
                     TTKVRIQSAPPGTYSNSWDVVKKLLRDEGPAAFYKGTLTPLVGIGACVSVQFGVNEFM
                     KRYFYTRNEGGRMSLGQFFVAGSVSGIANSFFASPIEHIRIRLQTQTTGPKVFQGPID
                     VIKKLYTEGGIPLIYRGLGATLLREFIGAGVYFLTYEGLVQREMDRNNKLRKDVESWK
                     MCGYGGLAGYSMWASIYPVDVIKSNMQVDHYKNPKFKTYVDSAKFIFRKFGYRGFFKG
                     FVPTMLRAAPANAATFMVFEEVMRLLG"
     gene            <803644..>804537
                     /locus_tag="FOA43_000379"
                     /db_xref="GeneID:62193780"
     mRNA            <803644..>804537
                     /locus_tag="FOA43_000379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920711.1"
                     /db_xref="GeneID:62193780"
     CDS             803644..804537
                     /locus_tag="FOA43_000379"
                     /note="BUSCO:EOG09343KV9;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776639.1"
                     /db_xref="GeneID:62193780"
                     /db_xref="InterPro:IPR018618"
                     /db_xref="PFAM:PF09783"
                     /translation="MPTPNSNIPIFEPEFKRDLKDDLKVNVSEEKMRRSLPYTSNARD
                     SSDIEMGDGNDAIHFRPIASNIQEQTNGTQKGSRSRSGLKGNRSKIRLVSSPPLEITD
                     PFANNHISTSSSFLKPNSSFIGSQQSGRSIYDVRVDLKEVDLKRSYLAGFLTIHGLTE
                     SHPEITTFFRAEIVGPQYSFYTNHSVWGSNSRNDLQHWGRFPSWRKLNFNAENDIANS
                     DLYEKAADNEFLYMRWKERFLIPDAKVTDIRGASFAGFYYICFNQLTGSISGLYFHKC
                     SDKFQQLELSHIPDGGNISVI"
     gene            <804812..>805999
                     /locus_tag="FOA43_000380"
                     /db_xref="GeneID:62193781"
     mRNA            <804812..>805999
                     /locus_tag="FOA43_000380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920712.1"
                     /db_xref="GeneID:62193781"
     CDS             804812..805999
                     /locus_tag="FOA43_000380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776640.1"
                     /db_xref="GeneID:62193781"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MNDAIPLTEAPLRHSLHFQSQRKSSFAKDPNKTVYEKVNFYVDS
                     KYEIINMLGKGSYGTVCSAINSKANGKPSLAIKKVCNIFNKEVLLKRAIRELKLMAFF
                     KGHRNIINLIDLDIVYIKPYDGLYCFQELVEYDLAKVIHSSVQFSEYHIQSFIYQILC
                     GLKYIHSADVIHRDLKPGNILVTSQGVLKICDFGLARGINENFLRFSHRSPAITHYVA
                     TRWYRAPELILSRKGYGKPVDMWAVGCILGELYGRRPIFIGDNQMHQINEICKIIGTP
                     SRKVVLSYESGAAWDFFCNSRPNYEKKDWVELFPHTNPYARDMLSKLICWEVNNRLTV
                     GQALESPFLIKVRNYDEEPVAKEPFDFSFEWNSTSIEEMKLLLHNEVENFKSRLHTQF
                     NKE"
     gene            <806512..>811074
                     /locus_tag="FOA43_000381"
                     /db_xref="GeneID:62193782"
     mRNA            <806512..>811074
                     /locus_tag="FOA43_000381"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920713.1"
                     /db_xref="GeneID:62193782"
     CDS             806512..811074
                     /locus_tag="FOA43_000381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776641.1"
                     /db_xref="GeneID:62193782"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MGPELALMVPSAQTVAVSAYIDFIPGIQYSKPLGASRFLKAVKC
                     LDTEGAVVVKLLIKPDSHLNLTHLLKQMEDLREKLVGVPNVLPFHSIIDSQRACYFMR
                     PYIRFNLYDRLSIRPFLEGIEKKWIIYQLISAIARIHAKGITHGDIKTENILMTSWNW
                     CLISDFATFKPVYLPEANPSQFSFYFDTSQRHVCYVAPERFVNSTDEGVSNMNEGSSV
                     TEEMDIFALGCTIAEIYTEGLPIFTLPQMFKYKKGEYLPNLDGVGDPGIKKMVLSMIS
                     INPANRLKAEKYLAKYRKIAFPDHFYTFLHPYLRKLSVAGSGNEKNNNSMQQCDYRIN
                     QIYQDFDKIALYLGFKKYISEEPTEETTFSIGESAIPLRLSLPGMHQHIPRRTSEVFK
                     RDSIPDCSTLILLSVVLYNVRNTTHAAFRIKACDLMIALTEQLHDAAKLDRCLPYLVY
                     MLDDPSEDVQAAALRSMTQLLFMVDSITPVNVSLFPEYLIPKLRNFLMRSYLNPEGIE
                     GSKPSDDNGITEDNGNNYSNTREPTRTSYIRTAFAACLPHLALAAQKFYDMSNLLTTQ
                     MKLFNDPETENNLNMGNGSLIDANYQKIVDGFEFLTIRIMTDSDPYVRIGLLNNILPL
                     CTFFGKEKTNDVILSHLITYLNYKDPQLKIAFVSSIVTVSIFVGVVSLEQYILPLLVQ
                     ALPDPSELVVLELLKVFAELVKLGFIRKQYLWDLVKLNMRLILHPNQMIRDAVLNLII
                     AVGDTLPVADLYCMLYPLIRPYFRHEVTSFTWESLFMCAHSPIPRSVYSIAKSWSLTH
                     EPTLFWQKASRAGGNNTDSSNKIDSFGNKQVSFMKKSGSRKRPQIFRSSSSGSNGSNT
                     DNNVVENYEIPLSVEDSKQVERFKNIGFPESELWKLATLRSYIYRVAHVGSGNAKNEN
                     RDINYTRVNISPRSVFVDVNQQREVPKQQTKRSDDDYRKGRKAMLSKIDASNSKSTPW
                     DKSALFFDAVTSLPSIGRSPENAIGDAPSLHGKTSSLSIMGHGNYILSDRSEFNVQNE
                     TLNLQKLITKIRHSYSGNNTYILKFLRSLSFEPTLNDYTEFGSLIETGEALSTEENGE
                     SSGESVLISRLLEHKSSINCVRSSPDYSFFVTGDEQGLLKLWDTARLETNVTGRSFCS
                     LNLGSAIKSIDFMANRCCLSVSTGDGFIKIFRVDMNLISGSHRKTATIVLIREYKVPT
                     EDLYAMGIQFSVTNEKPYLAYYTPTCKVVILDLRTLSIVTCIQNDISHGLPTAFAIGA
                     NSSWILIGTSKGILDLWDTFFELQVKSTIVKPPVFPFKQIKLLPNSFQLDKARNRYVV
                     TIGETGDSDVIIWDVSKLQPRLVLCSSSEGSTIDRYSVRELKDDVDSVNNEISELPIS
                     IKSIENDKSCTALSVISSPVENSELYIVSVTCAGKVTLWNLLSPTQSRVIVEAKSSTD
                     TTKTNCLPKFSETQVNSNLTFINEIYASTTGNTNQKSKSGSTQNSTKLDALKRHQDRV
                     NDVAMIFKPYPMVISVDRSGVINVYK"
     gene            <811222..>813138
                     /locus_tag="FOA43_000382"
                     /db_xref="GeneID:62193783"
     mRNA            <811222..>813138
                     /locus_tag="FOA43_000382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920714.1"
                     /db_xref="GeneID:62193783"
     CDS             811222..813138
                     /locus_tag="FOA43_000382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776642.1"
                     /db_xref="GeneID:62193783"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="PFAM:PF01485"
                     /translation="MSEDFHCGSEPESEEEFNSEYESSEFEYEDEAYLDDDNMEKVEV
                     HYTFQVSKTRMGTPTHRMKYMPVSVEDVQKSLDDKVMQLNQILQIGIDECRILLIEYD
                     WNDDRLLEDFTSRKTEDFYKASGIISDLYAKKDNEDLLEKITDESFECNICYNSPSKK
                     RPLEAFRLQNCNHPFCTNCYIRFIQEANANSQLLIRCPNSECNHVLRISEIEQLSEYD
                     WQRRKKLDDQKQLENKERARVPLTEDQIREKYQKNEQDSDLSDFSDLEIGDPSEVNDS
                     DSKKDSNDNKTIDNVEVEPAKELFNFQERMLLKEREERERRRNSTLLSKYWFNATTMY
                     CSKNYKNFKNCPFPDCDSLVMQLGFDSSTVATLAEYTKRLLIPSVQCSHKHEFCYNCL
                     KEDHSPCPCAIVKKWERKCKDDSETAHWIVANTKDCPKCSSPIEKNGGCNHMVCRSCQ
                     HQFCWVCLKDWACHGNMNYNCIMYDEGTQEAKVEQEKNRKSLERYMFYFRLFANQRTS
                     FEKDKKFLEQFESRIQEIQRNSSISWIETLFYRESVDILLRARRELMWSYAIMYYIDS
                     KCPRQLLEGVQCTLSHQVERLSMLFADTEANLNLRQKSKFLNYSSMVKKSRDSLKETY
                     LDCITNGIIKLTRI"
     gene            complement(<813184..>815277)
                     /gene="GLC3"
                     /locus_tag="FOA43_000383"
                     /db_xref="GeneID:62193784"
     mRNA            complement(<813184..>815277)
                     /gene="GLC3"
                     /locus_tag="FOA43_000383"
                     /product="alpha-1,4-glucan branching enzyme"
                     /transcript_id="XM_038920715.1"
                     /db_xref="GeneID:62193784"
     CDS             complement(813184..815277)
                     /gene="GLC3"
                     /locus_tag="FOA43_000383"
                     /note="CAZy:GH13;
                     BUSCO:EOG09340MAY"
                     /codon_start=1
                     /product="alpha-1,4-glucan branching enzyme"
                     /protein_id="XP_038776643.1"
                     /db_xref="GeneID:62193784"
                     /db_xref="InterPro:IPR004193"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006048"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR037439"
                     /db_xref="PFAM:PF02806"
                     /db_xref="PFAM:PF02922"
                     /translation="MTKVTASIAVNALVDIDPYLAPHVEELVYRRKLADDWLSKFDKD
                     EGGILKFADSYKSMGLHIQSDNSIKYKEYAPNAVAACVIGDFNNWEHDKHVMEKQDFG
                     FFEITIPPNADGSPAIPHNSRVKVFFTLPNGEKIARIPPYITRATQPPKEYKNPTFEA
                     RFWNPPVKYQFKNKRPALPTSLKIYEAHVGISTPEPRVGTYKEFTKNLLPIIKDLGYN
                     TVQLMSIMEHAYYASFGYQITSFYATSSRFGTPEDLMELIDTAHGLGLRVLLDVVHSH
                     ASKNVEDGLNMFDGTDYCYFHSGGKGTHDQWDSRLFNYGSYETLRFLLSNLKYYLEEF
                     KFDGFRFDGVTSMLYIHHGIGEGFSGDYNEYLSPFAPVDKEALTYLMLANDLCSTYSQ
                     GENFEITTIAEDVSGYPTLCRPRLEGGVGFDYRLAMSLPDMWIKLLKHEKDENWNMTK
                     ICYTLSNRRYKEKCVAYAESHDQALVGDKTLAFWLMDAEMYTNMSLLTPLTPVIDRGI
                     QLHKMIRLITQVLGGEAYLNFEGNEFGHPEWLDFPRQGNDESYWYARRQFNLIKDDML
                     RYKLLYQFDKAMNTTEGRYTWLNCDPAYVSLKHEGDKMIVLERNNKLFIFNFHPTNSY
                     TDYRIGVEKAGAYRIILNSDRAEFGGHDRIDEQKSEFFTTAFSWNNRSNYIQVYIPSR
                     VALILALEEEIKENN"
     gene            <816053..>817141
                     /gene="RPL4A"
                     /locus_tag="FOA43_000384"
                     /db_xref="GeneID:62193785"
     mRNA            <816053..>817141
                     /gene="RPL4A"
                     /locus_tag="FOA43_000384"
                     /product="60S ribosomal protein L4A"
                     /transcript_id="XM_038920716.1"
                     /db_xref="GeneID:62193785"
     CDS             816053..817141
                     /gene="RPL4A"
                     /locus_tag="FOA43_000384"
                     /note="BUSCO:EOG09342UHG"
                     /codon_start=1
                     /product="60S ribosomal protein L4A"
                     /protein_id="XP_038776644.1"
                     /db_xref="GeneID:62193785"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013000"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="InterPro:IPR025755"
                     /db_xref="PFAM:PF00573"
                     /db_xref="PFAM:PF14374"
                     /translation="MSARPQVTVYGVDGQKTSAALPLPAVFKAPIRADIVQSVFTKVA
                     KNKRQAYAISENTGMQHSAESWGPGRAVARVPRIAGSGTGRAAQGAFGNMCRGGRMFA
                     PTKIWRRWHVKVNRNEKRYATASAVAASAVPSLVTARGHRIEAVSEIPLVVSDEFESV
                     KKTKDAIAILKAIGAHKDVIKVIKSRKMRAGHGKMRGRRFTQRRGPLVIYAHDDGLVK
                     ALRNIPGIDTCTVQALNLLQLAPGSHMGRFVIWTQSAFGALDSIYGSETVKSSKSGYS
                     LPKNVISNDDYLTIINSAEVQASIRPAGQHHQKRAHVVKKNPLKNKQVLLRLNPYARA
                     FSEKKLGSVKKVAAKGVKKEAFLKVLKN"
     gene            <817874..>819874
                     /locus_tag="FOA43_000385"
                     /db_xref="GeneID:62193786"
     mRNA            <817874..>819874
                     /locus_tag="FOA43_000385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920717.1"
                     /db_xref="GeneID:62193786"
     CDS             817874..819874
                     /locus_tag="FOA43_000385"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776645.1"
                     /db_xref="GeneID:62193786"
                     /db_xref="InterPro:IPR000014"
                     /translation="MSNSLGSLPGWHVNFVIPSTCSVTTVDPAVTASNEGFTKIARTP
                     FEKKKSTSRKDSIDLSLESMSQVGQLGEFGSTSAIGTTNIIRLLDSDSTAFSVSGQSK
                     KLQIGGKVKKKRRKYRKRKKKADSPMKMIQVTEQTQKHVPDSKQEAPTRFHSPSLPAG
                     SQNLSAASFVNFEDTSKAILPFSLSVATLNKLLSHASGVLPPSQVPTFQLPPKPQSHL
                     ASSQIDPAFNSSTIRVINPDNTSDNANVSTLSDHIPTEVSSHTPQYSAFDSGVDLQST
                     VDPEEPLEFNAPSSRRPSLASISASSHTLNVPHQSSNQELLSAPASIDSSVYKQKQLQ
                     HSSRDSSPHHQFPNALDRKSPEGSSDNSSGKKFMSTTANDEYVKLTDLLNTNPPSPSQ
                     DFLEDFSGHIDTDDDYHISLPFIEIGIDDNSMRTSYTNNTTPNSYIYNGEHSHMPNTA
                     REIPHDLQEDDDFTSPLIMRHVIKKPDDIYLTSIVKAYQYPKAYHALIAYLKQRFDKN
                     QLIEVAKCMAKYRPSFIAATKSLYENDLIFTERSFQRALLEYEQLISLSPSPTIIWRR
                     TGEIVALTNGFATMTGYSKMSLLSKRTFIVELMDDESTLKYFQSFSEMAFGDLNATYL
                     TDCNLRKADDNDYLKCCCVWTIKRDVFDIPMLIVGQFLPVLS"
     gene            complement(<819924..>821648)
                     /locus_tag="FOA43_000386"
                     /db_xref="GeneID:62193787"
     mRNA            complement(<819924..>821648)
                     /locus_tag="FOA43_000386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920718.1"
                     /db_xref="GeneID:62193787"
     CDS             complement(819924..821648)
                     /locus_tag="FOA43_000386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776646.1"
                     /db_xref="GeneID:62193787"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="InterPro:IPR036928"
                     /db_xref="PFAM:PF01425"
                     /translation="MVDIGAPVNIESFYKFTDDVSNPELFESWKPKIKAYLEDLDKES
                     PAQYKIPEKEVPEDLDEKSFSTIEYLKDTMYLTDSDKKITEMSVVDLAKNITSRKLSS
                     VEVMNSFAHRAIILNQFTNFASQFFIKEAMNTAKLLDEYINNTGNVIGPLHGIPISVK
                     EQIGMAGKITHGGWVAWLDYIPEEDATTIKVLKKLGAVLYVRTNEPQTLMHLDSNNNI
                     IGRTRNPYNSLLSSGGSSGGEGACVGGRGSAIGVGSDIGGSIRAPAAFCGCFGLRPST
                     RRISTAGGVSSGRGQESVVAVEGPLAHTAKDIDYFMKSYINAGKPWEDDPWCMPMPWR
                     EVAKPEPRDVTVAIMYDNGMVKPHAPISRGLKTVEGKLKSSGVKVIKFEPLMIEEAYD
                     VCHQLYTCDGNNAQKEMLKPSGEPLLPLTKWAMSMGNGDKCLSITENRSLNARRDTIR
                     AAYNKYFIEKKVDFVISPTYVGVAPCAIENGIAGPYYWGYTSLWNLLDLPTLVAPTGL
                     YQYPPSDLKDPSYKPRSPIDEIEQNKYIPELFRDAPICLQITGRRYFDEEVVSFGELF
                     EEIMKNKS"
     gene            <822548..>824473
                     /locus_tag="FOA43_000387"
                     /db_xref="GeneID:62193788"
     mRNA            <822548..>824473
                     /locus_tag="FOA43_000387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920719.1"
                     /db_xref="GeneID:62193788"
     CDS             822548..824473
                     /locus_tag="FOA43_000387"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776647.1"
                     /db_xref="GeneID:62193788"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR036864"
                     /translation="MSKFGGTKIRNMKGPDPFFPKTRTKTGCFTCRKRKKKCDECYPV
                     CSGCARNFICCIWPENKGDSLPRDFRITSSTASDLQAESGGPGVSSDSASEAVQSTFT
                     ISNSLHSVIETDSSVDFSDFNVPINMCSVIPLTSYKYVVPQSANVSCTVPESPDCIMF
                     RVRCTPFASPEASSASLSSSSSVSPVSASGTGSPSFALPLDESFTQLQSVSQMFSSLH
                     DNLRSAKMSWPSNSGSLNDNREALYGSCLRSFLSPSSSSSFGSNSGINSEAEIPPSRI
                     AALREVFYAYGSACIAKKCTSSSPGGGDYYNKIADRQFKKAIELIKYQTKENILGKAT
                     KTSSSSSSNDWLLVSLRTMQLVRRSIDLISEKCIMSLSSALCKQSVTVDQSYDSQKAV
                     LTSFLFNYSVGLYFLPKAALSELASPFEIFEQNRDQFSSILFSKSSKLPGSWLYNVIT
                     GSIFNCFENLCKLLWLLRQFKTINSRRRTLFLGQVKRDMTLIWTTLQTSEIQLDSMPH
                     VGARSLLMYAKYFHQALEILHIKLSDPLIISTNPVISFYMGQFIHIYQSVVQDEAVAS
                     WLKVAPLLIAGCTSKSLENRVFLSKEFHLVARDLDLAFFENVAMEMEERWCVEESGGS
                     TSFDCLLSREGFDHLCN"
     gene            complement(<824546..>825766)
                     /locus_tag="FOA43_000388"
                     /db_xref="GeneID:62193789"
     mRNA            complement(<824546..>825766)
                     /locus_tag="FOA43_000388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920720.1"
                     /db_xref="GeneID:62193789"
     CDS             complement(824546..825766)
                     /locus_tag="FOA43_000388"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776648.1"
                     /db_xref="GeneID:62193789"
                     /db_xref="InterPro:IPR031349"
                     /db_xref="PFAM:PF17110"
                     /translation="MTSKCPSTPLHPDANQEIETPATKIPQELTSALDLGSDSEDDGS
                     NIMHDAHLAKVISKTGGPELSEEEDEMDNNDSLMDSDDLERLDPEVMDAMAPMGEPLS
                     PRPSPSSSDSASGVASSGFFDTDTQKRRTPLNPFGGNSQLASSEPIRIIRKKSRSQGA
                     SKPLSMKQQSRLVTYIDERLMEIQRRFIKYLSAREDPDNEPESTATQFGFSDLAEALD
                     KVITIIWYSIFQVKVVPFVYHYNILTPSEAAVLGYNEGKEVVLEEITPDFLFGQTNYF
                     IRIMGDLVDYVEKFEFVHFDSIHNLLLLFAKLDNIISILIDEYSEDNGPSRTNNQPFI
                     NNTEKIRIDSIISRTKLLVIQKFDVFKKISLYESVDENGKRKQIESDIKKDIQKYELL
                     IGEIYEGILDRTSI"
     gene            <826472..>827986
                     /locus_tag="FOA43_000389"
                     /db_xref="GeneID:62193790"
     mRNA            <826472..>827986
                     /locus_tag="FOA43_000389"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920721.1"
                     /db_xref="GeneID:62193790"
     CDS             826472..827986
                     /locus_tag="FOA43_000389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776649.1"
                     /db_xref="GeneID:62193790"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="PFAM:PF00171"
                     /translation="MMSYPTQVKITVPNGNHWNQKTGLFINNEFVPSSTGETIEVEDP
                     GTGNSICSVYLADKEDIDKAVAAAKEAFDKAWTPLSGKQRGDILYKLAELFRENSSHL
                     ADLEALESGKTKNNNAIGDVLHSADVYQYYAGLAVTAKDGKTIETDPSKLTYTITEPY
                     GVCAAVIAWNFPCSTFAWKVAPCLAAGNTIVVKTSELTPLSALYTCELFKEAGLPAGC
                     LNVTCGSGKTAGAALTEHLDVMKVSFTGSTAVGRQIQVGASTNLKACTLECGGKSPLV
                     VYDDADLEQAVKWAALGIFFNKGEICTASSRIYVQDNIYDQFISKYAKHVEENYIQGS
                     QFTEGVNVGPQVSAAQKQRVMNYIQSGIDEGARLVLGGKTPESLSSSKGHYIAPTIFA
                     DCNQKMKIVQEEIFGPVVTISKFHTDEEAIKLSNDCVYGLAAYVFTKDIKRSQNYIRA
                     VQSGQVWVNITFAADFRVPFGGYKMSGVGRELGEAGMAAFQQTKAVHINLSGHL"
     gene            <828490..>830990
                     /locus_tag="FOA43_000390"
                     /db_xref="GeneID:62193791"
     mRNA            join(<828490..828493,828565..>830990)
                     /locus_tag="FOA43_000390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920722.1"
                     /db_xref="GeneID:62193791"
     CDS             join(828490..828493,828565..830990)
                     /locus_tag="FOA43_000390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776650.1"
                     /db_xref="GeneID:62193791"
                     /translation="MTELRRCFSNSLSINYPSAKLLHIPLADVDRSSISHVNSIVREN
                     QPVDVTFISHSGLSPSIIGSTQEIKKTSSPLSIHKTSHSENLISEGIHPESTVNGTAI
                     STPLDYVSDVISSISQTNETVRHYYDLLQGSFESLRTLFDQSSSLSPKSDAAGNSEYR
                     TIPSLARMLKDRCFVTAYTTVKQTFDQGNFLTPTELEQLILELYPQKTLAYSLVLLYS
                     QKYDITAFDTTTICRMLMLSHSNNDYSMFDKLFTTYLNVSDSTDPSILSIAFKVYLDT
                     DNVSMANQIFNQSVLTEPELPCFLLDKYLKNLKRTTRNVGLCYTAYRLWLSKDFVTWP
                     KTDAFMYKFVRDCGSSEQLDWFMGSLARRNRATNPEILLVDLMLKLRKRTELDLFYSQ
                     GDYQKWVGLLSGSNFLLDEFETKLIDLNLSQGNYQRARTILINSDTEKHFLRRLDKII
                     VHLKEYRQTKTLVSLLSKLHSEAGLKIHEIYPEAIWDSLVKQYPQFSTDITKKFNYFV
                     EQDRSHIFRSLLKGMKVEKDWRSDGAFAYPSKNINGKDICNDLTPLPDNPSIDAIESR
                     IRCGINPTQHKVVKAMRYCENIDQFNRIVTLICHHPKELKMEDLGFQIQLFWKQRQFK
                     MNMPGGRSVRNFLCRAIENMDSLDRATMRNLMELIMMSTKFEDFDLGYQILKYIRVKK
                     LRPACSDDAQRLSYCLVNFFFKQKDFESLVLVLERVKEDPNINLNPFFIKSLVRLKEK
                     YTTLLLEEEDEDPENFRKSVYMKLLNYYDKTICELNKKYRTERSQVEKEVDDDLQFLS
                     SWIRDDLHREQ"
     gene            <831320..>832657
                     /locus_tag="FOA43_000391"
                     /db_xref="GeneID:62193792"
     mRNA            join(<831320..831325,831464..>832657)
                     /locus_tag="FOA43_000391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920723.1"
                     /db_xref="GeneID:62193792"
     CDS             join(831320..831325,831464..832657)
                     /locus_tag="FOA43_000391"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776651.1"
                     /db_xref="GeneID:62193792"
                     /translation="MTILEAIIETIIQGDPSRKVAIDKFLNEKNEDYEKDHKSEVPLF
                     DKTFVKFSEAVIDSSDGVPRCSVCHWEVHGDTCENCGRTILRNPSSTRNSNMIMDDDD
                     IYYEDYDIGTVIMNRIMHNIGGVRPGDFYDDEAAEDGEGDEEDADWDPSVGDMAGYVY
                     DDQVEAVRTGRIRRRSEEEEKEEEEEDDSFVDHRPLNEILNDDDENSSTDIEDDDEYM
                     YVARSREGEDKESDSDSNIDVNIDSEEESPAQHRLERISSDTEEEDLDENETQEQPGH
                     LVNSISWGMGRHPPEPLHESRRIARLVEPEEVEDPEALEEPQEPETSGNNHNDDDTED
                     GESLNYSGRRRSERIVTDTESEDETTSHNRSTLRETQRSRHNGDIINAGRRRKIRRRR
                     RRQRITQ"
     gene            <833008..>837228
                     /gene="PMA1_1"
                     /locus_tag="FOA43_000392"
                     /db_xref="GeneID:62193793"
     mRNA            join(<833008..833011,834458..>837228)
                     /gene="PMA1_1"
                     /locus_tag="FOA43_000392"
                     /product="plasma membrane H+-ATPase"
                     /transcript_id="XM_038920724.1"
                     /db_xref="GeneID:62193793"
     CDS             join(833008..833011,834458..837228)
                     /gene="PMA1_1"
                     /locus_tag="FOA43_000392"
                     /codon_start=1
                     /product="plasma membrane H+-ATPase"
                     /protein_id="XP_038776652.1"
                     /db_xref="GeneID:62193793"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006534"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF00122"
                     /db_xref="PFAM:PF00690"
                     /db_xref="PFAM:PF00702"
                     /translation="MTCLFTIMSSTDEEKKAQQAAATAEKGVGSEKKNSPEGGEDEDE
                     DIDQLVMELQSNQGLDEDDDEEEEEGENKASFKPVAEHFLQTDPAIGLTESEVQQRIK
                     KFGYNEMSEEKQNLFVKFCGYFVGPIQFVMEAAALLALGLEDWVDFGVICALLLLNAG
                     VGFIQEFQAGSIVEELKKTLANTAVALRNGELVDIEARLVMPGDILKIEDGTVIPADG
                     KLVSENCFLQVDQSAITGESLAVDKRCGDPTFSSSTVKRGEALMIVTATGDNTFVGRA
                     ASLVNKAAGGQGHFTEVLNGIGTMLLILVIVTLLLIWVACFYRTSNIVRILRFTLAIT
                     IVGVPVGLPAVVTTTMAVGAAYLAKKRAIVQKLSAIESLAGVEILCSDKTGTLTKNKL
                     SLHEPYTVEGVEPDDLMLTACLAASRKKKGLDAIDKAFLKSLISYPKARAAMPEYKVL
                     EFQPFDPVSKKITAVVESPEGEQIVCVKGAPLFVLKTVQEDHPIPEDVLEAYENKVAE
                     FASRGFRSLGVARKRGEGHWEILGIMPCMDPPRDDTAKTVNEAKRLGLRIKMLTGDAV
                     GIAKETCRQLGLGTNIYDAEKLGLGGEGGGDMVGSELYDFVENADGFAEVFPQHKYNV
                     VAILQERGYLVAMTGDGVNDAPSLKKADTGIAVEGASDAARSAADIVFLAPGLSAIID
                     ALKTSRQIFHRMYAYVVYRIALSLHLEIFYGLWVAILDEMMDINLVVFIAIFADVATL
                     AIAYDNAPYSMKPVNWDLPRLWGMSIVMGIILAFGSWITLTTMFLPKGGIIQNFGSID
                     GVMFLEISLTENWLIFITRAVGPFWSSCPSWQLAGAVLAVDVIATCFCLFGWWCQNWT
                     DIVTVVRVYVWSFGIFSVLGGAYYLMSESEKFDRLMNGKPLNDKPPQRSIEDFMVAMR
                     RVSTQHEKSS"
     gene            complement(<837594..>838289)
                     /locus_tag="FOA43_000393"
                     /db_xref="GeneID:62193794"
     mRNA            complement(<837594..>838289)
                     /locus_tag="FOA43_000393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920725.1"
                     /db_xref="GeneID:62193794"
     CDS             complement(837594..838289)
                     /locus_tag="FOA43_000393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776653.1"
                     /db_xref="GeneID:62193794"
                     /translation="MWFGWGYSGDKRESGKNDISLEVPKDLSDYLKENESSISDREFK
                     SFLKRSQEVEVSKPIPKEEPKKEVNNTAKIEREKLLEDEMSSIHQSPVKPTFKSRYTS
                     TETEIYKRENPTREAVLTNCSEIQYAFMNCLRQKSTIERLTSMAKGNDECSMLADFLS
                     SCMKMQKMALVMFDYSSLDKVEEFETAKNKVDKCFNDHFKNMDDIQDDKNYMAYTKEL
                     KIEREDFHGKFGK"
     gene            complement(<838433..>850828)
                     /locus_tag="FOA43_000394"
                     /db_xref="GeneID:62193795"
     mRNA            complement(<838433..>850828)
                     /locus_tag="FOA43_000394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920726.1"
                     /db_xref="GeneID:62193795"
     CDS             complement(838433..850828)
                     /locus_tag="FOA43_000394"
                     /note="BUSCO:EOG0934002S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776654.1"
                     /db_xref="GeneID:62193795"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR035699"
                     /db_xref="InterPro:IPR035706"
                     /db_xref="PFAM:PF03028"
                     /db_xref="PFAM:PF07728"
                     /db_xref="PFAM:PF08385"
                     /db_xref="PFAM:PF08393"
                     /db_xref="PFAM:PF12774"
                     /db_xref="PFAM:PF12775"
                     /db_xref="PFAM:PF12777"
                     /db_xref="PFAM:PF12780"
                     /db_xref="PFAM:PF12781"
                     /db_xref="PFAM:PF18198"
                     /translation="MIQSEMTSEESESLNTSENHLKVCAIDPDQLIRYIRPVISSLLN
                     VSIEKLTLSTNSTLISEFISSPNERSLYMVRSANDFAILEELTVSPATYSSIVIIAKS
                     QGTIVQERPIEDQLLISELPLEGSAYSENLNKLRCIMSSVVSTYFDVITSAHLNDQLY
                     GTSTPISVAKKKISELISSLEHLQQVVQTPNLLLTADPIVKTLVAENDDIDVIANAHP
                     QLLADSSFLNRLQSIAGDWVKQIQNLVSLSYDLTHGTASEEVKFWESKELALRSVENE
                     LQDPVVLLTLRLLKDTKRFHGGSRLLSDSGIRNSLTTTSKYNQLLRDLPIGELTSSRD
                     LVKIKEAIIAIFNHIKKLKVIQYPIDRAVLLVQVITIEANDRILEILKQMKLMDTSYN
                     EFTQINLQACGVLEVIKECIKKFTVLARELLRKRSERFMVVKVENSDCLRERLDKIKG
                     IRDEYEEISISIHQLSKSMKIDVGTLLSGVYDVLINDDLLDITRAGKRRFASIVGVYT
                     EMIEAVEYKIADKLRDALKLSFSNTNEMFTIFRDFDFLLKRPSIRNSVQDYQDQLVNH
                     LQADLQSLESQFDLRQQSWRILQLRNLPPFTANLVWIQQIQVGIQELIEKLEVALTKD
                     WILYPEGKKIGAQLDLISGKLNIQGIFNDWAHRAIDHLRSPIMNERILIVQKMDKWLR
                     IEVNFDNQSVNLSDEVDSLETLGFSVPRSVHSYAQQLVFIYPYTINLLQSVAGYENMM
                     EQVDSLGELTVLMKPLLEPALSSVKILLKECWSNIYKAHDLISSNITDVDEVRTLKTV
                     EALGPEIVSITRKFELLQNIRPSFVNTLQKFNSVDYDKQCIASLIISVQKLVDTLVAN
                     GFQNIEELVHMLNETMTCMLIERCERRLDNLSREFSLDSHIHSIVPCVKHSILFHDLS
                     IIVHPQLEFSKSRWIRLLNQNMEVITSQKLLTGKHYDVNVVASTRSLDNLLDITSRLS
                     AKYNDIAVKIGQLFEVASRYTLQWIELQYLWELNFDDIEATIGSELTSWLDAFKDLTT
                     SRNLVDTVDSKHLLGPLVIDYSLVQPRVNAQYDVWQRKMAQKLATVLGKRMSITNELI
                     TKLRQKLESVSVNFTSGSSTVCLCSLIYTTRRSLDNIEVALGTYKAGNDVLLQVRFKF
                     PRDWVYFKQVSDNCSSFLELIDDRFGRVNSNKSIVCSRVQEKASELSGTVIQARKAWL
                     GIINKLNIDVATSEIDKFERMFDELKHQREMIFNSTKLLGLDVIIDCDIGDVDCQVKK
                     YKEIWSCIYALVGKISVIKSTSWEDFSPRTLRLALEDMLAFSRETPIRIRGYSAFSDI
                     QSEIRGMIHVVPILASLKVDAMTFDHWNRIFENLKIMHVPEKLTLGDVLDLNPAKHIK
                     FLRTVVQEAQSEKLLADSLKEIEESWSSITFELQPFGNDYLIVKSWGSLFDKVEADLN
                     SLVSMKSSPLVGNYRETITILENKIGKLHDILDIWVVLQKDWIYLFGIFQKNEDIRRL
                     LTIESTRFDTVTSELYLILRSAYRVKSVLDVITVPGIAHTFEKTLQVFSKTKKSLSGY
                     LEKQRELFPRFYFVGNDNLLEVVGNASNVGVASRHINKMFPGISSLEYDSDRSMIIGI
                     VSPEYEHVLLHASITITHPCSASDWLSSLEIAIKKTIFHLLVPSLKKLNTLWEDTKET
                     LFLSWLKNLPNQILLVSLQVLWTSLTEAAIANGNGLKSLAVKYDELLILLAKLVFEKL
                     TALEQLKLENVTVEALHQRQALEELLSAKDVSLLSFSWISQQRYYFDSEHRDFLESLV
                     VKQGNASFFYGFEYLGCPRKLIYTPLVNNSFCAMTEALNQNFGASLSGPAGTGKTESV
                     KALGQNLGLMVLVFCCDETFDFYAVTRILVGVCRTGSWGCFDEFNRLTEEMLSAMSTQ
                     IEKIEGFLGSDGSEEIDLLGKKLKVNKKAGIFITSNPAYAGRSNLPDNLKSKYRSFAV
                     VRPDTLVIAEAILISQGFVHAKYLAPRAVSVFADLESKSSKQSHYDFGLRALKATLLN
                     CGKIKRLHKGKDGINHGQTFESQIIVKGMHNIVLPRLIPQDEPVFFDSIEVFDIEYNA
                     FDANEELIKDIGLAAERMSIQTDDKWLSKCLQLYEIWKAHQGFIMVGKPGSGKTIMLK
                     CLMQALKESTGSENLWYTIDPKALTKEELYGSLDYATNDWTDGVLTSIIRSVNENVRG
                     ESTKNVWIILDGDIDPVWVENLNSVLDDNKILTLPNGERLIVPDNLRLVFEVERLDYA
                     TPATISRCGVVWFADSMFDLAGNYAVLVHEFQHSFIDNEEAYNSKLIQAGLSVAELKT
                     NFAKNICSVISSEILQNIWNFSKSYEHVMASDLMRCLETFMVLLSRKFHLFLDFLVEN
                     ISLSNEDYSEVFLKMAVVSLAWAFAGDIGLNDRKQFCNQLISLYPLIRLKDSLNGSLV
                     YTDVSFETSGWIDFQSRVPIISLEPQMVIQPDTVIPTLDTVRTEDLIFSLLEQHRNVV
                     LSGPPGAGKTMLLMSALRRSTKFDFTGINFSKETSPGIVLKTLEQHCVYKSGPNGVVL
                     QPSNPDKWMVVFCDEINLPSSDRFGTQKVIAFLRQLIVRHGFWRSRKNDWVHISRIQF
                     VGACNPPTDPGRNKLSDRFLRHTSVLMVDYPGEESLKQIYTTFNKALLKMVPDLQAYA
                     DALTTAMLEVYGRFRIKFDRKVRAHYICSPRELTRWVRGMFHSIQNSTSLTVDGLIRL
                     WAYEALRLFSDKLEFKEDRNWTLSMITDVASECFPYADLSIVLRQPIMYSDWLSFSYQ
                     SVNIVELSKFVDGRLRVFCEEEANCSLVLHGDMLEHILKIDRALKNSQGHLILVGPSG
                     SGKTTLTRFVSWMNGFKVFSLSVSRNYSLEDFDKTLKELMIRTGSKGEKLCFIIDEST
                     ILESAFLERMNTLLANAEIPGLFEGDEYSSLMETVSRASQEAGLYLSSDEELYQWFTQ
                     QVSANLHVVFTMSNPYLPNAPRIFSSPALFNRCVLIWMGNWSAGSLLTVASGFLEKLP
                     LDKSDYEPPKNSTFKSYRNAVVNALIDAYTSMNLHRNNSQLSIQASPLKFISLMKNFS
                     KIFIQKEGELMQYHRHIQIGLDRLKETLLSVKDLNRSLQAKKEELDQKDQEAQQMLDK
                     MLTEQNEAERKEEASMEIRALLESQDKKIKERRETVYLELSEVEPLIEEASRGVKNIK
                     KQHLTEMRSMNNPPEAIKLTLESVCVFLGFDVRTWRDVQNVIRKDDFIARIVEYDTER
                     QFSKELGGYMNKHYMSNSIYNYESVNRASKACGPLLLWIQAQLRYAMILEKVEPLRKE
                     MKHVEKSSLETKNKLIAIDGMVADLRESIKDSKLKYSQLIRDTENIKTLMSNVKLKVA
                     HSIRLLESLSDERTRWQSSIVEFEQQRQDLIGNVILVACFMTFAGPHNEKVRQSLWTT
                     WMSKLTKLNINFDQYLSFTRSIANVGEVLKWERMGLPNDDLFMENVAGITSEVSDGYA
                     FIIDPTGLMIDFLEKYTVPKKLVITSFLDKDYLGQLKNCVRFGGSILILDAEYYDPAI
                     NRVISYDTQLTGGRVLVRIAGESVDMSPDFKLYLHTKDPSIQIIAFVASRMNVFNFTF
                     TATSLVKHGMNMTLKSERPELNKKRLDSIMANSELKQKLEGLETDLLELLNNATESIL
                     DDAELTKKLELIKKESSTIKFKIAESKNIFNEVSEITDSYQSLARLYTFFCLMVAELW
                     KLNLVYLFSDNYVTSILQEVLAIHKGKTIDTITLQFVKRIYSCLSISLLQVDRPLLGL
                     LVYNFYRNCLYNPNHEERRFVTEGDDELCGLANDYSRLVRDDATVRLPDVGVQSFEDA
                     INKSSLFVLRALEGFASFKVISHGKSVGKQVVTYSVGSNDSLEVATKLLKEACKKDQW
                     VVIENVDLSNELLDLIPKLYDSLRKHKDFKLFLACSVNAKLTNILCKMSKQVVFETAP
                     GVRLILEDGLLAKDGALSILQDSLTPESKKIYFLLAWLYSVLKERLRFVPIGFEKSYE
                     FNEYDLAFSKVFIDESLANCEKILGTAVTIDTIPFDWIARFIGRIVFGGKIDKNSDLQ
                     FVTSLANKVLSLDCFEGRSNLLLTNSYDLRSPNDDFKGFISKLPEVEPVAWVGLPENA
                     DLVLKQKQCKRVFDKAKMLFEEVVGVI"
     gene            complement(<851015..>852655)
                     /locus_tag="FOA43_000395"
                     /db_xref="GeneID:62193796"
     mRNA            complement(<851015..>852655)
                     /locus_tag="FOA43_000395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920727.1"
                     /db_xref="GeneID:62193796"
     CDS             complement(851015..852655)
                     /locus_tag="FOA43_000395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776655.1"
                     /db_xref="GeneID:62193796"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MSAISDQESFDSRKSLANDQHTPTRTPSANVSPKACWKYLRTRL
                     STLLAIPAKAKNKKNKTLNPYEAIKAMNRHQWNLFSHGFLAWTVDSMDFFCVSVCVSD
                     IAKDLNTGVQNITWGITLVLMLRSIGAVIFGYCGDRWGRKWPLCVCYFLFVVLEIGTG
                     FVTNLSQFLAIRSLFGIAMGGCYGLAAATALEDAPQVSRGFLSGIFLPGYSLGYVLAT
                     AFFRAFETTSFTWKALFWFSAGPPFLLLLWRLTFGELDYFKEMQEAKRSHNLRVKQVK
                     ESRELGEQTANDDEGLTEITFSSELKETFRTEWPLMIYLVLMLSGTNFMSHGSQDLFP
                     TMLKKQAMLSRNALTITNVVVNLGGCVGGLFWGQISEFLGRRMTVLCCAIWGGAFLYP
                     TFFKHTEQYIIPCGFLLQFAVMGAWGVIPVHLTELTSRSALRTMISGTAYQLGNLASS
                     ASSTIEAKIGAQFPLPSLGPDAYDYGKVMCIFMGCVFGYLLIIMFFGPERFHTSIKTE
                     FMLEEEDVDSGYEIDRILSPVPRPQFDEKIWVTHTERK"
     gene            complement(<853873..>855600)
                     /locus_tag="FOA43_000396"
                     /db_xref="GeneID:62193797"
     mRNA            complement(<853873..>855600)
                     /locus_tag="FOA43_000396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920728.1"
                     /db_xref="GeneID:62193797"
     CDS             complement(853873..855600)
                     /locus_tag="FOA43_000396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776656.1"
                     /db_xref="GeneID:62193797"
                     /db_xref="InterPro:IPR001810"
                     /translation="MITLEGLPDSILELVIDLLPQQAKFNLCLVNYKFYQVVQPELYE
                     NLIFTISSIIPSKSDFRSSLATIIGGSSNPLVSTESQRKLYNVRQEVLLQSLSINEQL
                     AKFIKRVIVYTGKEEGVFSSNSINDKNDDDNAAFPAANLKLLDLIKKRSVNLVQFTVI
                     GDTSRGIAGLTKEQILLLPRLERLDITDLTYLDCLTDSIKTLVIHKLTTNRFDLKTSK
                     PDIINQIGRLDSLIINDEDAQVRFLQYLIGDNPKLTFKFKALRLLHYHGFSDYNVIST
                     RLALQLLNYVDRETLKSLELVMGCDHITCDCLKELVNNITVKKDFDLTRMAIQQFTVH
                     KDHNYSEKFDFYVSDLLSKMKHRSSIRYLCISYDTPNDFNIGNGIKGNGIEGNWLKRK
                     RLFAATLPKLTGLKTLVLPHFLENAAGYEQIISDLLWNGCKCSHCKDYLSLFDYYIMH
                     HQYYNSLDGYMTDMISPILFGSAGRVMASRVIEDFNLNALKYPPLDTYWNFHKGNGIS
                     HFKSQDKNDCKFNESCFKPLTKCISHFFLEYVESYGSSLPSLNLVVMNGEYFDRVEGK
                     SSEWICEYA"
     gene            <857932..>858909
                     /locus_tag="FOA43_000397"
                     /db_xref="GeneID:62193798"
     mRNA            <857932..>858909
                     /locus_tag="FOA43_000397"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920729.1"
                     /db_xref="GeneID:62193798"
     CDS             857932..858909
                     /locus_tag="FOA43_000397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776657.1"
                     /db_xref="GeneID:62193798"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="PFAM:PF08543"
                     /translation="MMTRSKTPLTIPKQADRVLSIQSHVVHGYVGNKAATFPLQTLNW
                     DVDVLNSVNFSNHTGYGSWKGHSCTGEEIEQLFEGLEGIHTHYEAILTGYIHGSSALM
                     CVGQKCISIKSSYPETLWLLDPVMGDEGQLYVSEDAIPIYRDILCCRLVDIITPNQFE
                     LELLLDVKITSLESLKVAVNLVHKEYNVKYLVISSLTLTAEDLGLGSAKKGKMYSCIS
                     SAESGKIVFFEIDKYDSYFTGVGDLFSALLLDRLYKTRDVIISTNQVLTIMSKVLYVT
                     RELCLKDLGKEVKAKMGDSRSMKECELRIVECMDMYSEDDCDYTPFELS"
     gene            <859297..>860949
                     /locus_tag="FOA43_000398"
                     /db_xref="GeneID:62193799"
     mRNA            <859297..>860949
                     /locus_tag="FOA43_000398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920730.1"
                     /db_xref="GeneID:62193799"
     CDS             859297..860949
                     /locus_tag="FOA43_000398"
                     /note="BUSCO:EOG093422B3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776658.1"
                     /db_xref="GeneID:62193799"
                     /db_xref="InterPro:IPR002650"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR024951"
                     /db_xref="InterPro:IPR025980"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027535"
                     /db_xref="PFAM:PF01747"
                     /db_xref="PFAM:PF14306"
                     /translation="MLTPHGGVLQDLIKRDASKNKQLLIEAANLKSIVLTERQICDLE
                     LLLNGGFSPLTGFLNQKDYQAVVHKMRLTSGVIWTIPINLDVSQSVGSSLKSGERIVL
                     RDPRDDAPLAIITVEDVYKPDKVTEAKEVFRGDPDHPAVRYLYDVAGEYYVGGAVDAI
                     SLPKHYDYTDLRKTPAQLRSEFASRHWTRVVAFQTRNPMHRAHRELTVRAARDKLANL
                     LIHPVVGLTKPGDIDHHTRVKVYQEIIKKYPNGMAQLSLLPLAMRMAGDREAVWHAII
                     RKNYGATHFIVGRDHAGPGSNSKGVPFYGPYDAQVLVKKFSKELEIEMVPFRMVTYLP
                     DENRYAPLDTVAENTKTLNISGTELRLRLKTGAAIPDWFSYPEVVKILRTYHPARPHQ
                     GFAVYLTGLPYSGVSALGYALQATFNQFNGRRHITLLDGVNIPRDTYPVVISELVRAG
                     AGVIVANSEEKDKEIPTIEQIAELQKSVSKAGSFILVSVNTPLEQCLKNDRFGFYDEH
                     PEAKDFKAPENVDISADLSDDGIYEAIQKVVLYLEEQEFYQF"
     gene            <861784..>863184
                     /locus_tag="FOA43_000399"
                     /db_xref="GeneID:62193800"
     mRNA            <861784..>863184
                     /locus_tag="FOA43_000399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920731.1"
                     /db_xref="GeneID:62193800"
     CDS             861784..863184
                     /locus_tag="FOA43_000399"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776659.1"
                     /db_xref="GeneID:62193800"
                     /translation="MPSARFYYIDGKISTCRRCKRKRTLDEPPEHLQFKTCYRCRMIE
                     RDQKKVNQARRRGSSSRLDSPSLSHSHHAHRDIASSYYTRGGPTATSHAPAVFNPIGA
                     ANSVGDVGVVNRNTSSSLLTNGLNVPDVSTMNSDNLININLANSFARGNSAYVSKGNG
                     AGIVTLDGASISAAAAAAAAVPSTFNALNVIPLGNAGDGSVAHGRVSSLTPSIFNEGL
                     YSFNIRSIDSKSNPLSLPQEQQTLIQLSFLTKLHYDQRYTNSLQYSALGLRADQCVNC
                     SRNIATPNGGRQLCDGCLSRPSIVHIFNYYLTVLKLNKRQDLYKVIFVTRISVDNLLK
                     SSLSADRSRSNIINKLYDRFIDPINNVTGAEFIFMKDDIDHETNGNSEKSSNHARIFP
                     VIKRFLKCAKDHSSLTTVKEENIDPEALKLEGFKENIYVQSSKLTHRGCNSLIFLDYD
                     MRNGDLMICFSHQVHQ"
     gene            complement(<863300..>864436)
                     /locus_tag="FOA43_000400"
                     /db_xref="GeneID:62193801"
     mRNA            complement(<863300..>864436)
                     /locus_tag="FOA43_000400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920732.1"
                     /db_xref="GeneID:62193801"
     CDS             complement(863300..864436)
                     /locus_tag="FOA43_000400"
                     /note="MEROPS:MER0000358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776660.1"
                     /db_xref="GeneID:62193801"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="InterPro:IPR034193"
                     /db_xref="InterPro:IPR036852"
                     /db_xref="PFAM:PF00082"
                     /translation="MEALCIQDDQIKAFNHVRSGIRKVFSFGKFEGIVGEFTNDVVQR
                     LTDNPLIERITPDIVVSAVDYTVQSDTPAHLVRLTQENAVDKEEDSEYFYDTAHLGQG
                     VNVYIIDTGVFVEHPEFEGRAILGPNFSEDIRHLDYVGHGTHVAGVVASKTYGVAKKA
                     RVISIKSLDRFGLGSLSSVIAGLEYAVNHRKQEDVPGVANLSLGAARSSILDSAIEAA
                     VDSGMIVLVAAGNSNMDACRTSPAGSSYSLTVGAIDDKKDRIAGFSNWGRCVDIFSSG
                     VDVISLSNNPFDYSQIRKMSGTSMASPVVAGICAILLEKGISTNAIRGELFKLAIDGA
                     IPRTSLLLRPGSPNMIASTGVRENMLMGRQVINSTIHMKSSATV"
     gene            complement(<864928..>871620)
                     /gene="ACC1"
                     /locus_tag="FOA43_000401"
                     /db_xref="GeneID:62193802"
     mRNA            complement(<864928..>871620)
                     /gene="ACC1"
                     /locus_tag="FOA43_000401"
                     /product="acetyl-coenzyme-A carboxylase"
                     /transcript_id="XM_038920733.1"
                     /db_xref="GeneID:62193802"
     CDS             complement(864928..871620)
                     /gene="ACC1"
                     /locus_tag="FOA43_000401"
                     /codon_start=1
                     /product="acetyl-coenzyme-A carboxylase"
                     /protein_id="XP_038776661.1"
                     /db_xref="GeneID:62193802"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013537"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="InterPro:IPR034733"
                     /db_xref="PFAM:PF00289"
                     /db_xref="PFAM:PF00364"
                     /db_xref="PFAM:PF01039"
                     /db_xref="PFAM:PF02785"
                     /db_xref="PFAM:PF02786"
                     /db_xref="PFAM:PF08326"
                     /translation="MSFTSKQKELPANFIGLHTVENAEPSSMKDFVIEHEGHTVIRKV
                     LIANNGIAAVKEIRSVRKWGYENFGDEHIIQFVAMATPEDLEANAEYIRMADQYIEVP
                     GGTNNNNYANVDLIVEIAERTNADAVWAGWGHASENPILPERLAASPRKVVFIGPPAS
                     AMRSLGDKISSTIVAQNAHVPTIPWSGSGVDDVVVDEKTGLVSVDSITYAKGCCEGPE
                     DGLEKANKIGFPVMIKASEGGGGKGIRMVDRQDDFVSMYHQASEEIPGSPIFVMRLAP
                     HARHLEVQLLADEYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPETFHQMELAAIRL
                     GQLVGYVSAGTVEYLYSHDDEKFYFLELNPRLQVEHPTTEMISGVNLPVAQLQIAMGI
                     PMHRIEDIRLLYGVDSHTSTPIDFEFKNPNSLKTQRRPVPKGHCTACRITSEDPGEGF
                     KPSGGTLHELNFRSSSNVWGYFSVANQSSIHSFSDSQFGHIFAFGENRQASRKHMVVA
                     LKELSIRGDFRTTVEYLIKLLETPAFSGNTMTTAWLDELISKKLTAERPDRIVAVICG
                     AVTKAFLQAEGCRKEYVASLERGQVPSKDLLKTMFNVEFIYEGSKFKFTVAEAGQGIY
                     TLFINGSRCVVNARYLSDGGLLIALGGKSHAVYWKEEIASTRLSVDSKTCQLEAENDP
                     TQLRTPSPGKLTKYLVENGGHISVGQSFAEVEVMKMCMPLVALENGTVQLLKQPGTTV
                     KAGDILAILALDDPSKVKHAVPFEGTLPKVGPPIVEGTQPVHKYYKYFGILNNILAGY
                     DDQVVMKSTLDGLMAVLRESHLPYSEWAHKISALHSRLPSKLDENLEELIERSQNRGA
                     EFPARQVLKMFEKARSEKDTDILIFSQTISPLVQIAEAYKDGLKCHEYQVFADLLNEY
                     HRVEFLFSARNARAEEVILKLREEFKDDLNQVINIALSHSRIAAKNNLVIAILDAYQA
                     VLQESPEAVAAFKPVLKKLVELDSRSTAKATLKAREIMIQCSMPSIKERCDQLEHILK
                     SSVVNTKYGDSTAAEHKMPDKAVLQDVIDSKYTVFDVLTQFLTSKDPWVAAAAAEVYI
                     RRAYRAYSVSKVKHEVSGTSTFSSCAPVSLWSFQLPSLSTSQYNAIPAALRKASSSNV
                     SSSEVMNRAVSVSDLTFMINKNDSQPLRTGVLVSAPHLDDAEDALSKGLDAVKHIADK
                     NGDDLLNVCNVMVNSTDGFQSQDHVLTRMKEIVDDNRADLNDAKIRRITFVLGDKAGS
                     YPKYYTFKTSSSFAEYKEDQVIRHIEPALAYQLELGRLSNFSIKLIPTDNRNIHVYEA
                     VAKNSAGVDKRYYTRGIIRTGSIRDDITAPEYLISEAHRLISDILDTLEVLDTSNTDM
                     NHIFINFSAVFNITPADVESAFGGFLERFGRRFWRLRVTGAEIRIMCTDSDTGVPFPL
                     RAVINNVSGYVVKSELYVEERDSNSEWRFKSIGAPGSMHMRPISTPYATKEWLQPKRQ
                     RAHSLGTTYVYDFPELFRQALSDQWKKTNPNMKFKDDFLTYEELIFDESGDLTTVARE
                     PGANTIGMVAFMVTAKTPEYPKGRQLIIVANDITFKIGSFGPKEDAFFDKVTKRAEKL
                     GIPRIYLSANSGARIGMAEELLPFYKVAWNDPAHPSHGFSYLYLTEEDKVELEKDGKW
                     SSVQTEIVVEQGETRYIIKTIIGAEDGLGVECLRGSGLIAGTTSRAYKDIFTLTLVTC
                     RSVGIGAYLVRLGERSIQVEGQPIILTGARALNKLLGREVYTSNLQLGGTQIMYKNGV
                     SHLTADDDLSGVQKIMEWLSYVPAKRDIPVPVLVDPKDGWDRPVDFKPVVGETYDVRW
                     MIEGRDTEDGFQYGLFDKDSFQETLSGWASGVVVGRARIGGIPMGVIGVETRTIENLI
                     PADPANPGSTEMLVQEAGQVWHPNSAFKTAQAINDFNHGEQLPLMILANWRGFSGGQR
                     DMYNEVLKFGSFIVDALVGYKQPIFTYIPPTGELRGGSWVVVDPTINPDMMEMYADVE
                     SRAGVLEPAGLVGIKYKENKLVKTIDRLDDQCREWSLRLLSAELSEEEKTEVTEKLNA
                     RHAHLLPIYRQVSIQFADLHDRSGRMLAKGAIRKELEWTEARRFFFWRARRRLNEEYL
                     IKRIAEQVTTSTRLERVARLNSWLPSTLNTENDREVAKWIEDNHKTLETHIKKLKGKF
                     VKQTLARLFKTDPKHTSEGLSEIMSLLPAEEKKKILKELK"
     gene            <871895..>872137
                     /locus_tag="FOA43_000402"
                     /db_xref="GeneID:62193803"
     mRNA            join(<871895..871898,871914..>872137)
                     /locus_tag="FOA43_000402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920734.1"
                     /db_xref="GeneID:62193803"
     CDS             join(871895..871898,871914..872137)
                     /locus_tag="FOA43_000402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776662.1"
                     /db_xref="GeneID:62193803"
                     /translation="MYGCVMTSKRMLRLEETFEQEKIQMALTFAKKLKLDAQPENKVV
                     ELIKNRPHQQQDNRKIEKADAMHSMRKNVNN"
     gene            <873834..>874865
                     /locus_tag="FOA43_000403"
                     /db_xref="GeneID:62193804"
     mRNA            <873834..>874865
                     /locus_tag="FOA43_000403"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920735.1"
                     /db_xref="GeneID:62193804"
     CDS             873834..874865
                     /locus_tag="FOA43_000403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776663.1"
                     /db_xref="GeneID:62193804"
                     /db_xref="InterPro:IPR007213"
                     /db_xref="InterPro:IPR016651"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF04072"
                     /translation="MHYKLMSIESEFRRLAVSRNLRKTFFNLVDYKASDNGNNIPRFG
                     TPHVPVGALKSPVINRGTWLRTSSISMIIDDFMKQNEGENVQILSLGAGNDTRAFELL
                     PKYHKTLQYFELDFPDSCKVKKFTILTDKRLYAKLFVEASANASQLPTDYLSFSSSDG
                     KLDSNCYHLIPSDLRKLRKEMIPANFDWTKKTLVLSECCICYMGTEESNQLLEYLRKW
                     LISGLFVVYEPMGGQETQDSRYGEVMVRNLKTRGIEMPNLMVYNTIEKQEARFKGFGI
                     DLKDLVVCDLKFIYYNWIVRNSIMRISQLEMLDEIEELNLINSHYTLIVASWGNAFNC
                     KLRRQLQQH"
     gene            complement(<874910..>875608)
                     /locus_tag="FOA43_000404"
                     /db_xref="GeneID:62193805"
     mRNA            complement(<874910..>875608)
                     /locus_tag="FOA43_000404"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920736.1"
                     /db_xref="GeneID:62193805"
     CDS             complement(874910..875608)
                     /locus_tag="FOA43_000404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776664.1"
                     /db_xref="GeneID:62193805"
                     /db_xref="PFAM:PF02466"
                     /translation="MWFFGNDTKTENGETLKREQEQVSNEPSKRSEDVSSILNTTDFD
                     PSKLHPLAGLDKDIEYLDLDDEKLNSLEGSSNGILASRGWGDDMCYGAGTVYVLGLGL
                     GGLKGLDEGIKHLPHPKIDPVTSALRPVPFKLKLNTVLNQVTKYGPHAGNNAGVLAIM
                     YNIFDSSLDNIRGKHDDWNSLASGFLSGALFKSTSGLKAISISSTLMTIAAASWCGLK
                     RLISRRGGRNSFGA"
     gene            <876413..>876997
                     /locus_tag="FOA43_000405"
                     /db_xref="GeneID:62193806"
     mRNA            <876413..>876997
                     /locus_tag="FOA43_000405"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920737.1"
                     /db_xref="GeneID:62193806"
     CDS             876413..876997
                     /locus_tag="FOA43_000405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776665.1"
                     /db_xref="GeneID:62193806"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="PFAM:PF00892"
                     /db_xref="PFAM:PF06027"
                     /translation="MESLSKTKVISIGLSVLGIILVTSNDDPVTNQASTTDIIYGNLL
                     ALAGALCYGIYSILLKLKVKEDSRIDMKLFFGFVGLFNFLFLWPPLIIMHKLGYEKLE
                     LPPNVYVYMIILVNCLASFLADFLWARAMLLTSPLTVTVGLSMTIPVAMVCDFVFKFK
                     WNSPIYMFGAALICVSFYMVNKDEKVDEIYQRND"
     gene            complement(<877011..>878146)
                     /locus_tag="FOA43_000406"
                     /db_xref="GeneID:62193807"
     mRNA            complement(join(<877011..878044,878143..>878146))
                     /locus_tag="FOA43_000406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920738.1"
                     /db_xref="GeneID:62193807"
     CDS             complement(join(877011..878044,878143..878146))
                     /locus_tag="FOA43_000406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776666.1"
                     /db_xref="GeneID:62193807"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF00085"
                     /db_xref="PFAM:PF04756"
                     /translation="MIFLIVASVVQAALPKSLLRQRASESDSNVILVQSDEFEPVFNR
                     SNDRDYFMVTLLTASHAEASCDLCKSVQPLFEEIASTVGRKEPNADIFFLHIDAHENL
                     ANLKEYGIRSVPQLWIYPPFQLIYKESSDIDSTDDYDSRQIFPKNLNITSEHYAFTLS
                     NEIPESVLELDLAMFISHICHVNIQIDKGIEMQTLVKSFVAFTIVFRLLKKKGRKVLD
                     LLSDWRLYCGLSIILIYINMSGLNFCIQRGVPFLSRSSTGNIQLMTGGVQYQQGVEIA
                     ISIAFQVSFTLFLVVLLLSPEYLEEGNKGLAVTISVVSIFLTYNTFTTAFLAKDHGYP
                     FNVVEMFHQKL"
     gene            complement(<878249..>879223)
                     /locus_tag="FOA43_000407"
                     /db_xref="GeneID:62193808"
     mRNA            complement(join(<878249..879135,879217..>879223))
                     /locus_tag="FOA43_000407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920739.1"
                     /db_xref="GeneID:62193808"
     CDS             complement(join(878249..879135,879217..879223))
                     /locus_tag="FOA43_000407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776667.1"
                     /db_xref="GeneID:62193808"
                     /translation="MLDNSSHSTKHGFRLPKTPRLGLGMSSNTHSTQLTPRTLTDGGF
                     KGELKRSEVLETQIREISQTASQAYDKIDDLKTRNNMLEEQVAQQKRLIHNIMGELDT
                     AKDDAEKVESLVSEAREQAKLARQAQAQAEMIAEETQERLKSMLRDSQSSNGSASSGN
                     AANMNANFSNMSLTTRGTPATSVYTSPNSTIEIKKAVQPPCVDGTDVDKVAHENNIID
                     KQQHCITELRARVKELEVQTDRDDKEYQDTLNRLKSSLLAISANRKFLGSRLEVRDDE
                     EYQRRPKYFGHEEGKTYVLKL"
     gene            complement(<879375..>880928)
                     /locus_tag="FOA43_000408"
                     /db_xref="GeneID:62193809"
     mRNA            complement(<879375..>880928)
                     /locus_tag="FOA43_000408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920740.1"
                     /db_xref="GeneID:62193809"
     CDS             complement(879375..880928)
                     /locus_tag="FOA43_000408"
                     /note="BUSCO:EOG0934259Y"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776668.1"
                     /db_xref="GeneID:62193809"
                     /db_xref="InterPro:IPR007238"
                     /db_xref="InterPro:IPR016558"
                     /db_xref="PFAM:PF04104"
                     /translation="MFRKVRRRTDGRRNFDSNPSKGFTDDLSRYPRRLTFYRMPPLEE
                     ITLEEFETWAIDRLKVLLEIESCQSRGKKFKETSSIVTPILSKLLPLNPPSKESSSLY
                     QERKKDHYSHFILRLAFCRSDELRRRFVKAETALFKIRYQQLGLQEQREFVDSIDLPW
                     EEVSEGEREQFRDQLLSCSYNAIRSTLMQTVDYQRTQHVTDQQISAYLDTVKFYRLPF
                     EYVPELVSTRQSFLHLGYAYVGEFQRLSLIATEFSNFLMEQLQATMKALPTLDEDDRL
                     VPVLNNLSKGYVAIDYKLNGYGVGEGDGSDSNDMINAGNVGQFVQDFPLCMQILMEGV
                     QQNHHLRYSGRQQLSLFLKGIGLNAEEALKFWQQQFTAMGPGSMSVEKFNKDYRYSFR
                     HNYGLEGGHIHYKPWDCRTIISKPGPTKNEYHGCPYRDLHRDELSTRLQQLGLEDDTR
                     LGEVLELSERGEYQTACTKVFELVNRERIDSCLKQGVKVDESSIVHPNQYFDRNRYLD
                     EHTEPTKTK"
     gene            complement(<881087..>882693)
                     /locus_tag="FOA43_000409"
                     /db_xref="GeneID:62193810"
     mRNA            complement(join(<881087..882499,882688..>882693))
                     /locus_tag="FOA43_000409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920741.1"
                     /db_xref="GeneID:62193810"
     CDS             complement(join(881087..882499,882688..882693))
                     /locus_tag="FOA43_000409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776669.1"
                     /db_xref="GeneID:62193810"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /translation="MSNVLQMDDDYSSGHTSFALKHIFHNAADGHTHKRLDIDDQLLD
                     SLNIKSDEPLSVTQQPFTHIFDMSSDTQSTIRMANRDPDFVESYLNYAFEARNESFIH
                     LDWSEEQISIPNITDPETILNLAEMCSDAYAKLPSDPSWRDVGDHYKLGRGFGWKKGG
                     VRGHVFVEKVPKLEGRRPPKVIIALKGTSASGIVISDDMDATGDDGETVDGDKLNDNL
                     LFSCCCARVSSLWTTVCDCYEGSTYQCDETCIEREFRRPDRYYKAALDIYRNVSSEYP
                     RSEIWITGHSLGGALASLVGRTYGLPAVTFESPGERLPTTRLHLPVPPGLPEEYEHIW
                     HFGNTADPIFLGICNGASSSCNIAGYAMETQCHSGLVCTYDSVKDLGWHVNMLNHRLK
                     NVIDNVLSVYNETAPCVRPPPCMDCYNWYFVDHSDEKYKAPIKSSSTPAGSTPTDDPS
                     GGKCLKRTWYGRCYKWEGDGPE"
     gene            complement(<883488..>884567)
                     /locus_tag="FOA43_000410"
                     /db_xref="GeneID:62193811"
     mRNA            complement(<883488..>884567)
                     /locus_tag="FOA43_000410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920742.1"
                     /db_xref="GeneID:62193811"
     CDS             complement(883488..884567)
                     /locus_tag="FOA43_000410"
                     /note="BUSCO:EOG09343V1A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776670.1"
                     /db_xref="GeneID:62193811"
                     /db_xref="InterPro:IPR007304"
                     /db_xref="InterPro:IPR038511"
                     /db_xref="PFAM:PF04177"
                     /translation="MGDLTLSEEFDAVVERLNNFHRDGNRAAFVKQYNDRLDQLKDLD
                     NKVDQLHLFSSNEPLDDISTDNLKFLAIPYHLAHFMEQYGGVRSDGAPDKRSRLVNLL
                     HADSIYMGFLHRAQDYGILTKAQSELLDSLKENNQLELSQIEIRDPVLRRQRKIENYK
                     KEKAFREALEVLKDKESMKEMDDEVVRNILQEQLQYYALKSFEALEGNVMELELLKNA
                     TRFEEQEVPTENDSDRERKKQDQKGKFDKGFTDKVESIDNPVFSDKGRVLRPFTIVPA
                     QTREQIRTGIQGTGQKLPTMTVEEFVDHELKNGGMVSNTNEHEDNDDKDNDQYQDKET
                     YKQRELDEFKDYHAKGSGNTKGNMG"
     gene            complement(<884713..>886464)
                     /locus_tag="FOA43_000411"
                     /db_xref="GeneID:62193812"
     mRNA            complement(<884713..>886464)
                     /locus_tag="FOA43_000411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920743.1"
                     /db_xref="GeneID:62193812"
     CDS             complement(884713..886464)
                     /locus_tag="FOA43_000411"
                     /note="BUSCO:EOG09343SV0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776671.1"
                     /db_xref="GeneID:62193812"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="PFAM:PF00320"
                     /translation="MSTPICKNCKTQTTPLWRRDESGQVLCNACGLFLKLHGRPRPIS
                     LKSDVIKSRNRVKHNNSKSGPNTPELKAKDSRAKFSSKQYRPKSSRSGSKRNSNGSNV
                     TSSQSENGSNGTPHFGSMAAVTGSAAATTTGTTAGATGANMGSPANGKSPGLLPLLPR
                     NQNGITSPVQAYAYGNTNSWVGKSQVNPTIHPLHYPSSTPAQFASNLARVTSPLLLSS
                     TAPPKFNPSQSSERSSSQQNLGRDAILNAAGALETLSQQSSNDKIPGMRLDNKAQSAN
                     GNSGNGNGLPTPSDSAHSHTTEALPLIGYGRKPYSPSTELNGYATPPLLPTGSAKLPS
                     LDSATTRPGMSPNFGAYQSQNTEKLPPLKNLTQNSSPLGSNPPTPNFGAQQQQQQRSQ
                     MISPMLVGSADGTRLPSLGRSPMLASFQQQQQQQQQQQTQQFQSQQNGLTSNEELRTR
                     ISELELVNDLYKTRIIELEATDNAAKQREMLLKKRIDDLTDMLRRRKEYRYSGEYAGQ
                     ALQTMRGVPQISAIQAVQGKNQMSSSSKPHNQQQKPQQPQQQPQQLASPPVPQVQPQQ
                     TQQQPGGDLKRIKVEPN"
     gene            <887615..>888388
                     /locus_tag="FOA43_000412"
                     /db_xref="GeneID:62193813"
     mRNA            <887615..>888388
                     /locus_tag="FOA43_000412"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920744.1"
                     /db_xref="GeneID:62193813"
     CDS             887615..888388
                     /locus_tag="FOA43_000412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776672.1"
                     /db_xref="GeneID:62193813"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR036423"
                     /db_xref="PFAM:PF00080"
                     /translation="MVSFNKISASFGSILLISATIVSAEEAPQNLDNPEGAIYKAHLD
                     SGDIKGIIEIYTARNSSAKVHLDITGLPEKGGPFFYHLHQNKVPESGDCEATGTHFNP
                     YEASFEECDSNQDDSYCQVGDLSGKHGWINTTCFQTTYYDPYLSLNKENKAFIGDLSV
                     VVHYSDMTKMLCANLYESKRKFWKKEYTDDFTDVHQQEKNDSYSNSTSGYGGQYANYT
                     NSTNGSSVEGITSTYCGSATKQTISTLLGALIGLLISFF"
     gene            <888605..>891892
                     /locus_tag="FOA43_000413"
                     /db_xref="GeneID:62193814"
     mRNA            <888605..>891892
                     /locus_tag="FOA43_000413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920745.1"
                     /db_xref="GeneID:62193814"
     CDS             888605..891892
                     /locus_tag="FOA43_000413"
                     /note="CAZy:GT20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776673.1"
                     /db_xref="GeneID:62193814"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF00982"
                     /db_xref="PFAM:PF02358"
                     /translation="MTIYIASLFLPYTIHFEVEASKVPMLNDDEIVEPVESLNSNNAT
                     RIGSPSEESDYEDSTISILKSLAKNKSTSNLSYEESELASISSGEASEQPSFRQQLQQ
                     QLQQPQQQQQPIMFTPSNRVSVQDFFFNNPNSSRLSLSSPSIEDTQARSEGGYFAAAT
                     NTTAESPASGSAIATTPSKINTVPAVGSVGSGGSGASTSSPTGAVQRSKSGIPPSGLA
                     GSSASAYVRPHSRLRNPPPPTNVSELLPRPSLEHTRSTRSFGSSMSRALLARRASSQV
                     IPRQRSSLAGADVGFEGDGDSAAMMKPLSGQRADDQLDRYFAEKTTNGKVVPFGGFSR
                     DYKSLLNEQNNVFATAPWKVVHYERGNGSLRNAVHQAVESGHLKDVQWIGTPCMPSDL
                     VPQKTRDAISVKLNAEYASDPIYVSDDVFEGAYDRFCKQVLWPILHYQLPEQQKANEF
                     LNGSWRDYETVNRQFADKLIAKYKEGDIIWIHDYHLMLVPAYVRKALPKAKIGFFLHV
                     SFPSSEVFRCLAQRKQILEGLLGADCVGMQADEYVAHFFQSCNRLLLADFDDYGIHYG
                     NRTISVTHNPIGIDAFGLQKVINGDVVNNWRVLVRDRWAGKMLIVSRDKMDKIRGVKE
                     KLLAYERFLNENPEYLEKTLLLLICIPGRAAADEKMENEILTVVDRINSRRDNIASDR
                     PVIVLNQDLQFEQYLALLSEAGLFIVSTLREGMNLTCHEFVEASSEDHSPLILSEFVG
                     SAAVLSGGALITNPYNVRQVAEAIRISVEMSAEEKGRRWKAMHEAVLRHDSLNWVIQD
                     LKDIDEASLLNTSQQPGDMKQLTWAAVDNALLKSNSMSHTDSGSTYSRLFIIDLGVLI
                     SNVEVHGTKINPIQQRLTDSIINNLASDPSNAVYLLSSSTKADLGMRCRSMNDVGILS
                     ENGAYVRLCNELEFTSLVSHKELEWLSAVVDTMKSFSLRIPGAYVETESSMVRFHTEG
                     SHDIEPEHRDKLVGELMAHINELYGHDWNLHAHVVNKMVVVQEADTVQKALSYIVDQS
                     QLTFVMATGETSPTNEEVYNFFRERRERFANNVLTVKMGKAHDSSNAEFKLHGMNELL
                     IALSRVA"
     gene            complement(<891969..>893069)
                     /locus_tag="FOA43_000414"
                     /db_xref="GeneID:62193815"
     mRNA            complement(<891969..>893069)
                     /locus_tag="FOA43_000414"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920746.1"
                     /db_xref="GeneID:62193815"
     CDS             complement(891969..893069)
                     /locus_tag="FOA43_000414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776674.1"
                     /db_xref="GeneID:62193815"
                     /db_xref="InterPro:IPR024637"
                     /db_xref="InterPro:IPR024638"
                     /db_xref="PFAM:PF12243"
                     /db_xref="PFAM:PF12350"
                     /translation="MDPFEARIYFAKQLVALTPSKVAAQELIRFLIHYSGIQNDLYPA
                     VLETLHKVDLNYRINILQFLNDLISTLVLDPKHFSTISPAYGYVRLTVNQLPSILAQV
                     LPRKPDPDSIVSMDPKQLEEMRCLTNLRASYSILIDISKLLQFPDLETYVDQFDATLL
                     TQTDVQSIKQDKTFDEAYIYETVANRKPIDQPELVPLLHQEKMFIEPLTDSWKFILAK
                     KRQSQYERVMIDTHPGRLKDSDFLSTISTVPSDHRNPLLLSQKQILQRMEADRERQKK
                     GKETLWRVRRPTNEVSMPEFQHIWHSLDKYDLKADRALLDELNGLYNVCKTPDVSDSS
                     AHHRRHLPPNHRPRGGRRGGANSNVVSRHRAE"
     gene            <893286..>893741
                     /gene="TIF11"
                     /locus_tag="FOA43_000415"
                     /db_xref="GeneID:62193816"
     mRNA            <893286..>893741
                     /gene="TIF11"
                     /locus_tag="FOA43_000415"
                     /product="Translation initiation factor 1A"
                     /transcript_id="XM_038920747.1"
                     /db_xref="GeneID:62193816"
     CDS             893286..893741
                     /gene="TIF11"
                     /locus_tag="FOA43_000415"
                     /note="BUSCO:EOG093448XP"
                     /codon_start=1
                     /product="Translation initiation factor 1A"
                     /protein_id="XP_038776675.1"
                     /db_xref="GeneID:62193816"
                     /db_xref="InterPro:IPR001253"
                     /db_xref="InterPro:IPR006196"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018104"
                     /db_xref="PFAM:PF01176"
                     /translation="MGNRGKGKGGKNRRRGKHENYSQKRELVLREEDQEYAQITKMLG
                     NGRVEATCFDGEKRIAHIRGKLRKKVWMQQGDIVLVALRDFQDKQCDVVHKYNSDEAR
                     TLVSMGELPEGAKINQTGTFDMDEDEDANFEFGTGSADDTDEELDIDNI"
     gene            complement(<893815..>894912)
                     /locus_tag="FOA43_000416"
                     /db_xref="GeneID:62193817"
     mRNA            complement(<893815..>894912)
                     /locus_tag="FOA43_000416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920748.1"
                     /db_xref="GeneID:62193817"
     CDS             complement(893815..894912)
                     /locus_tag="FOA43_000416"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776676.1"
                     /db_xref="GeneID:62193817"
                     /db_xref="InterPro:IPR008521"
                     /db_xref="PFAM:PF05653"
                     /translation="MEEKYIGLALAVSSSFAIGSSFVLTKLGLLKDGSRGESYTYVKN
                     PVWILGTALMAIGEIANFAAYTFAPPILVTPLGALSVIIGAVLAAIFLKETLGVLGKM
                     GCAICLLGSVIIVLHAPGDKEVTTVDEILDYAARPMFLLYATAVVVFSFFMIYKVAPK
                     YGSQNPMVYISICSAVGSISVCAIKAFGIALKLTFGGSNQFTHVSTYLFIITVVVCIL
                     TQMTFFNKALAQFDTSIVNPLYYVTFTTATLLASFILFSGFNTTSAVDVISLLCGFLI
                     IFSGVYILNISRKNPEEVSREEFFSTNKDGLSDISLNNDISAYQIRKSIETKRPKLHQ
                     GTTSINNTDQYYQIPNENSASSARRSDSFEL"
     gene            <895169..>899698
                     /locus_tag="FOA43_000417"
                     /db_xref="GeneID:62193818"
     mRNA            <895169..>899698
                     /locus_tag="FOA43_000417"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920749.1"
                     /db_xref="GeneID:62193818"
     CDS             895169..899698
                     /locus_tag="FOA43_000417"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG093403JV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776677.1"
                     /db_xref="GeneID:62193818"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019442"
                     /db_xref="PFAM:PF02985"
                     /db_xref="PFAM:PF10350"
                     /translation="MSVIDPCWFDESCFEELSRQKLFDLKRYLIKRRNYIDEQTGQIV
                     FLNKVPRRILNALSKNHVNIETTDYRTVACDAMAVWLSRASQLVYSQKSATRIRYAQE
                     LSSFVSTDTADSLLHYVIDFWTDSGSPLGNALKEMFIKLMSFITATEDDQFRKQLFQK
                     WTLEALQIPYSMRVFYFLIEHLYKQVEPADFILQKRPTFVRDSLEYIWSSSLATNVGK
                     AIVMVLRNMYSSENESEWMDCWCDDLIISLKNLQLRQGIETYLLPQLFKISKTATEAF
                     LKRVNSENDITMLLGCLTVAQSTSIIIEPFDGENPLLSLHTVESLLIQDDEYFKVTAF
                     SLLVSCPKHSSPIKPYLYDLISSCLDALFSEMNVETRNKMFSLLKKFILRIRDSTHKL
                     QRDYKNMESKDPERFVEEIESKKHDIELGRQFLQNLLDFSVFNLKPGSSHQRKAFAFM
                     VLLALIHSGLDSRVREEHHDKFKVVHYPFDVAVYSSYLLRVMIDNISDDYEDNRNSAV
                     NVLSISPLSLTNTDLKLAKVRALQLLADLKGKNVDSGARFFCFLFQLYQNNNEKDSCR
                     ELLSSLNDHLAQGIAIAKSDIASACFKYSIQGYFAAFKLIIEIIDFDKTFRDDKFMID
                     MLNRLIYQAIDGWNVSKGVLQHDSPEGNLPKEIEKSYSPELEATYGKGTQIISSYAWR
                     TLKESTGMLEIAIINAPLNKEQLLKIGPLLMKQLATIRHRGAFSAVYPTFVACCLRCH
                     KTPEISLVTRDWLKSNLQLITEKSNFITRRSAGIPFLINGILTADPELAGPTFDKLMV
                     IAQEPADADQTMENVSLPQVNAFNCIKAFFVDKALSEVSVLYIDRAMELALQSFESPI
                     WAIRNCAVMLFTALENRMFSSRKLRNNFLPTYPAKLFFTKFGSIKETFLRNLQQAIES
                     GLSDARQVQRIFPILTIMGRLDPTPNYTSLDAFRPLILQCLCSKQWKVREMAARSLPA
                     LLSSHKALRWELAERLSTVTSTTKDLNMAHGALLASKELLFRLREGLFGWSREASSID
                     LTAQSMISEVKKIVMSKLDDVLAIPCYPIQLEYFKLVSTFHDLTDYGTELDCMQNWLA
                     DHVNLGSRLNGGKQLAVSEACQIVLEHRLSQKTIFRIVVSECLLSELYEVQKSALTFC
                     ENHEDEMTAEEANDVVRCLWKLVQLPAWTYIKARSLKLLNELLVKKGVTSSQGSELDR
                     IKLLMALLSSSESANKFLKLACIEALGPLVGKSLALEKTPGLDSFFVIWLEKVRLLVD
                     DDLEYPERSAALRSLIGFNTNYFHDERSSEISKEEMKVVALLFRFLSDDDHELRDLVS
                     QHLSTVVLGLDFTLVPAMTEKRMVDWLKGIIVANKALVELVFDSSCFVFFNYNQKFRD
                     LFTKDLLLFKFEKQNLYRDEINRADQLNQILLEVEIAPDCEALTTYADAIARNVSDIT
                     NWIIKEHPVDGCLGWSLDEAKMEFVYENLQGLSTLIKIGRFPKNSELVEQTKKAFTNA
                     ELQIHPLLVNTVTSM"
     gene            complement(<899933..>900877)
                     /locus_tag="FOA43_000418"
                     /db_xref="GeneID:62193819"
     mRNA            complement(<899933..>900877)
                     /locus_tag="FOA43_000418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920750.1"
                     /db_xref="GeneID:62193819"
     CDS             complement(899933..900877)
                     /locus_tag="FOA43_000418"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776678.1"
                     /db_xref="GeneID:62193819"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="PFAM:PF06687"
                     /translation="MFFTLVNRTLTAILIAGATLCLLFIILSGAVNHSPFNQFYWLQA
                     HTADIKNAGGSVTRWTYWGVCHPNSVNSSKNGNCTQLGPDIPLSPFDNFGNSTSLPHE
                     FVSNRDTYYYLSRFSFPLLFVAFGFSAISFIGQFLTPCWAAMRHVTFFFVSLGLIFCL
                     AGAACQTAVSVLARKQFTNSKMAAKIGASMFGLVWAATACLLIVFFLTCCSSLRKAYT
                     VHRETYANDRALELNEAQQQDGFQPIVPGQTLADGSQPQLATVPGGSAPVGVQQTLSP
                     SETGDDYLQSQGALPSNEGGIRFFKIKRNNKNTDEESL"
     gene            <901666..>903372
                     /locus_tag="FOA43_000419"
                     /db_xref="GeneID:62193820"
     mRNA            join(<901666..901712,901767..>903372)
                     /locus_tag="FOA43_000419"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920751.1"
                     /db_xref="GeneID:62193820"
     CDS             join(901666..901712,901767..903372)
                     /locus_tag="FOA43_000419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776679.1"
                     /db_xref="GeneID:62193820"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="PFAM:PF02732"
                     /translation="MSDIEVINLDTSPHRDQPLENVIDVDEIDEFSDDHNGLIYSDPD
                     QLCDLLGIKQSSKAVALLLSSSPPSSSQQLAPIRSRHAARVLSVESEKSETDCPSSQS
                     GVITVESSSDQIIDFSVPTSQYTSISCRRSRASNQHIQSYSDISSISNHSDSIVIEGL
                     LDANESRPLTCTAATGSSPLHQIHNYQPINTTLEPKTSHSCLSTPHYTDSELHIMLET
                     AKRNDPKLLKQVNLVSHTKPELIAQMTVSFDVKLMDELKEINPNFTEFLKPMHFSAYQ
                     NPDNYPSIMFQRKVNSVYYKAKGAFVPVKTHLENEKMIGLYVDSKKLPQMFKSHFLGD
                     TIRSMRKTYADYRLVVFLSGYDSFLQGVRSRQNKEYINKVRQEMTQETESSDNSETTK
                     RKRRRKNIKDMDGGEVKFTAEQVQAKLLRYEVDHDIHLFPIKGIKDLVEWLKSLGYTL
                     ASKYIDNLERNLDFSNIGQIRSGKDARGSFIEMLKQFKFMTTSSADKLVDETGIKSVT
                     ELMLMLQQGDKLVNSAGRPVVRSNVENVLRKVLLSEDGEELI"
     gene            complement(<903492..>904409)
                     /locus_tag="FOA43_000420"
                     /db_xref="GeneID:62193821"
     mRNA            complement(<903492..>904409)
                     /locus_tag="FOA43_000420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920752.1"
                     /db_xref="GeneID:62193821"
     CDS             complement(903492..904409)
                     /locus_tag="FOA43_000420"
                     /note="BUSCO:EOG09343H8V;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776680.1"
                     /db_xref="GeneID:62193821"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013918"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF08609"
                     /translation="MDGLLKWSLAQQGGNDEAKERAGKPDPNALAQLLGMGHFKDDPS
                     LMKESAEVLNNKESTKDQLKIAFGNMELLIENLDNANNLKNMDLWPAVLQHLNNEDPD
                     IQALACSCIGSAVQNNPRSQNDFLDQCKSSNSEWFDTILKHALDTDPDHNQLKMKALY
                     ALSSITRHNATAYKLFEVLDGWKVVSAVLNDAEASSKLKLRALSLLTSLLSEEEEDAD
                     LSSEQGREKIRRIQEDKVVDSMIKTLDSDGDINCNDRIIHLLAVLISHGYKFKGDEVS
                     QISLKLKQLEPIKDRLNEDDLKTLKSVLS"
     gene            <904611..>905669
                     /locus_tag="FOA43_000421"
                     /db_xref="GeneID:62193822"
     mRNA            <904611..>905669
                     /locus_tag="FOA43_000421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920753.1"
                     /db_xref="GeneID:62193822"
     CDS             904611..905669
                     /locus_tag="FOA43_000421"
                     /note="BUSCO:EOG093431SX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776681.1"
                     /db_xref="GeneID:62193822"
                     /db_xref="InterPro:IPR004600"
                     /db_xref="InterPro:IPR036465"
                     /db_xref="PFAM:PF03850"
                     /translation="MDAIADRAFVDVQSGKGNLHRVVDETPSLLIVILDVSPLEWKKL
                     MDSGTLDFKNVVSALLVMLNSHMALNSGNKVALYIANSYLHGAELVYPWFDDRDDSSD
                     GSEQNSKRRRMNADNILKASGIYRQFRIVDESIVDKLDSLIKEEPSKLKSMVNKGNTH
                     IKGTLSGALSQALSYINRLQKSDEHSGLKARVLCISVSGDSALPYVSIMNSIFAAQKM
                     KISVDVCKLGPDSTFLQQASDATNGVYIHINNPDGLIQYLSTALFIDPLLRPIVVLPT
                     NTSIDFRASCFITNKLVDVGYVCSVCLCILSVIPDDERCPTCHSKFDHNLITRLKRKP
                     KVLPLKMGNKRKKRVVDK"
     gene            complement(<905688..>906164)
                     /locus_tag="FOA43_000422"
                     /db_xref="GeneID:62193823"
     mRNA            complement(join(<905688..906039,906097..>906164))
                     /locus_tag="FOA43_000422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920754.1"
                     /db_xref="GeneID:62193823"
     CDS             complement(join(905688..906039,906097..906164))
                     /locus_tag="FOA43_000422"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776682.1"
                     /db_xref="GeneID:62193823"
                     /db_xref="InterPro:IPR005351"
                     /db_xref="PFAM:PF03669"
                     /translation="MSIYLTNRNKMGKELIRENLVKPYVHTPLDKSTKASDFAASNFP
                     MVAMFMRNKALSWSALFIAVQSYLNDPLIKDPSDQSQPAILKVVFAFVAVTTSYLDIL
                     FPQMNPAVNMQAINAAAAATATATATAATVTAATGSN"
     gene            <906816..>910175
                     /locus_tag="FOA43_000423"
                     /db_xref="GeneID:62193824"
     mRNA            <906816..>910175
                     /locus_tag="FOA43_000423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920755.1"
                     /db_xref="GeneID:62193824"
     CDS             906816..910175
                     /locus_tag="FOA43_000423"
                     /note="BUSCO:EOG09340AY9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776683.1"
                     /db_xref="GeneID:62193824"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR002202"
                     /db_xref="InterPro:IPR004554"
                     /db_xref="InterPro:IPR009023"
                     /db_xref="InterPro:IPR009029"
                     /db_xref="InterPro:IPR023074"
                     /db_xref="InterPro:IPR023076"
                     /db_xref="InterPro:IPR023282"
                     /db_xref="InterPro:IPR025583"
                     /db_xref="PFAM:PF00368"
                     /db_xref="PFAM:PF12349"
                     /db_xref="PFAM:PF13323"
                     /translation="MIFTEAPAYLAKLCANRPIHFIVATLLVASISYLTIFDHYLARI
                     NSLGGDSLTFYHSPLADDAQWDIVANLTEFEINAASKLATAYDNDVATTFSSEVSDSS
                     FSDLAFNSTPHWALTPIIFRAHSHAIPFPSNDSHFISGPDDDEKFYLTEYSHQIPLPP
                     SFTNAEGDVFKLRKSNRLGRYYEYIRNLANTLRSSAKGAEPLDLLMVALAYAAMIFII
                     IQLFYEMRTTGSKFWLAFGSLLSSVIAFLFAIVLTSEVFGIHLPLSSLTEGIPFLVAS
                     MGFRHKIAYTVPAMEAIRKEPTRDISDTMWEVVLKKTAAPLAKQELITAACFLGIALF
                     TSNMPGLRNFCVFTAVLMVCDLFITFTFYSAVISLKAQINIVHRQVALTEALEEEGVS
                     EEVAHSVAATGLASSAYQPLFKHDKNVWAFKVVTIAGFLVLHLFALGTSWLYDDFSDY
                     TPSAALLSYAIGGHLSGRVSEKIPLGIQGTLVTLMPTKVYRRVTLLTQVEDVVFDSLS
                     RFSQAIRDPYISKFIVLVAGISFAINVYLLNVARNHLFKHSDSVISEKISKKKRTDVK
                     SRGEASTSHAGKKAAVVTAPASSVTSSAPVSAPVPANSTFDNVKDHQIVSDSASSSEE
                     SVNDESVRPLDELVSIFKEGRLRDECNDAEVCELATNGKMPLYALEKQLGDSARAVVV
                     RRKAIAKLANAPVLNTDRLPWKGYDYDRVFGACCENVIGYMPLPVGVAGPLIIDGVPY
                     HIPMATTEGCLIASTMRGCKALNAGGGVETVLTADGMTRGPCVRFSSLSRAGAAKRWL
                     DSEDGQKTIKSAFNSTSRFARLQHAKTALAGKLLFIRFKTSTGDAMGMNMISKGVEYA
                     LKYMQEKCGFEDMDVVSLSGNYCTDKKPAAINWIEGRGKSVVASAIVPAEIIKKVLKS
                     DVDALVKLNIDKNLIGSAMAGSIGGCNAQAANLVTAVYLATGQDPAQNVESSNCITLM
                     EKRPDGDLEISVSMPSIEVGTIGGGTILEPQAAMLDMLGVRGPNPTHPGANARQLAKI
                     VAAAVLAAELSLCCALAAGHLVRAHMQHNRNSKKPVEKPVEKPVEKPAEKPAEKPAGD
                     HSENLTKKSAEQPPKEDMQRLKDGSKICIRS"
     gene            <910481..>913051
                     /locus_tag="FOA43_000424"
                     /db_xref="GeneID:62193825"
     mRNA            <910481..>913051
                     /locus_tag="FOA43_000424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920756.1"
                     /db_xref="GeneID:62193825"
     CDS             910481..913051
                     /locus_tag="FOA43_000424"
                     /note="CAZy:GT20;
                     BUSCO:EOG09340CW9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776684.1"
                     /db_xref="GeneID:62193825"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF00982"
                     /db_xref="PFAM:PF02358"
                     /translation="MSIEPSDCKNSGLRLSGRILNCVTQLPSEIYRTKTGEWEVKHIR
                     GSSALYASNMFLSKHTKWETHLIGWTGELFEADEMVPRSIPASQKIENDPLYLSEEDK
                     RDVTEKIRTMNGNKNIHPIWLLRKDQDRWRQYAENVIWPLFHYLLNEPSDGRQESQWW
                     YDYVKFNEAYAAKVKQLYKPGDIVWIHDYYLLLLPQILRMELPEAYICHFLHVPFPSS
                     EYFRCLSKRKIILDGLLGANQLGFQSYSFSRHFLSCCTRLLGYDVTPTFVYVHSSQVR
                     VDTFPLGIDVTALEKDVFSKEVNAKVTALHELTGGRQLIVGRDRLDTVRGVEQKLLAF
                     DQFLELYPEWIGRVVLIQVSFIPSYHSSRLVKRVSELVAHINGRYGTLEYTPVLHYNM
                     RVPKAEYLALLRAADLCLVTSIRDGMNTTALEYVVCQRTQGHPLILSEFSGAASILPD
                     AIQINPWDTVGVSRALNECLLLSAPTKQATETKLYKSVVSHTVQDWTCKILSSLLEFL
                     TPSNGSDGNQRFSRNGITPYLNKPKLLKCYEVAQKRLFLFDYDGTLTPIVRDPAAAIP
                     SARLLGLLKDLVADKRNEVWIISGRDEAFLEKWFAREVPELGLSAEHGCFLKNPNTPE
                     WTNLAASVDMNWQKRVEEVFQYYTERTSGSFIEKKKVALTWHYRKSDPELGAYQGEQC
                     RKQLEEEICSQYDVEVMPGKANVEVRPRFVNKGEMVRRIVLCSDPVKQVVRKHGERPD
                     FVLCLGDDTTDEDMFKTLNSIEKHWQMQGVTKNATGDDYGLFPVTVGPANKQTVAKAY
                     LSDPQQVLDTIGLLLGQVSLFDTAGSVDLDDRGHLKNSESALKSAQNRKEYQKKAAKK
                     "
     gene            <913208..>915765
                     /locus_tag="FOA43_000425"
                     /db_xref="GeneID:62193826"
     mRNA            join(<913208..913216,913282..>915765)
                     /locus_tag="FOA43_000425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920757.1"
                     /db_xref="GeneID:62193826"
     CDS             join(913208..913216,913282..915765)
                     /locus_tag="FOA43_000425"
                     /note="MEROPS:MER0015336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776685.1"
                     /db_xref="GeneID:62193826"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="InterPro:IPR036757"
                     /db_xref="PFAM:PF04253"
                     /db_xref="PFAM:PF04389"
                     /translation="MPYSSPSDSAEISSTQSAPAGLTPFPGSTGQTSVETDEEFTYHD
                     YPQQHRKSSHVRKTLHPNVGYYGSLGERNSFLASRSTSITESIANSVISVTQMTLRQM
                     RRQRFLTVCIFGVIFMLLFKLIFMPRTSLDRDLRRLHGEYLTLDDCSRLFLTHLTLKN
                     DIRRYMKCYSEEIHTTGDNYEATVELFREFPTFKTSTEKYEAWFSRPQESWLRVLSAD
                     NKVIYDANLQETELMSFYPYSASGKMRAKYVYANYGSVGDFQQLNASGIPVEDRIVIL
                     RNGNLHPSIKIQNAQRVHVAGAVIYSDPYDDGKYVESHGYAAFPDGFARNHHAIQKDT
                     LSRILEQPGDPTTPGWSSTLFSKRVKPETIPTIPVLPISFAAIQPILDSLSNGADLGW
                     KGDYANFSYSASVSENTLELGSTVQFKIKPIYNIITEIKGIIRDEVIYVGASRDIVGG
                     IGGASSGFSELLELARGFNELAKKGWKPLRTIKLISWDGSAAGLLGSTEFGEFYEGKL
                     RKNAVVYVNLDGVKGSRLLVESNPLYGQLLVKSMKEILVDDDTTLWEYYIDRHQHNGS
                     EIDLISQRSGDYSVFQCFVGVPSINIGFSNVKDKDPVPYTNSKYDSEDWQLLLDRKLR
                     YHNLVAQFAGLFVLQISEREIIDVGTGDYMSRIQQRFDVLSSRVPSGWKHKKMKIRGQ
                     KDGRNVGEEIERLDELLSEIVAIAKNFDDHLVWLQRQILQDYPWFKMYVKIKIAFQIK
                     IASAKIKALDKLFVAPEKYTNVDVDGQREGLLKGRKWFRHLIFAPDRVSGYRLEVLPG
                     FTEALQNGEYGFFERNIQAFGEALEKVYSKLR"
     gene            <915921..>916460
                     /gene="CYP1_1"
                     /locus_tag="FOA43_000426"
                     /db_xref="GeneID:62193827"
     mRNA            <915921..>916460
                     /gene="CYP1_1"
                     /locus_tag="FOA43_000426"
                     /product="heme binding"
                     /transcript_id="XM_038920758.1"
                     /db_xref="GeneID:62193827"
     CDS             915921..916460
                     /gene="CYP1_1"
                     /locus_tag="FOA43_000426"
                     /codon_start=1
                     /product="heme binding"
                     /protein_id="XP_038776686.1"
                     /db_xref="GeneID:62193827"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="PFAM:PF00160"
                     /translation="MFNISKRAFSTSSINLTKCFFDVTIGGKKQPRIVFDLFDKELPK
                     TAENFRALCTGEKGFGYKNSIFHRVIPQFMLQGGDITHFNGYGGKSIYGDHFDDEGFP
                     FKHTKPGMLSMANAGPNSNGSQFFITTIPCPWLDGHHVVFGEVSDGYDTVKTIEGVGS
                     SSGKVSQEVRVEDCGELKE"
     gene            <917466..>918983
                     /locus_tag="FOA43_000427"
                     /db_xref="GeneID:62193828"
     mRNA            <917466..>918983
                     /locus_tag="FOA43_000427"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920759.1"
                     /db_xref="GeneID:62193828"
     CDS             917466..918983
                     /locus_tag="FOA43_000427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776687.1"
                     /db_xref="GeneID:62193828"
                     /db_xref="InterPro:IPR011063"
                     /db_xref="InterPro:IPR012094"
                     /db_xref="InterPro:IPR012795"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PFAM:PF01171"
                     /translation="MFINPLGLTNTATATVSSKFLTSLTKIFAANLTKFPPRVAVALS
                     GGADSMALLNLLVKIKMKKLNDLKIDAITVNHNIRPESTDEVDQLSKLISHLPITHHV
                     LEIKQKIDPKQMERTARELRYQLMLGACEKLGISDLFMGHHRDDQLETFMMRMQSNST
                     LFGLRSMTPVSRFPMVSPTLDLKVIRPLLEVDKKEILQFCKENELVWFEDSTNFMPEL
                     TRRNYYRYLLKDEKKRLPPVLHKARLLDSLARIEKFNSRVEREIALMDRSLTKNGSVK
                     FDPETISLNLKIPKDMFSRFSFVTLDRYLFLKLYQVSPSKNFFHEFTKVDNKYSAFTE
                     NPSNKKKNSLMQDINTGHKPNRFTVLNCQFEVTKTDKFIEISVCRANENTHQGYNVMP
                     FSMKEGFSNWIYFDNRVFFRFFNKSMSNNGDYRLEVYKDSEHLDLLKQGFAKYLDFKR
                     LLNNYNLPVLIKAGQNDEPDKIVCFPTISRYADGFNKDNLSVDAELKRDLVQEDE"
     gene            <920502..>921265
                     /locus_tag="FOA43_000428"
                     /db_xref="GeneID:62193829"
     mRNA            join(<920502..920507,920561..>921265)
                     /locus_tag="FOA43_000428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920760.1"
                     /db_xref="GeneID:62193829"
     CDS             join(920502..920507,920561..921265)
                     /locus_tag="FOA43_000428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776688.1"
                     /db_xref="GeneID:62193829"
                     /translation="MLIDHSQSLDDSIARRLFNYRPSMSDVTNTTFNKTESMMELLKC
                     NSSTLIGSWSLQELSKFGNACDYHEKPFTLRIVFPTDQFVIVCSNPSIFVQTFYRLNI
                     AHEISLDLDLRLTMPIDYCIPRRRNRGRRSTVESAVTVALPEFEEDEEAIGSTETEEL
                     ISISSDSGLGPASSPTSSESIFSTVERMGTGGTTLAREGQYEKAAASPELGVSLYQEL
                     VFSIKCIKNCRNRTVAFL"
     gene            complement(<921326..>922633)
                     /locus_tag="FOA43_000429"
                     /db_xref="GeneID:62193830"
     mRNA            complement(join(<921326..922493,922629..>922633))
                     /locus_tag="FOA43_000429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920761.1"
                     /db_xref="GeneID:62193830"
     CDS             complement(join(921326..922493,922629..922633))
                     /locus_tag="FOA43_000429"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776689.1"
                     /db_xref="GeneID:62193830"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="PFAM:PF01026"
                     /translation="MNYTKNTGNLFDAHCHLSPVVTKQRFSTLKEELQKKLLQEPSDG
                     FIFKYPCLNMMSTNFIDYKLVHELSKEFPGFVNPNYGVHPWFCHLYTFVDYSKDENAP
                     LSSTQVKRLHYSSILLPHKDISDQLLEALPVPIYIFDYLKEVEALLQENPLAGIGEIG
                     IDKSFRLPMCGYLGSEQCLEWIDDPFLRTKNPQEQELRHKWSPFRTDMDHQIRVVEAF
                     LDLAKRFRRPVSLHCVGNHGKLFDLLKKVFIDDTSTNNGYRFSSIDLHSYSGSIEQTR
                     MYTRMFPGIKFSISSVLNLKRYRNRLDESLKSGHLTPKNLLLETDLGLDALYWPQKEE
                     DGEDRYELLVSRKTGSLDRHTELLSSTLEQIYDLDSRVSLQTLNDNYREYLNLVTN"
     gene            complement(<922637..>924547)
                     /locus_tag="FOA43_000430"
                     /db_xref="GeneID:62193831"
     mRNA            complement(join(<922637..924372,924541..>924547))
                     /locus_tag="FOA43_000430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920762.1"
                     /db_xref="GeneID:62193831"
     CDS             complement(join(922637..924372,924541..924547))
                     /locus_tag="FOA43_000430"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776690.1"
                     /db_xref="GeneID:62193831"
                     /db_xref="InterPro:IPR036866"
                     /translation="MTHHLAGFGSNSLNDIVVFCTDATKQLIRGFHNIEYDKNLEKIR
                     VCRFNETISLHNGTLKVTFIPVYHCIGSAMILLEAPDHKILYTGDARFDSPILKLVSM
                     NHRLLEYIANSAWLDTIYLDTTFSYRSKNIQIMDRYIGIEMLIQSIQTYPIGTKFNLI
                     NTTCGFEDVWMRLAWKFGVSSLAFDESLRKRFELLRKVRDKFELMTNPVDNFLNFLGL
                     HQSEAKGKPTDQSSPYSFYVGKGFEGCDVRVSAAINITSREFNQRYIGKGKGEFKKLV
                     IDDQNTYSGTFAYHINDRVSIDLTQRYLPFPERGILLPTELKFVFSRHSSCQECLKFL
                     AAFKGNVREVYPTVYNTEAWIRGFSMQRYFGNFCMRNSFRFDREMNEKYGSSAISFTE
                     PVKLANYWPTESNPYRRHLDLLGQSGGIKGEKVERGTSLYRIRKLRKYRKLHHSDNRE
                     KVFEQSENHQKVFKSHKVPEMNITNSESSSNDNDRHMEEAVIAKQLQLTSRKEIMDSI
                     SISIDYSVIESSTTTETDSEPQKAELNRWNDYVVEPTKEFGNCEEPISVKDIYCQKYN
                     RRRADVRHRILKIL"
     gene            complement(<924866..>926095)
                     /locus_tag="FOA43_000431"
                     /db_xref="GeneID:62193832"
     mRNA            complement(<924866..>926095)
                     /locus_tag="FOA43_000431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920763.1"
                     /db_xref="GeneID:62193832"
     CDS             complement(924866..926095)
                     /locus_tag="FOA43_000431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776691.1"
                     /db_xref="GeneID:62193832"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR036625"
                     /db_xref="PFAM:PF00364"
                     /db_xref="PFAM:PF02817"
                     /translation="MLRTFTVSTTRTVFKAVMARRTFTTTYARQAAKIYEMPAMSPTM
                     DEGGVVEWKVKEGQEFSAGDELLDVETDKATMEVNAGDDGIMAKILVPAGTNGVKVGA
                     PIAFLADPGDDLATLEYPDISAAAAAPEAAKPAPAAAPAESPAAPAKAPSFTGGKANP
                     DQTFFPSVEFLLAENKISREDALQKITATGPKGKILKGDVLAYLGKIPADDNTKIASF
                     LEDREKLDLSHIELATPEAAAETAEGSEGAAAADSSAAAPAKPAKQPVVVSHQFVISS
                     AVPSKILAALVAKAASKAETAAYATKNYKSSDLVDPLFEDLIAPPANTERFKVNYSIN
                     TTPAPSAAISESIVDEFDFEPYEEPVKSSKPELLTTVDVELTCNEKVIDSKTKAGVFV
                     SKFGNYLGQIDRKFTRV"
     gene            <926590..>928656
                     /locus_tag="FOA43_000432"
                     /db_xref="GeneID:62193833"
     mRNA            <926590..>928656
                     /locus_tag="FOA43_000432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920764.1"
                     /db_xref="GeneID:62193833"
     CDS             926590..928656
                     /locus_tag="FOA43_000432"
                     /note="BUSCO:EOG0934159D"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776692.1"
                     /db_xref="GeneID:62193833"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR011501"
                     /db_xref="InterPro:IPR016903"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="PFAM:PF03914"
                     /db_xref="PFAM:PF07540"
                     /translation="MGKRVKRSVELRQNKRRKQGDSQLRGSLFNKMDGELEEEDDGVV
                     EEEEIADYEAKPRRFDDQNEDLVEGLPVRSSDGTIHRVVMKKEERKTKRLQDEEQKEL
                     EEEQEQEQEEREQEEQASKEDGKNSVFDESNDEKYKDLSAAEMVLKIKEDLADMAQSM
                     IEDPEENVMLMSRVLTMMTSKNPIIAKLSLLSLVPVFKSISPSYRIRPLTEAERKEKM
                     SKDVQRTRFFEQNLVSYYQKYLKFLARKASVVINSPRASNLDKQMGIVATRAACELTE
                     SLRFFNFRSDLFKLLIRRVMRKPSSESEHDAFRRCISTLEGLLVEDFESGDVSFDIVR
                     IVCRSIRHRDFKVDESVVNIFLSLTVLSDYDPLRKEDEKEEEAKMRKKDRVYLTRKQR
                     AQLKERKLIEKEWDQAEQKVTSQQRERFQAQILKLLLTLYLEILRGRPEKLMAPVLEG
                     LAKYGHQVNLDLMGDFLQVLREISEDLLTNQMSGKGITGNQMRQVLLCIITSFSLVSY
                     MPPKKVHLDLNKFVDYLYSLLPMLSQDADIEFSHKTLRLMDPLSTQLQMKPSVNVSTE
                     AELLLRCADAIFLSSRSGSEARALAFTKRFYLDMLNFPEKTSIAILKFIDKLMSRYDE
                     IKCLYTTEDRIQNGVYHSYADSVERANTEVAVLWENVLLEKHYNPTVSMAAKALLKRA
                     KARNAI"
     gene            complement(<928671..>931022)
                     /locus_tag="FOA43_000433"
                     /db_xref="GeneID:62193834"
     mRNA            complement(<928671..>931022)
                     /locus_tag="FOA43_000433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920765.1"
                     /db_xref="GeneID:62193834"
     CDS             complement(928671..931022)
                     /locus_tag="FOA43_000433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776693.1"
                     /db_xref="GeneID:62193834"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MSLDYQRFLNGGLLHNRYTRVEGLNEGSFGIVSLAKDALNGSKL
                     VALKYNTGELEDFEAFEQKEAKTTYANAKIEHPDVDKSFVLSETTREVKMLRKAGRHP
                     NIAQLLDNFDTYIVLEYVSRGDLHDAIQLGIAPVSTRDVVDVFMQLISAVEHCHNLGI
                     YHRDIKPENILIAEDWSIKLTDFGLATDHLWSTDFDVGSERYMAPELLEHNDIDSYRA
                     DKVDVWSMGICLLNIVFGKSPFKSASSGDKMFLYFAANRETLFDIFPSMSYDLFGVMR
                     HSLTIDPENRDLQQMKESLSKVDVLTYDYEFEEEEEEATFDLPELAAEPATPEIIPTP
                     IKISGKPEDDTLGKYILKPYSGENALAMDFHGVNKVPERPVQTSVPVTASQIYTVPKG
                     KHRFPHHRKPLNIPAGTRHRNRSQKGRVNKETYTESELNGSFLREDYFTPRSVFNHYM
                     EKTNQHRKFDHRAREQQQQQQHRYDYHEDRHSGRAWRQRKNQRSYAFNKYRSGNRVNG
                     RKPYFNSGRNYLYARNNARSSSFQDDRNNGGIARSIPISQSSNTARCAYKPRTLQNLS
                     SPSGKYIPPNMRSRPLSPGLPPVMGPELELAPPLEGATEDDEMFMFEDAGARKETKVE
                     DNSQQISALSRKFRDCTLNVTSTVPELSLSAPQEKYVPPHHRRKSSYSSKSRPIFLCP
                     KKYNIPHNNVTPMTAAAAKSEDRVISSSVPAKNTNWFMQHYQPHKDKSTIMTGDRSNW
                     YDYDDQDLEDYVSEGFGLSYVNGENREGRHLQMKDIRGHGKLN"
     gene            complement(<931519..>934069)
                     /locus_tag="FOA43_000434"
                     /db_xref="GeneID:62193835"
     mRNA            complement(join(<931519..933411,934064..>934069))
                     /locus_tag="FOA43_000434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920766.1"
                     /db_xref="GeneID:62193835"
     CDS             complement(join(931519..933411,934064..934069))
                     /locus_tag="FOA43_000434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776694.1"
                     /db_xref="GeneID:62193835"
                     /db_xref="InterPro:IPR003120"
                     /db_xref="PFAM:PF02200"
                     /translation="MQSPITTYRHSISGDGISDTTTGSPSSVNLSKDDKLTKSEIEET
                     TKNLELIHDLKFFLLTAPVNWHENQVIRRYYLNKEEGFVSCVYWNNLYFITGTDIVRS
                     VAYKLELFGRKIVDRKKLEEGIFSDLRALKCGTSAILEMPKSPFLRFLHRNQCLRTQK
                     KQKVFFWFSVPHDKLFQDALARDLERGLSSLPSATVPSTKLLKRFKYDHTEALVPQLE
                     SHILAQTGKSFSYILSESSPEETQAVFAKQEKAAAEASVTTTTTTADNTANVRNSEEE
                     ESSMLSFSDSSPGSSSDNDAGFPLDYIQNDSFLFNVDGVGSVTECNGGAMAAGSAAVT
                     DFTYTQNPSSAFLPDFPSLWLVSPTVGGVPDDLLLDQATPVVPMFGAASRSPITATTP
                     RSLYFKNTGFGNKATALGGDVPFSGGLASPGFAMFTTLGNFESVNETTVQQQETGHDV
                     AEAQDKPIKSFSFVPSASSLTNNGLATNADDVSTEDNGNLKPQIITIPPGTGIFDAAS
                     LSGQMFSPVIGSSVEPNLYYYYGASPYFADFPVLPFSRPLSGIKSTFDGGAGNGIGKS
                     NERVNGKTKGEIGKTESGRIGKPKRKGLLNPSLRHLELDIQEQTDNESQPTNKGEVRL
                     KLEHGVAM"
     gene            complement(<935123..>937354)
                     /locus_tag="FOA43_000435"
                     /db_xref="GeneID:62193836"
     mRNA            complement(join(<935123..937323,937351..>937354))
                     /locus_tag="FOA43_000435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920767.1"
                     /db_xref="GeneID:62193836"
     CDS             complement(join(935123..937323,937351..937354))
                     /locus_tag="FOA43_000435"
                     /note="BUSCO:EOG093410QU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776695.1"
                     /db_xref="GeneID:62193836"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF00806"
                     /translation="MERDEKHKDEHNHEHKHEHNHEHKHEHNHEHNHEHKHGHKHEDG
                     HKHEDGLDGEEKGVDEDDKNSEVLEVKPSGTTETTNMPFFGLLNSEQSAYFRQAESTL
                     NLDTFDNAEAKRAFVDSVLEEAKGNELKLATNQICSKLMERLILLSNEREMRQIYHGC
                     KGFFYQLCIHKYASHVMEAFLVRTASMVEKEMLGHKDGNNLDSEDEDFTSMEGIVLEI
                     VKEMQPKLKSLAKDRYGSHVLRLVLLIVAGKKLPSSIESNSLLRSKRSKIARKMVEIE
                     DNEDYERNFQVPSSFADALSNIVTQMIDGETTESLREVAIDPVASPVLQLLIQLEGKV
                     SRERPYWNMTFARADEPKNDKEGAFMEYLLSDPVGSHFLQTALSNQKMKNINRVYRFY
                     MLDRVGKLAKRETTGSFVVQTLLEKSKPKDQEVILDELVPILNELIVNNFGLGASIVD
                     CSERNNDYLKKEIVDKFFEFFNKTVNGERMDDTSILENLLQLSRSTLFSVKDDWPTSE
                     ERRRALFLEKLIDYDDRFLRACVEGLMGLAEVAKPQKNYARERNKINESETSEVEPKD
                     EKDETDETDETKDINSVESESNMLIEICKHGVFSHIVESCIAKPERLEMVTKKLLLNL
                     LVGHVIELACNAQGSHIVDKLFELTFRLNMYKDRIAKKLVDNEDLVKRTVYGRQVWKN
                     WKMDLYARRFGEWKRMVKQEEIDKKVQKGVDIGLANRKRGFNGQGPSKRLHR"
     gene            <937542..>939041
                     /locus_tag="FOA43_000436"
                     /db_xref="GeneID:62193837"
     mRNA            <937542..>939041
                     /locus_tag="FOA43_000436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920768.1"
                     /db_xref="GeneID:62193837"
     CDS             937542..939041
                     /locus_tag="FOA43_000436"
                     /note="BUSCO:EOG09341R1I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776696.1"
                     /db_xref="GeneID:62193837"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR004595"
                     /db_xref="InterPro:IPR007198"
                     /db_xref="InterPro:IPR012170"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036465"
                     /db_xref="PFAM:PF04056"
                     /db_xref="PFAM:PF07975"
                     /db_xref="PFAM:PF13519"
                     /translation="MQSDVDEDDIVNTSHRTRTKVSFEDDDDYNEQDVGDKGSDISPP
                     LLGEKRTTSESEDSVSVGQDSVSSRTKRRHLKGPDSDKVGIDDSQLPPEQLKGSSGGY
                     SWEDEYRRSWDIVQEDESGSLETIVSGLVESQKKQYLKNVTPFQRGIIRALVLVLDFS
                     KVMREKDLRPNRASMMISYSIDFVNEFFDQNPISQLSIVIMKNGLAQIVSEVSGNPHD
                     HIEALKKLRRMEPEGDPSLQNALEMSRGLLLHVASHCTREVLIIFGALFTSDPGNIHN
                     TVKQLIAEKISVRVIGLTARVAVCDELCSLTNHGDLKSSYNVILNEHHFRDLFMDAVT
                     PLAVAKSESRNKHGFTLVKMGFPQRISEENPSLCACHSKLVHGGYICPKCKSKVCVLP
                     TVCPCCDLMLILSTHLARSYHHLFPLLLFVEVRISHSYPSTRCYGCQVGFPKALDISQ
                     KNNTNKKEYQTSSRYRCTSCGKDFCIDCDVFIHEVLHNCPGCESNSRKK"
     gene            <939245..>940723
                     /locus_tag="FOA43_000437"
                     /db_xref="GeneID:62193838"
     mRNA            <939245..>940723
                     /locus_tag="FOA43_000437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920769.1"
                     /db_xref="GeneID:62193838"
     CDS             939245..940723
                     /locus_tag="FOA43_000437"
                     /note="BUSCO:EOG093435ZC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776697.1"
                     /db_xref="GeneID:62193838"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="InterPro:IPR039416"
                     /db_xref="PFAM:PF01417"
                     /translation="MTTKSMLRSIKNVTNGYSSAQVMVRNATSNDASGPTVTQMADVA
                     NHTYDRGEFLEIMDIIDRRLNDKGKNWRHVAKSLTLLGYLVRYGSEDVVIWAKDNVYV
                     VKTLREFQATDSMGQDQGGIVRVKARELTDLLADDERLRQEREAASRKSGHRAQRGYA
                     ASGSQENIPGENDFDLERAIEESKMTAQEEEEMRNRHNSDASIERAIQLSLEEDEMRK
                     KKQNLLDLDDDTPVPPTVLGYYTGLPQPMNSSGQIVGYDMYGNPVYANQAMPTGYLQN
                     AYQSAASQQQLLQEQQTQAQAQAQQLAAAQQQQQQQLYQQQLAAAQQQQQQQQLLLQQ
                     ASQQVPMETGSNNPFAFNSQPTDTPDHASLERLQQQQRLQQLQLQQQAQTSAAPSAAN
                     QAISEQYAELNNLLAQGTGIDTFGNEGDSRIPAQHTKTGTFLNSSGTGFRQENGNSAG
                     NPFMGTQFAGMPSTIVAAPTGYGFGNQQQSSSQKPPGSLIDL"
     gene            complement(940879..940963)
                     /locus_tag="FOA43_000438"
                     /db_xref="GeneID:62193839"
     tRNA            complement(940879..940963)
                     /locus_tag="FOA43_000438"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:62193839"
     gene            <942024..>942677
                     /locus_tag="FOA43_000439"
                     /db_xref="GeneID:62193840"
     mRNA            <942024..>942677
                     /locus_tag="FOA43_000439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920770.1"
                     /db_xref="GeneID:62193840"
     CDS             942024..942677
                     /locus_tag="FOA43_000439"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776698.1"
                     /db_xref="GeneID:62193840"
                     /translation="MGEDQPRYKVRNKKEAEDPIRYRTHGTSFYNLRLPENYRLGNQA
                     IYQNPLINFVIGAKRLSLAFGVIGVLFAYLMDRTGIVWPQISEAVAIISLIPFPVLLY
                     LYQPYVARVFRIYDTKKPQTMENLIKDEKILLEKINWNGFKTYNELVRVDSLRAPDKN
                     DYESRFGYVNLVSEDPKTGLKMYYYINDGFGNVKMDRIMAISERKAGVNNGRDFFDN"
     gene            <942805..>943290
                     /locus_tag="FOA43_000440"
                     /db_xref="GeneID:62193841"
     mRNA            <942805..>943290
                     /locus_tag="FOA43_000440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920771.1"
                     /db_xref="GeneID:62193841"
     CDS             942805..943290
                     /locus_tag="FOA43_000440"
                     /note="BUSCO:EOG09344D89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776699.1"
                     /db_xref="GeneID:62193841"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="InterPro:IPR023509"
                     /db_xref="PFAM:PF02580"
                     /translation="MKVVIQRVKEASVTVENEVISQIKRGLLLFVGICNEDTEEDVSK
                     LANKVLRLRVFEDSKEDAGTNTKWVGKPWAKSVTDLNGEILSVSQFTLYGSIKKGTKP
                     DFHKAKKGELAQVLYESFLKELRNGLGQEKVKDGQFGAMMEVSLVNDGPVTIVWDTRD
                     K"
     gene            complement(<943419..>944586)
                     /locus_tag="FOA43_000441"
                     /db_xref="GeneID:62193842"
     mRNA            complement(join(<943419..943469,943606..>944586))
                     /locus_tag="FOA43_000441"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920772.1"
                     /db_xref="GeneID:62193842"
     CDS             complement(join(943419..943469,943606..944586))
                     /locus_tag="FOA43_000441"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776700.1"
                     /db_xref="GeneID:62193842"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PFAM:PF00582"
                     /translation="MSKVPLLPINASVHPHSIDKAISGVSEDNLPPVEEAENEDALAE
                     ADANDEQFNEEIERRQLQELIEETGFMMMDYQMPVDTETQRNTLHNALLYQMSEEELR
                     EMDPKYISDSDTERLMMSPEVVSSPVMVDSVPSLPLSPISSSEFSVCSEGTDNAVNFH
                     RGVTLDTFNTTAHDLSKYQITLTLRHKDYKYTKSARTLICTYDEKQMSLAALRWTMKE
                     MVSDFDTLVVFSVLDPELDMALVRKNHRQRAEHLLNQILQLNERDQKIKIVLEFKVGN
                     VQYMVSKAMRDYDPTFLIVGTNGNEKTGFKSLIAPKSMSKSFLQLAKMPVISLRRILL
                     QVSVEGPGF"
     gene            <944819..>945913
                     /gene="DUG3"
                     /locus_tag="FOA43_000442"
                     /db_xref="GeneID:62193843"
     mRNA            <944819..>945913
                     /gene="DUG3"
                     /locus_tag="FOA43_000442"
                     /product="glutamine amidotransferase subunit"
                     /transcript_id="XM_038920773.1"
                     /db_xref="GeneID:62193843"
     CDS             944819..945913
                     /gene="DUG3"
                     /locus_tag="FOA43_000442"
                     /note="BUSCO:EOG09342KGC"
                     /codon_start=1
                     /product="glutamine amidotransferase subunit"
                     /protein_id="XP_038776701.1"
                     /db_xref="GeneID:62193843"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR026869"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="PFAM:PF13230"
                     /db_xref="PFAM:PF13522"
                     /translation="MNCCFSSFNMCRFLIYKGREPMLLSNLLTKPAHSIINQSFDSRL
                     RIDHQPINGDGFGVGYYTLEDEENEMNSGKVSGPCVYKAITPAWNNLNLQRLAEKTRS
                     RMIFAHVRSSTYGVLSETNCHPFTYHNLMFMHNGGICNFRKIKRRLMSHIEDEFFLTI
                     QGATDSECSFSLFLDTLYKMGYDPKLDRAIPAEIMRLALVKTIQYIKDWVTDLHLEDT
                     DPSLMNFAVTDGESIVVSRYVTSKTDEAASLYFSTGSKFIEVAQGQFKMERLNRSQDI
                     IMVASEPLTFERGDWISMPTNSTLTIRKQIVMLHPIIDEFYQENPTFIRSREFAESKG
                     LMGMIPKEDISDKEVPPLEREGRSRAGLTV"
     gene            complement(<946012..>946548)
                     /gene="TIM22"
                     /locus_tag="FOA43_000443"
                     /db_xref="GeneID:62193844"
     mRNA            complement(<946012..>946548)
                     /gene="TIM22"
                     /locus_tag="FOA43_000443"
                     /product="Mitochondrial import inner membrane translocase
                     subunit tim22"
                     /transcript_id="XM_038920774.1"
                     /db_xref="GeneID:62193844"
     CDS             complement(946012..946548)
                     /gene="TIM22"
                     /locus_tag="FOA43_000443"
                     /codon_start=1
                     /product="Mitochondrial import inner membrane translocase
                     subunit tim22"
                     /protein_id="XP_038776702.1"
                     /db_xref="GeneID:62193844"
                     /db_xref="PFAM:PF02466"
                     /translation="MENPFLPGKKKRTDEMTQEERAEYGAHQIMEFVASCPGKTVLSG
                     ASGFALGGFFGLFMVSMQYDQPLTGSVTHISELPLKQQMRLQMADMGKQTWRSAKNFG
                     YIGMLYSAVECVLQSFRAKEDLFNGAAAGCITGAGLAIKSGPTAALTGCAGFAAFSLA
                     IDTYMRSENGAPPPTDYD"
     gene            complement(<946687..>949863)
                     /locus_tag="FOA43_000444"
                     /db_xref="GeneID:62193845"
     mRNA            complement(<946687..>949863)
                     /locus_tag="FOA43_000444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920775.1"
                     /db_xref="GeneID:62193845"
     CDS             complement(946687..949863)
                     /locus_tag="FOA43_000444"
                     /note="CAZy:GT2_Chitin_synth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776703.1"
                     /db_xref="GeneID:62193845"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF01644"
                     /db_xref="PFAM:PF08407"
                     /db_xref="PFAM:PF13632"
                     /translation="MPHEIDLNGNPRNPWHNIIEELGDPEEQANQRNRQHLQPPRPYI
                     GDNTYIAADQRGHELIGFPEEVSQKATQAANHVTFRMPTKIYSPERYSVSSRNSNSIS
                     PTRKYDSQYSPSPTRPLLRSDVLGSGFKPAGISQGRTRIPDIPDMDGDTATETTCSSS
                     TKIPEPRQANEPSAGHIASPQNSDPFCGYDFDDGNSEKNGDDDEVRRHGTSDHSWQKE
                     GPEEFVPFPDLENSYYPINPPQDFYDPFSFESYYNDDGSAMESSSDDPTVKEKGEDDD
                     DMDQFMDLYENGEGQSDLAARQVRMVNGNLVLDCPVSDVLLNKYKVPLTERDREFLFM
                     RFQACTADPNEFLEKNFSLRQRFYTQPRGTEMLVVITMYNESEILLARTLKAVFKNIR
                     YLYSLKHSSTWGRDAWQKIVVCVVSDGRRKINLKSKALLAAMGVYQEGFAKNKINEDK
                     VVSHIYEYTTMVGISKIYRDHVTLTTENQVPVQMIFCLKEKNQQKINSHAWAFQAFAK
                     ILQPNIVTLVDVGTEPQTKSLYRLWKSFKDPRVAGACGEIKASLGAHDKLLLNPLVAA
                     QNFEYKTSNILDKPMESVFGFVTVLPGAFSAYRYQALLGAPLDKYFKGQDLKKSNDDG
                     IFNANMYLAEDRILCFELVAKKNCSWILKYVNSASAYTDVPEHLHELISQRRRWLNGS
                     FFSAIYSLCHFYRTWHTSHSLGRKILLHIEFSYQLLNLLVSWFSLGSYYLVFRTLTVY
                     LGDSDSNFAPGNVLSVIFLWIYLASLATTFVLALGNKPKGTKKFYLAIVWFFAILMIY
                     MIFAAIYMGIQAIQDILQEHSSDFKIKYLFTETRFRDLIVATSSTYLLYLVGFTMYLQ
                     PWHMFNSFIQYLLLSPSYTNVFNVYAFCNMHDISWGTRGEDNANDLGVAKTTKNATDG
                     ELEIVIPTTKHQIDMAYRKIVEELTTRDESPAEETLSMDEKTSFYYANMRSITLLVWL
                     FTNFVLVAVVTDTGGLSQLSSDSSDDDPLPMNKTFIFLTVILWIVAFMALFRFVGSST
                     YLILKLVDRFRLRKFRKSYSIRGAQYDV"
     gene            <950296..>951279
                     /gene="FSF1"
                     /locus_tag="FOA43_000445"
                     /db_xref="GeneID:62193846"
     mRNA            <950296..>951279
                     /gene="FSF1"
                     /locus_tag="FOA43_000445"
                     /product="Putative alpha-isopropylmalate carrier"
                     /transcript_id="XM_038920776.1"
                     /db_xref="GeneID:62193846"
     CDS             950296..951279
                     /gene="FSF1"
                     /locus_tag="FOA43_000445"
                     /note="BUSCO:EOG093436DC;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="Putative alpha-isopropylmalate carrier"
                     /protein_id="XP_038776704.1"
                     /db_xref="GeneID:62193846"
                     /db_xref="InterPro:IPR004686"
                     /db_xref="PFAM:PF03820"
                     /translation="MASSVPGPVVLPESRYDLSTYTGRVKHCAEISDPTLLLSSKTDI
                     QKSRQLIWDYKNGVIPRMTSELWRAKKILDSSVHPDTGETVFFPFRMSCCVLSNLVVT
                     AGMLTPGLGSVGTVFWQIANQSLNVAINTANGNKSHPLTTKQLVSSYFLAVGSSCGVA
                     LGLNSVIPKLKNVDVHTRLILGRLVPFAAVVAAGIVNVFLMRGEEIRQGISVFDNDGN
                     DIGSSKKAAFQAVGETAASRVINATPIMVIPPLILLRLQKGLLRGRGLGIQTVTNIGL
                     IAVTSFAVLPFALAIFPQRRIVNPDRLEDKFHNLKDKNGKVISAVQFNRGL"
     gene            <951457..>952254
                     /locus_tag="FOA43_000446"
                     /db_xref="GeneID:62193847"
     mRNA            <951457..>952254
                     /locus_tag="FOA43_000446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920777.1"
                     /db_xref="GeneID:62193847"
     CDS             951457..952254
                     /locus_tag="FOA43_000446"
                     /note="MEROPS:MER0069292;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776705.1"
                     /db_xref="GeneID:62193847"
                     /db_xref="InterPro:IPR013536"
                     /db_xref="PFAM:PF08325"
                     /translation="MVVKGKGRFPGRKPPKRPNKPSPTPLIGRIASLTRMPARDQALD
                     LLHDLARMAAPIMSCFGFKVGVLCEMFPKNGQLLGLNVNSGSKICIRLRPPHNKNWFL
                     PMNELVGTMLHELAHNQCGPHNDKFYEILDKLKNKYYEIQAKGSYQATGYLMENNRLG
                     RASLLGSSSTVREARLKKLGKPKYVSKVTKLGTLRTTKNSSKPIRQLILEATERRVKD
                     NKTCPSQMNQDDINQVVPRDEELNVVELDEEDDDEKKDGNPDLIIID"
     gene            complement(<952276..>956646)
                     /locus_tag="FOA43_000447"
                     /db_xref="GeneID:62193848"
     mRNA            complement(join(<952276..956422,956642..>956646))
                     /locus_tag="FOA43_000447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920778.1"
                     /db_xref="GeneID:62193848"
     CDS             complement(join(952276..956422,956642..956646))
                     /locus_tag="FOA43_000447"
                     /note="BUSCO:EOG093405X2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776706.1"
                     /db_xref="GeneID:62193848"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="InterPro:IPR014908"
                     /db_xref="PFAM:PF03177"
                     /db_xref="PFAM:PF08801"
                     /translation="MSPANTSSQLMKTHQSDGIDTGKLTTPPLSSSSPLALASGCVTN
                     AITKDNSMPPLYEALSKYAVDNYNYKPSNESLTPFSRFEKSNIFNIPDRIFQKYKSLD
                     CITNIGIFTELQKSWLTVDDKLIIWNYKAGSSEQEFFTIDDFKSTILTVALVKPKPKV
                     FVDSVNYLLLVSTSVNIHILAVQNTKDHLDVSDTKMSVSTQGLLVNKFVTYDATREIF
                     FTGAGDSEGIWRLNYSNDDEWFSRNCSKECLTKSSLSSVLPGVLRTFSGFGLIGGSSG
                     KNSRMETIIELKIDQSRGILYTLSSKSIVQAFRLKSDKGKTSLGSRLTKRSFDLLKEL
                     STTTINMQTPLLARNKMKMINIFPISKQENNNFFLVVVTDTGCRIFLNGSTLYGDRLT
                     LTASQVKFPPPDSRFYDNLEKKKEQQLIQQQNFINNNGFVPSASKSSITKNPMGSLVT
                     VRDLKQAQESSQLLTGLTNTMMIAPGIFIGFTKDKKVFSCVPDYGILKNSSQYIEDFE
                     FVDGFDKLHSIVQLTPSFNATNTPSGYCNEFASQYSSTPLKFAVLTSTGIHVYRYRTP
                     DLILEDSLDDKTFQEFSKKYGSNEACSSALYLACKYGKSENFRNLATKYFISGGENAR
                     LNKMVQPTLDDVELSDRFYALVILVSRLVRNFWDKEVFQLKPEVKFTRSGYIDINSVK
                     KMNNSKIILKGLSITKSQLEYFLCSILILVKYFKENGKLIPGLLNGFSQQMDSTSWKE
                     KESEVCLQAEQIGFSAMMNFLNTVKEGLSFLTILLDEDPKSKNFEATMNYLSVQSQAD
                     LSCLTFNEFFTCSNTYVSKLNKEILSAVINKSIASGNSVELVANTLQEKCGSFCSTGD
                     VLIFKAIESLKKSKDYANYNDQEMKMNYLRAAVKLLKKTSNSLTEETITDCVNIMLQL
                     EYYDGAVEFLLDVANNPEQAKLAIQYENEMQTQMVRDPKKKKMYERRLNLYQLVFQIL
                     ADIDKRTIMSLEKASAGNISATTHTVNGTADISGHVFVDKNGKLITQYSQMRTRCYNI
                     CLNYKDRMFHYEFYKWFISNGVGEKLLDIDTPYILDFLKDYASKDLEMAKLLWVYYSR
                     RDHYYEAAEVLYDLAVSSFPVNLSSRIEFLSRANGFCHCIPPQSLRQEVLILSSEISD
                     LMAVSNLQDELLLTVLQDTRVNSAARQNATLALDRGIHTISDLYNDFIDPLGYYELGL
                     ITFKISDYRNSEDILTKWESLFGKWYVEYKNKPNPASEPFFLELTNKFVLIAARLNDT
                     DVLFPILDLFQLLAKYIYSEDFSGNVRAPTGVIVDVFIKSEVKYGKLYYSLRSIIEST
                     TFEVFEGYTKILNDEMSYLIHSWYKNDKKLREIISDDSVKNLQTYSVEKDPIYEYIRT
                     TGNPL"
     gene            <956976..>958421
                     /locus_tag="FOA43_000448"
                     /db_xref="GeneID:62193849"
     mRNA            <956976..>958421
                     /locus_tag="FOA43_000448"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920779.1"
                     /db_xref="GeneID:62193849"
     CDS             956976..958421
                     /locus_tag="FOA43_000448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776707.1"
                     /db_xref="GeneID:62193849"
                     /db_xref="InterPro:IPR004887"
                     /db_xref="InterPro:IPR005615"
                     /db_xref="InterPro:IPR014042"
                     /db_xref="InterPro:IPR014049"
                     /db_xref="InterPro:IPR014709"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR037013"
                     /db_xref="PFAM:PF03199"
                     /db_xref="PFAM:PF03917"
                     /translation="MPLQFPQLHDEDESKLIHNLTQYGLSKGLIMYPISYQEYQVNLA
                     PLTLFPTPFPRSQFEKAKSLATAYSELYANVVSQHDWLINVIEALAPVDSSFTGMLYQ
                     SYLKAQKKGIVQPISLGIARSDYMYDTTTQQIKQVEFNTVSVSFAGLSRCVGQLHKFC
                     NDNGLYTSNGDAYYDDSDLPVSDSSLGLARGLRDGVSCYEAHHTDGYTKTIVLFVIQP
                     NERNAFDQRAIEYTLFDDFGIVSKRIDLARVTSEVVVDEISHRLYYEGREVSVVYYRS
                     GYSPHDFEVKEAWDCRVLLETTLAIKCPSLLAQLSGAKKIQQLLTDESILAKFYDKQD
                     KSELHSTFCKIYPLDDSARAAAAKKLAFECPENFVLKPQREGGGNNIYKEDIPGFLRS
                     IPEEEWSGYILMELIHPPVQKNILLRDGQLAKDGIVSELGIYSSFLFNEYSGEMINAA
                     YQGYLLRSKISSSNEGGVAAGYGCVDSIYLY"
     gene            complement(<958585..>959388)
                     /locus_tag="FOA43_000449"
                     /db_xref="GeneID:62193850"
     mRNA            complement(<958585..>959388)
                     /locus_tag="FOA43_000449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920780.1"
                     /db_xref="GeneID:62193850"
     CDS             complement(958585..959388)
                     /locus_tag="FOA43_000449"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776708.1"
                     /db_xref="GeneID:62193850"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR036361"
                     /db_xref="PFAM:PF02037"
                     /translation="MASTTARAKPTNSMNCSSRFSKFFHRTVHSTSKKETILFDLNNG
                     SKSKYGSMNCQGLKMELRRRGLKVSGKKLELIQRLCQADETRMSQGSNANTSSRAFST
                     TKVSNGRLPMKESKAKRQRTKKAKSIQQVAQFEIRKVSTLHKVPEKQAIASLTRSLSS
                     SSPVEAKDDTSNIDYFRPAKKEAPPVEHLKVPKVEKPEEEIYTKSGTQSFKAPQKPKE
                     PKESKGSKEPKEPGVEPNGSSDTRAATFWGVSGLLTLIWWSGRKRDGRQ"
     gene            <960169..>961260
                     /locus_tag="FOA43_000450"
                     /db_xref="GeneID:62193851"
     mRNA            <960169..>961260
                     /locus_tag="FOA43_000450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920781.1"
                     /db_xref="GeneID:62193851"
     CDS             960169..961260
                     /locus_tag="FOA43_000450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776709.1"
                     /db_xref="GeneID:62193851"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00107"
                     /db_xref="PFAM:PF01262"
                     /db_xref="PFAM:PF08240"
                     /translation="MMKALTYVRPGVIKYQDVEKPKLLQPTDVIGKTVVTTICGSDLH
                     ILSGAFPEFNKLAEKKAGRGFILGHEGIIKVEQIGSEVKNFKVGDVCIVSCITPCGEC
                     FYCKEGCEAHCTQNEGTCGCILGSEIDGTQADYVRVPLADNSLIKCPDNVKLESLLML
                     SDILPTSYELGVLDGGVKEGSTVAIVGMGPVGLAALISAKALNPDYIVAIDLNESRLK
                     TAKKLGADYTFNPSKDDVVKLVMGLPVKQGKLPGVDVAIECCGIPATFEMCQDIVGMN
                     GRIANVGVHSKSCKLAMEKLWVMNINISTGLVCGHSTKDLLRKVVSGELDPSSLITHR
                     FKLNEIEKAYDVFSNASETDAIKMLLIND"
     gene            <961404..>963677
                     /locus_tag="FOA43_000451"
                     /db_xref="GeneID:62193852"
     mRNA            <961404..>963677
                     /locus_tag="FOA43_000451"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920782.1"
                     /db_xref="GeneID:62193852"
     CDS             961404..963677
                     /locus_tag="FOA43_000451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776710.1"
                     /db_xref="GeneID:62193852"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="PFAM:PF00654"
                     /translation="MSPRYTSARQIKDDPRFSLIPVISYSSHSTTISSATLNDSDDIT
                     PPSGSPKYEENTFIDWQYEYARLNFPKRIWSQSASRFKRFENLSVRWLTLIISSIGTA
                     MVTLLIDYVGMLFHDIKFGICLDSFYRVRSKCYTKWSNWGPLFVSETLLQTIINFAVV
                     LITTTLLAIGAFKIAARHSDISKSGIAEMKMIVSGLFLPRFLNSSLIFSKIISLLMVI
                     ASGLWLGYEGPLVHIACALLSTCLDVFSRFGVGFTNEAIRREFLSSGFSIGIASAFNA
                     PIGGVLFGLEQIQSYFPVDKMMWNSFICTTIGVTVLQKLNPFKDVSVNDSFKVDFKNN
                     WLYFEAFVYIFLGLICGSLGILFNKLNTTFARFRKRHIGGSSGLRLTEVVVVAIVSNV
                     LAFCFNASHRSITEMMDLLFTDCADDPNSPLCSLDNTEGFPIKTLLVLLFLIVQGYFL
                     SAYTYGIFVPGGALIPALTVGALIGRFVGVLVEFIQYRFSDLSVFLHCYNEKISCISV
                     ASYAVVGSASFFAAVTKMSVASVVIVFELTGALNYIIPIMMGVFCAKVLNDLFLGKSI
                     YELWLIAENECYLPSNLEDTMTVSEMSMMSATQLMTSADDLEVIYDSRCITVQDLEDV
                     PASLYGHPILKSPSDPELIGYVTSFQIGQEVDRIHTNLTPTTDTNESVRNEAEDGNSN
                     GYFSLGQTMTPLADLFVVAPNFNLLTAYQAMDKLKLSNIFVCHAGTSNFRGVISKQDL
                     VQFVHLNDKKLKKEVGI"
     gene            complement(<963684..>964520)
                     /locus_tag="FOA43_000452"
                     /db_xref="GeneID:62193853"
     mRNA            complement(<963684..>964520)
                     /locus_tag="FOA43_000452"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920783.1"
                     /db_xref="GeneID:62193853"
     CDS             complement(963684..964520)
                     /locus_tag="FOA43_000452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776711.1"
                     /db_xref="GeneID:62193853"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="InterPro:IPR036570"
                     /db_xref="PFAM:PF02301"
                     /translation="MSLLRRTPSSRLPLSVSEDLINSFLFIAVSSVSYLRGLFDDLHF
                     VKTKYSFSKRYGREKNLSEALSVQLLKEGLSLEADTIILWLRNSVGEAIHRGYLQAVC
                     LTIILDNKSTQNVFESYTFSVNYERRDHYLTMVINDNELVVDDEKNAMMSLLKHLIAE
                     TQLLPALPPKRYLLMRLVLNKEAPKDYVPEHFKTMKNSSDSLKNPQYSTDCGSVKTIH
                     HEIRCELSSKICTNAASTLPNRNESDSDSELDTDVETEFPSIPYPMAQMTRHITNIGC
                     PK"
     gene            <964776..>966596
                     /locus_tag="FOA43_000453"
                     /db_xref="GeneID:62193854"
     mRNA            <964776..>966596
                     /locus_tag="FOA43_000453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920784.1"
                     /db_xref="GeneID:62193854"
     CDS             964776..966596
                     /locus_tag="FOA43_000453"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776712.1"
                     /db_xref="GeneID:62193854"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PFAM:PF01636"
                     /translation="MLSRGTGIALTAKRALGIGRISLIRGFRTTTSYKAKQDSSDEVF
                     TRLNDDTDPKRNKLFEYHWGTWMNNDAAEKQKRITKFSISGLNILTGVLEDVANAKDV
                     DKKGELKMMDGNVNVLTKNLKELTGSSFENIKQVVSIHEGMFHHVYLVNLNNGKSMIL
                     RLPYKLYPDYYTSRAVNSEVATTEFLREQLGLKVPKVLAYSGQFDNYLNYPFILSEYI
                     EGDLLMKDWYPLVEGKVEDKKVSNELHKVITPIFDFFKAVTKPVFTGYGSLYFKQDYP
                     QGKPAIDGQEKFVLGPTTLKPYYEKGSNLDQKEVDKFVGPWALDQPLKMVSDLAQVNI
                     ASLRKEQNNRHAEEALRVYKALLATGEKLFDLKSSSIPNFKEMIKPRLFIPDLDPMNV
                     ITSENGNYFVDFEDSTVTPFILNPAPKFVEYTGPKVFHLSEIPDLEKLDADLKDQYEY
                     MQKRTRNQVYWEKSLAENTSKLAISAAPAVKKIRESFTSALKDKNPKDYLNIEASLAD
                     LEMLWKSFSEDHVVGEGDCPIKFTEEDLDKFKEDFEDLQKDLSSTPFAATGGWVPQDV
                     FENLLNKGLIVKDGENYKIDIDKALKDAPTKEKDDGRAAN"
     gene            complement(<966692..>967189)
                     /locus_tag="FOA43_000454"
                     /db_xref="GeneID:62193855"
     mRNA            complement(<966692..>967189)
                     /locus_tag="FOA43_000454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920785.1"
                     /db_xref="GeneID:62193855"
     CDS             complement(966692..967189)
                     /locus_tag="FOA43_000454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776713.1"
                     /db_xref="GeneID:62193855"
                     /db_xref="InterPro:IPR008699"
                     /db_xref="PFAM:PF05821"
                     /translation="MFRQVTKSIVACNRRGIKDVCLQSKRFVSSKEEYELPKFLPDAE
                     KEFGVEVPKDYVPPQYRDPYKKYDDQQNRVNFGEKIHPFHDYMDMWSPDHFHPVRDRT
                     ALKQISVFFGCLGAFAAVIYLGDLWPDRPSMPRDYPYDGLYKDLGGRDGEEKLFQARP
                     DKGFK"
     gene            <967687..>972483
                     /locus_tag="FOA43_000455"
                     /db_xref="GeneID:62193856"
     mRNA            <967687..>972483
                     /locus_tag="FOA43_000455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920786.1"
                     /db_xref="GeneID:62193856"
     CDS             967687..972483
                     /locus_tag="FOA43_000455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776714.1"
                     /db_xref="GeneID:62193856"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR038718"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /translation="MPYSVKLESGRLANSGKRHQSNDTDTANRLAKRSKKDQNTSSAQ
                     SHYIEEITGSTNQGDSDSITISVNDSLKLPAYYSQSTILSHQRKVVDQESGKQKLCDL
                     LISNEKLIDELFHLRNYTSLVYFDPQKASEIRSSESFQRIEQEYQLWPEIEEKQRGRR
                     VSSRVMQHSDPLRLEIHNMLFERSKKTRTKLIEQVKEDKPKAMVKRETKSQGKVKKDE
                     EEEEEEKRDEEEEEEEEEEEEEKEVEEEEEDHNDESEEDSSFEMSSDDSVVHVSPLPE
                     NYHLPKKISLSYHIKPQRIAHPMFITRPKFKSLDEFLNSYKTTIEDPPRDLSIPEYNE
                     YLKSQEHLVDKIKDGLRRKLLKLDFNENIFRNVPSGSREPTIIKRNFQHNISHYKLPP
                     SPFRMKNELTHYDHIVAQGIKLSKVVHHMRTVKLQKGRKIAQMIENHFRRLSQEKERR
                     QREFHRKKLKLARDTAREVKKRWLIAVKAFKILEEREQERERAEQSKKQLSKILDQST
                     KVLGAQLTNKRSTSPRVLGAHDEASETDSSINDDDYFSSSTSNEEGDTDDNDLTMGEQ
                     TDGQINENSDDNLLTAEQLRQKYKVLVEADQEDAEESDDGENLPGSGLADLYGGNASH
                     VDLNPELASSEVSEREKQLLANETPDPLLEDEDNGDDDDDDFSDSTDDSGSLGDSEAE
                     SAVNSESGDVSLNGPTDHGLESLLDKNIDDSDDDSVYSEHDSDTPTSSPKDGSGKDES
                     SSIPDVPLPSLLRGTLRPYQKQGLNWLASLYNNGTNGILADEMGLGKTIQTIALIAYL
                     ACEKNEWGPHLIVVPTSVMLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWNTLDSF
                     HVCVTSYQLVVQDHAVFRRKKWQYMILDEAHNIKNFRSQRWRSLLNFNTEHRLLLTGT
                     PLQNNIVELWSLLYFLMPSSKTNQSMPEGFADLMNFQQWFGRPVDKIIQGGGLVNDKE
                     TRETVDKLHQVLRPYLLRRLKQDVEKQMPAKYEHIVYCRLSKRQRLLYDDFMSRAQTK
                     ETLASGNFLSIINCLMQLRKVCNHPDLFEVRPINTSFALKKSVTVDFLLKKMVVKRHM
                     KSDPFKKVDLNFLNLIPSQNYLLTSHELSGVKRLSASNIFAQRVKELKSKLEVEKSEP
                     SLANLEDYYKWLIYKQNNDLLEHTKHAMYVNSNNCNKAQIISSNLIKLLTVDRYSKQN
                     IEQLEELRAVKTIDFRSKLMSPIIENFTFITPKVTAEDMVDMCAPAELKREIQHAAQI
                     DQISNPFHQVQIKSSIAFPDKSLLQYDCGKLQKLAILLQELISNGHRVLIFTQMSKVL
                     DILEKFLNYNGYTYMRLDGATKIEDRQLMTERFNRDNRVNCFILSTRSGGLGINLTGA
                     DTVVFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEYTIESNILKKANQKRQLDN
                     VVIQEGDFTTDYFNKITVKDLLGEQSGAEEGDGTKSGVEGNYSKGNKVLLDNAGREDL
                     TKALEQAEDTEDAAAAEVAMKEVSLDTRDFEDDNKDSGRSPSVGTPMESDVTKSAEMA
                     QKIALKEETVEGHEPEQVYEDEDEDDGVGDVDEYMIRFIAGGFYFD"
     gene            <973371..>974417
                     /locus_tag="FOA43_000456"
                     /db_xref="GeneID:62193857"
     mRNA            <973371..>974417
                     /locus_tag="FOA43_000456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920787.1"
                     /db_xref="GeneID:62193857"
     CDS             973371..974417
                     /locus_tag="FOA43_000456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776715.1"
                     /db_xref="GeneID:62193857"
                     /db_xref="InterPro:IPR021211"
                     /db_xref="PFAM:PF10806"
                     /translation="MISLIAEINRFNSNFPLVTYAPIDNVSESFDSLESKREFKLVDE
                     EEEDNGNVNQYTKFKLGVYNVLPFNFDENILVTVDPLCFFALLLLASRSGCYLPKLGP
                     DTNSAGYANTRNGSIVSLAFGASPDGELPILIEDEIDKITKTVKRKVRRTTVVNKFAL
                     ASVTDTTELMYIKLVDTRLFDFYISRLTLTKDKSLIMRLYSLSGIEEKQQDISEKLVY
                     PSVMAHLVSRFQFDLRNPSIASAFNTGFFWFPSWIRPKYYTQSINEEYQRCKDEGIEA
                     LLQFERVYNDAGQKGFFFGSETNKPSVFDYKLAAMVYCILDLAEFVDEFAQVKVKCPG
                     LAFHCAAVMKTVMK"
     gene            <974519..>978714
                     /locus_tag="FOA43_000457"
                     /db_xref="GeneID:62193858"
     mRNA            join(<974519..977323,977375..977444,977585..>978714)
                     /locus_tag="FOA43_000457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920788.1"
                     /db_xref="GeneID:62193858"
     CDS             join(974519..977323,977375..977444,977585..978714)
                     /locus_tag="FOA43_000457"
                     /note="BUSCO:EOG093411JO"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776716.1"
                     /db_xref="GeneID:62193858"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="InterPro:IPR036420"
                     /db_xref="InterPro:IPR036599"
                     /db_xref="PFAM:PF01068"
                     /db_xref="PFAM:PF01987"
                     /db_xref="PFAM:PF04675"
                     /db_xref="PFAM:PF04679"
                     /db_xref="PFAM:PF09414"
                     /translation="MSDEAQLVSFSSLVVSKPQNHGGLPKFKQLVDDLFLPVERITRN
                     LQLGISLKKADVIERFIRNYRQTVGNDILPVAHLFFPKWDRDRVYMMKEYRLGHLVCQ
                     YLNLGKNSDDYKTIANWKRLSYNRVHATVKFSDLLVKVILERRVRPVIKDSLGVDDIN
                     DMLDKLQGFAQDSKLDQMKLIKEAIDRLTDSELRFFFRIVLKTDPIGSESVFLRCWHR
                     DAKKLYDLTHDLKLVFWGLSDPNFQLSDKEKEIQLMLPFTPQRCQRVRDQYVKIPSEN
                     FNDGPFFIEEKFDGERIQVHIKRVDGERFQFKYYTRNAMDYTSIYGEFSTSLRGCLSP
                     FLGPENFDLHMHSCILDGEMICYDPILKVPLPYSVLKTSALHSLSAKPGSKNPHPMFV
                     AFDCVFVNGESLEKYPLERRKKVLSYVLKKPIANLFVAADFIVARTGDEIEKAMDRAI
                     GMDSEGLVLKSIQSKYDIGATTKQWIKIKPEYLEEFGENLDLVVVGKIPGIKSSFLCG
                     LRDDNDSGCKFMTLCKISNGFSQDDYRHIDRVTAGKWKDINMDPPNDNLVKFGKTLPV
                     VWIDPRDSVVIEARARSITRQPEQEFYATDTTLYNAFCVKIRTDKDWKTASTLKEYEQ
                     SSNQSKLYNAQNVIGNESKKRRIGYPSKKITMLQKLNEEYEVGGLAPKSNLFESYIFS
                     IRTDCIYLGKLVRIRELNQIVSDNGGALARNPESVVLDTDKHERLMVIAEKMTIEVKD
                     LSNKYNVFRFKWCEDCLAVKELIEPDLTHILVAEPSLEEDCRKRLDKFGNNLVTPLTE
                     YTLWKMVPSEERNEVNLSQEELNRYHSFFVFYKMKFKVIFSAENARIGSIVAQEIEIN
                     GGKVCESLEEASMIVVVLFKVDKQNSFESYSSTTAIVQRTMRQRNELRKLCKRIPRVV
                     SHSYIRACTTSSSLVDPAEYKRAQFADLEACEQIEKLGKDGCLVIPPIIKASVVDDTD
                     VPGNVSTLKIARNEKYAIEFTKDEPVMETLGNPKSTLSLTIPPSVPVYVKRGSLISIF
                     MADSGANLDTAVTSTLRINQPIRRFLYGGFTSTYQRLLSTVSLNLMISAYSKGGPLSS
                     FMFSTKAQSTKTFCNIAMDGTMDWALLDPKSLHVYTGNNLLVTSQMLPKKTNGKKKLD
                     TGLYSLFQSGYTLLTGRGYVSLVGSGSIFKLGLARDEEIYIKQANLLATTIKDVSELS
                     SGYFIGKNIDNKTFAKSVKVKAKKEVGLGELETTKSRLSWFGAFKSMLVKVLSILASS
                     QARVSKLVAFNGRYIKVKGPRTLLIQTSSGLDKFVYNSTLLGRSKFRGSITDVEKFIR
                     NKQQLSKPETEIHK"
     gene            <978884..>979550
                     /locus_tag="FOA43_000458"
                     /db_xref="GeneID:62193859"
     mRNA            join(<978884..978899,978922..>979550)
                     /locus_tag="FOA43_000458"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920789.1"
                     /db_xref="GeneID:62193859"
     CDS             join(978884..978899,978922..979550)
                     /locus_tag="FOA43_000458"
                     /note="BUSCO:EOG09344BMW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776717.1"
                     /db_xref="GeneID:62193859"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="PFAM:PF03357"
                     /translation="MSGLETSFWTYTNRQLLADSLFQLKFTAKQLTRQAAKARKEEQR
                     EKGKVKKALIEGNNDIAQIYAQNAIRKGQEYLNLLRLSSRIDAVSSRIQTAVTMRSVT
                     GNMARVVNGMNKAMETMNLERITMVMDKFEEQFEDIESSTNYYETVSNEMNATQQPQD
                     QVELLMQQVADEAGVEMKHKINDAKVDNLKIPEQKEAVEQSEDKLSERLRVLRN"
     gene            <979815..>981503
                     /locus_tag="FOA43_000459"
                     /db_xref="GeneID:62193860"
     mRNA            join(<979815..979911,979969..>981503)
                     /locus_tag="FOA43_000459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920790.1"
                     /db_xref="GeneID:62193860"
     CDS             join(979815..979911,979969..981503)
                     /locus_tag="FOA43_000459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776718.1"
                     /db_xref="GeneID:62193860"
                     /db_xref="InterPro:IPR019194"
                     /db_xref="PFAM:PF09816"
                     /translation="MAPDNIIEDGKYEVDMSGLFCSQQLSDVFGIRFGFRPETIDDSY
                     SSLLVKDVDDDLYILKTEAKENTKAVTSLSHDRSTRQDHILFEGKMPQSTIAAKRTVS
                     HSSTLSSPSSPSLSAGSPSIARGLAVTNPYNTPLAMSSLSDFILLYDDVAKKFRMERF
                     NGVIKLSKSREPEVLEKRLRDIEKKRLSSSLNPLGSTTSVVDSLLQSAKLDDTAATFS
                     QHINRISFLKKKSSSVPPQISDLVRPSSYVNSPSLSDSNSVSPLKIVKPKIKQRRRQK
                     QKQKSELLRAAQRAVAKSPRMFTSGESKLTRKVATRIKGTKGGDVKIVTSGPSKSGST
                     TGSPERSSNAVSDSEVSENSSSQSTEHVMSDEDLAEFADELEEELDEDHKGATSVSRS
                     IDDVLEKVTNKNSKLDDLKNTGLGGLFHVTVEDNPRRKNSLRPTMTTAYASDSASSIV
                     SPLPRGPISMRKLAVTGNLISRGSTPLGLSSPNIRIDTPNLGDEISSPDSSPLHGATT
                     TRKIQDKAKDDEIDFDEEELDRALDDLDDEISEAE"
     gene            <981717..>983642
                     /locus_tag="FOA43_000460"
                     /db_xref="GeneID:62193861"
     mRNA            <981717..>983642
                     /locus_tag="FOA43_000460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920791.1"
                     /db_xref="GeneID:62193861"
     CDS             981717..983642
                     /locus_tag="FOA43_000460"
                     /note="BUSCO:EOG09341LTA;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776719.1"
                     /db_xref="GeneID:62193861"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="PFAM:PF00171"
                     /translation="MSNFTDFVSQVNQSIHSVNVTELTRALLATNFTNSKLFTTSDSI
                     FPVQISLSVILGLIPIIVFLLRRSKKNIEKPTKFEFPAPEEAKPNWKGRRLVPADIYQ
                     ENDPDNIYCYCPATAQYLGKFKSNTKEEVDVAIAHCRKAQQNFYRDPEFSLKRRKVLR
                     TLNEFIIRNQETIARVACRDSGKTMVDASMGEIMVTLEKINWILNNGEAALKPSRRPG
                     PSSMLMKYKTAEVWYEPRGVVGALVSWNYPFHNMLNPVVAAIFSGNGIVVKCSERVRW
                     SSEYFVNLVKTALRVCDIDDDLVQLICCWGKDGDLVSGNPGFDHLTFIGSIPVAKHVL
                     RAASEVVTPVVVELGGKDAVLICEDYLKKKGVNGIASVVMRGTFQSAGQNCIGIERVI
                     VSGDSDNYERFVQELAKKVATLRVGSAIDQNEEIDMGAMIMGGAKFDELESWVEEAVK
                     HGARLLHGGKRYTHPNYPQGHYFEPTLLVDVDPTCKLATNEVFGPVLCVIHAKDDDEA
                     LNLANSTIFGLGGSVFSTNFARAKRLTAGMRAGNVAINDFATFYVCQLPFGGVGGSGY
                     GKFGGEEGLRGLCLEKSVCYDKTSLISTSIPNVIDYPISNGKKAWKFVSALCKAGYDY
                     SAWQRVKAVVTLAKNAN"
     gene            complement(<983706..>984476)
                     /locus_tag="FOA43_000461"
                     /db_xref="GeneID:62193862"
     mRNA            complement(<983706..>984476)
                     /locus_tag="FOA43_000461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920792.1"
                     /db_xref="GeneID:62193862"
     CDS             complement(983706..984476)
                     /locus_tag="FOA43_000461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776720.1"
                     /db_xref="GeneID:62193862"
                     /db_xref="InterPro:IPR023584"
                     /db_xref="InterPro:IPR036191"
                     /db_xref="PFAM:PF01765"
                     /translation="MFRSYRTLFSRRVARNGVLKRLSGVPKIEVRLFTNSSYALGKKK
                     KSRKGGNKKGEQQQEENEPTEEIDTRQILKQADNEFQKSIEEYGKRATQVKMGKADPD
                     IFNSLEIALTNKRRANFQQVAQTTMKGGKFLTVTVFDPNDTKSVISAILGTNLNLNPE
                     VDSKNSQLLKVLLPNSTKELKTKQLKELKELTDDFKTAHNNKFSLVHLRGKYMKLIKN
                     VEGSEDVVRKVENDIEKLYKNYASKLSDAYKASERSLR"
     gene            <984929..>986970
                     /locus_tag="FOA43_000462"
                     /db_xref="GeneID:62193863"
     mRNA            join(<984929..984934,985024..>986970)
                     /locus_tag="FOA43_000462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920793.1"
                     /db_xref="GeneID:62193863"
     CDS             join(984929..984934,985024..986970)
                     /locus_tag="FOA43_000462"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776721.1"
                     /db_xref="GeneID:62193863"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR035899"
                     /db_xref="PFAM:PF00621"
                     /translation="MVCSSGSILMGNLSSPEPIAGKVSTATATDTILSTPASKITQLP
                     SSGLIKRSFSRLKQVKELLNTERVYIQSLEILRSTYLQGIMADLETPLYFRTFKRVVA
                     KLIHTHTIFLNKVSSIYVIWGKHTSSALQEPAIASPDFETFQVPFNETPYLEQIFTLV
                     SEDAIDVTSYCSYCSLFSRVLEFCKDKNVDKYKRLSIKIKNDYLVKHIDSTRAEYVVD
                     QSLDIRFISLIQMPTARFTRYALIIRSLMDKVRQDDPDGELFGKGQEVIDCLTEKCLS
                     INSYIGFAQEKQNKLRLFKQLSNGAVEKLMGPIFPENLGAAIFSGGCGTVWIEDNVVV
                     YEYVGLFLFDTHILITKPHHFGQPQVRFIIPISSLLNSFQREEIEVTRLFTRYPFHLK
                     LRFEENYRQYEVVLILPSEYEKSIWISKIKKRVRKWRKRISDTEFGYSDFVRSRPFTE
                     SGSKPFVFSGHLPNQLGYYKEKEGEYNEELEKTHIFVVRHFLTRINECDQDDIISSAQ
                     EIKHVSAVLVSVRRDHRTFMEKSIGSLWSKELPLYHLEGGRLSRSVSAISLRKMISEE
                     TQSIFSKFTADDRGNDDDERKETKHHVRFHQSLRELKNIILPFPSLAPNPAMNFRDDK
                     ARLRGRNQAKGSWSVVRGMMGLSTRK"
     gene            complement(<987019..>987533)
                     /locus_tag="FOA43_000463"
                     /db_xref="GeneID:62193864"
     mRNA            complement(join(<987019..987350,987527..>987533))
                     /locus_tag="FOA43_000463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920794.1"
                     /db_xref="GeneID:62193864"
     CDS             complement(join(987019..987350,987527..987533))
                     /locus_tag="FOA43_000463"
                     /note="BUSCO:EOG09344GRH;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776722.1"
                     /db_xref="GeneID:62193864"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="InterPro:IPR036786"
                     /db_xref="PFAM:PF01172"
                     /translation="MNVFYKGDKMDLFVFLDSEEAYHKWLKGDKTVPLSDVLSTFNVY
                     TYLTKIGSEGVLLAASKQMMSEEFGNFESVEDEIIPKILREGKVQRKKIEEGKDMKKR
                     RNSRSSNKKK"
     gene            <988096..>990585
                     /locus_tag="FOA43_000464"
                     /db_xref="GeneID:62193865"
     mRNA            <988096..>990585
                     /locus_tag="FOA43_000464"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920795.1"
                     /db_xref="GeneID:62193865"
     CDS             988096..990585
                     /locus_tag="FOA43_000464"
                     /note="BUSCO:EOG09340HVW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776723.1"
                     /db_xref="GeneID:62193865"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030381"
                     /db_xref="PFAM:PF00350"
                     /db_xref="PFAM:PF01926"
                     /translation="MSSLQARTTVRTISFIGLGKAASKTVKLPAYIGGGLAAAGSYVM
                     YKFEQVQTFTSDKLDKMKGFAGNIRDGIGSIFGRGGRENGKDNGGSGDGDDAATAGVA
                     AAAVGVGFDGDDEGNLNENGEISDDDEDEDAEREQEQHLDDAMVNLTKQMIEIRSLLM
                     SIDGATALTLPAIVVIGSQSSGKSSVLESIVGQEFLPKGSNMVTRRPIELTLVNDPSQ
                     AAEVAEFPALKLYNMTDFQQVQKILRDLNLAVPDEETVSGDPIQLTIRSPKVPDLSLV
                     DLPGYIQVEAADQPASLKEKIREVCGRYLDEPNIILAISSADVDLANSSALRAAKRSD
                     PKGERTIGVITKLDLVSPEDGRALLTNRKYPLKMGYVGVITRAPNSGSIFRRKTGSQA
                     YLAQQSFEKSYFKDNKEEFLGTSIGTKVLKRRLMKVLESSMARALKPMHDKVANELEE
                     ASYQFKVEFNDRDLTSEKYMAQTIDNLKLVVKEFSERFGRPELKSLLRSELDQRVLDL
                     LAQRYWNKPPVTAKKQQQEQQSEFNEPSLEELANLSVDDSYWRRKLELSTASLTKLGV
                     GRLSTSLVSDALLAEIGVMLDNSELRTHPGMKDAIRDAAAAVLVKRYNSTSDQVENCI
                     KPYKYEIDVEPREWTMSRQHAVGLLREELKQCNDAYRDLKRTVGGNKLKQIMTFLENE
                     DNSVGESIAKENIGFSPGLMLRGKEALFLRDRSILLSMRLKFLRSSACKNKDNKYRCP
                     EAFMDVVADKLTQTAVLFLNVELLSDFYYSFPRELESKLSSGLTKEQIDAYAKEDPKV
                     KRHIELQEKKELLELALGKIEDVMALRKQIS"
     gene            <991038..>992675
                     /gene="SRP1"
                     /locus_tag="FOA43_000465"
                     /db_xref="GeneID:62193866"
     mRNA            <991038..>992675
                     /gene="SRP1"
                     /locus_tag="FOA43_000465"
                     /product="Importin alpha subunit (Karyopherin alpha
                     subunit) (Serine-rich RNA polymerase I suppressor
                     protein)"
                     /transcript_id="XM_038920796.1"
                     /db_xref="GeneID:62193866"
     CDS             991038..992675
                     /gene="SRP1"
                     /locus_tag="FOA43_000465"
                     /note="BUSCO:EOG09341G0Z;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="Importin alpha subunit (Karyopherin alpha
                     subunit) (Serine-rich RNA polymerase I suppressor
                     protein)"
                     /protein_id="XP_038776724.1"
                     /db_xref="GeneID:62193866"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR002652"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024931"
                     /db_xref="InterPro:IPR032413"
                     /db_xref="InterPro:IPR036975"
                     /db_xref="PFAM:PF00514"
                     /db_xref="PFAM:PF01749"
                     /db_xref="PFAM:PF16186"
                     /translation="MDSTDTTRYVPEYRKANFKNKNRFQQDEVRRRRETQQVELRKQK
                     REELLTKRRNFNSSDISKENDSDSEEDTDTSNGEHLFYSQLQEVLPKMMEDVTSADLE
                     RQLESTIKFRQILSKEHNPPIDLVIETGVVPKLVEFMKAGPEVLQLEAAWALTNIASG
                     SSEQTKVVVDAGAVPLFVELLYSQSMEVKEQAIWALGNVAGDSSAYRDYVLSCNAMDP
                     VLSLFQCSKMSLIRTATWTLSNLCRGKNPQPDWQIVKSALPTLAKLIFSVDVETLIDA
                     CWAISYLSDGTTDAIQAVCDARIPKRLVELLGHESTLVQTPALRAVGNIVTGNDLQTQ
                     IVINAGVLTALAPLLRSSKESIRKEACWTISNITAGNTDQIQAVIDANLIPQIIKLLA
                     TGDYKTKKEACWAISNASSGGLTRPDQIRYLVSQGCIKPLCDLLAIADNKVIEVALDA
                     LENILKVGEMEKEARGASINENAIFIEEAGGAEKIFECQNNENDKIYSKAYHIIETYF
                     NGDDNDEEANELQPEMAGDQFGFGVNDNYQQGGFNFN"
     gene            complement(<992999..>993376)
                     /locus_tag="FOA43_000466"
                     /db_xref="GeneID:62193867"
     mRNA            complement(<992999..>993376)
                     /locus_tag="FOA43_000466"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920797.1"
                     /db_xref="GeneID:62193867"
     CDS             complement(992999..993376)
                     /locus_tag="FOA43_000466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776725.1"
                     /db_xref="GeneID:62193867"
                     /translation="MKFSTFVIGAAALNCMAFVSADKTPTGTTTVTKTYPNTHTKGRF
                     NNTHGQNHKTTTTTGTHTKGRFNNTHHALATTTVTVASNSNSTIAASSTGAASSSSNG
                     ANSKAAIGISVGGVAAIAIALLM"
     gene            complement(<994034..>995083)
                     /locus_tag="FOA43_000467"
                     /db_xref="GeneID:62193868"
     mRNA            complement(<994034..>995083)
                     /locus_tag="FOA43_000467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920798.1"
                     /db_xref="GeneID:62193868"
     CDS             complement(994034..995083)
                     /locus_tag="FOA43_000467"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776726.1"
                     /db_xref="GeneID:62193868"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="PFAM:PF00962"
                     /translation="MTVEPNRHLYEICHNVPKVELHCHLFGTIRKNTFLEFNERAGKP
                     FTDKEILAFYIRGEKPVGVLRAFRTLDSRLIKYARDLYRLTFEYLEDAKSHNIHYTEF
                     SWNPTGTVISSGIPFKDAQRAIADAIEEAHSKLRITGRLICAIDREDSPERAVQMVDW
                     MIANPDPIHTIGIGIDYRETNRGPQLFFDAYARAKEYGFKLTAHAGEFETPWQNVQYA
                     VNSLQVDRVDHGYSMLHNPELVQQILKEQKVITVVPTNSYYLRTLPRSQWASKHPIRQ
                     MIKLGLKIHPNSDDPTLHDSNSTKDWMMMVECFGATIEDLERFSLNGIDGCWAPDESK
                     LQWREDIKDFFKHYK"
     gene            <996708..>998147
                     /locus_tag="FOA43_000468"
                     /db_xref="GeneID:62193869"
     mRNA            <996708..>998147
                     /locus_tag="FOA43_000468"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920799.1"
                     /db_xref="GeneID:62193869"
     CDS             996708..998147
                     /locus_tag="FOA43_000468"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776727.1"
                     /db_xref="GeneID:62193869"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MDSEKDAKTSSMEEEVKAIEAPAFVDVKHMFRKVDFVLLPIMMF
                     TYAVQFMDKLALSAGSVFGLRTDLKLVNQDYSWASSIFFFGFMLGNFFVVRLIHLVKI
                     GRFVSFVICAWGITLACSTASQNYAGLLVARFVLGFLESAISPTFVFITSMWWTQKQQ
                     AVRTNLWFAGNDIGGVLNSLIAFGLGHANGPWSPWRYIFLTYGLMAFVWSFVILFFLP
                     DSPQNARFLNQGEKQYYQKEMKSSKVDKKWDWGQAKSAFTDIQVWLLLFSTVLCVLPN
                     AGITSYGFIILDSFGFTSIQSTLLNLALSIFTWFAIALAGYLASRFKNARCYVIWLCL
                     VFAITGGCLIYKGNSKGVKLLGYFLVDVQPAILPLLLGMAASNFRGTTRRSTVNSAIF
                     IIYCACNIGGPQLFQSSDAPHYPHAFLSWIICYCLNVVFTLLIRLAAIRANKKLEKLA
                     AEFVPVVEEEIEVEKELVEYEDPSFRYKY"
     gene            <998220..>1001581
                     /locus_tag="FOA43_000469"
                     /db_xref="GeneID:62193870"
     mRNA            join(<998220..998227,998788..>1001581)
                     /locus_tag="FOA43_000469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920800.1"
                     /db_xref="GeneID:62193870"
     CDS             join(998220..998227,998788..1001581)
                     /locus_tag="FOA43_000469"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776728.1"
                     /db_xref="GeneID:62193870"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="PFAM:PF03178"
                     /translation="MASMSLVLQDEIEHPGVIIASFGFKTEVDGDSTNDHVFMIRPFL
                     VELHRLNLKKQTTSVISKFETKYRIVAANHILSDGQKGEWLLLLNELNQLMVVSPTLI
                     DSNQLKLTVIQTFHIHDYLNRQNNVVDVDKGILTVPSSTPSLEVDPQQRFIIVHSCRC
                     FLLVFELRPSKLDLAERASKNRPPKQVEKNSKAALLNAFKVFEDPYVVTVGSDPIISI
                     RFLSGPSEVDNVNNFWFGMITRDISLRYSLEWYRIYKLRRLSVKKVKKMTPLDSKPTL
                     VYSLSGCNALLIVCGLIQYCYPAPNCEMHCQLDDVKTVGSYAKKRFVTVEASSVAVFV
                     SACNISTTRLLLCSQKGGYYILEVKEKTEKSRTNNSSISERLDPDKMILPSEKNECFD
                     LEKWEVCKCGEEGLRCDYLIGTSAKDSFFGVSALGSFGFSKISSPSQSLKTVTTYQCL
                     PVIFLSSHNSQRMMYAKGNYQGTYLNYGEETLNIPDAAVRKVILMDSTLFGLLFVVLT
                     ESHIADDTNDPDSMNIQDRITIYDSNFKKISCYEFDPGRNCVDLLSLEGFKCHLDEND
                     ESLTGLDNQMSNSFLAVSTFLDDTNVEKSEILFFIIEDDSADMLRLSTMAILNKELNQ
                     ILKLNENKCLLLGPHSMFWITITASQKEESICYKIVLASKCLGLPCGYITQVAKLDSD
                     GKELLVADSIEGLYYVKFHDSADKITKVTRILSGVNITTFAMICRDGIAVCDLLGNFY
                     LLLIDDKKQLSIVTQLNLMAGAIGAIDSTLTMRDVRLKDLFSNESAKSSICTVGTNEG
                     AVIGIYGVGRNHNINTLTNYQSYLGVHYSNLIDTDPNKNEDNEKKKWKTMELPSSTKE
                     AKMNLEVHTQMTLDSWYQNESFIEQKFLRLLPGYNFLRIHNAFENTLPEISIVDIRYI
                     KLKTILYGVTKPKDIEDFD"
     gene            <1001750..>1003519
                     /locus_tag="FOA43_000470"
                     /db_xref="GeneID:62193871"
     mRNA            <1001750..>1003519
                     /locus_tag="FOA43_000470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920801.1"
                     /db_xref="GeneID:62193871"
     CDS             1001750..1003519
                     /locus_tag="FOA43_000470"
                     /note="BUSCO:EOG093419OA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776729.1"
                     /db_xref="GeneID:62193871"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="InterPro:IPR007010"
                     /db_xref="InterPro:IPR007012"
                     /db_xref="InterPro:IPR011068"
                     /db_xref="InterPro:IPR014492"
                     /db_xref="PFAM:PF01909"
                     /db_xref="PFAM:PF04926"
                     /db_xref="PFAM:PF04928"
                     /translation="MSVSVPVKQYGVTPPISTAASTPEQVKLNDAMIEELRNQGSFET
                     EAGVLKRREILATLQTLVEEFVYTVSRKKNMSEGMSKDAGGKLFTFGSYRLGVYGPGS
                     DIDTLVVVPKHVTREDFFTIFDQIIRKRPELQNIQSVPDAYVPILKTVFDGVDIDIIC
                     SRLDVPQVPLDMSLKDNNLLRNIDDKDLRALNGTRVTDLILQLVPQKTVFRAALRTIK
                     LWAKKRAIYANMFGFPGGVAWAMLVARICQLYPNAVGAVIVEKFFHIYLQWKWPQPVV
                     LQQIGDGPLPVRVWNPQLYGQDRSHIMPVITPAYPSMCATHNIGASTQAIILEEIRRA
                     SEIVTDIESGNKKWNALFEKHDFFYRYKFYLTVITATKGSYEEHLKWSGMVESKLRLL
                     VQRLEPIEGIVLVHPYVKPMMNAYLSKEESDLFKMKELYGTLEGEKFAKDHLEEFKID
                     DDTDVKKIEEEAAKANKHIVYLMKLYIGLKLDMKGTNKKLDIQVPCSEFDMICRGWPA
                     FDQDKNSLSIRHVKLWNLPNDVYEEDEKRPVKRSKRKASEHQSNGESTHKKLKGDTSS
                     SSAATQVQAGAPPSSGVVANAST"
     gene            <1003665..>1005194
                     /locus_tag="FOA43_000471"
                     /db_xref="GeneID:62193872"
     mRNA            join(<1003665..1003670,1003806..>1005194)
                     /locus_tag="FOA43_000471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920802.1"
                     /db_xref="GeneID:62193872"
     CDS             join(1003665..1003670,1003806..1005194)
                     /locus_tag="FOA43_000471"
                     /note="BUSCO:EOG09342G92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776730.1"
                     /db_xref="GeneID:62193872"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="InterPro:IPR037239"
                     /db_xref="PFAM:PF01237"
                     /translation="MKTESTAMPSFTSKLLGRSSSDSKKTSVSSSRKNTSASTTNTNG
                     CENVDDIDEVDEQGQSILLGIIAQLRPGCDLSRITLPTFILERKSLLERITSQLQQPD
                     IVMKAEATRDDSLERFLLVVKWYMSCWHIAPKAVKKPLNPILGEFFTCYWDLPNGEQA
                     YYISEQTSHHPPKSSYFYTIPSSNLRVDGIVIPKSRFLGNSTAAIMDGVTRLSFMDIR
                     DPETGEPETYTLTQPNMYGRGILFGSLKFELGDHMVVKCPSTGYEADIEFKTKGFISG
                     TYNAIHGVIIDTRTDETLYEITGKWNEQMYIKDLDSDEKKIFWDCDEANPLRPKVRPL
                     EEQGDYESRKLWKKVTDALADRDHKIATDEKFKIEEEQRKEATAREEEGVEFHPKLFK
                     PLSIEESVEDGNDKLEFIIYKDRSLDKDFAEHDTESIKKHIFEMAPILPGQKFDKQFR
                     IPAYEKIADQPGEE"
     gene            complement(<1005216..>1006340)
                     /locus_tag="FOA43_000472"
                     /db_xref="GeneID:62193873"
     mRNA            complement(<1005216..>1006340)
                     /locus_tag="FOA43_000472"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920803.1"
                     /db_xref="GeneID:62193873"
     CDS             complement(1005216..1006340)
                     /locus_tag="FOA43_000472"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776731.1"
                     /db_xref="GeneID:62193873"
                     /translation="MSLEVTQQLLSVLSDEITLYKCVQCVADSDVNQDSSLGSLFKAE
                     TFPHKYDPKKNILDILVEKSQLAQCFVECYKYLYMGEDGDDKLKYFAALGILLVTPED
                     HTAMKYVSSIRGPQYQQDFQFRIICAYLTSSIAKTNKSSSLWVCFRRLLVKLMEDDRC
                     NVGPLSRVTLKIILISVKVHPRNYYAFNTLRFLIAMLRDNGDRSLLNYYEASIMEYLK
                     TDGLDDYSMWMALVQLATGLSTEEYYLKEFRRYCSYKWDAEFIEYRYTNDSYSDLVNW
                     LRGSEYKYYSGWYAALIISTNMGNDLPDLEMYFELSYINFENSHSCIIESRTEILRDK
                     NSGDAINLDEDLLLKEKFTKNLAFKKICTQKAKESTEQVS"
     gene            complement(<1006525..>1009755)
                     /gene="CRM1"
                     /locus_tag="FOA43_000473"
                     /db_xref="GeneID:62193874"
     mRNA            complement(<1006525..>1009755)
                     /gene="CRM1"
                     /locus_tag="FOA43_000473"
                     /product="Karyopherin transporter"
                     /transcript_id="XM_038920804.1"
                     /db_xref="GeneID:62193874"
     CDS             complement(1006525..1009755)
                     /gene="CRM1"
                     /locus_tag="FOA43_000473"
                     /note="BUSCO:EOG093407XD"
                     /codon_start=1
                     /product="Karyopherin transporter"
                     /protein_id="XP_038776732.1"
                     /db_xref="GeneID:62193874"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR014877"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF03810"
                     /db_xref="PFAM:PF08389"
                     /db_xref="PFAM:PF08767"
                     /db_xref="PFAM:PF18777"
                     /db_xref="PFAM:PF18784"
                     /db_xref="PFAM:PF18787"
                     /translation="MESILDFSKDLDIRLLDQIVETFYRGSGEEQKQAQEILTKFQNH
                     PESWTRADQILQFATDTETKYIGLSILDNLIKTRWKALPDPQRQGIRNFVASMIIAMC
                     EDDAQFEAQSALINKCDLTLVQILKQDWPQNWPNFIPELVQSSRAGYNVCENNMRILR
                     LLSEEIFDYSADQMTQAKATALKTRLCDEFGEIFKLCFEILDKATRPSVILATLNALQ
                     KYMPWIPLGFVFETELLDLIAGKFLPEDGFRRAAIKCLTEVSQLVAPQYNQRFVQMFG
                     LALQAINKAIPSGSDLRAIYRRAGTSEQQFLQDLAVFLVTFLGNHLQPLETPAVLREL
                     LLGAHTYLIGLSRIEERELFKTCLDYWSQLVAGLYDEIRDLPRQLAQSPLQQLQYNPR
                     VGAPDPSIFEGRELRRNLYQDILSKLRLVVIENMARPEEVLIVENDEGEIVREFVKES
                     DTIQLYKAMRQVLVYLTHLDVKDTENILSAKLNAQIDGSEWSWHNINTLCWAIGSISG
                     SMDEEREKRFLVTVIKDLLALTEMKRGKSNKAVVASNIMYIVGQYPRFLKAHWKFLKT
                     VVNKLFEFMHETHEGVQDMACDTFIKISNKCRRHFVIQQPGETEPFIDEIIRNIQETT
                     ADLQPQQVHSFYKACGIIVSAQNTQVPRARLLANLMHLPNVAWHTVVRQAGEDPNLLS
                     NPDIVKIIANILKTNVAVCTPLGPGFLPQLAGIFNDMLSLYGAVSSLISSAVATDGPV
                     ATKTPKVRGWRTIKKEILTLLEIYISKATDEQQIVTDLVPNLLSTVLQDYKESVPDAR
                     DAEVLNCLSTLVAKIGRRIPSETVEILGAVFATTLDMINKDFTEYPEHRVEFYKLLRE
                     IDLQGFEALLQFPPESFQSFVDAILWALKHNNREVENTGLTLCVELLDNIEQLGPSNA
                     FALGFYRNYFFSIISDIFYVLTDSDHKAGFRLQAQLLSKMIELVCENKIADSIYPEGS
                     APKGTANHVYLKEYLGNMLMQAFPQLRKEQVANFLQVLFSSYNNKAKFRGVLRDFLVQ
                     TKEVGGDPTDYLFADEKEEELKQKALEEKEKARMVGGLLKPSEMED"
     gene            complement(<1010053..>1011054)
                     /locus_tag="FOA43_000474"
                     /db_xref="GeneID:62193875"
     mRNA            complement(<1010053..>1011054)
                     /locus_tag="FOA43_000474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920805.1"
                     /db_xref="GeneID:62193875"
     CDS             complement(1010053..1011054)
                     /locus_tag="FOA43_000474"
                     /note="BUSCO:EOG09343KZ5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776733.1"
                     /db_xref="GeneID:62193875"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR016478"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF01926"
                     /translation="MSTIRQAFKPRMIFPEYRVNLADFKGHQSKALSRMKELSPQLDL
                     ILELRDARAPVSTSNPLLHRVFRDKEKLILYTKRDLSSMTASLLDKWHEPLHENWRFI
                     DCRSSNDIHKLLASIKKQYDSMYPRPPLGLRLMVVGMPNVGKSTLVNSLRGIGLNQKK
                     KSVARVGSNAGITRSTSEIIRVSRDPEILLYDTPGVLLPQVKQIKTMLSLSLIGTVSK
                     VNQADPVITADYMLYVMNLTDSSGKRYGKYLDHPTNDIYELLGAMAKKNGNYKRFKGE
                     SEKKLNYLSCAMELIQSIQIGKFGKWCFDIDALRELQRGILPQIDHAPNWAHNSFIS"
     gene            <1011203..>1012087
                     /locus_tag="FOA43_000475"
                     /db_xref="GeneID:62193876"
     mRNA            <1011203..>1012087
                     /locus_tag="FOA43_000475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920806.1"
                     /db_xref="GeneID:62193876"
     CDS             1011203..1012087
                     /locus_tag="FOA43_000475"
                     /note="BUSCO:EOG0934358U"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776734.1"
                     /db_xref="GeneID:62193876"
                     /db_xref="InterPro:IPR013641"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF08433"
                     /db_xref="PFAM:PF13671"
                     /translation="MPLILFVGYPSSGKTRFARKLCEQLKQKISSLNLTEPGAGMKVI
                     LHNDETLRINHQMYKESTSEKAARGEQMSAVKRDLSKNNIVILDGLNYIKGFRYQLFC
                     ETKNLSTTYCVIQVIAPNSVCFQWNQDRPETDRWDSSLVKELIMRFEEPDGRNRWDSP
                     LIPISYDDEEVPFDDVWTSVILKKPPKPNQSTFLKPAAASDYLQELDRLTSKVVDSVI
                     QYQNLNQIGGKVLIKAKNERTDAQSIYINMPAVNVSIAQLQRLRRTYVSMNRMRSIDN
                     QSIIPLFVQFIDHALNTD"
     gene            <1012379..>1015772
                     /locus_tag="FOA43_000476"
                     /db_xref="GeneID:62193877"
     mRNA            join(<1012379..1012383,1012454..>1015772)
                     /locus_tag="FOA43_000476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920807.1"
                     /db_xref="GeneID:62193877"
     CDS             join(1012379..1012383,1012454..1015772)
                     /locus_tag="FOA43_000476"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776735.1"
                     /db_xref="GeneID:62193877"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="PFAM:PF13638"
                     /translation="MGHGSHSSIVQYQIKRGTPFQENSTPTQPAFELPYSPAAAKQMN
                     TEISPNGSTSESRGITPILTGAAAATDATAATATTTGATIDASNEAQRHHHYHHYPLT
                     NLHTLSPQQQQQLLYIQQQQQQQQQQQQQQQQQQQQPQQSQPKKPQQSQQPLQQPLQL
                     PQQQSLQRPQQTQQPLQQQQTPQPQQRVQAIRRQSSSTVISQTSSQIQPEAANQRSLT
                     GEEEILASNLQETYKAILKLEVETQQGCSEVNQRLIENDAGAEITSQLWVVYKNVVQL
                     LDHYYDFLLYALSPTSARAGKPLVMNYRILRRMWVYGVVSFLEVLKNVAAIFVEHEIC
                     ACFIAYAFNIISCLTDPQLGVEGWWAEKLGDLSRMAIALYPGRYMDWKASSVSWYRAA
                     METQFGHGKIYYHACTVESDNLEALVDIGKSVTCRDPFVPTQQYLRMIVDNVCSQRNI
                     LSSTEMAMIDFVKIHKILLLPNYEGSQEMVSLVSHYATHFGMDSGNLDFFQLRSGAVP
                     SEKLQFWYQKSANFALCNINHIIGFGDSRNPLAKLFNLPEALKERKERKDKHRKSTRT
                     LDADGKSNIEDDPDALYYSTASEQDETSWFQLLSYLNRGVVELSMRMLLQYVTGPIQT
                     STPHVIVWLYFVAAVGKAVQVQPSAKPLFIQLVHRFFPWSKVIPYLNDILCILRFSPE
                     SSALLKADIDNLKLDDRDVLLYHSENENLWEVWKCWGSLWFDALSCKKDYGSVIDSGV
                     RTDIFDMPAGGPRYKFTENRPRFVRIAVLGNYIAQNFPEMGLTIDCNIFKYAPDQTGT
                     MITPGESSRLESFCQDQRFQGLFEKPSAELTLAGKTDFTVTFNAEKWVDENASPQLPT
                     MEANSYGFMTAFLNNEYPAVNPDEEHQEEQQVQADDEVEYNDMYLQHGAYQADPLRIA
                     GDLGDKMDTSLTFISLDTNTWLKHCGRVFKCVRAEIFRLSVPLTVFQELRSLRRSTDA
                     SVADSATRAVIIIRQLYSEEDVLPVRADGSKASSLNETLEFEQNQNWRSNTDEIIMKS
                     IKLNDDLGKSLLLGNNYRINKGGKILTRVEASAFKYNILITDDRNMSLRSKAIRLVNF
                     SSAWLFKQIERVSNGRCSD"
     gene            <1016505..>1017578
                     /locus_tag="FOA43_000477"
                     /db_xref="GeneID:62193878"
     mRNA            join(<1016505..1016521,1016720..>1017578)
                     /locus_tag="FOA43_000477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920808.1"
                     /db_xref="GeneID:62193878"
     CDS             join(1016505..1016521,1016720..1017578)
                     /locus_tag="FOA43_000477"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776736.1"
                     /db_xref="GeneID:62193878"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="PFAM:PF04193"
                     /translation="MYRGPNSLKLTKIIGTGIIMGLGKAQAMPITAQFISLAKQKENN
                     SVIYRVLDYLISLDTQKLGKIFGWVSAFLYISSRVPQIFKNIQVQSTGGVSLKLIICA
                     LVGNLLYAVSLLTSEDAIKGGHTTIQFWEDELCYLVGSIGTVFFDAFVILQWIYYDIV
                     GFCEEEPMHQDLSLLTHCPRSPLLMESPSKPIKFSPSVLSPKHIRKLSEFTPLTPIDF
                     LLDDYGCSAENDSRSVASSLSPSADVAARLSDTITKVLSPVQDCYDHNHPNFPNKQVI
                     DNLDTDDQNSTFDKS"
     gene            <1017925..>1019205
                     /gene="APR1"
                     /locus_tag="FOA43_000478"
                     /db_xref="GeneID:62193879"
     mRNA            <1017925..>1019205
                     /gene="APR1"
                     /locus_tag="FOA43_000478"
                     /product="aspartic proteinase precursor"
                     /transcript_id="XM_038920809.1"
                     /db_xref="GeneID:62193879"
     CDS             1017925..1019205
                     /gene="APR1"
                     /locus_tag="FOA43_000478"
                     /note="MEROPS:MER0000941;
                     BUSCO:EOG093423EI"
                     /codon_start=1
                     /product="aspartic proteinase precursor"
                     /protein_id="XP_038776737.1"
                     /db_xref="GeneID:62193879"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="InterPro:IPR033121"
                     /db_xref="InterPro:IPR033819"
                     /db_xref="PFAM:PF00026"
                     /db_xref="PFAM:PF14543"
                     /translation="MRLSLSICTSVLLALAFSDTANAKVHSVQLKKNPIADTFKDITF
                     TEYVNSLKNKYIKTFQEHLDAEKRRANNVVGSLSGDIQTPFVPFAEKSNEVQIEASHD
                     TPLTNYMNAQYFTEIELGTPAQIFKVILDTGSSNLWVPSNDCSSLACYLHTKYDHEQS
                     TSYEKNGTDFSIQYGSGSMKGYISQDTLKLGDLVIPNQDFAEATEEPGLAFAFGKFDG
                     ILGLGYDTIAVNHIVPPIYNAIDKDLLDEPQFSFYLGDSSKSEDGGICTFGGIDKSKF
                     TGKITWLPVRRKAYWEVKFNGIGLGDEYAPLEKHGAAIDTGTSLIVLPSQLAEVLNSE
                     IGAEKSWSGQYTVDCAKRDSLPDLTLNFDGYNFTLSPYEYTLEVSGSCMSAFTGMDMP
                     EPIGPLAIIGDAFLRKYYSVYDLAKDAVGLAEAV"
     gene            complement(<1019389..>1021785)
                     /locus_tag="FOA43_000479"
                     /db_xref="GeneID:62193880"
     mRNA            complement(<1019389..>1021785)
                     /locus_tag="FOA43_000479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920810.1"
                     /db_xref="GeneID:62193880"
     CDS             complement(1019389..1021785)
                     /locus_tag="FOA43_000479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776738.1"
                     /db_xref="GeneID:62193880"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016256"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF00498"
                     /db_xref="PFAM:PF07714"
                     /translation="MDNLAEYLVRSGVICRLICITDTDGKNSYIDMKLKDHDDTSGLQ
                     EWIFGRRIEACDYTLPTRSNRISNKHFKLWMNTRDRNKSHDANVMIQDTSTNGTWING
                     SKLIKGANYILAQGDEISIGIGVPADVIRFVVHFPKYSGFSNEEDSGLQETFGGTKLK
                     PEKQGKEITTVPLNRRASEHHQRPKTGILADFIIRDEIVGSGAFATVKKAIERSTGET
                     YAVKIISKKKALTGALEGVSKELRILQKLHHPGIVSLKAFYEDDDEDYLVMEYVPGGD
                     LMDFVASYGAVGEAAGREIARQILLAIRYVHSKGISHRDLKPDNILIAQDDPVTIKIT
                     DFGLAKGQDKSNMLKTFCGTLAYLAPEVITGKYGPRISGKKRYLGNGKSLEDSYSNKV
                     DMWSIGCLLFVILTAHLPFSGSTQELLFKNITAGNYHEALLKENAVSLEGRDFLNRLL
                     EVDVSLRMNAKEALNHPWIREICPEDSQISLSQSQSYQQRLSQQMSQRVAARADVKAA
                     VTSNLRVSSHNSHHERMTFKVPDIPKPSQRAATTNISAGSSCSYITTDPVCENDVETA
                     NSTASISAPLDIIRTDVQTPPGTFLSLKLISSTKDIKLKPQIHIRQGKTMFYFGRFND
                     LDCTITDERISKLHCILMKKRHPIQQTSIFESPAMGLEDIWLLDLSTNGCFIGDRKIK
                     KGHKVKIHNGDLISLFRDKQKGDGLTYQIIVNDGTGLFHSGERDSEVCEDDPIEPLDN
                     FDIKLAKDKITACLNNGKFASSSSKRIHKRKLTESSQPNSIDDGSQRLKKTRRADLVE
                     "
     gene            <1022206..>1024230
                     /locus_tag="FOA43_000480"
                     /db_xref="GeneID:62193881"
     mRNA            <1022206..>1024230
                     /locus_tag="FOA43_000480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920811.1"
                     /db_xref="GeneID:62193881"
     CDS             1022206..1024230
                     /locus_tag="FOA43_000480"
                     /note="BUSCO:EOG093411AM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776739.1"
                     /db_xref="GeneID:62193881"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR011760"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="PFAM:PF01142"
                     /translation="MTSETTLKRGFDSLDNGDAKRSKISSVLLNETSSRPAQPKIGIK
                     ESDVGITEYVYHGSGSRITGILKQRYTDFQVNEIAPDGKVIHLEDLGIDTPKKSEEEK
                     DKEKKERKERQEEKRKEDKQEFDISEQDKNVLTELLGKDDTEKLISMVGTRNKMETTK
                     SYPDKMERTKVHKLIRKIFDNSFETATTEDDKIIVGANSFRNHEKRENTHGNNAPGLI
                     HNLGPRKTFLWFNMYKQNKETMEVANILAKIMGIPVKHVKYAGTKDRRGVTVQKASLE
                     NVPVERANSLNRILRGCQIGGFEYSDTPVNLAALAGNEFIITLRDAKSIDSSITLEEA
                     VSSIVKSLSTIGFVNYYGMQRFGTFSVSTHEVGKEILNGNWKAAGELILSEQEIVVPS
                     SRDARHIWKQTRDANMALKKMPRKCSAEFSLLSRLDRSEKEDDGEYSSGAYFNAIMGI
                     PRNLRIMYGHSYQSYVWNVVASRRVQLFGYTVVPGDLVLINKKVQDGDMVEDVKNETV
                     TTALAVTEDDIKADKYTIHDIVLPTPGYDVVYPENEELRNSYVEVMKKDGLDPFNMSR
                     RVREFSLPGTYRKVIARAGNLEYYIRKYDTFTDELVRTDLEILNLLKKATEEGKKDIS
                     VDRILPGDPNGDKSALIIKMQLPSSTYATMALRELIVEDTSIHGGVPKKN"
     gene            <1024653..>1026062
                     /locus_tag="FOA43_000481"
                     /db_xref="GeneID:62193882"
     mRNA            <1024653..>1026062
                     /locus_tag="FOA43_000481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920812.1"
                     /db_xref="GeneID:62193882"
     CDS             1024653..1026062
                     /locus_tag="FOA43_000481"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776740.1"
                     /db_xref="GeneID:62193882"
                     /db_xref="InterPro:IPR034250"
                     /db_xref="InterPro:IPR035979"
                     /translation="MVQSTDAKDEICGNSDTSESRLLPSLRKLKRPLDCGIPHESGYQ
                     EKANDIRSFSKGSNLEKGLYRVDESDSYREKHTHFRKLAKNWLFNSNVSEVVGNRQTE
                     SRGLFAQNEASEVTSESSRFRSSRKTSRRSGRHFLSEWFSEERRVSGTVVKKEDEFAL
                     KEQLLLSRLIEANLSNTESAQSKNTKTLKQLLPPTKALYFQALQNNEAVLNQVLPIAN
                     IFANNTELATSWTLLLTDIPKCTSLATILTQIGGGPLQSVQLLRRIDWNLITGLHNWN
                     DCIDWGETNLRLQFDNHENAMKFYEHSRTGAFVVNGFHIVTQWVPNEFSKRKFNKGIA
                     NDIEKEVLEYMAEPEGARRVLVLKRPVPNKKKTATGVKKQFSYPNPLNNYTESFDVEA
                     VIKDFSHFGKIVEVTPVISRKLSFGIQFFDVISAMAAKHSIEGNFENEDELKVEIAKK
                     YSDWYVWYGKDPTDKPILE"
     gene            <1026464..>1027585
                     /locus_tag="FOA43_000482"
                     /db_xref="GeneID:62193883"
     mRNA            <1026464..>1027585
                     /locus_tag="FOA43_000482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920813.1"
                     /db_xref="GeneID:62193883"
     CDS             1026464..1027585
                     /locus_tag="FOA43_000482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776741.1"
                     /db_xref="GeneID:62193883"
                     /translation="MTERNDGEDMLNSLRTLPQLQLLKSRGEILATLKHDRPDLQDGS
                     MRKLILWYRIIHGYIQFFKEGISNVWRTYRELKKTVYRRHDPFYIFDNGLDRSDKATG
                     SSKDKKMILRSLSLDQIIGELATAVRCQHNVEGDKMWLFEKKDDRNYIRISRKQLQSM
                     IRNKYDMRRLPFFAVLFAILEEFSLAICWLSPYILPTTCLFPKFMPRYYSRSVKAQKE
                     LKKLRKNVPLVDIASRNPYSMSTEESRFLCEFLLVNRSFKWANYMESRHFMCQRLLKR
                     YKEISLDNYLIVRDGGVDKLDILELFDACIRRGLIDIENLMQNISHNKTNSYYTNFPA
                     KDEMRKNLRKFIVDFNDRGNNAGLLGLYATAEPATSEAK"
     gene            <1028405..>1030612
                     /locus_tag="FOA43_000483"
                     /db_xref="GeneID:62193884"
     mRNA            <1028405..>1030612
                     /locus_tag="FOA43_000483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920814.1"
                     /db_xref="GeneID:62193884"
     CDS             1028405..1030612
                     /locus_tag="FOA43_000483"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776742.1"
                     /db_xref="GeneID:62193884"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MARFGTMLAHLRHHEESNDQETSIPEKRVDLIDGQKSSQQSLSS
                     RQSSMALKPQISSSNNSESQVGITDANQSQRMIQGHSHNHSKSQLFNQQMSNAGEAAA
                     SFAATNGSLSPTVSNSGMNTGSVPQVISSRRSFFGLSMGRSHTGDSLLDHYHGANTQL
                     NMTSAHAERPQPHYSSSMVQLKKFFRPMRKRTTHDSGTTSPRTVSHANSGPTFTHDSH
                     NNMIVKTDQRFWDGLEGSLSKKYGKPGKMLGSGAGGSVRLISRESDNVTFAVKEFVPR
                     RAHESVKEYAKKCTAEFCIGSTLHHPNVIKTLDIICENNHYYEVMEYAPVDFFSVVMS
                     GKMTRSEINCSLKQITLGVQYLHSVGLAHRDLKLDNCVVTKQGILKLIDFGSAVVFKY
                     PFEDEVVMAHGIVGSDPYLAPEVLSSTNRYDPQFVDIWSIGIIYCCMTLRRFPWKAPK
                     KDDPSFSLYCMEDDIPHDYLESAKRHKQLLLERKQKIAEKRKLEEQRKEEQDENDDLC
                     GVTKGVEAVYIKDKHENEKNENEHEGEHEQKNADEFELDRENEEKEKEHESKQEHGHE
                     EKNKEKENVNEHEQSDGDEHKFVEDHNDMKVKEDVKNEEQDDAKEDSDQKVDDLENVD
                     QNKLEAQPDKLHSSHHKLSPEPKSEIDSVPERRQKAVSKTHRQIHGPYRLMRLLPHAS
                     RPLISRMLCVDPKKRATIDEILADSWFNDIKYCTIDKEGNVINDPGHHHTIII"
     gene            <1030927..>1031706
                     /locus_tag="FOA43_000484"
                     /db_xref="GeneID:62193885"
     mRNA            <1030927..>1031706
                     /locus_tag="FOA43_000484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920815.1"
                     /db_xref="GeneID:62193885"
     CDS             1030927..1031706
                     /locus_tag="FOA43_000484"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776743.1"
                     /db_xref="GeneID:62193885"
                     /db_xref="InterPro:IPR031818"
                     /db_xref="InterPro:IPR038744"
                     /db_xref="PFAM:PF16815"
                     /translation="MSASIRLSIFWPNSEPEQLPERTDTLVLTTSSGRYIDIRSYKQN
                     SLDSHPELKSFPFDWAFAGDERVLSKNPTKIEFTHQFFDSSYILRLSSYLRRESSVKP
                     NRDEIPVDCGRFVTLSSGIREETGEMMNEHTKKVEPYIEHWVSVDPLNSKPNNMIQLD
                     DDSTDNVRFKSTLFDIEVEEKYEGRFIRLGAWAQGLIWDKSNIDCPISVIRRHQNGSK
                     WITILQFGDCISKLKGLEEEPVKEGVTTIKDDVRWTCKESN"
     gene            complement(<1031741..>1035342)
                     /locus_tag="FOA43_000485"
                     /db_xref="GeneID:62193886"
     mRNA            complement(join(<1031741..1034952,1035339..>1035342))
                     /locus_tag="FOA43_000485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920816.1"
                     /db_xref="GeneID:62193886"
     CDS             complement(join(1031741..1034952,1035339..1035342))
                     /locus_tag="FOA43_000485"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776744.1"
                     /db_xref="GeneID:62193886"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF04082"
                     /translation="MEMNSNLGGSDDNSYVPRQIADATDADLPMHPPVKAGMNDRAKK
                     NPKSSKTQAPTIKDKKGRSTSCYLCQKRKQKCDQRFPSCTNCIRAHVKCVQPPRYGEN
                     YRSHVKDDYTALLEKKVKQLESLLDETTKKIYQLEQQDNRITSSSGITSSSVRQIDTH
                     ENNHRVDTINANVKNVASLPSAVLDRSETSTPFDSSRILKYRKIGDLLDISKNTARSY
                     LPYDQFDHALNKPYTYFMADNADRVKKSSVASYHLTNFLRYDPVFDLDQELSRQLIDI
                     YFAMLQYKFPLLSEQEVKQFHHDYFERKVFSNHVDYHFRAARMLLIFAISAILYRATG
                     RYRGPAPYRFFSSALRHIVFCQNLEPLKKIELLVLLCLLINRTDKDSNCLYMIITDAM
                     KLCMRLSLHKQKSYCNVSSTLRERHLRCFWCAYILERSVSIAVAKPFTLKESKIDKSL
                     PSFDSESSKPTPHSTIGTKFINQVIKIRRMEAHFVEDLNILSSASIATRTQLPKVQIY
                     FQRLQEWRKECQGFQSDKETETLSVYYYRAVRNLIQPFLELLDPDDKLFKECQAAAGQ
                     ICQAIKTFHQKTVSGHSILNIHTTFTSGVTLIYCLWLERNRDDMKRKLLGDDKKHTRP
                     LVSAALFSGIDDLRACSISLYVMAERTKFALSFRDSFDELMHATVDNLILRCGPNSSE
                     ILNYSEPGMPPAVYRQPLQHYQLDSRFTQKTAAETQEDEERTKRTGHLTRLAIPRGLS
                     HLLIHSPTISGVRYGQIGNSLSSAQPTTSTFAPPTKPLIQSSAFGQSNNTFSVSNFHA
                     PPPSVRSMNFGSSATMPNVSIPPVMASPIANTASSFSSMSADTLRHANSGNENTVEEL
                     AHSQKTLNGAHANNSDAVYAMSSSVTDVEHTPSTPTTTASSSSSITPVIANTPIIPEL
                     LPFVGRTTAMINNISVWTGESGQQIPQTGLVMIQQQNNANSNGNPGFLMNSSGNTDGY
                     TGMPFRAPSQTGADSSIFGNQVGVGMNFIGGNSGTNGGNGGNGGNGASGQSGVEGAVS
                     GNGNEQVIDSSSGNGMELLNNWGSYPNDDFWSVRNDLGFIP"
     gene            complement(<1035473..>1037191)
                     /locus_tag="FOA43_000486"
                     /db_xref="GeneID:62193887"
     mRNA            complement(<1035473..>1037191)
                     /locus_tag="FOA43_000486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920817.1"
                     /db_xref="GeneID:62193887"
     CDS             complement(1035473..1037191)
                     /locus_tag="FOA43_000486"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776745.1"
                     /db_xref="GeneID:62193887"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MNNSKPEILHAEYQEEVCEQDNIQGKNKVESDLYNFDTSVLADL
                     DEIPTYLKVSGNKLQLMATLMGSVGFCLFGYDQGVMGSLLTLPSFRDTFPSIDTVTHP
                     DTHTSTIQGFVIAVYEIGCLFGALVNLRLSDKYGRLKSIFLGCALMAIGAAIQCSSFT
                     IGQFVVGRVITGLGNGLNTSSIPVYESETVRADVRGKLVMLFGAVNTGGVALSYWLDF
                     AFYFIHSSVSFRFPIAFQILFPVLILPMLPFLPESPRWLSKHGRFREAAKVFAAFEGT
                     SINDPIVLGEIDRVRQSLIEEKEAGKGLSMRKALFSQGKHRNFHRMMLGLCSQILQQL
                     TGINLVTYYAGTIFESYIGMSALNSRIMAACNGTEYFFFSFVPFFTIEKYGRRALMMI
                     GSVFECFSMTMLTVFTELARQGHNKTSMGIGATVMLFVFNSAFAFGWLAMTWLLPAEL
                     TPLSIRAPANAITTAGNWSFNFMVVMITPIAFNNIHSYTYTIFAIFNFLTIPIIYFMY
                     PETKGRTLEEMDEIFGQCPIKEPWKVVGIAKRTPYEARRYINIETSTIDSSSKSNSEA
                     EKDIVV"
     gene            complement(<1039912..>1040856)
                     /locus_tag="FOA43_000487"
                     /db_xref="GeneID:62193888"
     mRNA            complement(<1039912..>1040856)
                     /locus_tag="FOA43_000487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920818.1"
                     /db_xref="GeneID:62193888"
     CDS             complement(1039912..1040856)
                     /locus_tag="FOA43_000487"
                     /note="BUSCO:EOG09342OCQ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776746.1"
                     /db_xref="GeneID:62193888"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00005"
                     /translation="MTEVPSIYTKNLFYRYPNSRIGLFDINITLKRGSRMLLVGPNGA
                     GKSTLLKILAGQRLINDGIVLLNGKDPFDMVDRGSQIVTYLGTEWANNEITKRDIPVT
                     VLVESVGGNFYKQRREMLINMLDIDITWRMNQCSDGERRRVQLCMGLLKPWDLLLLDE
                     VTVDLDVLVRYRLLEFLKKETEQRNCTIVYATHIFDGLGEWPTQVVHLNGGIIVKKYR
                     PEDIDFINGAERPVEETELKEDAKMERQERRSHVVINKIKSFYPLALKWLNEDLHVRG
                     ERTDDNTKPKYEELTQRLVKFYYDDQDRISKYFERTQQ"
     gene            <1041047..>1043287
                     /locus_tag="FOA43_000488"
                     /db_xref="GeneID:62193889"
     mRNA            <1041047..>1043287
                     /locus_tag="FOA43_000488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920819.1"
                     /db_xref="GeneID:62193889"
     CDS             1041047..1043287
                     /locus_tag="FOA43_000488"
                     /note="BUSCO:EOG09341TS3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776747.1"
                     /db_xref="GeneID:62193889"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MTSSDHIFEEDVDKMIEEKQKEEDEEMDEESDGEEEVDEVERGR
                     EGEDEGEEEDEEEEDEEGEGEGDGEGEGEGEGDGEGEGEGEGEGEGEGKGKGEEDEGD
                     DEDDARKGEAEGDELDEGKEEEEEDEEEEEEEEEDDDDGGREEDEGNSDGEVDTEDDT
                     DDVGGSDDVEGTGESSTKTTDTKYDAQPPDTSKRSEPGSAKIATDITEQSDSTELIET
                     VEQSKFADRKNAKKTESLEPGVHGKTSQTEEKDLSSSVEDNSDLTARQKLVRDASKVN
                     VTEILPLVAIPYSFPVHSLAFSKGPKWMFTGGEDGLIRKYDFFGSVEGKSPLTVAQRH
                     QLVDSIAFGGMISSYWENEQPYYKEELLKELVKEQQTKGKGGRTKKMDINSITLYEPR
                     LSPVYSLAAQSDAFWLLSGLKSGGIALQSTRSNEGCIQYYFKNGLGEHQHSSAVSCLK
                     LNSTDDKFLSGSWDKKILQWDLNTGACTAVFNKSTGQVSSIDCRPIVGIDIPLLKDDD
                     AGEDMDSKPDKDAAEDDEDSTKGQIKKDLAMDSKTTLQKGRYEGVIRSDNVFVSSSIN
                     GIVNIWDVRMPEESNQVGTIGLHNETSPWCMSAIWSVDGNSIFAGRRNSVVEEYDVRN
                     LKKYKDVLRFPLASGPISCVRSLPNKNYLLCGCEDNIRLYDLRLSDYHQGEEDRSYDH
                     HRDHHHHKRRRRKVPFMIVPGHNGGVLSDMYVDPTSRFVVSASGNRGWHGKASDYVFI
                     YEIQKA"
     gene            <1043863..>1045695
                     /locus_tag="FOA43_000489"
                     /db_xref="GeneID:62193890"
     mRNA            <1043863..>1045695
                     /locus_tag="FOA43_000489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920820.1"
                     /db_xref="GeneID:62193890"
     CDS             1043863..1045695
                     /locus_tag="FOA43_000489"
                     /note="BUSCO:EOG09340NDW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776748.1"
                     /db_xref="GeneID:62193890"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="InterPro:IPR039551"
                     /db_xref="PFAM:PF00755"
                     /translation="MPALLYSTSTKGDLFKYQDSLPSLPVPPLEHTLTLYKKSIVPYY
                     PMGQQDPNYLKSCKIIDEFGKEKGSQLQRRLLKFSKGHRNWLSHIWDEYAYLAYRDPV
                     SPFVSYFFSHKDLNTFIGKDQILKASALSFQILRFMEAIEKEALEPELIKGNPYCMES
                     FKWMFNNCRVPKLPADDTVKFRPEENRFMTVISNGYIYKLHHHNPDTCEILAPADLYA
                     GIDAIYEDAHSKPPCKNPVGILTSSNRDVWAQNYSELCKNPVNTMSLEQIQRSSFVLC
                     LDDNFPSTVAEKSRNCWHGNGFNRWFDKPVEIFVAKNASSGFLGEHSKMDGTPTLRMN
                     DWVVKQVSKMSAEDFETGPQSEHGISYSELKFEINPTMMAAISKELATFNNTVNSLDI
                     NVWHYFGVGKDQIKQFKTSPDAFIQMLIQLAYYKYTGTVRPTYESASTRKYFSGRTET
                     CRSVSEESLKFVRDWEDPTKSLAEKTASFRKAITAHVQYIKQASDGLGVDRHLLGLTQ
                     MLTKEEEKPAIFTDPIFSYSQHWYVSTSQLSSSQFNGYGWSPVVPEGFGLAYMINKDW
                     CHVNITVFKNNPLGLRADVMAYYLTESMNELKEVLSREPIKAKL"
     gene            <1045847..>1046566
                     /locus_tag="FOA43_000490"
                     /db_xref="GeneID:62193891"
     mRNA            <1045847..>1046566
                     /locus_tag="FOA43_000490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920821.1"
                     /db_xref="GeneID:62193891"
     CDS             1045847..1046566
                     /locus_tag="FOA43_000490"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776749.1"
                     /db_xref="GeneID:62193891"
                     /db_xref="InterPro:IPR031404"
                     /db_xref="PFAM:PF17075"
                     /translation="MDSFKSKNSREATINSVNKSLITYLPSVSTVLGSSEDIRSGKEY
                     ASLLASSSGSSYKSGASEIARISKQANNIKKSRSQRMKMKNKLKKQRHQVMQKNREFQ
                     SRVEKLGRLAIGDTKEMEELVDQNLERLKKLEPENEEQIKMLEKEVLDLKYGSESRSG
                     GAGRRRRKTAETNLEGESKQQIEFKSKVEKGLISVPGLTPGLAPVGESDEDDSESDED
                     EQTAGTDDILSGFKDDFNEYH"
     gene            complement(<1047023..>1048834)
                     /locus_tag="FOA43_000491"
                     /db_xref="GeneID:62193892"
     mRNA            complement(<1047023..>1048834)
                     /locus_tag="FOA43_000491"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920822.1"
                     /db_xref="GeneID:62193892"
     CDS             complement(1047023..1048834)
                     /locus_tag="FOA43_000491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776750.1"
                     /db_xref="GeneID:62193892"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MSFTHKTASFLKDVFIPVSPVKAVGTAGRGAPHVTESQQAIGTG
                     SSAGSTVPEAFDTEKKNGSVEVTVSNAEEVTKEYREYEQGRTHRLLSNRQLQLIALSG
                     TLGVGMFVNTSKTLSKCGPLSLLLGCIFWAIPVLIVNISCGEMVVYMPIPSPFISIGQ
                     RCIDDAFGFMAGWNFWVLQGSLVPFEMTLFNSLIHYWRDDFSAAIPFTIIIILYFLIN
                     LSTVRCYAEVEFYLGICKILLAIAMILFVFFTMLGLNPMHDRYGFRYWSTPMVEYIGT
                     GANGRFQGFLDSVITYSFLMAGPEYISMCASEIKNPRAVLPNAYKSVFYRIAIFFFGC
                     AIATGTCVEYDNPTLLAAIENGSPGAGSCAFTVAMKNLQISVLPDIVNVVLLLTSFSG
                     GNDFTYCASRSLYGMAVDGKAPRIFAYCNKNGVPIYAVLASLVWACLSYLQLGEGASV
                     VLDWIINLVTASQMLNYLIILATYIQFRKCVNAQGISRDEFKFQGWYQPYLAWFGLFL
                     VTCMLGAQGYYVFLPESWDVSSFLFSYIMIFVDIFLFLVWKVIKRTKFVRPENADLVT
                     GMDEVEAHEKYLENIGELKPLPPKGWKGRIVNLLYGY"
     gene            <1051002..>1053344
                     /locus_tag="FOA43_000492"
                     /db_xref="GeneID:62193893"
     mRNA            join(<1051002..1052268,1052524..>1053344)
                     /locus_tag="FOA43_000492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920823.1"
                     /db_xref="GeneID:62193893"
     CDS             join(1051002..1052268,1052524..1053344)
                     /locus_tag="FOA43_000492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776751.1"
                     /db_xref="GeneID:62193893"
                     /db_xref="InterPro:IPR006644"
                     /db_xref="InterPro:IPR008009"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR015919"
                     /db_xref="PFAM:PF05345"
                     /translation="MFHVLSFLYLVAHIGILVTATPIVGLPFNEQLPDVARVGEDYYF
                     ALNSDTIESDNTGESVTYSASGLPSWLTFDATSLVFTGTAENATNITFTITGTDSTGS
                     VDEECQLVVSEDAGPRLTSETSLYEQLAQSGNTNGYDGIVLQPNEDFSIKFDNDTFEM
                     GSGSGGSIVSYYGRSANRTSLPIWCQFDDDTLTFSGTAPTVNAVDAPSQEFDLVLIAT
                     DYIGYTGAYGAFHIVVGGHYLISKVESPIIINATAGKEISQEIPIDSVYLDGQQISST
                     NISSVDLYEGPSWVSISDNDTLAGTVPDDILSNTSLNVTVTDIYGDSIFISFDVDVLD
                     QVFAIGTFPEVNATRGEFFKYTIDSDDLMHANSTNLTATYEDANWLNFYYSNNTFNGW
                     VPKDFESVDVTVNGTLGDLTDSREFTIEGIGPVNKFPTNDTLSNDGGAAAGLVEENML
                     KLDGGSASSVSSSATDVDSDGEKQGQMHTPYGVITGDGSNNNSSDSKGAVRNSWRKNS
                     TRSKSNWKPRDSLTSLATVTTNDLLTMNVVDDPSLQRRSQMNLLLRHNSNALSNNNLS
                     NTKLIPSYRNSRVASIANRDSGSIKHNKNNNSTNIGRNNSSDYFSSEPSSNIELLDSN
                     SSASNSKNNITSFGDKNTHSEQKLAPIRDFSGNSGSTGSAKLMDFQDRASIEKTSATP
                     LNTDNRSYHGVIE"
     gene            complement(<1053536..>1055113)
                     /locus_tag="FOA43_000493"
                     /db_xref="GeneID:62193894"
     mRNA            complement(<1053536..>1055113)
                     /locus_tag="FOA43_000493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920824.1"
                     /db_xref="GeneID:62193894"
     CDS             complement(1053536..1055113)
                     /locus_tag="FOA43_000493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776752.1"
                     /db_xref="GeneID:62193894"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="InterPro:IPR033120"
                     /translation="MFRSLPNLTLRHSWFKSSYAIAKTIRQVSSTSVRYRSATKFNEE
                     SPNPEDAADATSTVLSDAVDFQKRLQSKNRLTWWEILQKRSERIKEGKMSDSDTLDDV
                     KTTAITDKTRSDSFSYVCLPFKDDIFLRDFYINAPGRLRFGHLFQDLDALAGRVASRH
                     CKPAEPMNVTASIDRIYVTKKIDEIDKFNFVLVGFVTYTGRSTMEICIKGLAYSGSIP
                     ANITTDIVISDAEKCFISANFTFAARNPITHKAHAINKILPTTEREWADYKRAESHNA
                     AKKMRAKSENLNKVPPTDFESKMIHSLFTAGKAAESLEKRPENVSFMRDTRLNSTQIQ
                     QPQYRNRNGIIFGGYLLRQTFELAYCAAGAFSRAAPRFVSLDNTTFQAPVPVGCVLFM
                     NAEVCYTEHVHETKEDAPSSAQLNGLLNDYDTAANGLSEDPHELISVPGTLIQVKVST
                     KIRSLSDSKHYIESGKFVYSFFVPRDTSGVFDQPGYSSVIPVSYEEMIDYVEGRRRAY
                     ETAAYAQQLKLNGEMAY"
     gene            <1055921..>1058218
                     /locus_tag="FOA43_000494"
                     /db_xref="GeneID:62193895"
     mRNA            join(<1055921..1056138,1057042..>1058218)
                     /locus_tag="FOA43_000494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920825.1"
                     /db_xref="GeneID:62193895"
     CDS             join(1055921..1056138,1057042..1058218)
                     /locus_tag="FOA43_000494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776753.1"
                     /db_xref="GeneID:62193895"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="PFAM:PF04116"
                     /translation="MAMIDNKIPSDFIKEDLLRRPQKSDRMASKYLGKGLENSFISPV
                     EEPKDGIESRIAGIFFSFAKTRAASQEQHCHYQSLTMDLVLEVLDYAFLDKFYASWFP
                     KSMEESLPEAPAFIQEWAKIIDNGTKVAMSYSENSKFQTFLTKAFSDTSKEAMIYGEN
                     APYHFFGETVYTHASFLSRSSILRQSLSLLVMMSIFGWLLYFTVASLSFFLVYDKSNF
                     NHPRYLKNQISMEIRLATEAIPVMVLLTVPWFLSELHGYSYLYWDIDESTGGWKTILF
                     QLPASIMFTDAGIYFLHRWLHWPLVYKYLHKAHHKWIVCTPFASHAFNPVDGYCQSLP
                     YHWYPFLFPLHKFTYLFMFTFVNFWTVMIHDGQYLSNGPIINGAACHTVHHLYFNYDY
                     GQFTTLWDRLGGTYRQPERALFDKKARKETTWAKQAAEMDKIREVVEGDKDERVYGTE
                     EELSDLHLFKEKAN"
     gene            complement(<1059207..>1060721)
                     /locus_tag="FOA43_000495"
                     /db_xref="GeneID:62193896"
     mRNA            complement(<1059207..>1060721)
                     /locus_tag="FOA43_000495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920826.1"
                     /db_xref="GeneID:62193896"
     CDS             complement(1059207..1060721)
                     /locus_tag="FOA43_000495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776754.1"
                     /db_xref="GeneID:62193896"
                     /translation="MALFMSMSRERSRGRSTVTARSISADRDSEQGENNRQTLGPSFY
                     SSSAVATNDPTKQKILEEIEKKEQLVTFNSQAIDRDLLKCNNGAIDKVLPTVKILRNV
                     SHAKEFIENAASVSDITTTDLDDAEKLSPIKQGRKCEISESTGRGKQSDGLSESEKSS
                     NKMHLAKTKYNKSSLSEVNEEFNDFPSSSAGVDSSKSSRGPANADVNTVSYLEPSSEI
                     KHLLQTESGPDDNMTSSMNESELNVEDESTGKVLHKVINSPRIRTKRGADSDEDLSIE
                     TKRSRIVDELIKKYDSPPWEDPPELESEKKRNRSRSRSRSRSRSRSESNSQLSSNSPE
                     RFPRSPKYGAQGKLLRSDRGRKLALDYARVELTQTHPVLSLSGARKEDQSQVVGSAAD
                     SVPASEDSSFNNYSSNTSSTLEPPVLSTEKLALSKKLSDKSDDSPMVEAVRRLRAMEK
                     EFGLSDDDGDQFDSPPVLLTEVIQGDTGEKSDTRKVDDTKPTNGVTEVHSPFLE"
     gene            1061180..1061252
                     /locus_tag="FOA43_000496"
                     /db_xref="GeneID:62193897"
     tRNA            1061180..1061252
                     /locus_tag="FOA43_000496"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:62193897"
     gene            <1061396..>1062613
                     /locus_tag="FOA43_000497"
                     /db_xref="GeneID:62193898"
     mRNA            <1061396..>1062613
                     /locus_tag="FOA43_000497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920827.1"
                     /db_xref="GeneID:62193898"
     CDS             1061396..1062613
                     /locus_tag="FOA43_000497"
                     /note="BUSCO:EOG09342U3P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776755.1"
                     /db_xref="GeneID:62193898"
                     /db_xref="InterPro:IPR000159"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="PFAM:PF00536"
                     /db_xref="PFAM:PF00788"
                     /db_xref="PFAM:PF07647"
                     /translation="MLSWGNDQLLLWLKNAEYSNDVVDAFRSHNITGLTLPFLNTEEL
                     KEMGIENLQLRLRLMKDICSLLMEKNMNFIGSNMHPIMIQLQSTMMATTLINTISQDI
                     RDDVITNSESSNKSLLHQFGKLREDLLPILKELKDKKPLPTPDLNSTQRSQYFSGSPS
                     KSAQLSRVSSKRDSSISERMSVMSASSRNSSMDLMSSHRNSGESTLEQETLSSFPSMF
                     SSAEIVTATAARKLDARPILVQPEGDNAMKQTVETISKPVASISEIPTSGTVSNAASI
                     LPGSVPTNSPEAQPPPNSLTPQAHHHSKHRTQSSNEPLKQLRARTEDKCYKILQAAMK
                     SHGLDISEWKNYALVIVYGGDQERVLSYDEKPVVVFKELSELGLNPSMMLRQVDEEDR
                     LDYQEFDTPGGRL"
     gene            complement(<1062656..>1063537)
                     /locus_tag="FOA43_000498"
                     /db_xref="GeneID:62193899"
     mRNA            complement(<1062656..>1063537)
                     /locus_tag="FOA43_000498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920828.1"
                     /db_xref="GeneID:62193899"
     CDS             complement(1062656..1063537)
                     /locus_tag="FOA43_000498"
                     /note="BUSCO:EOG09343G8S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776756.1"
                     /db_xref="GeneID:62193899"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR024326"
                     /db_xref="InterPro:IPR040447"
                     /db_xref="PFAM:PF12923"
                     /db_xref="PFAM:PF17799"
                     /translation="MAIKQLREYTVLPVLLPGTRNISKAWHYLFIKKHVTKDEAESKT
                     RSLFIVNIPVGANFNNMKRLMSQVALGANIESFQACEYYDPDNVINYNMDINLSKLSN
                     ADFGEENLRDNRIPVGCGVVTFLDRDGMNLALSSIKKLVMSSKSDCKPPEWELFTDKE
                     TGSSRYLGVNNRLNAGSLSKDVYSSMKAFEKREHEVEEELKQMTETVDEDGFTVVVGP
                     HRKTKSGIMGSLKTLTDLEHDEKYSKKIKKKEKKDFYRFQIRERKKQEVNDLLKKFKD
                     DQERVRIMREKRRFNPY"
     gene            <1063834..>1064982
                     /locus_tag="FOA43_000499"
                     /db_xref="GeneID:62193900"
     mRNA            <1063834..>1064982
                     /locus_tag="FOA43_000499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920829.1"
                     /db_xref="GeneID:62193900"
     CDS             1063834..1064982
                     /locus_tag="FOA43_000499"
                     /note="MEROPS:MER0001342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776757.1"
                     /db_xref="GeneID:62193900"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002467"
                     /db_xref="InterPro:IPR031615"
                     /db_xref="InterPro:IPR036005"
                     /db_xref="PFAM:PF00557"
                     /db_xref="PFAM:PF15801"
                     /translation="MTAEETKNDDQEEARYCASPVCGKKTTSNLKCPICLKNGAKQYF
                     CSSKCFRESWHLHKAYHPKEDAESYNPFPEFEFSGDIKPAYPLTIEPQVPESIQRPDY
                     SRDGRPVSEIKNDKTNKVRVLSSEEIEKMRVVCKLGREVLDAAAAAVRPGITTEDLDK
                     IIYKEAIKREAYPSPLNYFNYPKSVCTSVNEVICHGIPDKTVLKDGDIVNLDVTIYKF
                     GLHADLNETYYVGEKAKQNKELVNLVETTREATMKAISTVRPGIPFRHFGDLIEAHAK
                     KHNVSVVRTYCGHGINNLFHCQPDILHYARNKSVGTCKAGICFTIEPMLNMGTYRDIM
                     WPDNWTAATSDGKPSAQFEHTLLVTEDGVEILTARNMHSPGGPIKRLP"
     gene            <1065248..>1067233
                     /locus_tag="FOA43_000500"
                     /db_xref="GeneID:62193901"
     mRNA            <1065248..>1067233
                     /locus_tag="FOA43_000500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920830.1"
                     /db_xref="GeneID:62193901"
     CDS             1065248..1067233
                     /locus_tag="FOA43_000500"
                     /note="BUSCO:EOG0934131R"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776758.1"
                     /db_xref="GeneID:62193901"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="InterPro:IPR036045"
                     /db_xref="PFAM:PF00995"
                     /translation="MSLMENPQTLRECQIQKLKKMLHLNVGTDVNLVSSSNQEELTWK
                     VLILDRRSSGIVSSVLRVNDLLEYGVTMHTLIDQRRAALPDVPAIYFLQPTAENIAQT
                     IADIENDQYDDFYVNFTSSLSRSLLEDFAKKVAQTGKSYKIKQVYDQYLDFIVTEPNL
                     FSLDMKNVYSEFNDPNTTEDQITSKADQIVSGLFSAILTMGSIPIIRCNRGGPAELIS
                     QRLDQRLRDHVINTRQNKGTGAESTSTASSSSHDKLVLVLLDRNVDISSMLAHSWIYQ
                     CMVSDVFKLERNTIEIKLSGDDDQSTVRRYDIDPHDFFWNENASLPFPDAVEHVEAEL
                     SKYTQEAKEITSKTGYSSIKDIDPTDKTNTQHIQEAIKALPELTQRKNIIDMHMSVLT
                     ELIKELDAKNLDSYFEIEQNFNDLRTQKQFLELIKKQSKGDNSRDKLRTYLIIYLKCD
                     DLPKSFCDQCEKTLGDLGVDLAPLKYIKKVKELNKMSAMNTGKSLQTNGTNRNLSSNG
                     GDLLSGLSSKLMGLTTEGSSKITEGFGSLISGIKNLLPEKANMPITNIVESIVMPANA
                     NQESINLTDDYLYFDPNATRGTHSRPPKRYSYNEAMVFVVGGGNYLEYSNLQDWCNSL
                     NNSLGAAGSRQKLVTYGSTHICSVNEFLDECAELGKH"
     gene            complement(<1067290..>1068723)
                     /gene="RBV1"
                     /locus_tag="FOA43_000501"
                     /db_xref="GeneID:62193902"
     mRNA            complement(<1067290..>1068723)
                     /gene="RBV1"
                     /locus_tag="FOA43_000501"
                     /product="RUVB-like protein"
                     /transcript_id="XM_038920831.1"
                     /db_xref="GeneID:62193902"
     CDS             complement(1067290..1068723)
                     /gene="RBV1"
                     /locus_tag="FOA43_000501"
                     /codon_start=1
                     /product="RUVB-like protein"
                     /protein_id="XP_038776759.1"
                     /db_xref="GeneID:62193902"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF06068"
                     /db_xref="PFAM:PF17856"
                     /translation="MTETVQPLGSIISQSTTESSKPSSTAAAATVDSARENRTAAHTH
                     IKGLGLDEHGYAKKNEGGFVGQMEAREACGVIVDLIKSKKMSGKAILLAGAPGTGKTA
                     LALAVSQELGPKVPFCPIVGSELYSAEVKKTEALMENFRRAIGLRIKETKEVYEGEVT
                     ELTPEEAENPLGGYGKTIKHVVIGLKTSKGTKSLKLDPSIYEAIQKEHVAVGDVIYIE
                     SNTGSVKRVGRSDAYATEFDLEAEEYVPLPKGDVHKKKEIVQDITLHDLDVANARPEG
                     GQDILSMMGQLLKPRKTDITEKLRTEVNKVVSKYIDQGVAELVPGVLFIDEVNMLDIE
                     CFTFLNKALESEIAPVVILASNRGMTTVRGAEIKSPHGVPPDLIDRLLIVRTLPYNHD
                     ESKNIILKRSKVEGLALSGEALDKLATTSMTTSLRYSLQLMSPAAVIASVDGRNQVES
                     KDIDECLSLFLDAKRSTKVLEDTKGYL"
     gene            complement(<1068974..>1069678)
                     /locus_tag="FOA43_000502"
                     /db_xref="GeneID:62193903"
     mRNA            complement(<1068974..>1069678)
                     /locus_tag="FOA43_000502"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920832.1"
                     /db_xref="GeneID:62193903"
     CDS             complement(1068974..1069678)
                     /locus_tag="FOA43_000502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776760.1"
                     /db_xref="GeneID:62193903"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="InterPro:IPR036663"
                     /db_xref="PFAM:PF01557"
                     /translation="MSYDYLKHVGKVLCIGRNYMAHIKELNNAKPIEPFFFIKPESAV
                     LKYGEGPILIPKGVLAHHEIELACIIGKQLKDLDPAKFGPQEAIDSIEGYALAIDMTA
                     RNVQAVAKKKGLPWTIGKGFDTFLPISPLLSKKQIPDPYNVELNLKVNDEHRQHDVTN
                     LMIFPIHKFLSKMSSIMTLNPGDVILTGTPKGVGIVKPGDIVECWCSVNDAEVQGSRM
                     KFDVEQKPGPYEFKGE"
     gene            complement(<1070032..>1071687)
                     /locus_tag="FOA43_000503"
                     /db_xref="GeneID:62193904"
     mRNA            complement(<1070032..>1071687)
                     /locus_tag="FOA43_000503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920833.1"
                     /db_xref="GeneID:62193904"
     CDS             complement(1070032..1071687)
                     /locus_tag="FOA43_000503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776761.1"
                     /db_xref="GeneID:62193904"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR020956"
                     /db_xref="PFAM:PF00170"
                     /db_xref="PFAM:PF07716"
                     /translation="MTSSSTSKFAKISAAGATAAPSKLPSTSEHQSQGSSGSRKTLDL
                     EPNPFEQSFAQTKDGHADTAGSNGADEGSKGVEVTGAGAGAGGEVGIDEASRINGGSQ
                     SNANGAALATSKTATVTSVPSSLAAIALPQSFMHQQPQVKSDAQAQPPQQLSPPVLTP
                     GGTRRLHTSSMLPPLVGMMSPGGGSLPGTPGLWSAFFSGGGGSGTPGSATAQYFNINP
                     LNGASDPQQQQKQQQQQQQQTSAQAQQGQQYFNFVSDSRKAGLTPNESSMRTGITSGG
                     GMLSAHLPGSNGFNLMMGTMPSDPISGIPSTPGGSLASFTLQGSATGEGNRGTGVTGL
                     SQPLNLPNLKLPDSITTHKSKVNSKKIWDVKSLGVAADSSGAFKGKHSLKNSDKELSN
                     KKRKLSVKKEASATSSPPPPPDNYESGNGRKRKSRGEMTEEEKRQNFLERNRLAASKC
                     RQRKKRMVENMKEELDFYTKQYQSLNSQVSILREHVLTLRTILYAHKACPQLVEQVGG
                     IETLNTLLNGTNYVAQLPQAHQAPPPTQSPLTTQEISSLQSLP"
     gene            <1072149..>1076072
                     /locus_tag="FOA43_000504"
                     /db_xref="GeneID:62193905"
     mRNA            join(<1072149..1075023,1075306..1075325,1075374..>1076072)
                     /locus_tag="FOA43_000504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920834.1"
                     /db_xref="GeneID:62193905"
     CDS             join(1072149..1075023,1075306..1075325,1075374..1076072)
                     /locus_tag="FOA43_000504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776762.1"
                     /db_xref="GeneID:62193905"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="InterPro:IPR032190"
                     /db_xref="PFAM:PF02460"
                     /db_xref="PFAM:PF12349"
                     /db_xref="PFAM:PF16414"
                     /translation="MNIPFALLAFWASLSLAVSPYTELHSPGFCALYGIGGKESFIDI
                     PLPQNIEAQPLTAEERNELVGICGSSWQNSDTACCDMSQIQQLKTNLAKVRPLISSCP
                     ACQENFFQMFCHFTCSPDQSTFVNVTKISESTSGNDIVDELDFYIDSASFASEFFDSC
                     KNIKFGATNGYAMDLIGGGAHNYSGFLKFLGDKKPMLGGSPFQMNFKYEDAKNKIVPF
                     TTIARKCNDVDPRFRCSCADCPQACPILSKLNPSHRCTVGKLPCFSFAVILLYTAVAA
                     AYIYIVAFAHGDSKNSLLNLFDRESALLTDDMGDDNNDAEETTELSSADEMSNFDSFK
                     ANKSYFFNDWLEKLFYQQGLYCAKYPWHVICVTLTIATIICSFIYKLQLERDPIHLWV
                     SPEANAYKQKDIFDKSFGPFYRSEQLFVSNATGDSIFQDYEFVKWWFEKEVEIQTLQA
                     ENKNVTYSDICFKPTGESCALESFSQYFHGDINYLPESSWKQKISSCAASPVNCLPTF
                     QQPLTRPLLFGGDFEKPVLDSPAFVVTLLLNNNEDQQSNQILEAKSWEEQLETYISGS
                     LIPEAEAWGVNITYNTDGSVEKEINKSSNTDVKIIVISYLVMFAYVSIALGTRGGNIV
                     PTGHKFGMDSVLSILTRTRFGLGLAGVFIVLLSVFSSVGVCSIFNLKSTLIIAEVIPF
                     LVLAVGVDNIFLLCNELQDINYLNVTNDLQLCERVAKTLANVGPSILLSATSEVACFL
                     LASAVGMPAVRNFAIYSALAIFFNTILQLTAFVAVLALDQKRLEEGRLDLLPFIQIRE
                     GLISLPEDSEAGNSAAHEANLSELLSGTSSASGDGWFGNLIKKHLAPWLFRPTVKKGV
                     LIFFITWLGISLSLLPKIELGLDQRLAMPADSHLVGYFDDMYKYLNVGPPIYWVVDNN
                     NVSSIDEQRHLCGKFTTCDSMSFVNILQQEYKREGLSTIAEPVAMYLVDGKQDFIDAY
                     HDSIRITQEIKKEQPDLDVFAYSPFYIFFVQYENIISLSITLICIGLVLVFALASLLL
                     GSFTNAAIIVLNVALIMINVGGSMALWNVSLNAVSLVNLMICLGLAVEFTVHLVRHFN
                     FNFNSETEPKLSRKDGRAYNSLCFIGNTTLSGITMTKLIGISVLGFTRSKIFQVYYFR
                     MWLSLIVISSIHSLLLVPILLGSFGSTRNYKTSSYAAVDNDEVLRRLRETN"
     gene            complement(<1076182..>1077885)
                     /gene="PGM2"
                     /locus_tag="FOA43_000505"
                     /db_xref="GeneID:62193906"
     mRNA            complement(<1076182..>1077885)
                     /gene="PGM2"
                     /locus_tag="FOA43_000505"
                     /product="Phosphoglucomutase-2"
                     /transcript_id="XM_038920835.1"
                     /db_xref="GeneID:62193906"
     CDS             complement(1076182..1077885)
                     /gene="PGM2"
                     /locus_tag="FOA43_000505"
                     /note="BUSCO:EOG093414NR"
                     /codon_start=1
                     /product="Phosphoglucomutase-2"
                     /protein_id="XP_038776763.1"
                     /db_xref="GeneID:62193906"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="InterPro:IPR036900"
                     /db_xref="PFAM:PF00408"
                     /db_xref="PFAM:PF02878"
                     /db_xref="PFAM:PF02879"
                     /db_xref="PFAM:PF02880"
                     /translation="MSFAVITVPTKPFDDQKPGTSGLRKHTKVFQEPHYSENFIQSIL
                     SAMPGGPKEKTLVVGGDGRYYNDHFLNLIAQIGAANGLKSLVIGQNGLLSTPAASHVI
                     RAYNEAGKTVDGGIILTASHNPGGPEKDCGIKYNLSNGGPAPESVTDKIFEVSRQLTS
                     YKIIKDLPKLDLTQVNKKFYGPLSVEIIDSTADYVAMLKEIFDFDLIKRFIKKSLPAG
                     FTFLFDGLNGVTGIYGKAIFVDELGLPVSAIQDCTPLPDFGGMHPDPNLTYARSLVDR
                     VDKEQISFGCASDGDGDRNMIYGANAFVSPGDSVAIIAEYAADCIPYFKKTGVRGLAR
                     SMPTCGAIDLVAKDKGLNLYEVPTGWKFFCALFDAKKLSICGEESFGTGSDHIREKDG
                     LWAIMAWWNILAYLAEKNPEDDPTLANVQHSFWKKYGRTFFTRYDFEGCTKKAGDSVM
                     TLLKSKIDNPVFIGSRIGEAKVVEATSFSYTDLDGSVSSNQGLIVKLDFGVRFVVRLS
                     GTGSAGATIRLYLEKHASDKSDVTLSKDAGSFLGADIKAVIEFLQLKKFIGTETPTVI
                     T"
     gene            complement(<1078183..>1079499)
                     /locus_tag="FOA43_000506"
                     /db_xref="GeneID:62193907"
     mRNA            complement(<1078183..>1079499)
                     /locus_tag="FOA43_000506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920836.1"
                     /db_xref="GeneID:62193907"
     CDS             complement(1078183..1079499)
                     /locus_tag="FOA43_000506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776764.1"
                     /db_xref="GeneID:62193907"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00155"
                     /translation="MFRSSKSVRYIRFPSTYSLASNLVRFQSRWAGVPQAPSDKILGL
                     SLLYTLDANPNKVDLGVGAYRDGNGSPWILPSVRMAEKILQDTESDKEYSPILGSPKF
                     IQLVQKLLFAHDTSGFQLLADGRIVTAQGLSGTGSLRVLAEFLHRFHSNHHVKVPDPT
                     WTNHLSIMKDSGLTTSAYRYYDQKSNALDFDGLLEDLSRSEEGTIVLLHLSCHNPTGV
                     DSSPEQWDEIIKMLSERNLVPVVDTAYQGFQSGDPVKDLATLFKFNDAVAMGKIPTYL
                     LSQSFAKNMGLYGERVGTLSVICSGPRESERVRSQLAKLIRPMYSSPPTHGSKLVETI
                     LGNEDIYNQWLNDVKTMCDRLDSMRLLLYDKLTVEYNSALDWEHIITQKGMFCYTGLN
                     PRQVEKLRSTKSVYMTADGRISIAGICLKNIDYLARSIDEVTKETA"
     gene            complement(<1079910..>1081151)
                     /gene="SDS22"
                     /locus_tag="FOA43_000507"
                     /db_xref="GeneID:62193908"
     mRNA            complement(<1079910..>1081151)
                     /gene="SDS22"
                     /locus_tag="FOA43_000507"
                     /product="Protein phosphatase 1 regulatory subunit sds22"
                     /transcript_id="XM_038920837.1"
                     /db_xref="GeneID:62193908"
     CDS             complement(1079910..1081151)
                     /gene="SDS22"
                     /locus_tag="FOA43_000507"
                     /codon_start=1
                     /product="Protein phosphatase 1 regulatory subunit sds22"
                     /protein_id="XP_038776765.1"
                     /db_xref="GeneID:62193908"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="InterPro:IPR032675"
                     /db_xref="PFAM:PF12799"
                     /db_xref="PFAM:PF13516"
                     /db_xref="PFAM:PF13855"
                     /translation="MSGDKQDQHLADKVDKLRLQEGTESVSGEVEAVDSSGEAVRSMS
                     SATDDEDDDDDNDDEEEDESPMVKAIRVEEEMKKKEFAHIEKTYGMTEIPDSTPQILP
                     ADSELTEDVPLDTDYIDLVHMKIRSLESLGLDRFSKLESLVLRDNLIESLHEFKLLTC
                     KDCLEELDLYDNRIKHISKHINELINLKSLDLSFNNLKHVKHVDKLTKLENLYFVQNK
                     IHFIENLEGLNHLKNLEFGGNHVERISETILKLPSLEQLWLGQNKITKLENLDNLNNL
                     KILSIQSNRIDHIEGLDKLQSLEELYLSHNKITKLQGLEKLSNLNVLDITGNKISRIE
                     NMKELKNLTDFWASYNLIDSFDNLHEELGCLPKLETVYLEGNPIQRNNSTQYRTKVRL
                     NLGKSLKKIDALYIASNQMVL"
     gene            complement(<1081552..>1081998)
                     /locus_tag="FOA43_000508"
                     /db_xref="GeneID:62193909"
     mRNA            complement(<1081552..>1081998)
                     /locus_tag="FOA43_000508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920838.1"
                     /db_xref="GeneID:62193909"
     CDS             complement(1081552..1081998)
                     /locus_tag="FOA43_000508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776766.1"
                     /db_xref="GeneID:62193909"
                     /db_xref="InterPro:IPR003231"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR036736"
                     /db_xref="PFAM:PF00550"
                     /translation="MFRQIAYAARNSAKLASRAATFRAATLRATTSVGSMMRPVAFTP
                     VKFMRFSSTGSSLTKEDVLARTVSVLKTFELKNSTDKIELETQFTKDLGMDSLDYNDA
                     LVALEEEFDVVFDDKSANEIKTVGETVSYVLKNYLPEQQDLDKEVR"
     gene            <1082529..>1084688
                     /locus_tag="FOA43_000509"
                     /db_xref="GeneID:62193910"
     mRNA            <1082529..>1084688
                     /locus_tag="FOA43_000509"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920839.1"
                     /db_xref="GeneID:62193910"
     CDS             1082529..1084688
                     /locus_tag="FOA43_000509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776767.1"
                     /db_xref="GeneID:62193910"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF08647"
                     /db_xref="PFAM:PF13920"
                     /db_xref="PFAM:PF13923"
                     /translation="MSTVKRPFSENTTGQQSVKKKFKRSETSLEELTDGGLLSQDDVI
                     YYQKEAIYRMLNLVRHRNRRLRRELSRINDNYSSLNKYYSIINNWWSQVIDNFQNFDM
                     VAKVEASDGSDFNQHLLINVPESAVKETDQLQQELQAKRTKLISLLQPLLSQPVKNRD
                     DKLVDLEESLTNLNVFKSRLEDENKLLRDKIEDLNQEVDTYVKFVENRSSKSLNRISD
                     NLHDKEELKTEDKDGGVIKEEVTDVADGLSETVGVNGNGTAKVEEDLEALKASRKEVE
                     DLKIELAGLTSENKAMSEQLDDKSGKAALLEKQVTELKGAMINISEKDLVRCSEYQAL
                     LAKNSSLSTQISQVKFEGSKIESQLFELESNFTAKKEKLEAQLKSEMEFNNGYIAKLE
                     NDINRIRSDRDSLKAKINIMKAEKGKSELAEEYRKLNQILEKRVEELEESMDTELNFE
                     NNSDKGNQDSETLSKHNKLLSRELKQMEDAFKSTRQLANTKLAKYIESDSYINKLSVE
                     KSKADEKYFQAMRTKDALTMQNKILNGNLTKQAELIEVLKANEKKLLKKLEIENSLFS
                     KLKNLESVYNNDLTFQRNKNKELEIKLKTLQDNNSDLQSSLVKKQEVISQKDKKVLSL
                     DSHTQSMQSQVNELQKLVEKYRSDSRSAEDEEINQALLTMTKCQLCNKNFKDVTLKSC
                     GHCFCSECIHNRLASRMRKCPNCNKQFSNYDLLSIHL"
     gene            complement(<1085030..>1088191)
                     /locus_tag="FOA43_000510"
                     /db_xref="GeneID:62193911"
     mRNA            complement(join(<1085030..1087899,1088185..>1088191))
                     /locus_tag="FOA43_000510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920840.1"
                     /db_xref="GeneID:62193911"
     CDS             complement(join(1085030..1087899,1088185..1088191))
                     /locus_tag="FOA43_000510"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776768.1"
                     /db_xref="GeneID:62193911"
                     /translation="MDDGKAQQFLVNKLLEQKGIIFTEYNDIQLKLFDVDSTLSPNEF
                     DRLARKLDPQSKILLCEKVKLIYGFNSLTPFIVRLIHILNFSTFFSIFDITSNIKLYG
                     FYSLNYTNPVEILVKQIRHDLFIVKSFKEFTIQEMKKEHDFHLPYKEFKRLNLNDGNL
                     VVVKILFKNEQKPIDLALIKPLLPRIELLHLSLESEAKLKPFNDLIDQYGTNLKYLKF
                     GVNRGTFKKIPIRNSIDVMKLVNIDNLNFINDLKNCQSLDVFFDNWELRKNCDIKFQQ
                     NFIIKFDVKQRIQNLRTLNIFHTYLDSKDLNKLKLFPNLTYSKISYVILDNDGFDMSE
                     CKKLQELKIHFTYQKAVEEPDNGEDVASRIQWPPNAKKLSITIHNIKNLDQNFSIRLN
                     ILKKIAKPLPPSIVDLCIDISYDTGGSGPELYSISRDDILKISMLINQILTSNLENLK
                     LKGISRYNYKIGKPLIFSAINFPPSLKLLSLNDFILDYNFINLPKLKKLYFEHSLFDL
                     DFRLPDSDEILIEKCTFKDLAHLPANSSKIEFKMCTFRKIPTYNGDVSNVVINNCRVM
                     EQPTNNIFKFQQQLQTSREDQNGSEQRQSLNQRRGQKSGRQNGQPQKAISNSVTLSAS
                     SSMEDAHQRRRPQRQQQQQQQQRETIPRHSGMHHHLRQKAAPLPQQASMFASTFTFHP
                     SQQSQQSQRAQQAQQPVQQFQMFPSSSLGNMTNPPNAVPAMKPSSSVNQIMGPHQPDM
                     NFAGYDYLGGSSQFSNFIDKDLEMQLNGLSLDNSSSYLGARGSPFGRNAQEQHVSSPP
                     LNSLAMSNSSSNQQAQRSVRPNEQLMPQFSGSGSVGPVSGAYSGMLLQFAPSALSSIQ
                     KETAPIPSSGYGIPSSAYEKTFMASSTKSNDGIGYFVNGAVSQDYATQHSPQVVPVQQ
                     RVAVPMQGQPLNNSNFIPSNEQAFVEMMNAEMNRANSNGVSDSF"
     gene            <1090535..>1096057
                     /gene="DUR1,2"
                     /locus_tag="FOA43_000511"
                     /db_xref="GeneID:62193912"
     mRNA            <1090535..>1096057
                     /gene="DUR1,2"
                     /locus_tag="FOA43_000511"
                     /product="urea amidolyase"
                     /transcript_id="XM_038920841.1"
                     /db_xref="GeneID:62193912"
     CDS             1090535..1096057
                     /gene="DUR1,2"
                     /locus_tag="FOA43_000511"
                     /codon_start=1
                     /product="urea amidolyase"
                     /protein_id="XP_038776769.1"
                     /db_xref="GeneID:62193912"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003778"
                     /db_xref="InterPro:IPR003833"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR014084"
                     /db_xref="InterPro:IPR014085"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="InterPro:IPR036928"
                     /db_xref="PFAM:PF00289"
                     /db_xref="PFAM:PF00364"
                     /db_xref="PFAM:PF01425"
                     /db_xref="PFAM:PF02222"
                     /db_xref="PFAM:PF02626"
                     /db_xref="PFAM:PF02682"
                     /db_xref="PFAM:PF02785"
                     /db_xref="PFAM:PF02786"
                     /db_xref="PFAM:PF07478"
                     /translation="MSGSIPNTIGWTVCDWTNFHRDSTPEQSFQTLLVLAESLKISPK
                     DPAWISVADKYNLNHQWKILQSKSDKPNLKLYGVPVAIKDNIDALGFQTTAACPAYAY
                     TPLEDSTAVALLREAGAIIIGKTNLDQFATGLVGTRSPYGVTPNSFCSKNVCGGSSAG
                     SAFATANGIVPLALGTDTAGSGRVPAALNNLIGLKPTLGTISTAGVVPACKSLDCVSI
                     FALNLNDAQLAYTICAQPDMDQCEFSRALPVNPLRHYPPKPRVAIPIDMTDKWFGDND
                     NPKIFSKAVHTLQKAGVEVVPLDFSPLLDLAECLYEGTWVAERWAATRDFFATNPDES
                     TLDPTVSSIIKGGAKYDAATAYEYDYKRHAILNQVNKKFKDIDAMMVPTCPLNPTIKS
                     VELEPVVVNSRQGTWTNFVNLADFCGLAIPVGFRDSDGLPNGVTLLGRAFEDYALLDL
                     ASRFFHALYPEHNRPIGHIENKISGVSDELDDRIPAPNMQASIRLAVVGAHLKGQPLH
                     WQLDKVQAVFLESTTTAPKYKLYALPTKTPTAIPKPGLKRVDVEAEGGAAAIDIEVYA
                     IPTERFGEFIAMVPEPLAIGTVETIGGEFVKGFVCEEIGYQVKGASDITELGGWLPYV
                     ERSSSEKAKHSKPFKTVLVANRGEIAVRIIKTLRKLGIKSVAIYSDPDRYSEHVLMAD
                     VALPLHGTTAAETYINIDKVVKACKESAAEAVIPGYGFLSENADFADRLEAEGLQFVG
                     PTGNSIRKLGLKHSARQIAEKAGVPLVPGSGLVASSAEAKKIAEKLGYPVMVKSTAGG
                     GGIGLQKVDSAKDIESVFQTVQHQGKAFFGDSGVFLERFVDHARHVEIQMFGDGRGNA
                     IAIGERDCSLQRRNQKIIEETPAPNLPEATRKKMRAAAEQLGSSINYRCAGTVEFIYD
                     ATRDEFYFLEVNTRLQVEHPITESVTHLDLVEWMLFIAAGDPPDFTKALTIDGASMEA
                     RLYSENPVKGFVPSPGTLTEVRFPTWARVDTWVKTGTVISAEYDPTLAKIIVHGKDRM
                     DALKKLRQALNETVVYGVVTNIDYLRSIANSALFENAQMFTKVLDSYDYQPNAFEISA
                     PGAYTTVQDYPGRVGYWHIGVPPSGPMDVYSFRLANRIVGNDSRAPAIEITLKGPSIL
                     FHHETIIAVTGGETPVTLNGETIKMYTPISIKHGDKLSIGKLTSGCRAYLAIRGGIDV
                     TTYLGSCSTFALGKLGGYNGRVLKMGDVLFLGQPGIPACSIPAPVSAPEAAPASLVPH
                     IPAKEWKVGVTCGPHGAPDFFKDEYVGEFFSAQWKVHYNSNRFGVRLVGPKPKWARKN
                     GGEGGLHPSNTHDYVYSLGAINFTGDEPVILTCDGPSLGGFVCFAVVVQAEMWKIGQV
                     KAGDLITFVPVSFSDAIVQRKALDNAIESLSGDMPSIQSSLPSPEKAIIATFKPSSSA
                     PLVTYRQAGDRYVLVEYGDNTMDLNKSYRVHKLIDMVHTHKTVGIVEMSQGVRSVLIE
                     FDGLEIDQTTLIETLVAYEAEVAFSNKWTVPSKIIHLPMAFEDKKTLDAVTRYQETIR
                     SSAPWLPNNVDFIAQVNGIKHKDVQDMLYSARFLVLGLGDVFLGAPCAVPLDPRQRFL
                     GSKYNPSRIYTPPGTVGIGGMYMCIYTMESPGGYQLVGRTVPIWDKLSLGVHTKNLNE
                     GNPWLLTPFDQVSFYPVSEAELNKMCDDWEHGFFKVDMVESVFDHTKYLQWIQENAQS
                     IESFKKNQGGEKLEEFSRLIQVANEELQKSSSTSDKPPEDWPENAELVYSEYSGRFWK
                     PLVKNGDIVENGQGLVVIEAMKTEMVVNATKNGKVLNVLHKNGDMVEAGDLVIVIV"
     gene            complement(<1096210..>1098567)
                     /locus_tag="FOA43_000512"
                     /db_xref="GeneID:62193913"
     mRNA            complement(<1096210..>1098567)
                     /locus_tag="FOA43_000512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920842.1"
                     /db_xref="GeneID:62193913"
     CDS             complement(1096210..1098567)
                     /locus_tag="FOA43_000512"
                     /note="BUSCO:EOG09343R9G;
                     MEROPS:MER0005855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776770.1"
                     /db_xref="GeneID:62193913"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="PFAM:PF00443"
                     /translation="MSQLPYQQIHPVDALVSLWNHRDRFAFLLSDKRPHIAPVPPDFT
                     FTTTLWCTIKQPRVLVTIGLSVIALYIFYPAISASRKDKMFSTKRPDKYTTGLINPSI
                     DCFANSNVQALSSLPALNLYLDTLMMIHSQLCQLNSETLMADQVPAIPLHQALIQILS
                     KMQDTIYTTRVVSVWDFLHVLEDIYDARISRSQHDAHELLQLILETLLKEFVALRKTY
                     RSSIPFQESLAREGIKEFPDFPFGSEVASNLRCMRCGKTSSTNYNPMMILSLALPEEA
                     SVSLENLLKRNESEVIEDYSCLVCEVKHILASKDQIVHEAKDLKLVERLRLLLERNLI
                     LINDDLEPELQQFVDNYPGIKSFKVKSIVHREVSIIKPPKILTIHLSRSIFQDTQAWR
                     NSCDVVFDEELQVKVDNKQFDEFKRKQEVESVDSTGSAIEEMSINPSYNPTLTSLSKA
                     STEHFEEATEDLSDSDFESDDDEDDDEMESGIEEYDEDDAENLDLDKITPQADGSVKR
                     RHEVNRHHKNHRPHGSTPTSASASTESSAFLSITSSFTCFTYEIRSMIRHLGSHSMGH
                     YECYRRKPVYYKSRITGEYYSKFPGLKNSNREKKTDVMAALNNLELSSSSFTETGTGT
                     GTTDEFTGMSDLSTTDMGNQSDVPKAVPASSSVNEQNPTISARKPSRTLSISKFRSRV
                     SSFVGVGPSRQRSLSTTSNGGPVGSLAGTSPSTSQIGPVPFRDPFTKPKRPKKDKKLA
                     SSIKHPFWRISDDKVKESTISDVLGDHAAVYMLFYERKDPLRIFQ"
     gene            complement(<1099086..>1101323)
                     /gene="HSP82"
                     /locus_tag="FOA43_000513"
                     /db_xref="GeneID:62193914"
     mRNA            complement(<1099086..>1101323)
                     /gene="HSP82"
                     /locus_tag="FOA43_000513"
                     /product="Hsp90 chaperone hsp82"
                     /transcript_id="XM_038920843.1"
                     /db_xref="GeneID:62193914"
     CDS             complement(1099086..1101323)
                     /gene="HSP82"
                     /locus_tag="FOA43_000513"
                     /note="BUSCO:EOG093418J8"
                     /codon_start=1
                     /product="Hsp90 chaperone hsp82"
                     /protein_id="XP_038776771.1"
                     /db_xref="GeneID:62193914"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="InterPro:IPR037196"
                     /db_xref="PFAM:PF00183"
                     /db_xref="PFAM:PF02518"
                     /db_xref="PFAM:PF13589"
                     /translation="MSTKTESYEFQAEISQLMSLFINTVYSNKEIFLRELISNASDAL
                     DKIRYQSLSDPHVLDSDPKLFIRITPKPEDKVLEIRDSGIGMTKAELVKNLGTIAKSG
                     TKTFMEALSAGADVSMIGQFGVGFYSAFLVADKVQVISKNNDDEQYIWESNAGGKFTV
                     TLDTTNEKIGRGSIVRLFLKDDMTDYLEEKKIKEVVKKHSEFVSYPIELMVTKEVEKE
                     VPVDDDEEKKDEEEKKDEEEKKDDEEEKKDDDEEKKEPKIEEVEDDEEKKVEEEKKEK
                     KTKKVKETVTELEELNKTKPLWTRNPSDVTQDEYNAFYKSISNDWEDPLAVKHFSVEG
                     QLEFKAILFVPKRAPFDLFESKKKKNNIKLYVRRVFITDDAEELIPEWLSFVRGVVDS
                     EDLPLNLSREMLQQNKIMKVIRKNIIKKCIEMFNEIAEDKDQFDKFYTAFSKNIKLGI
                     HEDAQNRTALAKLLRYNSTKSDDELTSLSDYVTRMPEHQKNIYYITGETLKTVKESPF
                     LDALKDKGFEVLFLVDPIDEYAMNQMKEFEDKKLVDITKDFELEETDDEKKKREGEVK
                     EFEPLTKALKDILGDKIEKVIVSHKLVDSPAAIRTGQFGWSANMERIMKAQALRDTSM
                     SSYMASKKIFEISPSSPIIKALKTKVEENGPDDRVVKNLTAMLYDTALLTSGFTLEEP
                     TTFAKRINSLIAIGLNIDDDNAETTEGEEKVEKVEEAEEKKDEDSAPSKDAEAESETA
                     MEEVD"
     gene            <1102356..>1107269
                     /locus_tag="FOA43_000514"
                     /db_xref="GeneID:62193915"
     mRNA            <1102356..>1107269
                     /locus_tag="FOA43_000514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920844.1"
                     /db_xref="GeneID:62193915"
     CDS             1102356..1107269
                     /locus_tag="FOA43_000514"
                     /note="BUSCO:EOG09340E3O"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776772.1"
                     /db_xref="GeneID:62193915"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR000593"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR036872"
                     /db_xref="PFAM:PF00307"
                     /db_xref="PFAM:PF00616"
                     /db_xref="PFAM:PF03836"
                     /translation="MSKGLPSIASLSDDDEHTPSTSSTKENTSPVKNLIIQKEKDTVN
                     NHATDFIPVPDSKLPPVKFAGFHTSSIYVEKKRTSNPSRSQRRRMSEINHAISASPSL
                     KNLNKLKLIENKLTTRKVSGGKKRSVSGIQYMLKFIADKPHNTNVLTRVPQTSSPSTN
                     ASPETDKLQFICRLLEVKQWIDAVLGEELDVGESNISEFQDYFRNGVLLAEITKKLDP
                     DSVKSIYYGQATNTVSSAKGKFVNKKGLYFKFTENIVQFLDYLRKVRMPDMFIFETRD
                     LFEMKNFPKVIFCLQALSYLSALKNNMPSIQRVSADSINVSAEEIRSVQAQIRGVKLP
                     NFDNIYDGVRVNVGSDIRPVALFSQGQIPEAEDKKSDVESGRKFSLHIAKTRQLQTDI
                     KSSEIIEETPEEKPKPTIFASDSSLDDDYLLPLKDPVAKQVDTTQARTLFRDYNPTLD
                     IDMEAIEKKYSSMIQQDNGLSLTGDCSITYHDDDSYSSPVVIDGTFPIENLIGLQSIA
                     RGALIRYGLFVNKFMMKVFTPDIMTFQGILRGVLVRHKLKLAHTSLNANSRSLSVLQT
                     ILKNRKKEDRYTIVKKQLSQCKSDVIFLQNQIRGAVIREGNYQTRKQLLRQTTRVIQL
                     QSLIRGIIFRGLLRRHGSDATRLKRPRYKTIIRAPRLESKRKRPPEKHQDRKSYRMHD
                     WDMMIYEHEDSWNSLSLIAKGYLVRRRIEQTKNRLRRRGAGVIALQSTFRGVLTRFYI
                     AVGLERLENKSPEIVLFQSRIRGALKRKKIKQREAWFQRPENIARICKIQNFVRGSIA
                     ATDYKSLINERNPPLKAIRNYIGLLSGSDIDLEDEISIEKYKRKITSETKHIEKWEHD
                     LKQLGVKLQLLKKNRISLEEVVRFRDNNLNLSDYSQSLNDLMNKSISSNPSKIVDKSC
                     KNLLELYGKIFYLLQTKPDYFAGLMHCVDFNGLKDTIRSKHVEDWVLKVFNYSSFVQE
                     TSNGSTREEFLLMKLILATSFKFFLEVGNKKNFHDFLKARQDLLHYEPKHWERILLCY
                     VNLPRQRLMAKNLFSGAILRVTSDSDSWYEPDPQKIYKRVVENDEEEGRITLKNFDRE
                     DPIDDPETRQQFVKNLSELREASYDIMKSIGESVVKVPNYMRCVCKEMYQQLKDQFPG
                     ESEKYYLSTVGSVFFRSYVIPLFTRPEDYGINVAGVSDELEKVATVMSNLEQVAKVLN
                     QLVCMRPFPPSEVYLQPLNPFIEEFTEGVRVIIKDLINVSPIDECYHMSSVYDDVASH
                     NKPILSMASEDVLDLIGYLRTNIDFVAPERNDLLRYLLLGAGELSSNHRKLETVRGFL
                     NLKLQPITESTNSEDLEIKTLIMEAKRYIIYILQVQDGEDLLDLLLSEITPQDELRFK
                     EIVKEEKKMIREVSGLESVFEKQALDDIYNSTYPQVKKHAIELVLDLEHKGIVTRSDC
                     YQPLLNEISKDIKNKKVQKEDRERRLKVVVDTLKKLTQKERTCSKLYAEYIKDIDKFM
                     LNLQNQSASRKKSFFSRLFSKQYYYQLRLKRKKGYIPRFGSFKYDGKYLKDGGIIENI
                     SSSTRATVKPGRINFMFSCEQQGKFIIDVSNNSVDITGLETLTLDDLLDYQYENKKQF
                     ELFGGCVTMNTDKFVAFIFKKFFEVKE"
     gene            <1108224..>1110369
                     /gene="RPD3"
                     /locus_tag="FOA43_000515"
                     /db_xref="GeneID:62193916"
     mRNA            join(<1108224..1108440,1108713..1108772,1108832..>1110369)
                     /gene="RPD3"
                     /locus_tag="FOA43_000515"
                     /product="histone deacetylase"
                     /transcript_id="XM_038920845.1"
                     /db_xref="GeneID:62193916"
     CDS             join(1108224..1108440,1108713..1108772,1108832..1110369)
                     /gene="RPD3"
                     /locus_tag="FOA43_000515"
                     /codon_start=1
                     /product="histone deacetylase"
                     /protein_id="XP_038776773.1"
                     /db_xref="GeneID:62193916"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="InterPro:IPR037138"
                     /db_xref="PFAM:PF00850"
                     /translation="MGNRWTEWILPIRVRSYNPTFQDGIGYEVNEILYRRMQQEAQIR
                     ERLSSELESYKSRQRQIRDDATRLLDTEGMLYVEKPWEDIKVNPQDKKRVAYFYDSDV
                     GNFSYGANHPMKPHRIRMAHSLIMNYGLYKKMEIYRAKPATREEMSQFHSDEYVDFLA
                     RATPDNLDMFNKEKFNVGDDCPVFDGLFEFCSISGGGSMEGAARLNRGKCDVAINYAG
                     GLHHAKKSEASGFCYVNDIALGILELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMT
                     CSFHKYGEFFPGTGELHDIGVGKGKYYAVNVPLRDGINDVTYRSIFEPLVKTIIEWYQ
                     PSAIVLQCGGDSLSGDRLGCFNLSMRGHANCVNYVKGFGIPLMIVGGGGYTMRNVART
                     WTYETGLLNQTLLGPDLPFNDYYEYYGPDYKLDVRPSNMYNANSPEYLSRILTQIYAT
                     LEHTKHAPSVQMQPIPPDIRDYDDDPEDDSREAMDTKGGSQKARDETIVPDNEFYDKE
                     EDASRVKNNIDYGKKMNGEESRSSVADVTTMGPSPPSSAVPAGTLGVSTTNAAVVAAA
                     GPSANGESQSKPPTADSVAPTNNSVTTPTTTATSEEKK"
     gene            complement(<1110569..>1112062)
                     /locus_tag="FOA43_000516"
                     /db_xref="GeneID:62193917"
     mRNA            complement(join(<1110569..1111719,1112056..>1112062))
                     /locus_tag="FOA43_000516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920846.1"
                     /db_xref="GeneID:62193917"
     CDS             complement(join(1110569..1111719,1112056..1112062))
                     /locus_tag="FOA43_000516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776774.1"
                     /db_xref="GeneID:62193917"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="PFAM:PF01513"
                     /translation="MDDQPPTNIFVVKKPWKQHVTEAMVTFIKHIHRKYPSCNVIVKK
                     EVAEELYDNEALFFPKNTDDGVNSMPRHTLYTGTNTEIVSKTDLLVSLGGDGTILRGV
                     SMFSNTTAPPVLTFSMGTLGFLLPFEFKDYRTAFKNVYDSRAYVMRRERVECHIVKKN
                     ADTKKEVTDNAGEQDLIDSHSYSSSFIKVHAMNDIVMHRGSLPGLINLDVYVNDHFLT
                     RTTADGLIFATPTGSTAYSLSSGGSIVHPSVRCILLTPICPRSLSFRPLILPASSHIV
                     VRVRSKNDGKSINTSQACAFINSSAKMSVDGIPVTELEPGDEMHVLCESEPRVGPNGD
                     PCHTDTDMQRLKEYDYRGVWCVARTEADWVNGINGMLGFNSGFRTKASDVM"
     gene            complement(<1112812..>1113534)
                     /locus_tag="FOA43_000517"
                     /db_xref="GeneID:62193918"
     mRNA            complement(<1112812..>1113534)
                     /locus_tag="FOA43_000517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920847.1"
                     /db_xref="GeneID:62193918"
     CDS             complement(1112812..1113534)
                     /locus_tag="FOA43_000517"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776775.1"
                     /db_xref="GeneID:62193918"
                     /db_xref="InterPro:IPR006384"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF06888"
                     /db_xref="PFAM:PF12710"
                     /translation="MKSPVVFTDWDGTVTLQDSNDYMTDHLGFGEVERKRIGKMILDE
                     KLSFRDGFNMMLKSITDKGYSMEYCIETLLKNIKLDPGFRPFLEWCKAHNVPLYVISS
                     GMRPIINALLKTLVGDDAADYVNILANDVEYDSVDHSKWHIVYRDETPFGHDKSRSIK
                     KILAEYHDVKPIAFYCGDGVSDLSASSTCDLLFARSGKDLVTFCDRHHIPYREFYSFV
                     NITDDVNAVSHGVKTIEDCLVK"
     gene            <1113832..>1115364
                     /locus_tag="FOA43_000518"
                     /db_xref="GeneID:62193919"
     mRNA            <1113832..>1115364
                     /locus_tag="FOA43_000518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920848.1"
                     /db_xref="GeneID:62193919"
     CDS             1113832..1115364
                     /locus_tag="FOA43_000518"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776776.1"
                     /db_xref="GeneID:62193919"
                     /db_xref="InterPro:IPR002882"
                     /db_xref="PFAM:PF01933"
                     /translation="MPNIAIVSGGTATNAILDVIQQLAGDQNHNSHSNGCISYILPIS
                     DNGGSTSEIIRVMGGCSVGDIRSRITRLIPDESSGLRDLLSYRLSPNLKEAKAEWEQI
                     VEGSHPLWASVDPPCRQIMRSFLIHVHLEILKRSRHSAKNFRLELASVGNLFLTGARL
                     SCGSLDSSIELVLRMTRVPSNIQVLPCINTNFTYHISALLKNGAIITGQSQISHPSLP
                     TKGRRREPSLLKSSSLSRLEYLHNGSTVSFNDDVVLQGSVAETPDQVRNVVKNAGLNW
                     KQQDSDIDSDIASYDSDIDDDSEMGTPSYVHPELRKSQLHFNKDDNIPLPAPIERIFY
                     ISPYGEEIYPVANSRVLNCLREANTVIYSIGSLMTSIVPILILQGVGDAILHNHRKSS
                     GSKKKVLLVNGSSDRETYGMSALDCITVICDALNYSMLFSPERKRDKSHEVTSGKFPI
                     SSFVTHILYIRFDAQIRVDVSAIESQGVKCIAVKNALGDGHAYDLTDMYKKMDEISKS
                     KV"
     gene            <1115492..>1116163
                     /locus_tag="FOA43_000519"
                     /db_xref="GeneID:62193920"
     mRNA            <1115492..>1116163
                     /locus_tag="FOA43_000519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920849.1"
                     /db_xref="GeneID:62193920"
     CDS             1115492..1116163
                     /locus_tag="FOA43_000519"
                     /note="BUSCO:EOG09344BOQ;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776777.1"
                     /db_xref="GeneID:62193920"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="PFAM:PF00036"
                     /db_xref="PFAM:PF13499"
                     /translation="MNLKYLFGTLSLFSAVLGAVAPGINKESEFKESIPQEFHGSWQK
                     WHMKVEHDLDDADSESVFKLHDSKNANKLSAYDILRMYGLARDEIVGEGNGMGSHDDT
                     EIVGKELKEKVIKEVMKLMDKDNDGAVSLEEWKEFSGKGGEFPDFGIGSGHEYDFEEE
                     YEKHHWNKYHSENDPDVKVQHAEDIEHELLHHFHEIEHEQSVNGYHIKAPIQEANIPL
                     KFLVQ"
     gene            complement(<1116323..>1119460)
                     /gene="TEF3"
                     /locus_tag="FOA43_000520"
                     /db_xref="GeneID:62193921"
     mRNA            complement(<1116323..>1119460)
                     /gene="TEF3"
                     /locus_tag="FOA43_000520"
                     /product="translational elongation factor EF-1 alpha"
                     /transcript_id="XM_038920850.1"
                     /db_xref="GeneID:62193921"
     CDS             complement(1116323..1119460)
                     /gene="TEF3"
                     /locus_tag="FOA43_000520"
                     /note="BUSCO:EOG093409R8"
                     /codon_start=1
                     /product="translational elongation factor EF-1 alpha"
                     /protein_id="XP_038776778.1"
                     /db_xref="GeneID:62193921"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF17947"
                     /translation="MSDSSHAEQVLDELFQKLSVASADDLDDVATNVASFLNGPIVEH
                     DVPYEFFQKLDKAVNDKKNAFNALEAVVHIASEDDLSSSVEPYIAELVPSVCAKCGDK
                     KEEVREQAEKALLALARAITPSSIKYFLPKLIDSLATTSKWQEKIADLKAISILVDTA
                     KDQLALRMPELIPALSEAMWNTKIEVGKTATETMTKCTATIDNKDIEPFIPKLIDSIS
                     NPDDVPETVHDLGSTTFVSDVTTAALSIMAPLLSRGLAERETSIKRKAAVIIDNMCKL
                     VEDPQIVAPFLPTLFPSLKSNMDIIADPEARSITHRALTTLRRVGAIPEDDTLPEVTT
                     AGDVEVNLAILKNIIGKQAKRFDVVQTYVAAMAGDLIDERKTDSDSWNALLGPFLTIF
                     LHEKEAHEVIEKFRATAIENIPTPPVFEEEDDDGEDLCNCEFSLAYGARILLNKTQLR
                     LKRGRRYGLCGPNGAGKSTLLKALANGQVEGFPTQEECKTVYVEHDIDGTHDETSSTK
                     YILESESVNYNEEEIKNKLREFGFEEEMLDMPIVALSGGWKMKLALARAVLQNADILL
                     LDEPTNHLDHINVDWLVNYLVSCGITSLTVSHDSGFLDRTVQYIVHYEGLKLRKYKGN
                     MTEFVKKVPAAKAYEDMTATDLEFEFPEPGFLEGVKTKQKAIVKVQDMSFQYPGTSRP
                     QMNHVTFQCSLSSRIAIIGPNGAGKTTLVNVLTGELLPTSGEVYIHENCRIAYIKQHA
                     FAHIDNHLDRTPSEYIQWRYQTGEDRETMDRANRKINEEDKQGMNKVFKVQGTPRKIA
                     GIHSRRKFKNTYEYECSFLLGENLGMKSERWTPMSSVDNAWLPRPELIESHGKMVAEV
                     DMKEALANGQYRALTRKEIEVHCTRMGLDPELVSHTRIRSLSGGQKVKLVLAAGTWLR
                     PHLIVLDEPTNYLDRDSLGALSKALKAFHGGVIMITHSAEFTKGLTQEVWTVQNGTMT
                     PSGHNWVQGQGAGPRISKKEEEGTKVDAMGNKVKLTQKKKKLSSAEKRKKKKERMKRK
                     KELGDAYVSDSDSDF"
     gene            <1120393..>1122976
                     /locus_tag="FOA43_000521"
                     /db_xref="GeneID:62193922"
     mRNA            join(<1120393..1121273,1121944..>1122976)
                     /locus_tag="FOA43_000521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920851.1"
                     /db_xref="GeneID:62193922"
     CDS             join(1120393..1121273,1121944..1122976)
                     /locus_tag="FOA43_000521"
                     /note="BUSCO:EOG0934325J"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776779.1"
                     /db_xref="GeneID:62193922"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR006565"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR011876"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="PFAM:PF00293"
                     /db_xref="PFAM:PF07524"
                     /translation="MTQELTSYHRLVKYLSKQDILDKFLEVIPLERTTGEKSSSNDGI
                     VKASSTISATGAAASSLFAGHDEEQIRLMAENCIVLDYNDVPIGSGTKKLCHIMKNID
                     QGLLHRAFSVFLFDSHNRLLLQQRADEKITFPSMWTNTCCSHPLCVPSELGFSSSAFD
                     GTNIHSLDTAVRGAKSAAQRKLDHELGISNKDVPVTAFKFLTRIHYMAPSNGAWGEHE
                     IDYILIIKSDGQVHANTNEVKDYKYVTKQELKQMFNRKDLLFTPWFKLICESYLYEWW
                     DHLDNLKNYTSTTIDRMLNNTISPTRAVMTLDTFNFHLLRVTLAQLMKTHGYDRSNNR
                     ALDVMTDLCTKYLRLLTSTVLKYTELRNATEPNIQDLTDAFLELKLISPATRLDAFDI
                     DRLTSKGMENFESWFMSEMNTRLREVARPDLQFVQNAIHEKKLKDVNSKMSTLTAALD
                     QQAQQAQQQNPTLPYQYQPSQTGLSPMRDTRGKSRQDKEAEHDDLTVDDDWVKFILRQ
                     QLNENPDLKFNGTVLINYLPKDKLPPKRTKPCRDFIVAGPTPNSLTPALPYSGDEKRL
                     LNELRDNDIEVDMNAYERAEAAEAEGENAPNLTFGTALSAQPTHKDFYPQVNLEDDPV
                     QEDSGDHSLNLFG"
     gene            complement(<1123069..>1126728)
                     /locus_tag="FOA43_000522"
                     /db_xref="GeneID:62193923"
     mRNA            complement(<1123069..>1126728)
                     /locus_tag="FOA43_000522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920852.1"
                     /db_xref="GeneID:62193923"
     CDS             complement(1123069..1126728)
                     /locus_tag="FOA43_000522"
                     /note="BUSCO:EOG093405MU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776780.1"
                     /db_xref="GeneID:62193923"
                     /db_xref="InterPro:IPR012978"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF08161"
                     /translation="MSSADDQLLQIVELKGKLDKVRSQISSKLVNQQHLALILQTVEE
                     NLDQQHQEKTAVAYFVSFLSLLDQCCENDQIKDFALATGAVYFLNLVSPYTPKGLLRP
                     HFGDILTKVAPALTDEHSQAPLIRSSIGFLESLLLAQDLDAWNNVNNYKISPKRGLMG
                     LLELSLDPRPKVRKGAQESVHSILLQVPVGTGAHPASFYSGEFALNRLISLVQKNPLN
                     KDSTFSKDLSAQIIHNLQLISAIAKANAWPIKQVNTLCDILLEICKSADEYMVSAAFA
                     AFEGLFQSMNSKIDNDKFVQVMDIIFDLKPAVNDPHLAPSWLAIVAKAVTSYSLNIDS
                     LKCFMKLPEIFKIVGDYFSSDVENVYISASQCLIAICSDAIDKKWLLYAPAVKQEISE
                     QIGTVISQLASITNSFLSVKYRQCAKEVAELIGALFLSLRIRANPDFLPHLGTIGEWR
                     SNEQEGFELNGVSESVIASAISSMGPEVVLEILPLNLNDANAVGRAWLLPILKVNVRC
                     AHLSYYIKDILPLTSYFEELVSKANPESMNTKIFATLVSQIWSLLPAFCDLPFDLVTS
                     FSDEFAAHLAKLLYQQVELRPTICHALRMLAESNAVYSSGVVDDLIVNQQFPVSKSKE
                     ALKYLSSTKAPKFLSVLFNVFSETPMDQRNYVLETIDAYLQISKPSDLVIIFNKVCTL
                     LQKALDDETEKDFAETDDPAANGKIPKLSITMMDIVIEITKYLEESSHNALLAIFNRT
                     VRVKDVQIQKRAYRILSSLIKTESGLKSVLKFLPDILKVLVEGSETTLMAAKSARLLC
                     ILEVIKILPVDYLHFIPGVLSEVILCTKSVNERARGNSYDILVAMGNNLIEFEGSPIK
                     NSLNDPDMSDSVASLKELFVMCSAGLAGGSPHMISATITALSRVFYEFHDNLEMDFLK
                     QMTSTIELFLTSKNREIIKSTLGFIKVATLSLPEDEVRPRLKGLLTNLLAVNHEQKSH
                     FRSKVKHLIERLVRKFGSDYIEQCVPEEDKKLIINIKKSKARAKRKKSQASYDDDAGR
                     GEGEAHSNNTFMSAYEEALYGESDASDDDAEENNNDGEEGYSHSRKPKQFISESKDAP
                     LDLLDKQALSHISSSRPKTFSKKDVKYHTKNGKLVFNENDDSNAFGGKNSIDAYVEAV
                     KQGPVRGQGNKLKYKKKQRTEDGINWDDEEAESRESGERKSVKQYPQSRSNYRNVRGG
                     RIGKPKSRFKARKKF"
     gene            complement(<1127412..>1128218)
                     /gene="THG1"
                     /locus_tag="FOA43_000523"
                     /db_xref="GeneID:62193924"
     mRNA            complement(<1127412..>1128218)
                     /gene="THG1"
                     /locus_tag="FOA43_000523"
                     /product="tRNA-His guanylyltransferase"
                     /transcript_id="XM_038920853.1"
                     /db_xref="GeneID:62193924"
     CDS             complement(1127412..1128218)
                     /gene="THG1"
                     /locus_tag="FOA43_000523"
                     /codon_start=1
                     /product="tRNA-His guanylyltransferase"
                     /protein_id="XP_038776781.1"
                     /db_xref="GeneID:62193924"
                     /db_xref="InterPro:IPR007537"
                     /db_xref="InterPro:IPR024956"
                     /db_xref="InterPro:IPR025845"
                     /db_xref="InterPro:IPR038469"
                     /db_xref="PFAM:PF04446"
                     /db_xref="PFAM:PF14413"
                     /translation="MAKSRFEYVRNFERENLLLPETHIIIRVDGRGFHKFSEKYEFDK
                     PNDDRALKVMNLSACQLMNQIPDIMMAYGDSDEYSFLLRKQCDMFERREFKLITTFGS
                     TFSANYQYFWSSVCSDKPLTVERLPTFDARAVVYPSDDTIKDYFRWRQVDCHINNLYN
                     TTFWNLVIKGGMTPHDAENKLIGTVSADKNEILFKQFGINYNDEPEIYKKGTLYIRDS
                     VITPTEANTRDLTKRQLERLQKRLKKSEIKELHCDIIKDEFWDDRPWLLC"
     gene            <1128352..>1129833
                     /locus_tag="FOA43_000524"
                     /db_xref="GeneID:62193925"
     mRNA            <1128352..>1129833
                     /locus_tag="FOA43_000524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920854.1"
                     /db_xref="GeneID:62193925"
     CDS             1128352..1129833
                     /locus_tag="FOA43_000524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776782.1"
                     /db_xref="GeneID:62193925"
                     /translation="MSRLELPGFYYDETRHRYFRIIQGGGDSGVSQHHYTSSTIQQKN
                     REQELVKKSEIQMNVQLPIEILAEQYFDHIVESGITDMELHYKYLMFSKELPPTEDRA
                     RPNSDIYYFGRHFSQRVKIQSLGNSQREEFLHIPERSSVVGFVKANCKWYIFCDNYKS
                     VASVSNLSDLSDPQATPYYEYNADSNLGFAGPLPTNAITSLSHPMNAFVGRINPLVAT
                     TRNGQVFSSRLLWTRNNWTLITQDDAVSSHPISFVPLHSFLICVKNKHFIFHVVQKGP
                     RYRILSHCGDSMTAVKSFSHEPTSIEQLGDRHLVIGFSNGDVTLFELNKALRDSSIKL
                     KQTQIPDHLHIGASVCHMVAIYLSKEQIYLIVSGLNNVLVCLNVFITDGKILLFEKAF
                     DYFEYFNAYNTGPNIKTFDEGQPFFVVQSYENDEVNLKLYYLFYQRPLDWGPHNEGFN
                     LGPTTDNPAYYRYIVDCYHLIVLNCRHKLLTSYCISEADSTDI"
     gene            <1130023..>1133532
                     /locus_tag="FOA43_000525"
                     /db_xref="GeneID:62193926"
     mRNA            <1130023..>1133532
                     /locus_tag="FOA43_000525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920855.1"
                     /db_xref="GeneID:62193926"
     CDS             1130023..1133532
                     /locus_tag="FOA43_000525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776783.1"
                     /db_xref="GeneID:62193926"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR009674"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="InterPro:IPR037033"
                     /db_xref="InterPro:IPR037034"
                     /db_xref="PFAM:PF00562"
                     /db_xref="PFAM:PF04560"
                     /db_xref="PFAM:PF04561"
                     /db_xref="PFAM:PF04563"
                     /db_xref="PFAM:PF04565"
                     /db_xref="PFAM:PF06883"
                     /translation="MSKAKFRTLEQVDRFKNPSKDKSAFPLLYEAVKPHIGSFNALTE
                     GPQGGLLNLAVKDIGTKTIFDSTNPDFLGNRLDIRVDSVQIAKPTVPSSDKLSLVRTI
                     YPSECRERLNSYRGRLLLKVTYIANNGKEVSQVKEAGLLPVMIRSNRCNLEGMSPEDL
                     VQHREESDEFGGYFIVNGIEKIIRMLIMPRRNYPMSVIRSSFSNRGASYSHFGVQIRS
                     VRPDQTSVTNVLHYLNDGNVTLRFSWRKNEYLVPVVMILRALIEANDREIFDGIVGSD
                     TSNSFLTDRLELLLRTYKHYKLNSQKEALAYLGNKFRVVFSASDDRTDADVGREVIKR
                     AILVHLSNNQDKFRMLLFMIRKLYSLVAGDCVEDNPDSTQNHEILLGGFLYGMIIKEK
                     IDEYLQNICAQIRADINRGFDVDFEDPKYMSRVFTRTNANIGQKLQYFLSTGNLVSQT
                     GLDLQQVSGYTVVAEKINFHRFLAHFRMVHRGSFFAALKTTAVRKLLPESWGFLCPVH
                     TPDGSPCGLLNHLAYKCKVTTEQLDTSKVCQALYKLGVSETASAVAISGPNVCCVQLD
                     GRIIGWCSHKQGKIVADTLRFWKVESSDHCIPLELEIGYVPPSQSGQYPGLYIFGGRS
                     RMVRPVRYIPLNKEDMVGPFEQVYMNIAVEPNEIESNVHTHVEFSPTYVLSTLANLTP
                     FSDFNQSPRNMYQCQMGKQTMGTPGVALVHRSDNKLYRLQSGQSPIVKAGLYDDFGMD
                     NFPNGTNAVVAVIAYTGYDMDDAMILNKSTEERGFAYGSMYKTEKIDLGRDRNRGDPV
                     TQHYGFGDDAWPEEWREKLDADGLPYVGTYMEESDPICAYYDDILGRTEIKKYHSSEP
                     GYVDEVKLIGNENANAECQIMTIKFRLRRAPIIGDKFSSRHGQKGVCSRKWPQIDMPF
                     TESGMQPDVIINPHAFPSRMTIGMFVESMAGKAGALHGIAQDATPWQFGENDTPLAYF
                     GDQLAKSGYNYYGNEPMYSGVTGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNS
                     LTMQPVKGRKRHGGIRIGEMERDALIGHGTSFLLQDRLLNCSDYTQSAICRECGSILS
                     TQMSVSRIGTAAGFRCRRCAQKVDSSSVIKDNELDVWEDGQGNKFVGGHDTTTVGIPF
                     VLKYLDSELNAMGIRMKYNVEPK"
     gene            <1133768..>1134241
                     /locus_tag="FOA43_000526"
                     /db_xref="GeneID:62193927"
     mRNA            <1133768..>1134241
                     /locus_tag="FOA43_000526"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920856.1"
                     /db_xref="GeneID:62193927"
     CDS             1133768..1134241
                     /locus_tag="FOA43_000526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776784.1"
                     /db_xref="GeneID:62193927"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="PFAM:PF00583"
                     /db_xref="PFAM:PF13508"
                     /translation="MPSFIDELPPLPDGYHIRKICSDDYGRGALEVLKALTTVGEITN
                     KEFEHTIETWARHPEIYHTLVILDLSETVVAIGSVIVESKLIHHCGKVGHIEDIAVRP
                     NQQGKKLGCTLIRHLIKIAGSLDCYKVILDCDPANEMFYAKCGLSKAGTEMQFRF"
     gene            complement(<1134324..>1136162)
                     /locus_tag="FOA43_000527"
                     /db_xref="GeneID:62193928"
     mRNA            complement(<1134324..>1136162)
                     /locus_tag="FOA43_000527"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920857.1"
                     /db_xref="GeneID:62193928"
     CDS             complement(1134324..1136162)
                     /locus_tag="FOA43_000527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776785.1"
                     /db_xref="GeneID:62193928"
                     /translation="METEGSDSSEKEKSGEDSSTLEKEAEVPASPVPGTGSSSHDSSG
                     VASDADSDSSSAVDNFFAEVSGERQETSLDGVSESSVQATSTVANIPSRTQDLEKSIE
                     IEVPEVLNGTAEEGSKGNSEKAISKPNRKISPMHHEYHEESSKISSSSTPSGESTPIV
                     SSDSSDEEVFTSETPQILPEASDGHVATEASEVGANSQESTGDKSSANHSNGSIDESP
                     LNVLASPTIVHEGSANILQSPNSSTPSYNPPLALPDTPKSTESTEDPDFAETLVPSRN
                     RESSGATGHAQASDHNTDYSPTSSPKITAKTSGSSDDSDNDTSFEEEYDEYIALKKEL
                     VELKKQLLDKISQLEDEKKSEDFNMDKYLEHCQLLNDYTNLPSFDFEKRLKLIKMFYP
                     NMNIVDVSRHKDVETSNQSLSFTISFIRLASFRVQIVFDKSDEKVMNLSLSKTGSLNI
                     TTEYDQIEKLIKYCEAQKDVSLFIYALNSYIHLFKCRSQLWMDLFAKYFEESVSINGY
                     TKVEAEGKNTRLLAYALLRSSSSFELTKEKKEIVFHWDFFFPMGENYNETIVGDCQSE
                     MKCFVFVESENGKDDAVLDLTETLKGLVKSDGTYKGFSRLIESMLV"
     gene            complement(<1136764..>1139247)
                     /locus_tag="FOA43_000528"
                     /db_xref="GeneID:62193929"
     mRNA            complement(<1136764..>1139247)
                     /locus_tag="FOA43_000528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920858.1"
                     /db_xref="GeneID:62193929"
     CDS             complement(1136764..1139247)
                     /locus_tag="FOA43_000528"
                     /note="BUSCO:EOG09340TLF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776786.1"
                     /db_xref="GeneID:62193929"
                     /translation="MSFDPVHDSIEANKDTEEHTVKAEISDDASVSGSSSASKHTASL
                     TSLLNPTNIPAAKKGTKISDLLVGPPSQPEVNVTKKKKRKPFLKDISKDAEQKEYRSY
                     QTLLINSRSRHLKKDDGEPYWRHEIQFEFLMRLFFNNKRAFKNPYYEAGVSYQWPDHF
                     KWARNDDGSVCQNDGKMLTFFELYLITLLKSSKISKILKDRLLLDINYALNFCVICLL
                     VNIGRLNTTVNFDYEMKSQFRTYHCIPSLQVGSHLPIIEKYYNIDESAIKLRLIEEDG
                     IVVTGENSAKATNSSTRSSTLPSYASVRGGSGYTISTVKQLQDTPRIKSILKSINDLN
                     TEIPKSYKEFVVGLSLGNKYNLNIVSLIFLLCVHEVEICKAFFPEPAELSEDEREQLN
                     NDDPVSSGSLFNDIWLQQDVRPEDKVDRFLWLIYLFKETEFKSEKMQKNPFNKPGVST
                     ELLEFNPNAEMSEEIATNNKYILGKTRSIVPELHYIDRGYRKADPVLNDEDTDSEKSF
                     GEKMKALRLTFVSKEYSSDSHRVELSTPPSSASSTAVSTVASGTTAVSSTEKESNATE
                     AMPADAKTVLSKPALTIAPKRRSTRGSAAKEAKKISEPLKVHASADLRRGTEEAGKRR
                     RVSVRPSSIESRLKRRTGIESVEAGAADPYELEIIEESYEKSIKRRRKNGISLPIRLS
                     RSQIESLLNSEIKAINSNSKNATSKRHRNNVYSLFMKDLLDYKMDQIQDLRITEGNLK
                     RYSKIDPNMLICEAEGAKVDETSSQSELYDFGEFKVHYFKELNRINISIDHMELVKLR
                     DSKLKHDERVKRFKEATSFIDEAMKKLDD"
     gene            <1139941..>1142232
                     /locus_tag="FOA43_000529"
                     /db_xref="GeneID:62193930"
     mRNA            <1139941..>1142232
                     /locus_tag="FOA43_000529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920859.1"
                     /db_xref="GeneID:62193930"
     CDS             1139941..1142232
                     /locus_tag="FOA43_000529"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776787.1"
                     /db_xref="GeneID:62193930"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /translation="MSRVSKTVRKKTGYSRKGCEDCKHAHLKCDEGLPSCKRCIRRQK
                     RCVYNTKFVVEGVDDKGSSLNFILNHNQRLQEPLHQPMQMQMRTGRVQMQQSTLPQMQ
                     MPRIEVIQNASLLPPTNNQNIVGANSFQMQPAYPINSQPHVRSPRINMRLIDSISSNP
                     SPSQQQFIRPQPPHQQRSIDQNRAYISQNLPLDTPSPNTSINARSLDGTNVDNQKDGT
                     TTNLKHILNKEDGSMHSNHTNASTVSSQNHSQQSPLSQQQIDDSFDDSLDKLKLDDLV
                     DILPDDLKFLSMLTAQDPSWFLMGTNNVKPERNPNMNVFQIQWRNVSNLEYMQLLYQY
                     DPIILRPEKAVSLSDTELIDFNWTLCRVSQFYYNFSSYPDETFNQLMQIFQRLSKKHT
                     IIQNVIMFNSSVFMITFYENMKHPNQARIWDRSVRLPTLKHILDSIRDGLIKDCSFSE
                     LVTIAFSVLILFSINSCDTNSLWRSNLTNCYRLLTKASELLPSVNTQDESDMAALKLF
                     QVIREWFFNVEFLAMVSSDNGGEITARTPLDIMFAGSSPNKLITFDNGINGLRGYSGE
                     LNPILHKLYRFIDMEKKRGRNLSGTNILRLVLETRDTKVLNEAKTFGFELLWDLKKLP
                     NNYKPLNIQDLRMDISLKDIDKAFRMGIEFYSTFFLIGQRDPITASEQLTSILEMIYA
                     IPYYYTCGIALHWIIFACALAAIVIRDDKLYDGFLDILRKISSKGMYVPEKSIERLNH
                     TKRVLENKDYEHLIDPHQDYIVF"
     gene            complement(<1142467..>1144140)
                     /locus_tag="FOA43_000530"
                     /db_xref="GeneID:62193931"
     mRNA            complement(<1142467..>1144140)
                     /locus_tag="FOA43_000530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920860.1"
                     /db_xref="GeneID:62193931"
     CDS             complement(1142467..1144140)
                     /locus_tag="FOA43_000530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776788.1"
                     /db_xref="GeneID:62193931"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="InterPro:IPR038271"
                     /db_xref="PFAM:PF02133"
                     /translation="MGFLGKLNSLLTLDESNMMQNKDLVPMPVSRRKWGLWAFIWYWG
                     ITSLCAVTWSAGSSLLSLGLNGNNAMGIVVVANLIITAAAVLNGMYGARYHIGYSVYQ
                     RVVFGIRGSVLGVLMRCILSVVWFASEAWLGGLCVNVILSSWSESYLNWENTLPDSVP
                     MTSQELVGFVLYLILSIPFLVIHPEYIDYLLAVASFAIFFMGIGMTAWAVHHNDGHYG
                     SLMGAKMDLSSSELGWAWLYGLSSWYSSLTAGIANQGDFSRYNKSVKGSAWGILLGMN
                     LTGFIVPLFGLITASALYEKDGVYYWMPNDVCLKWLQDDYSAGSRAAAFFCGLALVIS
                     QFGMNCVGNGISGAMDLSSLWPKYINIRRGAIIIMILSWPTQPWLFYNSDSVFLTVMS
                     SFSIFITPLIAVFVCDFFLVRRGVIKLSDCYINSKESIYWFNNGFNWRSVISFLVGVA
                     PGLPGLMNAANPSIKINAGATHFFQGSFIFQFFISLAVHLILNMLFKVEVGEQDAVDY
                     FGTYKPLECVRYKVIPHSSLEKPEDVIGMEMEKTPSGKEVMSVVSSKNQ"
     gene            <1146105..>1149116
                     /locus_tag="FOA43_000531"
                     /db_xref="GeneID:62193932"
     mRNA            <1146105..>1149116
                     /locus_tag="FOA43_000531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920861.1"
                     /db_xref="GeneID:62193932"
     CDS             1146105..1149116
                     /locus_tag="FOA43_000531"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776789.1"
                     /db_xref="GeneID:62193932"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="InterPro:IPR010318"
                     /db_xref="InterPro:IPR027479"
                     /db_xref="PFAM:PF01968"
                     /db_xref="PFAM:PF05378"
                     /db_xref="PFAM:PF06032"
                     /translation="MSILTAEKRKLLLGIDVGGTNSDLVVIEPDKLGTDTYGVVAWHK
                     SVTTPDVSVGIERAIITVLNDPKYRISKEEIISMTIGTTHFINAVIERDANRLEKVAV
                     IRLSGPFGVSSPPFGDFPQDLAEVINGYFCSVDGGSEISGKDIRPLDESALRDHCKKI
                     RHLDISAVAIVGVFSNMNFTQEKRAADIVAQEIPGCDVVLSHTISGIGLVERENATIL
                     NASIKKFGRKIIRSFVGAANRLGLKCPVMLSQNDGTVLSVKDALETPIRTFSSGATNS
                     MRGAAILCSGDPDVKGQNVIVCDVGGTTTDVGQLLNTGFPRQSAMYSYVGGVRMNFSM
                     PHVVSIGLGGGSIVRKDDKGITVGPDSTGSGIVTDSIIFGGSTVTTSDISVATYIDAK
                     GIATLPDAMKMGNADRVCNVFGDDYKAGYAAVVKRHLEKAIDRVKTSKGNIPVIFVGG
                     GSFIAPDNLNGTSKVIKPLYSQVANAIGAALGKISSNISEFRTLKSADDEEKQNVVNE
                     LIKKASDDAVAKGALRTSLEVVNIVSDAVPYLDNFYQFEIKIVGDVDYDKVMELVTKA
                     NLNTAKESVKDYVIEEVYKQAKVSKDEADDFDYSSYVPFVKNGIWSLTETDVDFIGSG
                     SYILGCGGGGNPHSSVIELKRLIREGQQVQIVTLKKFNEMTKGKGRAINVGYFGSPVI
                     SGEKLHADEILEALSQIEKHEGYKTDGIFMFEIGGGNGISGLWTACMRGLPVVDLDLM
                     GRAYPTQWQSLPSVYHDKRGYPYLAISDGNGLEMMITSARTDVQMENVMRDSMYNQGC
                     QGACVEPSMSIFEMEQETVHDPVSLSWRIGRAVYIATQKSDVDNLPKYIIEAAGGPQS
                     TKCLLTGKIVSVEKKLKRGYGYGVVEIESIEEDPKTHKRSMITMPFKNENIVAYKVEE
                     DGSRTPLCSVPDLITLVDVDGNAVGTQDYRYGLVVYIMVFACSDKWRTEKAVKIGGPE
                     AFGEDFQDLEYRPAGKYTATVPVADEFDTKN"
     gene            <1149671..>1152385
                     /locus_tag="FOA43_000532"
                     /db_xref="GeneID:62193933"
     mRNA            <1149671..>1152385
                     /locus_tag="FOA43_000532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920862.1"
                     /db_xref="GeneID:62193933"
     CDS             1149671..1152385
                     /locus_tag="FOA43_000532"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776790.1"
                     /db_xref="GeneID:62193933"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="PFAM:PF02656"
                     /db_xref="PFAM:PF09359"
                     /translation="MLFGVKLQNEIYPPWKNYYIDYEGLKRMLKENVLVSGRENWGDD
                     DEKAFAAELDSELEKVYTFQVSKYKELDEEISKLEMQTEKYLEGLSTDKNPFLDSEPF
                     QTKLEELLSETNELDHFSRLNFTGFNKIVKKHDNLHKGYSVKALLNVRMKSLPLNNIS
                     EDTSPYLYRISVLYTFLREQIPGDQDLSSSLSNSIRRLSTSGKLSSTPSATARGQENL
                     KVLKFWIHPDNLMEIKTAILRHLPVMIYSNRSGEEENEEYHSDPTIASLYFDNSNFEL
                     YNAKLLKQKSETPSLRIRWTGKLKDNSEVTVEKKTFDYDTGDEEDVRLSLKKKYINDF
                     IFAGKEKKNSSQDKDADDDSPDDNLDMDIDTGLEDNLADVHHNHGYRISNKSPLTLDK
                     YVRHLQKRGLPNVTVDKYARNFKDLQDFVIGHDLQPCMRAMYTRTAFQMPGDDRLRIT
                     IDSDILFVREDAFDSNRPIRDPNQWHRNDIDSNVDDPFSLLRKGEYTKFPYSAMEIKI
                     SSSITNNPQSKTLRWVSDLANGHLAKEVPNFSKFIQGISSLFLEDDNLEILPFWLPDL
                     DADIRKDPEQAYKDSKSRQLKRDQLADVLKNLRNKIGESPTIITKSGTSHLDKIIEEG
                     EDLDVDDSSDEDSSIPTSGSSQSQHQQDASGKSVAAVSGAQARERRRLSEVHAPSVAP
                     ANLYVDEHRHAMKLASSKNMERNKDFTETFMPIFTKSSKLEGYESEDEEINLPTGVVK
                     PKVLIRQSGPIKVEAKVWMANERTFVRWLHITSLLTVLTFTIFSSIQSTHFPELAIGT
                     AYIYFALTVFSGVWAYAIYSRRLELIKQRSGRHLDGMFGPLVLAGALIVSLGLEYYVG
                     VRKYVDSNALFAVSATSQTFLLDFPSQQVQDLHPILQWTLKKMVSIVN"
     gene            complement(<1152422..>1154284)
                     /locus_tag="FOA43_000533"
                     /db_xref="GeneID:62193934"
     mRNA            complement(<1152422..>1154284)
                     /locus_tag="FOA43_000533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920863.1"
                     /db_xref="GeneID:62193934"
     CDS             complement(1152422..1154284)
                     /locus_tag="FOA43_000533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776791.1"
                     /db_xref="GeneID:62193934"
                     /translation="MSSVPSLDRPRRDPVTEYEKVDSGDNDFYIGPGLRRVRHIHSLS
                     IYNIRLQGSGRQHHKNSSQYSFHLDSTETRPSTSYLDLENAQLGSIKDSLSPATTRDD
                     TYKEQLQKHRKGQLQQPDNQFLLGLDDQIQEQLNIQDLKRDTFFDSFYSLNNFMKVDD
                     PFYISRVFKNQLTIKEDLDFDSFNAKSSSLNLFVKRGSSWSLLCQYHIKLSLLVNVGD
                     NLELVEKHFKNRANFLLIQLSDGCYYILPDSGIPFHLIHQLQVEHKKNVLDRIENLYH
                     SKQRTCSYNQIMKMNNLSVCIRDLMWIKRDLGSRINEALRQHENSYAGVEEKIELISS
                     QLLSLKELLKDQEFHNSQLRRKIKSIHINGDAKKNTIELLSSRRYLLISPDFDSVKEQ
                     LIGYMDGLGQTNTSLNLEKSRVAKGLLAIFPIISSSAKTKSSKYDFELFGYRFPTTSS
                     TTQWVKILNRLSRTQMARLNALLGYLVLIIIKLSDYLCVPLRYPVKFLSSNSYIHDPI
                     SRTKNKNRLYPLFITQNSTLILRFSYGLMLFTKDLDQLFEYENLYKVEEFNLLVNLKI
                     LLTCLTSYDCRSDTIQDFVTEGFTTRESINETLLSEDRTNHIRKHLLGQSSDCD"
     gene            <1154438..>1155133
                     /locus_tag="FOA43_000534"
                     /db_xref="GeneID:62193935"
     mRNA            <1154438..>1155133
                     /locus_tag="FOA43_000534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920864.1"
                     /db_xref="GeneID:62193935"
     CDS             1154438..1155133
                     /locus_tag="FOA43_000534"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776792.1"
                     /db_xref="GeneID:62193935"
                     /db_xref="InterPro:IPR037520"
                     /db_xref="InterPro:IPR037521"
                     /db_xref="PFAM:PF11704"
                     /translation="MTFIVTLAHFCEVHGPSMVMCTQAVGPGELLSKYYGSGIPDSQL
                     CESCRLKIPKQSTEEMPDPSTVETKSKVNDSMYISTQFPTSQHRYSSLRHIIMRVFTI
                     EISSSTNQPLIFGDARAGYSMALLFKIFDSTARGSERKYSIIVTSDKEDDIFANYSLI
                     LLNLSKTVEYIISKSMQVMEKAGKNNDNNDVYLRRSAGVPKTKSLVTIMDDESFFVRL
                     HLLASSLLEELRC"
     gene            complement(<1155189..>1158878)
                     /locus_tag="FOA43_000535"
                     /db_xref="GeneID:62193936"
     mRNA            complement(<1155189..>1158878)
                     /locus_tag="FOA43_000535"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920865.1"
                     /db_xref="GeneID:62193936"
     CDS             complement(1155189..1158878)
                     /locus_tag="FOA43_000535"
                     /note="BUSCO:EOG093405IK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776793.1"
                     /db_xref="GeneID:62193936"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036277"
                     /db_xref="PFAM:PF02463"
                     /db_xref="PFAM:PF06470"
                     /db_xref="PFAM:PF13175"
                     /db_xref="PFAM:PF13555"
                     /translation="MGRLVGLELCNFKSYRGIASVGFGTADFTSIIGPNGSGKSNMMD
                     AISFVLGVRSSHLRSTQLKDLIYRGRNPNKDEALDIDDPSSAYVMAIYEKSDGVILKL
                     KRVITPNGSSEYKINNKQVTATQYAEVLRKENILIKAKNFLVFQGDVEKIASQSSETL
                     ATLIETISGSIDLKKDYDILSDEKEKAHDETALRNSKRRTLKEELNQYKRQCREVEEF
                     DHKTERLSNTIEAKYLSKLYFNDLAVKEAQKCLKKEKKEAKKVKLEINKKEEELREFI
                     RTESDGHTGYRDLESKIERDRDLVAQRKMALIPIGAETRQISKKLDAYNKRMKTLEEE
                     RERQASTIDETQSQLRKIEKAFENYERKVNKEAEEAGSFSIDSVVINEYKELREKFLM
                     KGGHIESKLADLTDEKESLIARKEDYDVKMKLIEARLDELELSKSELKAKHEDARSKI
                     NSISTSITAKKHQLNSLRASRDAINQEEFETNTALKKTLLKLHEFGSLQRENSREKRL
                     RENCAALKRLFSGVHGLLSDICRPKQRKYETAVSTVMGRNMDAIVVTSISVAAECIEY
                     LKEQRTGSASFIPLDTINAKLVNQQYRSIASTVRPAIDVVEYDSEYERAVQFACGDSL
                     ICDNLDIAKAVRWEKNILVKVVTLDGTIIHKSNIMTGGQIRRSTDRWDKAEMNSLLSQ
                     KEDMKAKLDELDKKKPSELLDKALLNDLDRLENELPSLQDSKQVLHRAINDADAEIRN
                     QHRLSRELEAEIDRLEEEIMKPLEERIQQTEVELHLVQDTVFNGFCEKHGFESITRFD
                     EKYGYRSWESSKESGKFQKEIQRLQNRLKFEQERLEDYDDRILKLKQDQKKFAESSTE
                     MQQKKEKLEFDIDHLEGELEVCQEEYDELQGKLKETSEESDELKSTIHDLKLELKDVS
                     KKIANAEEALVKIRMDKLGILRNCKMENVEIPLSSGSLEDIPLEENDGENEDEDEDKE
                     ERLQSVLNEVRADCSGLDKKYKSGTAEAKAKEIEEEIENLKNELAEMNPNMNARERLD
                     EAQERLNEADTEFSACKEHEREAVSKYEEIKKKRYDIFMQAFDHITNQIDPVYKELTK
                     SRVSPLGGSAYLTLEDEDEPYLAGIRYHAMPPMKRFRDMDLLSGGEKTVAALALLFAV
                     HSFRPSPFFVLDEVDAALDNANVHRVANYINEHASPTFQFIVISLKSQLFERSDALVG
                     IYREQSLGASKTLTLDLRKYLDEVA"
     gene            <1159595..>1161409
                     /locus_tag="FOA43_000536"
                     /db_xref="GeneID:62193937"
     mRNA            <1159595..>1161409
                     /locus_tag="FOA43_000536"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920866.1"
                     /db_xref="GeneID:62193937"
     CDS             1159595..1161409
                     /locus_tag="FOA43_000536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776794.1"
                     /db_xref="GeneID:62193937"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004621"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="PFAM:PF02219"
                     /translation="MKITQKLQQAQEDSSAPATFSFEFFTPKTSQGVQNLYDRMDRMY
                     DLNPLFIDITWNAGGRLGTLTTEMVNVTTTVLGLETCMHLTCTSMKLETINQALDSAF
                     DCGCQNILALRGDAPLDGSEFTGVFHYAKDLIRHIKSRYGDHFCIGVAGYPEGHPEER
                     DVDKNIQYLKQKQDAGGDFIVTQMLYDVDLFIDWCKKCRVAGITIPIIPGIMPISTYD
                     GFIRRAKWCEIHLPDHFLKRLEPIKDDDSMVREEGAKLVAEMCEMLLESGYIKHLHFY
                     TMNLEKSCVMVLRHLGLVSKQQLVGMDTKPWRRSLNPNRSLESVRPIFWQNRKFSYIE
                     RTSNWDEFPNGRWGDSRSPAFGSIELSGHQLIRHTREKALSLWGFPTGIKAITDLTVK
                     YLSGDINCLPWSDSKISHEIDPIKSDLLDLNRRGVLTVNCQPSINCCPSSNKVHGWGP
                     GNGYVYQKQYLEFLIPTAKLDSLVQEINAINNEAEYHVLTYYAIDEDGDFDSNAKSAS
                     TINAVTWGCFPGKGVAQPTIVEKISFIAWKDEFFSILRKWTSLFKNDDDLKRDQATTF
                     VDSLINEFTLVNIVDNDYVNQPNTRIFNVLKKLFPLKE"
     gene            complement(<1161926..>1163878)
                     /locus_tag="FOA43_000537"
                     /db_xref="GeneID:62193938"
     mRNA            complement(<1161926..>1163878)
                     /locus_tag="FOA43_000537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038920867.1"
                     /db_xref="GeneID:62193938"
     CDS             complement(1161926..1163878)
                     /locus_tag="FOA43_000537"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038776795.1"
                     /db_xref="GeneID:62193938"
                     /db_xref="InterPro:IPR035969"
                     /translation="MTTVSNLQSESDSQEVPPCKVNISSPVREVSPLSEDTGKVSYSS
                     SSSSKDFKGPRYKGRLPISEVPELMTLCEEFIATKNVTGLAMIARQRGLPPSLRYKIW
                     PVLLRYHPYVQHPYIEPDFDDDDDAEEEEENGHKNNNNDTVNDHNDEHNTGHNKKEAD
                     TGKLNIPYKEIKFDLKKYTRYTERYKPQSMTLELHDLFDIQDKMFEAIEGAIVRFVKK
                     WGSIVKYNSGLTWIAMGLAEWIPPLENSEYVLCGRDDIAKNGTKLRNVNDNYFERFDS
                     YDSDISSNASLTVDSTPSISGSPRSVSSLATSSLTSDDTRTSHSRHSNDPYPFKPMNF
                     AEVYERMVLVILHTPDPAEKDTHLSPVTTTASSHTSDSTSPSDMKRKLDQLPKFGGTI
                     EDRISFFFFGLRKLMPELHGYLSDEDSLKGNWILWWLKYCGSKVWSRYDRGRTWDMLL
                     GFRVNCRHFERDLPVLHKLTDEQMRLLGPDLFWYPEVDDLSVNNGYVDDSSLKNPLDH
                     HGRSSSILTLLNQVSVGSSELTPTLASLCISGLENEDIDALPQLPFSVIDPHIQMIFV
                     SLAFLKSKEFTITELDQSEIIQLFNRLSSLKTSEIRSFVSADGNTIDQHYHPIKKSNR
                     DIENIILEAGELWRKFIYMEMMVDNT"
     gene            <1164152..>1166178
                     /locus_tag="FOA43_000538"
                     /db_xref="GeneID:62